4D6YA

Crystal structure of the receiver domain of ntrx from brucella abortus in complex with beryllofluoride and magnesium
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
121
structure length
121
Chain Sequence
b'DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGSRLDGLALLDEIKKQHPELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIAL REGULATORY, FIS FAMILY PROTEIN
publication title Snapshots of Conformational Changes Shed Light Into the Ntrx Receiver Domain Signal Transduction Mechanism
pubmed doi rcsb
source organism Brucella abortus
molecule tags Signaling protein
total genus 42
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d6yA00
3N6VA 3NNNA 5GOTA 3I42A 4F11A 2JK1A 3MF4A 5T7BA 1JFVA 1YS6A 2L17A 1ZVVA 3EQ2A 4XXHA 1DZ3A 1AB6A 3O2JA 3OMWA 4CBVA 1OXBB 1YS7A 3A0UA 3CNBA 3DBIA 7ABPA 1USGA 3OLYA 5C5CA 3QELA 2MSKA 5IEBA 2HJ9A 3H5IA 3LUJA 1YMVA 5TPWB 3TO5A 4H60A 2H0AA 5TPZD 4Z4EA 2NZVG 4G0OA 4Z0NA 1BA2A 2CHFA 1Z2EA 2PUEA 3A10A 4EYOA 2NT3A 2PJUA 2IKSA 4RV5A 5EWMA 2JVIA 3JS5A 3H5TA 3W9SA 4EVQA 3KLNA 2PLNA 4JB2A 1QQAA 3TD9A 1YK0A 4W5NA 2IPAB 3IDOA 1UDRA 4D6XA 4E7PA 4M88A 8ABPA 1PNTA 3KYJB 4Q7EA 2QVGA 5GQSA 5EWLA 5KC9A 4P98A 4JB0A 3NNDA 4RWEA 1BDJA 3JPYA 1B00A 2A9QA 3CU5A 3LUDA 1OXKB 1DBPA 2GI4A 1K66A 1D1QA 1J56A 2E4UA 3D02A 4PE5B 1DG9A 2QV0A 1DC7A 4RKQA 2HQOA 3BREA 3JTEA 3QLVA 3N75A 4N0PA 1H9CA 3CKMA 1LJUA 3MQ4A 4EUKA 3OQNA 5CNMA 4Z4CA 2WJWA 4KV7A 3RVLA 2MYUA 3S99A 5BR1A 2R4QA 5KC8A 4YRZA 3H5WA 5JNRA 4TLLB 5CNKA 1URPA 3F7NA 3H1EA 4ZMRA 2PE5A 1M5TA 4MR9A 2FN9A 3OMXA 3TMYA 3O2SB 2QVCA 4NQRA 3VNAA 4MR8A 3OM0A 5DGCA 3C97A 3DLBA 1FQWA 2R25B 3EJWA 3L49A 4D74A 3H1GA 2MYPA 4Z4GA 1Y1LA 2H3HA 1YVUA 2PAFA 4RXUA 2LBPA 4WWHA 5DKFA 1DCFA 3C3KA 2FXIA 4EY3A 1VPWA 1NXOA 4JASB 1XWWA 2FVYA 5FWXB 2FKAA 2LP4Y 1ZITA 5IUKC 4MLCA 4XFKA 4ETMA 1QNLA 2F8SA 1PHRA 4MS1B 1JFSA 1VKRA 3R0JA 5E3JA 1D1PA 1U2PA 3FFTA 1AB5A 1RNLA 3N53A 3H6GA 1GLGA 3HO1A 1GCAA 1QMPA 2IPLA 2WMYA 3OO0A 1U8TA 3OLVA 4MS3B 3IPCA 3QLTA 2IPNA 4D6YA 1RZRA 3QX9A 1JYEA 4ZYLA 2FMKA 1PEAA 4GNRA 3OQMA 1ZH4A 3CS3A 5EWLB 1Z16A 1JWLA 2FLWA 1QO0D 5JS1A 3EQZA 5EWJB 2FMFA 1KRXA 4RK5A 4O1HA 3QEKA 4IRXA 3NNSA 5CNIA 3F6PA 3HDGA 4H3HB 1WETA 4JAVC 4DQDA 4OATA 2JRLA 1YK1A 2QU7A 2VYCA 4MAAA 5KQLA 2IOYA 4RXTA 5FWYB 3A0RB 1W9HA 4RKRA 1JFTA 4LDAA 3GWGA 3LFTA 4KVFA 5TQ0B 5KQGA 1JHZA 2WJAA 4H3KB 1P6QA 4FB4A 1SRRA 2HQRA 3O1JC 1FFGA 3LUAA 3F73A 2CWDA 3MA0A 4G0YA 4UHKA 3LUGA 2A9RA 3KLOA 3QEMA 2ZWMA 3O75A 4MRMA 4F12A 1SD5A 3QX8A 2ID7A 4JP1A 4HYEA 4PICA 5D2CA 5IX8A 4PEVA 3OLZA 1ZESA 4MQEA 4WXEA 4LZLA 2WWVD 5JNUA 2PUBA 2BGGA 3HDVA 1JDPA 2HQBA 4MR8B 3FGZA 3LUHA 4MS4B 3C3MA 4LX8A 4NICA 1Z26A 2AYZA 3IP5A 4RK7A 5BRJA 5C5EA 5IUNC 4S04A 3H5VA 1QQBA 1YIOA 4NCBA 2B1JA 4TMYA 1LK0A 2FEWB 1C4WA 2QSJA 5CNJA 3DGFC 4PYRA 1USKA 1JLKA 4Z4FA 1KRWA 2B4AA 1JF8A 3N8IA 5KQPA 3Q7SA 3RVKA 4YCSA 5DTEA 1ZGGA 2FQWA 5PNTA 3MMNA 2VUHB 2WRZA 2PUAA 5B3JC 4MPTA 4OLBA 4P1ZA 4NV3A 3IP6A 4EVSA 1U0SY 2P4UA 5KI6A 1ZDMA 3OLXA 3HXMA 5TQ2A 4L4UA 2FTKE 1NXSA 3HCWA 3MM4A 3HK2A 4NCAA 5JS2A 3RVPA 1QP0A 3Q15C 3QLUC 1MVOA 3IP9A 3K4HA 3EGCA 3CTPA 2QW1A 3LUKA 4RY9A 3NHMA 4ZPJA 2QZJA 1EWVA 1D2AA 3RVNA 5IBQA 3RVJA 1USIA 1A04A 1A0OA 5ABPA 4RXMA 3HUUA 1VRVA 4MR7A 3GA5A 4ETNA 4IGAA 1DJMA 1SXHA 2RJOA 4O5AA 1SXIA 1EHCA 5JNWA 3RVOA 1TLFA 3CG0A 3EAFA 4IMJB 2M98A 4XAQA 1FFWA 4G0MA 3QEMB 1DP4A 3E61A 3GT7A 3G85A 5BQ3A 2LUOA 2PL9A 2V0NA 5ED4A 3C3WA 1DRKA 4DADA 1IIBA 2M1ZA 4EYKA 3H75A 3CG4A 4G0QA 4MQEB 1SXGA 1DCKA 1RXIA 1PUXA 1VLZA 2PMCA 1YMUA 1K68A 1ZN2A 3OQOA 3P9YA 4EGSA 1C0EA 3QK7A 4Z99A 3BBLA 4ZJPA 1EWKA 4Z9AA 5TQJA 1RXEA 4RY0A 1CYEA 1CEYA 3SM9A 4W5RA 3GRCA 1QO0A 3FFWA 3CFYA 3QELB 4W5QA 1F4VA 3Q41A 3I5AA 1TJYA 5DLEA 3URMA 3ILYA 1D4ZA 4Z4HA 2AYXA 1XHEA 4RDCA 5TE9A 2WB4A 3SNKA 3TX6A 3LKBA 4XLTA 3HJFA 2GX6A 3I45A 5JNVA 3C6QA 3H5LA 2L2QA 1ZAYA 5IUJC 4JA2A 5HSGA 3B2NA 4N0QA 3JY6A 5EWMB 4YV7A 2FQXA 3HV2A 1LBIA 2X7XA 3LTEA 3JPWA 1E2BA 3DZDA 4LDZA 3KSMA 4XARA 2NT4A 1PNRA 1P6UA 5IEJA 4KREA 5FBHA 3UKJA 3OLWA 3EODA 4LE1A 3T8YA 3LUFA 2E4ZA 4MQFA 3KKEA 3GL9A 2IDMA 3O74A 1ABFA 3CLKA 5HQJA 1DBQA 1Z18A 3G1WA 2HSGA 4Y9TA 4QPJC 2PUGA 1S8NA 1L5YA 2OQRA 4IF4A 4IMIB 4PZ0A 1ZY2A 3N0XA 5TPWA 3ROTA 5IC5A 3TB6A 2L18A 1EWTA 3KHTA 1BDHA 4O1IA 4RK0A 4ZMSA 3A3KA 4ML3A 4Q6WA 2F8TA 3FMVA 3KJXA 2FSPA 3L6UA 2VK2A 1LBHA 3RVSA 1NXXA 1F51E 4N76A 2I6FA 4G0PA 2PKXA 3D8UA 4Q6BA 3GV0A 5TPZA 3UK0A 4EYQA 1NY5A 1P8AA 3E3MA 2XDYA 4MR9B 1JH9A 4ETIA 3Q7RA 4RZSA 4WUTA 1DC8A 1GUDA 1MAVA 2LPMA 1QPZA 2J48A 3IP7A 3KG2A 4IILA 4DN6A 9ABPA 3Q9SA 3GBPA 4E7OA 5T3YA 3HEBA 3T38A 3HVRA 4EVRA 4YR7A 4MGEA 2FMIA 3RQIA 3I09A 1W25A 1QP4A 2O20A 2E4VA 1FFSA 5IULC 1NXTA 3Q7TA 4RK6A 2A9OA 4Z4IA 1ISSA 2E4YA 4TLMB 4QYMA 1BVHA 2OENG 3O1HB 4G0ZA 4YWHA 2KYRA 3KYIB 2IYNA 2CHEA 3K9CA 2WY2D 3RVQA 3M9WA 3FFXA 2L19A 2FLKA 4OTZA 2GBPA 4HNQA 2R47A 4RU1A 4L85A 2TMYA 3RH0A 4W5TA 1P2FA 1Z2DA 2Q5CA 4MQFB 5B3JA 1M2EA 1Z25A 3CZCA 2PUCA 2RDMA 3NHZA 4FE7A 1JL3A 1E6MA 4G86A 5FWXA 3GBVA 2W42A 2P9HA 4W5OA 1GCGA 2NZUG 1NXVA 3CZ5A 4KQCA 4MS1A 2JB9A 3F6CA 3T95A 3M6MD 5JNSA 2PUFA 2QXYA 3KCNA 3H6HA 4KK4A 1D5WA 3QLUA 4Z9BA 1BDIA 4XASA 1U04A 1Z15A 4YGXB 4MS3A 1JX6A 1I3CA 1NXPA 2RJNA 3JVIA 1A2OA 4MRMB 3RVRA 1EAYA 3VNBA 1M5UA 4KZKA 3SG0A 3KTOA 4LRQA 3GYBA 4QYWA 3QLVC 5EWJA 3SQNA 1NATA 4RS3A 4RK1A 5JNTA 3LUCA 1RPJA 2MSWA 2CD7A 3MIZA 4GPAA 4JOQA 4OBBA 3N0RA 4RY8A 1T34A 5FWYA 4KRFA 4FE4A 4LE0A 4UHJA 5TQ0A 4N47A 2NUBA 1ZGZA 1ZH2A 2YHAA 2MYNA 3IPAA 4OG2A 6ABPA 3M9XA 2JBAA 1XHFA 1M2FA 3O1IC 1U2QA 1MB0A 2ZAYA 2MYTA 4YS6A 3EULA 2LIVA 3CRNA 3DLHA 1MB3A 3UUGA 1APBA 1Z12A 3LKVA 1YTUA 1CHNA 2FEKA 3KS9A 5FBKA 1NTRA 1TMYA 2RGYA 4TN5A 1HEYA 4WXMA 3MYYA 4G97A 2FW0A 5HKOA 2PL1A 2FQYA 4MS4A 3BRSA 3HM9A 4KPYA 4OLAA 5TQ2B 3ROFA 2MSLA 2PUDA 2DRIA 5HM6A 2JVKA 2JVJA 3DGEC 4EYGA 3ILHA 3JVDA 1ZHHA 2GWRA 1R8JA 3H1FA 1BAPA 4RK4A 4F8JA 3OM1A 1TM2A 1EFAA 2IPMA 3T6KA 4MLDA 2R48A 4MR7B 5F64A 3SY8A 4N41A 1QP7A 1FSPA 4N03A 4KK3A 2JCGA 3LMKA 4KNYA 4WT7A 4KQ9A 4WZZA 6CHYA 1E6LA 5KQMA 1Z13A 4B09A 3HS3A 3BILA 1KMIY 5CHYA 1E6KA 3RVMA 1L5ZA 3N0WA 2FEPA 1LJLA 2E4WA 4KFCA 1JBEA 1DRJA 4G0XA 5I4CA 3LOPA 3EDCA 1JDNA 4F06A 3FDFA 1Z17A 3HUTA 3CHYA 3O2QB 3SAJA 2N9UA 2YHBA 4KMRA 4S05A 1ABEA 1TVMA 2HPHA 2ID9A 1GUBA 1KGSA 3BRQA 1ISRA 4QICA 5KWSA 1QKKA 4LE2A 4RSMA 1NXWA 2JBAB 3OO1A 2FMHA 5BRAA 2FN8A 2QR3A 1DCMA 3HZHA 3H5OA 4YLEA 5DCLA 3O21A 1PEYA 4YO7A 1RZRD 2E4XA 4MYRA 3NBMA 4YP9A 4F3TA 1DBWA 4HNSA 1MIHA 1JYFA 4HNRA 2A9PA 3HSYA 2VUIB 2GKGA
chains in the Genus database with same CATH superfamily
1IQ0A 4NEQA 3BMNB 1P75A 1E3SA 1BGXT 1ML4A 1QE0A 3MF4A 3NG1A 4GXTA 3AYZB 3Q6MA 5DIZA 3KZ1E 2JNWA 2A7XA 3M3PA 3R5KA 4XTRA 4EG3A 1KK1A 1YS7A 4R5MA 1HE3A 2IDZA 1RHJA 4R9NA 4CI9A 1EZ1A 4CCSA 3VR4A 1MO3A 2BCGY 5IFKA 3OLYA 1YQWA 2D1QA 4DCOA 1WY7A 5DTMA 1P9WA 5F5NA 5JZOA 3QVGB 2HIGA 3EIEA 1RTTA 2DJ5A 1AO3A 4EHDA 1B0ZA 3WTBA 1IBMB 1Y8AA 4XYBA 3C3YA 5LLDA 1I8TA 3H87A 1QNFA 2WT8A 3Q87B 3P4UA 4PHFA 1VLJA 2G1KA 3BEDA 4IVPA 5H3LA 1BMFD 4OK5A 2JVIA 4RD4A 5KPDA 3KLNA 1KBZA 4UW9A 2FPWA 4W5NA 3I12A 2FUG6 1DAMA 1TI7A 1WZNA 3MQFA 4DCNA 1AQNA 1UWLA 1Z8DA 1OB2A 2G5PA 1IOVA 3SEZA 1ZK0A 3FKQA 2JANA 2WWFA 2ZE8A 1Y1TA 4IGFA 3DE5X 1QH8A 3KQKA 5DSXA 3LO5A 2DFDA 4E5SA 3B20A 3LUDA 3RS0A 5FBRB 4L3WA 4DBZA 1PK8A 1BE6A 1BCRA 3C6KA 1Z36A 3CJTA 4UKDA 1I2CA 5D3MB 2G9VA 1OYVA 4HR7A 3LD9A 4BAZA 5LXTB 3G7SA 4UFNA 5E7JA 5JMOA 1RRPA 3MPUA 1UXKA 1Z0UA 5J63A 3E7FA 1JBKA 3L02A 4BEJA 3UXMA 3CKMA 1K06A 1KVUA 5B53A 3WQHA 3V4ZA 1H9CA 1AUPA 4NCJA 1JG7A 1G5RA 3OQNA 1X7ZB 5CLFA 2AOWA 1RI4A 2HZBA 2HU5A 2WPDD 4TXJA 4AUKA 2D62A 3G2OA 1THMA 1RP7A 3PG5A 3LPNA 4ENRA 4AF6A 4OO3A 3TBFA 1GRNA 2WNSA 3ZHBA 4Q4CA 3IE1A 5HEKA 2IYOA 3QUAA 1SXJC 4ITVA 3HYSA 2ORYA 4ZCRA 5JNVA 4MVJE 2R66A 1JVBA 1UXGA 3R7SA 4LZOA 4P2BA 3C97A 5LCXA 1G8GA 1N6NA 4V39A 3SC6A 4DIFA 2DR3A 1PS0A 1U1IA 2XCUA 1T6ZA 1N2EA 2ZJFA 3D5TA 3JAMA 1V96A 2FHSA 4Y6RA 1Z07A 4IYRA 1K1EA 3KQVA 4K8OA 1XL1A 3B1WA 4MV0A 2H3HA 3ZI0A 1ECJA 4I36A 4EHJA 1N0WA 3SICE 1LEHA 3HY3A 1Q3TA 3RTEA 3L6OO 2I87A 5BR8B 2NTVA 1DPFA 2GVNA 1ZA1A 4KUGA 4NOLA 1E9RA 1PDWA 2V7QA 2BM8A 3B85A 1V4VA 1AGPA 4MINA 4MQUA 1VG1A 1O0SA 3FNBA 2EZ8A 1YR2A 2NUAA 3DHYA 3LY9A 1O95A 1ZWKA 3H4VA 2PWBA 2GEKA 2ZRLA 3BX1A 3GMIA 4LPSA 1P1JA 2W6JD 3ZJ5A 5KSOA 1RYZA 4H0FA 5F7ZA 2J32A 2AHOA 1E9BA 1U8TA 4HPWA 3U31A 5K09A 5C3MA 5EHIA 5ARBA 4GBJA 1U0LA 1IHPA 2QN1A 3OZTA 1M1NB 2R60A 2D2EA 5ALGA 2C5GA 1QH8B 1DWPA 3DT8A 3EQZA 2V7BA 2DYKA 2P9EA 4OQYA 4RE5A 3NUGA 2HBYA 5CVTA 3FPAA 1GPYA 5EJIA 5CXQA 3D8BA 3HDGA 3MWYW 1BCRB 4GT1A 3URKA 5CT9A 2OLEA 3U81A 1IN1A 1H5NA 1W0JA 2QIOA 3JWPA 4DDTA 3PGXA 2WTUA 1N9KA 1G9XA 1M1XB 1Y6RA 4LAFA 1KC3A 2GXSA 2IJGX 1JFFA 5HUQA 4OJKA 3QSYA 1FLNA 4GPD1 4UUNA 3RS2A 1YRQA 1O87A 1INLA 2BMAA 3FPSA 4YEDA 4UHKA 1P80A 1T6YA 1BWRA 2X6QA 1LRJA 5C46F 2DXIA 3OZVA 1X7WA 4NJEB 3OPQA 5AUQA 1N5KA 2P7HA 4ZVVA 2Q5JA 1HFKA 2H17A 2YRXA 2QRQA 1JB9A 2O23A 4M6WB 4XX1A 3FHLA 5K8UA 2Q07A 3TZCA 4MVJI 1Q1AA 1SC1A 4C87A 1LW6E 3RFXA 1H42A 4UNQA 1F4LA 2J3MA 1R0YA 1NUTA 3EEYA 4P7JA 5F33A 2CYCA 4UEQA 2FPRA 2UVQA 1GTVA 1SOAA 3E9YA 4UHEA 5H3CA 1UIRA 5IUNC 1AUOA 2ZYVX 3QENA 3CRVA 2YV4A 5KYYB 4IX1A 5TGZA 1EP3B 2QUHA 3KB1A 1EWQA 1T3LA 1GAWA 1GPBA 1W59A 2VZ9A 5TLSA 5CGZA 3ECCA 2W6ZA 4FMDB 3DWEX 1MV8A 3WLAA 1Z29A 1U9IA 1WB5A 2JHFA 3BTVA 3IOCA 2C1ZA 3E9NA 4K1LA 4ZT3A 3OHPA 4D81A 2UUAB 5EIWA 3A05A 1JT2A 2FF7A 2FPIB 1G7CA 2VG8A 2W83A 4H27A 4A2WA 2C54A 4QD3A 3MBIA 2PUAA 1S02A 1KGDA 4FSXA 2CW5A 2RAFA 3H9BA 4ABTA 4E51A 2VYNA 3IP6A 2PZJA 2FWNA 1CD5A 2UYGA 3O0DA 3JRWA 1X92A 4AROA 2WAYA 1AKMA 2KHZA 2I4OA 3A4MA 4K1XA 1X1AA 4B2LA 5B2FA 5LFAA 4C4XA 5H59A 4FCWA 5KOHB 5DISB 3DEAA 4J6FA 3LQ1A 4B3XA 4RTOA 1ID8A 1A8PA 3GDHA 4ZU6X 2FB9A 2ZT7A 2WICA 1J4AA 4DHWA 2VBFA 1M2OB 3HGQA 3DUFA 1PQWA 4OA8A 1PT9A 3HLTA 3NW9A 4JBXA 1M3SA 2NQ2C 5KSWB 4F4HA 1P9LA 1OWPA 2AN3A 4HB3A 3NCTA 4NYMQ 3KPVA 3RVOA 4M54A 3UWMA 2Z4RA 3T7RA 1EGQA 4DKJA 2BJHA 2GOYA 4HWTA 4G0MA 4M0PA 1YZYA 4G9BA 4XKJA 4XM0A 4AMVA 1QQ6A 2EXXA 5ED4A 3ESAA 4EEZA 2I3ZA 4UU1A 3PX3A 5FTNA 2JATA 3SXUB 1YBVA 3E9RA 3L1HA 2IKQA 3JD3A 4QG3A 3TBHA 4UTNA 4B2YA 5CG1A 1WHTB 3CKKA 2BLNA 1M0WA 1PD0A 4R9VA 5J2TF 3BT7A 2PMCA 2Q3HA 3EMKA 3KU4A 4GSLA 1CQPA 2PH1A 4TXNA 1REQA 2AZMA 3A04A 1IY8A 3K32A 2QRNA 4HXGA 4DTCA 1ODTC 4Z99A 3DHWC 5CDYA 1I1NA 4DCGA 2BY4A 2Q45A 4OM8A 1DQYA 1YTLA 2BEWA 1MO4A 2H54A 3HJAA 1VOTA 4CU2A 5LBTA 2OBYA 2O7VA 1NM5C 3RRJA 5C1PA 3GRCA 1KEEB 1QO0A 3CFYA 1TEHA 4WGGA 4NFSA 4YUXA 6LDHA 5LQAA 2AHRA 1GT6A 1NVVQ 1SZJG 2C77A 2DKOA 1LFAA 2OC4A 2AYXA 3AP1A 3NJ4A 2ISQA 2VC2B 2JA1A 1A7AA 4Z0HO 2NAFA 3LKBA 3RSGA 4E1VA 3HCDA 2O2IA 1KMQA 1AO0A 3AUKA 3WA7A 3C6QA 3VNVA 2XX3A 1OPRA 3EXFA 1JKMA 3G2IA 4RKYA 4BB9A 2YHIA 4AJ9A 4I1PA 2WSSD 1TQ4A 4A0HA 5ALKA 1F8FA 4EL0A 2C7VA 3PCXA 1OVMA 1M76A 1U2ZA 1X7DA 2X4IA 3PTLA 3EXG2 4FOTA 4M0EA 5HBRA 4EJSC 3LFUA 2X2OA 1SC9A 5K6TA 4YYEA 1PKXA 3I2GA 4KIGA 3GUUA 1RYDA 1GPH1 4HYYA 5DGHA 4RTRA 1L6IA 2WVGA 3CEMA 2JKZA 3FYTA 4YBRA 4DFDA 4DUGD 3T8YA 2ZJ5A 1YRHA 3TQFA 4DQKA 4YRSA 1JLLA 2ZZNA 1U8YA 3HWWA 1RAIA 1T5SA 5AW1A 2X22A 4KI0A 1VYHA 4KMOA 1O0CA 3L06A 2IHBA 5EZQA 3DUFB 1S8NA 4MARA 4NX2A 2NO0A 3BQNB 4V0QA 2WYOA 5KNBD 2QZ4A 2WK1A 3CCFA 3G0GA 1PZXA 2IZ1A 4OBXA 3TOSA 1ZM9A 1DTSA 5T64A 3E48A 3MJFA 2VP6A 2IUEA 3GLVA 4KX3A 1OH7A 4YAWA 2Q3EA 1PFVA 3SWWA 3J81A 1MENA 4K28A 5LU8A 5BVHB 3O91A 2WR8A 3W1VA 1P6XA 4D3DA 1FYFA 4HRVA 4Y1GA 3WIDA 2ZCUA 4YCMA 5ALNA 3DLIA 2BPOA 3AVWA 3UMFA 1K7FB 3ODGA 2Z0MA 4I50B 5MDHA 1FNCA 1XMVA 5KU7A 3ZDBA 4JJIA 2UZ4A 1TKAA 1GRVA 4YCDA 4GBMA 2QN8A 5CVCA 1JH9A 3G0HA 1A4RA 4C0XA 2DZDA 2VCYA 1CLEA 2IY7A 2HSEA 1TO2E 1G3QA 3KAKA 3PDJA 4B9AA 2BEWB 3I34X 4BQSA 1BWSA 2OYSA 4OSPA 3T9DA 3SKVA 3TL6A 4YJ3F 1EVYA 3ZJ4A 1E5QA 2BF7A 1L7BA 4IZOA 4PZCA 4MGEA 4BTEA 5BSVA 4DG5A 3DYBA 3NBAA 4S1PA 3U4CA 1DARA 3Q7TA 2OXCA 3WGNA 3VYVA 4WX2B 1RLTA 3PD7A 2E4YA 4QVKA 4QYMA 1KFBB 2HLNA 4Q18A 2YJ6A 2Z1MA 1M67A 2NSHA 3EXFB 4LRSB 4X8MA 1ZCJA 1R8XA 4MKGA 3G0OA 3M6LA 2PBZA 3EDYA 3PD0A 1OAOA 3VJKA 4DCVA 5EHXA 1JKIA 3S2SA 4K9QA 4RPGA 2OK8A 3T9CA 3BS4A 1ZINA 3PD1A 2R6AA 2FPXA 2GBPA 1E0JA 1OXXK 3OM9A 3D31A 3SR4A 2R47A 3ONEA 4UAGA 2VHTA 4OVKA 1Z5ZA 1W88A 1YRYE 5CK5A 4D80A 4RDXA 1IQPA 1JLLB 3SOPA 4MRRA 3O8CA 1KFCB 1BU5A 4G86A 3AVVA 3F7MA 2ZANA 3G3EA 4KO8A 4TT3D 2WEKA 4EO9A 4PZLA 1PWZA 1UH5A 1I2AA 3P94A 2ZI3A 2JB9A 1RMYA 3LE8A 3P45A 4MSUA 4PLVA 3WGKA 3R7FA 3HGMA 4KK4A 3UKOA 1GM5A 3G2QA 1G5QA 5AI5A 5FPTA 1QOPB 2BE9A 3ZX4A 1PJ8A 2G1UA 3V9AA 5LMNB 2FZ4A 2GAOA 5DIFA 3TLGA 2QRLA 4YGXB 4ZAWA 1JX6A 4AMGA 2IBSA 4ALJA 4F86A 2C5AA 4WCFC 3EF3A 1RRFA 3N2KA 5HFJA 3B1YA 1EAYA 4R2KA 2P35A 3WDLA 1WW3A 4J0FA 4LRQA 5J1SB 4Z7OB 3EFBA 4ZXPA 1ADJA 3RLFA 2C5BA 4PPNA 3CEHA 2RGBA 3KJEA 4GWGA 3II6X 4MVJA 3COPA 4LBZA 5HQ3A 2YJGA 4COKA 3WAGA 4U7WA 3GG9A 2XTNA 2EFDB 1K4YA 1UDAA 2VF8A 3CH5A 3SDZA 4KODA 3T7JA 1NLYA 2B4RO 2NADA 2VK1A 4JQCA 1QIGA 2CUNA 2REBA 1OFTA 2DTEA 1J2YA 4FE4A 5TQ0A 2TYSB 1SQ6A 3ZDEA 4H4CA 3HBFA 2Z6QA 3EWAA 2P9BA 5AVZA 1MJGA 3JD2A 1EFCA 1W52X 4PRLA 5AJHA 4ROSA 5K0CA 5A3QA 1FFYA 4R1SA 2CV2A 1G17A 4XB1A 5F3WB 1WCWA 4BXOB 3LKVA 4AO6A 1BA3A 1MX5A 3BC1A 3PQ8A 1TM3E 3HUEA 4V03A 2HU2A 3LGAA 4R3WA 4ZRDA 3FZNA 4BMZA 4CLRA 1FXUA 1K9SA 2YV5A 1PGOA 3D7KA 2PL1A 1UP6A 3HM9A 1I32A 4B84A 2VPTA 4NBNA 5DXJA 4BE7B 3UUWA 1HY3A 2JFWA 4M9ZA 4X54A 3AXSA 1W88B 4YGYA 2JGEA 3CURA 1PNQA 4G63A 3VMFA 3E53A 4R2XA 1R4NA 1D9ZA 2IHZA 2PFKA 3GUVA 3H1FA 4OK6A 3BE6A 2O0JA 3ITEA 4CIYA 5ADHA 3EHDA 2GZ1A 1N6RA 1TZJA 2WU4A 3OJFA 3ZHOA 2Y4NA 4JQYA 1RRMA 3L0CA 4QUIA 1RMTA 3CEAA 3PQDA 4QX6A 5LYJF 1P18A 4LZWA 2F3QA 4MCJA 3WIOA 5AJWA 3SY8A 3GY0A 3CMMA 1QXSA 1J8MF 5JJKA 3OCZA 3TLGB 1FYEA 1Q1BA 3KPYA 3TG2A 1E7RA 1XZLA 2XEXA 4NYJQ 2GN6A 5D51S 4KQ9A 3N2KB 3E18A 4MO9A 1KSGA 4YO8A 4B09A 3ZZNA 4ECEA 3UPUA 2AFHB 2PPVA 4AD8A 3OKAA 4YONB 2H2HA 4DB4A 1N2JA 1ISGA 3QE4A 5AD1A 3UGJA 4C6SA 3IMEA 5IS2A 1WB4A 1QG0A 3DE7X 3KB2A 1JSXA 1N5RA 3VUEA 3D5EA 4PTYA 5DM4A 1FYDA 4JK3A 4KUEA 4U0KA 3R0QA 3PVSA 3BMCA 4ZOBA 4ZV4A 1KAGA 4LA4A 5IJAA 4OSOA 5A7FA 2YQ4A 3HUTA 3IURA 4MW1A 3OUZA 1EDOA 3NIDB 4KC0A 4MUHA 3FYUA 4OQQA 5DYYA 1SD2A 4FLFA 1MFZA 4QOFA 3WRXC 1V5EA 2WLTA 3FG9A 4X1KA 4MJXA 4CTOA 3K1TA 1NQTA 2PX5A 2FMHA 1JJAA 4WBXC 2RIPA 5JZVA 4L22A 1ATIA 4XWKA 3GLUA 4K6HA 3LQ4A 1JG6A 1DKNA 1QLHA 1KR5A 1J06A 1QRTA 2BLLA 2XYQA 1P4JA 2D2IA 3D2LA 1RM0A 4TKMA 4W1RA 1H6DA 5T8KA 3EQ2A 1ZG3A 2BUCA 1YBAA 5J43A 3N6VA 5E38A 2GN2A 4IEFB 2W22A 1O97D 3BICA 4JBIA 5L51A 4B4VA 4FGLA 1E0KA 4P9NA 1UBJS 1W8IA 4UTVA 1XRRA 1YNSA 3EDMA 1NASA 1MLDA 1N4DA 2IOQA 3SS9X 4BQNA 4NENA 4F1JA 2TMGA 2WAMA 4KGVA 5CA0F 4B2PA 3HDQA 3R44A 1R4NB 2EKBA 4PR3A 1I2MA 2B9VA 5DB4A 2QLTA 3VR0A 1EZ4A 4MUAA 5A3JA 2QGNA 3RUHA 2JLZA 4RL6A 3BAFA 1AHNA 1NZFA 4RWZA 1O5OA 1Z06A 4H60A 3TW8A 1N5IA 4WACA 4AWXA 2BTQA 2Q6LA 3BDAA 1BA2A 3FFAA 4G24A 1Z2EA 3ES9A 1NVAA 3B6MA 5C1BA 2IS1A 5HE8A 3REFA 3LVQE 3I5UA 3A10A 3P4YA 4PGAA 4RHCA 1H93A 2RK3A 1M54A 1K6XA 3BK2A 4HNHA 3V4SA 3NYQA 3WFJA 1ZO8A 4XGIA 1NMSA 4EVQA 4XUEA 1YQUA 4XD2A 1VP9A 5CB6A 1TEVA 4Y98A 5J23A 3AUJB 1H2EA 5DI9A 3UFXB 5K0EA 2I80A 5ICCA 4GKJB 1M33A 4X1YA 5FOVA 4R1PA 4DA6A 3HYNA 3I3OA 1XAJA 1KDTA 2A9QA 3L93A 4Z3KA 1CQWA 4C0HA 5AM3A 2GCEA 3PEVA 3AIOA 4OHFA 3PSHA 4C04A 1VJDA 4PE5B 3LLVA 3AESA 5CPFA 1T8RA 1SMKA 1VP3A 2F2TA 3ZPXA 4CFSA 5EJ6A 1GTRA 4O25A 2YRWA 2J6IA 3IXLA 4G25A 3P9QA 5NLLA 1J6UA 1YUBA 4KDCA 5FYQA 3ELYA 3Q3VA 3H84A 4C76A 1RI1A 4E88A 3E7WA 2FEOA 1KP2A 3ZHQA 1F2DA 3L84A 5L95A 4KUHA 3T5PA 3QHQA 4MV5A 5C7YA 2X0RA 2W2QA 1KMHA 1Z8HA 4CHGA 3E3LA 1TCVA 3E5MA 3HJHA 3BTOA 5LC1A 4EO7A 3LPLA 4FHEA 1Z39A 3QQPA 3WLPA 1X15A 3FNRA 3M4NA 4MR9A 2GBLA 3EVEA 5JADA 2JI8A 1T1JA 2JFZA 3I39X 4MV6A 4DIUA 3BJZA 4MJLA 1XP5A 4MQ5A 1BU8A 2PD6A 1ZOIA 2VHEA 2ZIEA 4OUKX 4PSAA 3VOBA 4M1OA 4BX2A 2J9FA 1FU7A 1VLHA 5G0UA 1LBEA 4LHXA 4DMHA 1E3WA 1NBHA 2Y66A 4IGEA 3K96A 1F0PA 1K5GA 3CR8A 2JFXA 4QGGA 4TMWA 3IBCA 3MTQA 1NXOA 3LQYA 4GXRA 1D2MA 1UK9A 4JASB 2V9PA 3IUYA 4A2CA 3TW8B 2XWPA 5AQ1A 1QNLA 4TYPA 5C80A 5DHAA 5LR6A 3EZNA 5IT4A 1G4HA 4NBRA 3S40A 1CQIA 1E2HA 1MRZA 4RCYA 1KI6B 5BMVB 3N53A 4ZZ1A 3B51X 3RFVA 1DC6A 1I94B 3OLVA 3LHSA 3ZR4B 1JPVA 2GPYA 1C0KA 2P67A 4OIMA 2YBDA 2FMKA 3EVDA 1LLDA 3PPWA 4GNRA 3MMPA 3GNTA 2ZB3A 4X1YB 2HA3A 2EKDA 4G23A 5AHRA 4YV0A 3FPEA 4P3PA 4ND3A 1YHNA 2XGJA 4K7JA 2FMXA 4AP6A 1KAOA 3MUFA 1SU8A 4YDRA 5FUBA 3ORQA 1U4OA 3AESB 3R6DA 2F3PA 2J9RA 2ZSDA 4PHHA 1T6XA 3ET4A 2YJ4A 3EGXA 3TH5A 4P7KA 4DRXA 3G89A 1PZGA 2R62A 3SC3A 4H7DA 1DHRA 1ZKDA 3U2QA 1WDLA 1KO8A 2OP0A 3PQCA 3LUGA 4JJ7A 2CHVA 3PRYA 2IELA 5IJ0A 1ZCFA 4D82A 1JPJA 4MVWA 3RUAA 3TL2A 3VHXB 3ZWBA 5GPBA 4DSOA 2R2GA 4Q9AA 5DMXA 1KMHB 2O0KA 1ZM4A 3TTTA 3A7EA 2RAUA 3H2HA 3STYA 4D4KA 2ROQA 3OEWA 4G0NA 4B4OA 1T1SA 1JZQA 1TTPB 2Y1KA 4S1VA 3P9RA 1BHJA 2IYVA 3MTBA 3F74A 1OX6A 4PZYA 4YQZA 5K0LA 3PFBA 4DUYB 1JDPA 3DBHB 4KMSA 3BTUA 3K3PA 2PQ0A 3DOUA 2Y99A 4R1TA 3IIJA 4RVNA 2ZTLA 4NCHA 4BV8A 3C3MA 1KDRA 3GP8A 3FNIA 4EHLA 4UXHA 1HA3A 1QB7A 1YQGA 2J9FB 3AOEC 5TJHA 1QQBA 2B1JA 2FQQA 3ZHYA 2CC2A 5GM2A 4G1VA 1E3WB 4BJ3A 5EJAA 3FW1A 3SGLA 4CN9A 4EDHA 5B55A 1USKA 2NXCA 4QFBA 2ZYDA 1NNLA 3RO7A 3D54D 2R85A 3H3XA 3Q7SA 4FFNA 2VAPA 3IODA 3MJRA 1IQRA 4TXLA 3J80A 5B3LA 4IPTA 1EUCB 5PNTA 3QPCA 3V9PA 4IFEA 1KHTA 4GMGA 2Y0DA 2FKNA 2YW2A 3EIXA 2Y6VA 3CVYA 2XYRA 2J3KA 1C4KA 2XYVA 3VGJA 5F4ZA 4ARSA 4DIDA 4OXXA 4WOCA 2A5FA 4L4UA 3TTUA 3GLKA 3H1TA 4NCAA 2RARA 3RVPA 4A0GA 4RTKA 2B69A 4HAVA 4WFJA 3SC2A 1G0NA 3K5IA 3K4HA 1YAJA 1K89A 2HO4A 3DVSX 2VWHA 4I4LA 2O3TA 3UJ6A 3V6MA 4A73A 4I3FA 5FUQA 4JEUA 1NDHA 3NHLA 4OGLA 1V9SA 2ZYAA 4PQEA 2WIAA 2ENUA 1EFPB 2ZBVA 3HUUA 1NX9A 4BP1A 1RWQA 2HEGA 1TC2A 5LQCA 4ZKEA 3NHJA 4PHCA 5H68A 4QEKA 1PYOA 3CNHA 3EJ6A 4UUBA 3V2UA 2MTBA 3RFFA 2GHTA 3HABA 4UATA 3EBOA 4ZTUB 4MHOA 4B7UA 4D4MA 1HV8A 3IQZA 4TV8A 5A6SA 3MGCA 2V0NA 1V95A 2J07A 4OQDA 3D2BA 2M1ZA 3VI4B 5COQA 3WNQA 1Z6YA 2KMLA 1Y9JA 2ZIFA 4ONEA 4LXYA 1B0AA 2ZYWX 1XVUA 3WGIA 4QKQA 2JCBA 2W6MA 1YVEI 3ACBA 2A5DA 4W4TA 1OYWA 1EUDA 1IC6A 2VLBA 3COZA 3I83A 2XZLA 1FP1D 3FVWA 1GQSA 5BRNA 3VR3D 4ZV9A 3M89A 2LCQA 4CNQA 1E2MA 2ZTUA 4V0ME 5CT4A 3KEOA 2E21A 3S28A 3UFBA 5DE3A 1F4VA 1JE0A 3I5AA 1TJYA 2WOJA 2AKEA 2WTXA 3PC6A 2R4UA 4CM4B 2FG6C 2BN4A 4X7BA 5TE9A 1BE0A 3M33A 1HMPA 1Y81A 4BO3A 3ANMA 2YFHA 4DR3B 5DI3B 4EZIA 3PL5A 2EFGA 2J3QA 3DVRX 2EKLA 3FMGA 4MPJA 3BMOB 4IOMA 3DMYA 2Q1UA 3GNSA 4JA2A 4GI2A 4N0QA 3ZOZA 1H8ED 1U2DA 4MLPA 3HMQA 2FQXA 3F5FA 2ZDGA 1TTQB 2I9KA 4FWIB 5H81A 2J0EA 5K0SA 1AA9A 3DONA 2FPMA 4KU4A 1HZJA 1SGWA 2NVUA 3MJCA 4J2OA 4YMLA 4FQ5A 4A6DA 1IIRA 5EQJB 1OSNA 1L4GA 5CLJA 3H19A 1L4NA 5I3ZA 4L5YA 3TL3A 3TLEA 1E7SA 1F2UB 4NYIR 1FRZA 2O57A 1XRQA 1H6CA 4L9RA 3VHRA 1YJXA 3VNRA 4AMUA 1SK9A 2YZNA 3TB6A 5IC5A 1L5WA 1FMLA 4X95A 3GJRA 4A0QA 4D2IA 2YUIA 3QUBA 4HQLA 2UYHA 4OKSA 4DXAA 3R0XA 5FEUA 4DR5B 1V7QA 4FEEA 2XUIA 1LK5A 5BP7A 4YIHA 1B3BA 5I4KA 3WGVA 3FH0A 5IAJA 4BVJA 6REQB 2DFPA 2G5GX 4PX5A 5CB4B 4DLPA 1C9DB 4RFSB 3RC2A 1N2GA 1KFKB 3CCCA 1EK2A 2ZRMA 3TOXA 3B3QA 1BROA 5I9MA 2RH4A 5BNTA 1JDUA 2LV8A 1I3OA 2ASVA 3GV0A 2BD0A 4R0NA 4YAFA 3W0LB 4DLTA 1YVPA 1SKUA 5EMKA 1KI3A 4BWFB 4DCCA 3W9YA 1ADYA 1UDCA 2RG7A 5AVJA 4ETWA 3IBYA 2XUOA 4IIDA 1KH1A 4EPWA 1QX3A 1QZXA 3NBKA 1BMFA 4G5FA 2OGWA 2J48A 1TVEA 4RPJA 1SHJA 3B6ZA 3M83A 5IWAB 4QOHA 1VMAA 1B8PA 3SYMA 1AGYA 4RIFA 3HEBA 2QT9A 3H97A 3KSRA 5ALZA 3MELA 4OUDB 1Q1QA 3IDFA 2EFCB 4N7MA 3EPRA 2QZPA 2I4IA 4IKPA 5DEOA 4QYTA 2DBYA 3KL2A 4X64B 4WW0A 1Q7RA 3PXGA 3TLCA 5KPJA 2A9OA 1PJTA 2PBLA 2CSXA 3GGGA 4A1OA 4UZFA 4ZDJA 1KF0A 1B2RA 1E69A 4EKDA 3ZWAA 2Q6KA 4B6FA 4JJEA 3Q1KA 1G6Q1 1XJQA 2CUZA 2R87A 4BYGA 1HE5A 2IYFA 5HZGA 5IDQA 1BMDA 1KFEB 1KZHA 2J41A 3JRXA 2F17A 4HDAA 2WPDA 2C5FA 2EZTA 3N59A 4Q19A 3UJ8A 3WI7A 4J16C 4D3ZA 5JU6A 5A02A 4U0JA 2PNJA 2O7NA 2ONZA 4QO7A 4R16A 4EUHA 5FWXA 1Z5WA 4YJ2F 1C41A 3CZ5A 4G41A 1I13A 2J9ZB 2WJPA 3F4KA 3ONNA 4KBGA 4C05A 1NZJA 2J45A 4CYMA 5K45A 3WWDA 5KNCH 3S5UA 1EB8A 2PBRA 1ID1A 4Z9BA 3NRCA 2JARA 3WWPA 5IHXA 1TU3A 5F3DA 2QWXA 4KTVE 4M1TA 3UXYA 1KO1A 1UZLA 5JR3A 3AH8A 2Q5IA 2GQ0A 3Q11A 3Q3EA 4UPEA 2FUG1 1B74A 3M6WA 1GGJA 1JZSA 3ADKA 1HE4A 3CZ9A 1Z5UA 4QFDA 4MUMA 3GVHA 5BSUA 1U3TA 2I54A 2JLBA 4K2HA 2B5VA 1G63A 1C3XA 4KZKA 5TVGA 3PFGA 3RAFC 3ZJVA 4IJKA 1GZUA 2JAQA 3QEAZ 3QBJA 3I4FA 4RJKA 5DGIA 3R75A 2PZEA 1CRWG 3MXTA 3PDIB 5MGNA 4MTLA 3PHIA 1OLSA 2WG2A 5FUWA 3I32A 3BIOA 2AR0A 2ZU6A 4A5OA 4X93A 4C4ZA 1HT1E 5B6PA 1OGJA 4FS8A 5KYKA 1ND6A 1ZGZA 4QXOA 2YHAA 4WPGA 3CH4B 1B8UA 1NPDA 2JBAA 3WNVA 4X8OA 5T4HA 5ALHA 1AQYA 4DDUA 2O2CA 3BHIA 4HSEA 4BHTA 5M04A 2M6SA 1NFRA 4YP0A 3DLHA 1CQJB 4L08A 5TMPA 2XTJA 2B1GA 4TQAA 4RLHA 4I66A 4H1WA 4DSZA 1LPBB 1TMYA 2ETXA 4A26A 4U5XA 2AG8A 3K5HA 2VK8A 4NK5A 1GZDA 3BWDD 2WKRA 4RGBA 4AUEA 1CY6A 3O6VA 4XJXA 4CXMA 2O8BA 2UVDA 3H2KA 4MQBA 1IM8A 2CJYA 1BWQA 1NWHA 1MX9A 1VJ0A 1U11A 2C8VA 1OUMA 4RH1A 5CXSA 5AOAA 1DIGA 1SCUA 3BRCA 3QXXA 1T26A 2QD2A 2BIFA 3DZ8A 3DB2A 4XQ0A 3ZU3A 1TMOA 1TF5A 2XWJI 3OCCA 3ZWOA 1SG6A 2NXNA 5HHTA 2O8FA 2IPMA 4MCHA 1R6DA 3L7KA 2DLCX 2ES4A 5JAHA 3D6JA 1A9ZA 1K5PA 1KYQA 3DDZX 3FCUB 4QC2A 4IOLA 4WY2A 3SOZA 1CZHA 1H9BA 4AIRA 4F9TA 5LKRA 3EXHA 4CGZA 4B7ZA 3G1TA 1MU0A 1RLUA 1QORA 1XCOA 2X2PA 3C5HA 3R0ZA 1UBCA 4IH1A 1LI7A 5KQMA 3RTCA 2YFKA 1DCTA 2V7VA 2AA3A 3KLPX 4BBAA 2NP7A 2FEPA 3QKWA 1TM1E 5D86A 2YXLA 5IKXA 5BWCA 1DRJA 4RV4A 1RU3A 1P5RA 2QQEA 3IVCA 4WOJA 1VQ1A 2ZIVB 3LBNA 3RSHA 5IAAA 2EKZA 3C4JA 1UMDA 4F6RB 1YIDA 4DL9A 5JSZA 3EXAA 1BW9A 4KLCA 4AJOA 2GN0A 4GZ5A 3UENA 4ZK6A 4YBZA 2OQVA 2J30A 2PGDA 1HH4A 3N9IA 4CEIB 2CUTA 2JBAB 1HLDA 3C98A 2PX6A 3LI2A 1A8UA 4BKQA 3IAS6 1DCMA 3HZHA 1YNOA 1WDWB 1MABA 1XKQA 4DV5B 2PRKA 2GAIA 1HL7A 3I1JA 3UWKA 3LWNA 4W7SA 4F3TA 3VTAA 4HNSA 1L7RA 4EB3A 2W9XA 2AZDA 4BWGA 1Q77A 3Q3CA 4Y6OA 4TRMA 2JGKA 2ZT6A 1TK2A 2ZW9A 4FFOA 3L0BA 1Z6TA 2GMWA 3R09A 5I7AA 4MW0A 4KKXB 2G9ZA 1ZVVA 2BP7B 2IIVA 4H1UA 1BFUA 4XXHA 5HF6A 4B4WA 4LV8B 4KHZA 2W2TA 2X3FA 5HKKD 3VKWA 4K86A 3ADCA 5JTTA 1JSCA 2J6BA 3L7AA 4WKNA 4E3ZA 1OXTA 1S4MA 3ZCVA 1FXSA 4DW8A 5MF6A 4AUMA 4F93B 1MQSA 1SVOA 1XQXA 2V7GA 3PENA 2X42A 3OA2A 4L7VA 4B4DA 4EJ0A 3ADBA 3EGDA 1YMVA 1B7GO 1J99A 3PPYA 1HETA 2IYYA 1CULC 4B81A 3QKRB 1Z75A 1PRYA 3IO5A 4MICA 2Z2YA 4N5NA 5DLQC 4KQGA 4Q01A 2B37A 3A6GA 5B58T 2XT6A 4XFJA 2IH4A 3U5ZB 3EXHB 2VAVA 3H04A 1OMOA 2CXHA 3QYPA 3KL4A 4M0UA 5K05A 4JB2A 3AKDA 4BBPA 5LWQA 4NPHA 4AURA 1B23P 5HPYB 1X8KA 1B2LA 1Q20A 2QX9A 2Y3IA 1XNHA 3AY0A 2QM3A 5KC9A 2PEYA 3QH4A 1W6UA 2H4FA 3EC1A 4JBNA 4N49A 4JYMA 3CGGA 3D59A 3EEBA 5DN6D 3ZJUA 2YIDA 1ZD8A 4Y6GB 3SYTA 3TZEA 2QE7A 5E6UB 5IVHA 4R51A 3B8EA 2R6GA 4ZCIA 4OQZA 3T3PB 1U94A 4Z51A 2DR2A 4Q1AA 2QV0A 1TJ4A 4IOKA 4TXMA 5DPMA 4V0MA 2WIKA 1T8UA 3CPJB 1FX0A 3N75A 4TLBA 2QX6A 3TW0A 3RYCB 1DAKA 1QGED 1T2NA 4G1FA 1DBVO 3V46A 2H7XA 3JZFA 3MQ4A 4DUGA 3V7UA 2AJ8A 4DXHA 4YMTA 4EUKA 8GPBA 3JSAA 4P80A 4GPTA 4GBGA 2FP4B 1QG6A 1GOTA 1BOOA 3U60B 3QFCA 3W2TA 2YNMC 3KE8A 3JATB 3RS7A 4X0EA 4FGZA 2ENWA 2JLSA 1V25A 1D9XA 4MZXA 4XSVA 3LL7A 4Y30A 2I6TA 2UZIR 3VO1A 2H4WA 5MFZA 3AHDA 3N2IA 3T9FA 3D4NA 5AI8A 5A3SA 1ZBDA 4BL5A 2PR7A 4TYQA 4YDHB 1GGFA 4K9SA 2O50A 2FSHA 5JCZA 2FPKA 4LCJA 2B2CA 1P4GA 2J3LA 1VPVA 4BKUA 1OYOA 2QTTA 1S2NA 3DD5A 1TCAA 2IITA 3GRFA 1XEFA 3EGDB 2EJTA 2R7NA 1UMBB 4XFKA 2F8SA 2A5GA 1I10A 4OQPA 4S35A 4WN9B 1JFSA 5DYTA 3R40A 1OC2A 1O1YA 2JCYA 3GA7A 4IUCS 4E33A 5JASA 2VJNA 3NDIA 3OE5A 3PUVA 1UPTA 3G8DA 2BR5A 1DOAA 1PJZA 3SBOA 4LHWA 4MS3B 2A2ZA 4AXXA 3GEHA 1GZVA 2A1IA 4FGJA 2DUUA 3QX9A 3D43A 2VSNA 1XZMA 4MV1A 5DLDA 4X63A 3AR5A 5JS1A 3D0KA 5EWJB 3QBTA 2VDWA 3G6WA 5BQFA 4WEOA 3QEKA 1V1MA 4IRXA 3OEEA 2Z4TA 4JZKA 4TPKA 4CUKA 2TRSB 4WINA 1SXQA 4IV8A 4IFBA 1D4AA 2UXDB 2PDAA 2CXSA 4QU9A 2IZ5A 2OFXA 3T5GA 1DQZA 1PU2A 4ND8A 4C4PA 3HEAA 3LWDA 3NXSA 4JELA 4ZZ2A 1KJIA 2G1AA 1SKAA 3SVZA 3OQPA 4MKXA 5FAXA 2OK7A 3IPLA 3R0VA 4P4LA 1MIOA 4ZI7B 2CWDA 3ZY5A 3FLBA 3PQ6A 1B43A 1E1YA 4MA5A 4I0WB 3QEMA 4MA4A 4RHYA 4TX1A 5M7EA 2YXEA 1QB8A 2IBTA 3LPMA 1S2IA 2CNBA 5LLTA 2FSIA 4TT3A 4L74A 3LP8A 4JEIA 4UMFA 1SK8A 5B3KA 2WNIA 4HPJB 2BGGA 4HNAA 4E22A 5EG5A 2P9GA 2IS2A 2JCXA 4UBMA 5A5FA 4QJBA 3BCUA 5D7BA 3FGZA 4F7WA 4LX8A 1JSRA 4Z5XA 2COUA 2HRRA 1AUQA 2H2IA 3GJYA 3NC0C 1N8NA 4RJJA 3OZFA 3F6YA 4WZ6A 2WINI 1CCWA 1PG0A 3QVKA 5CHEA 1XU4A 3NVDA 4RVGA 1EVQA 3OOHA 5CB8A 2XZOA 3EE6A 3MWEB 5JZ9A 1UBTS 4PYRA 3JD0A 4Z4FA 1SBTA 3FOEC 3CONA 5AH0A 3OQVA 5A0TA 1RHKA 3EFOA 2H92A 3PPXA 5LMUB 3NYWA 5H16A 2Z43A 2HPVA 2VUHB 2ZAMA 2ZJBA 4GS5A 4PCVA 1E9FA 2IIPA 3KJNA 4KO4S 1BXKA 3TWOA 1I7DA 4OXKA 4R1LA 5CYOA 1F60A 3AI1A 2ZBPA 2Q3MA 1HPLA 2JZOA 1N8KA 2CXPA 2JFVA 2JJQA 1EQ2A 3C1OA 4U2FA 5DHSA 2WQ6A 3I9V6 3O94A 5D00A 3V1KA 4CMIB 1GNVA 2FTKE 3TMAA 4X91A 1QYXA 2JLVA 4NHOA 1YL7A 3QLUC 3L04A 4H1HA 3RJ5A 5FX2A 1WETA 3RKRA 2W4MA 3NANA 2YWBA 4MAFA 4HLDA 3NHMA 1EFTA 4CHTA 3PR1A 5CBKA 1I14A 1JAIA 2ZYIA 3PFCA 4M76B 4TZ0A 1TM7E 2K87A 1RXSA 3KPWA 4UQOA 2YYYA 4Y2XA 1HRKA 1TQ8A 1R4AA 2WF5A 2UUBB 3X1MA 2JW5A 4GQBA 3AFNA 4TUYA 5BW6B 3CG0A 2PWYA 5FA6A 1H4TA 4R9UC 4J1TC 1WXWA 4W1PA 1MDFA 2C96A 2E85A 1PGPA 3EW7A 3L0SA 3QEMB 4IX9A 4YI5A 4EW2A 3A1CA 4LRWA 5AR1A 4QQNA 5AVOA 3I5XA 1Q7TA 1J8DA 2B0JA 2A1TR 2H31A 3KOZA 3U40A 1W93A 1ZNQO 3GCZA 2OZKA 4YH1A 1PQ4A 5AKHA 4NE7A 2AG5A 4DR1B 3ZWPA 2W2KB 2I4MA 2EQ5A 4PN7A 4WXHA 4GEKA 2VJQA 4F38A 4AKHA 1ZN7A 3FSGA 1WCYA 1VKHA 3UJDA 2JS7A 2KS6A 5EQFA 1XG5A 3VU9A 4RGQA 4JBGA 2A33A 1OFUX 4ZEWA 2PUTA 3I01M 1R3UA 1BXZA 2XUKA 3V4VB 2OO5C 4HKTA 3ILYA 5HIKA 1YZVA 2WD7A 1IZYA 5E3HA 2OL4A 3NV7A 1JZTA 2WB4A 2J8ZA 4PNEA 1U6KA 3ZWDA 1HURA 1K8RA 1KTVA 1BZYA 1N57A 1Q15A 1XFAA 2OHVA 3HLYA 4GWLA 4JQSA 4AULA 2BL4A 1QTRA 1J2UA 5HSGA 3B2NA 3WG9A 4AJJA 3G9QA 1ZU5A 4L8WB 1TO1E 4JC8A 1FF9A 2H1LA 1Z8NA 2ZUUA 5KWJA 4EH1A 4JI4B 2QPLA 3RRMA 1PNRA 4XRGA 5IEJA 4DR7B 1Y6ZA 1HT3A 2JLWA 3LNCA 4C30A 3EODA 3EZGA 3OZWA 4FX5A 5IAGA 3KQWA 4BFWA 4O2RA 3O74A 2AUTA 5JCPA 2R84A 3CLKA 4TKLA 1ACMA 4GF5A 3NAZA 5G3ZA 4LECA 3SM3A 4BU0A 4G4SP 5ISMA 1UR5A 4AY2A 1JLMA 1DO2A 2BMDA 4BO4A 3U62A 2E18A 1T2EA 5D01A 1RIFA 4Z6KA 1JIJA 2ORED 3EGVA 2OYCA 1NHGA 3EAGA 4OHPA 4WZBB 1UT8A 3HYLA 2ZBQA 4DAOA 2NYUA 2X9LA 1GUAA 1P2SA 2D59A 4BNYA 2W5UA 4QVGA 4LBYA 1O96B 5BORA 1VJCA 5LA6A 2Z9DA 3JQ9A 4LOAA 4BNTA 4FI3C 3B9BA 3ZKWA 4ENUA 3N07A 3PCTA 4BO5A 5KX5B 3WL7A 2DBVO 1W5FA 2VNIA 3FKJA 4IHKA 3H9CA 4QULA 2DQ4A 3TVDA 2EW1A 3OQIA 2ZSBA 3DC7A 1QIMA 2RHDA 2FUCA 2QOEA 3IERA 1NONA 3K31A 5DOZA 1JSZA 4NULA 3SZRA 5DYNA 5K7SA 2LPMA 1D0IA 1PGNA 2QUIA 2B6HA 2OZVA 2WJ4A 4RA9A 1ACLA 4INZA 2JIZA 2Z5GA 2WZCA 4N54A 3E5RA 3VU9B 3WQQA 5LOVF 4OJYA 3SHVA 3TIVA 9ABPA 1OKKD 3NEJA 1T3ZA 3WVNA 3VI3B 2JDID 1EM8B 2C8LA 3ZU6A 3BL5A 4TVOA 3Q40A 1WXIA 2WD7B 3FNHA 2QL6A 5G1OA 4A82A 3FHJA 1Z5PA 2V4UA 1ZVQA 2G7MC 1JLHA 2HPZA 2VP0A 2EV9A 4ZU1X 3PFHA 1BVHA 3SLKA 2NUTB 3R24A 1ZJZA 4F6CA 3H9GA 3S7ZA 1YQ9A 3GPDG 2EJCA 3PFNA 4YJFB 2P9ZA 1S89A 2O52A 4YQYA 3FFXA 4CL2A 1FDTA 1IFXA 2FFAA 3DEZA 4ZDIA 2WJIA 4QUGA 2BFDA 3GLSA 3FX2A 4P3KA 1NMXA 1ISJA 1P5ZB 4R9SA 1OI3A 1QC5A 1T2AA 1QQTA 4UTZA 4EARA 2EWWA 3HJTA 2HJHA 2IEGA 2QRZA 3CZCA 4JP5A 3T4PA 5I5GA 3THWA 1E6MA 4CZ2A 2Y1WA 3WL5A 2PO5A 3GFGA 5I8PA 5DSTA 4WJZA 3ZV3A 2J3HA 5MN5A 1I51A 2Q28A 3CZRA 3WLMA 3T95A 1CUZA 3VR5A 3WO0A 4J8PA 3H6HA 3VZPA 3M4ZA 1TIPA 1SPBS 1XCGB 2Q3DA 3G2LA 3O9MA 3UWOA 3PQ7A 4HT3B 1QYCA 2Z1NA 4O8CA 3KALA 4J7XA 4UDYX 2QI9C 3KOWA 3FWPA 3WLTA 1S4QA 3AF5A 1H1DA 1N2SA 4P0PB 2VSQA 2I6UA 4R9RA 3OQIB 3UK2A 3W78A 4YMGA 1YB1A 2OCKA 1XD2B 4FNGA 1PFUA 1T9GS 2JEYA 3PB3A 4G3XA 4Z0PA 4D3SA 3K70D 1AM4D 2C29D 2VO1A 4LJAA 4MJ3A 5JNTA 1T5TA 3BRWD 1X7XB 4UTOA 3A1FA 3OQ6A 1JYSA 2GBFA 3TTSA 2WBLC 3C3JA 4UJ3A 3FOWA 3JYNA 4FQ8A 1JIQA 1FVOA 3LCMA 4KDFA 2IH5A 5EKUA 2ERCA 3IQHX 1DUIA 1SC6A 4LE0A 1HNWB 3BYZA 1EX7A 3UHFA 1JGTA 1HDEA 3S68A 1C7IA 2Y8EA 4CKYA 1Y4AE 3ADPA 1IUOA 1YGYA 2ZR8A 4A3SA 1HYHA 2ZRFA 4O02B 3TBKA 3I1FA 4X6LA 3SDSA 1X1BA 4BNFA 4YS6A 2HCBA 4MO2A 1IHOA 1FMJA 3TM4A 4LIPD 3HE3A 1J0DA 3ZUPA 2DPYA 1XHLA 3OQ1A 4V24A 3W8DA 1L3IA 1E6EA 1GXSB 1OILA 1O57A 1WXGA 4LOIA 1C4XA 1CY0A 3QHAA 3D9QX 1P45A 4M1WA 3KQNA 2BCEA 3BWXA 3MYYA 1GP2A 4WH0A 4AU1A 1N2CE 1DI0A 2VLIA 5CAEA 4DEYA 1UMCA 4CKXA 1A8HA 1BC5A 2QRVA 4J0CA 3ROFA 1RJ9A 4YAEA 5IW8A 2ODQA 1D1TA 1P4RA 3FDIA 3ZD8A 4A0FA 6PFKA 1QC5B 4EYGA 2R6R1 1PLJA 1U28C 4WY5A 1XEAA 4F9EA 2GDZA 1LZKA 4DWOA 3T9BA 4YT4A 2GF9A 2W2MA 2PD3A 2ZUFA 1VBFA 3THWB 2CNNA 4YAGA 4PFJA 3S8YA 4IQ4A 4W9MC 4H16A 1QRSA 1TVKA 2C00A 5MN4A 1F7VA 3THYA 1GILA 4QUDA 2X0KA 4Y2YA 2OQ2A 1G291 2AL7A 3U49A 4FWTA 3GZNB 2FWAA 3LOUA 1Z37A 4MPRA 3CB2A 4MRPA 3LMKA 4OFWA 1MN6A 2FUKA 2GSWA 1AZLA 2H3EA 5CIWA 2O59A 3EVAA 2RGCA 4RADA 1ST2A 1T5LA 5SV2A 2BKLA 3ZHZA 4BV3A 3MUNA 3HDHA 3HN6A 5HRAA 2ZWAA 5EQTA 1XTJA 1ZGHA 3DSRA 1B0PA 3FF4A 4IEEA 4Q4AB 3RVMA 2P6RA 2W6NA 1VHWA 1LY1A 3MHPA 3FGNA 4FVTA 4J2HA 3TS1A 3ZI4A 4NS4A 2RONA 4Q1FA 1G1AA 5ALVA 3LH5A 2CCKA 1C4OA 5K01A 1TA4A 3FDFA 2FPUA 1FXWA 2PY6A 5BUSA 3I4CA 1U81A 1PT6A 2XT0A 4Y3UA 5D6OA 2PQMA 1KGSA 1GTZA 2PJDA 3O8OB 3WNZA 5ALXA 1W36C 1EXNA 4QARA 2AVDA 4PG5A 2Z09A 1TCCA 1P7WA 1DKUA 1QMGA 4V0RA 1N8TA 5CM9C 2B36A 5CB0A 1PEYA 3QY0A 2DGDA 2I2BA 1AZWA 3R41A 1WTAA 3I8SA 1Z0JA 2P8SA 1LX7A 3FWKA 3UJCA 5EXEA 2V59A 2C1XA 3F9RA 4FYKA 5JMTA 2P4HX 1JQ3A 2I5PO 4F11A 3GR6A 1FDUA 5A4KA 3U09A 3FZYA 3SJUA 1XO1A 2YWDA 1CZKA 2BFCB 1RJ9B 3EEIA 4MK4A 3GRKA 4UEOA 4INAA 3IP1A 1JHYA 3JAWA 2Q2NA 4JYBA 4JLBA 1SO8A 5TY0A 3UWDA 4D0SA 4IXTA 1WPQA 1VL2A 5MGBA 3ZZ0A 4OMFG 4FM9A 3AR3A 1R7RA 4QRHA 1XP8A 2V9CA 2VJLA 3DD1A 4TN1A 5H5JA 3ZQ6A 4JKIA 1SKYE 5TS3A 4LYGA 5EHGA 2VDKB 1TVCA 3L2OB 1WDKA 4G0OA 2CB0A 4OQNA 2HCJB 3L7IA 3ECSA 5HE9A 3OZRA 3E8SA 3HRHA 4B44A 2GN8A 1GPKA 3WBFA 4RA6A 4RV5A 5EWMA 4EX6A 1GZHB 4HH3C 1JR6A 2Z04A 1MVLA 1SBIA 1VKZA 3C14C 1WXEA 3ELBA 2GBCA 2IYPA 8ABPA 5KO2A 1MMFB 3PEWA 3H13A 3ABSB 1BOFA 4P98A 4GRDA 3PGA1 3PNPA 4RWEA 4GGPA 5K2OA 3T94A 5ALRA 2IHTA 1NVKA 1KC1A 2VEOA 2QX7A 5D8DA 1EVIA 2O0MA 4TWZA 2GCPA 4HQ6A 5EJ9A 4XB2A 2HW8A 1UJNA 3HB0A 3ZZMA 4US2R 4ZVOA 1IN4A 1P29A 4PSVA 4C78A 3OIWA 5DM2A 4Z4QA 5DW3A 5FLKA 1CW2B 2DX7A 1NR7A 2L82A 3IQIX 2XTMA 1NOIA 5KYUB 4J7AA 3U3MA 2YWGA 3KKOA 1PV4A 4NECA 4Y67A 4DJAA 3N28A 4GX0A 4W9NC 2VCEA 1YQQA 3Q3HA 3RVLA 2ZYGA 1VE5A 1AUXA 4LXTA 1ZMRA 5JO0A 3ZXYA 4HGQA 4B35A 1ZEJA 5FI0B 5FP0A 4NIMA 3QMMA 1HOTA 1URPA 4OJMX 1V71A 3KEFA 2YC2C 4O4JA 5HF9A 4GGOA 1Z74A 3UA3A 5AVYA 5EIXA 4NQRA 4WFIA 4NAUA 4Y7DA 3CT6A 4JJKA 3VV3A 4OXQA 5K8IA 3OD5A 1NKTA 3OFVA 4FZRA 3X1DA 3PEUA 4YCAA 5JBIA 1CY1A 1VLQA 3V4RA 1J39A 4EF6A 4E07A 2J85A 4FJ0A 1PX2A 4C0WA 5I7VA 3ME5A 3CWCA 4NCXA 3DV0B 5HDQA 4PS1A 1A72A 1G42A 5JNLA 4N5DA 5A7HA 4R6WA 1U3GA 2DJIA 5LN1A 3GIDA 1XMPA 4MLCA 4P2GA 2R6JA 3F2VA 3Q0EA 3X3HA 4JHLA 4DZRA 1FPQA 4B48A 1VKRA 4WBNB 3W5IA 3CBQA 1ZUNB 4RA6B 4CT0A 5HKBA 1ZWLA 3WB2A 1AH2A 4TRRA 1DT3A 3Q1LA 4GI1A 3HDJA 1IXYA 3ZQ4A 4QTZA 3TFOA 3HTXA 1SG9A 1GZ3A 4O2AB 1XTPA 4YDSA 3OM8A 3SMQA 5BR7A 3HO6A 1THZA 2C7GA 2C7RA 1JYEA 4OIFA 2AW3A 2WB2A 4ODIA 1EFVB 4DGQA 4BV9A 2O7QA 3T06B 1XRSB 3NBFA 2R97A 1CUBA 1IOZA 4K26A 3TGLA 1W46A 2D7DA 1IWPB 1XVTA 4AQDA 5CG2A 3D4IA 1J0CA 1SOWA 1ZJ4A 1KVTA 1ZQ9A 2I7XA 1BHQ1 1EX9A 3BMQA 3N2EA 4IINA 4KIFA 3K73O 1N6OA 4R2WA 2HO5A 4YCBA 3SZGA 3VGPA 1U9ZA 4AAYA 4A8PA 4RANA 1XF1A 1YH3A 3TSOA 4NI5A 4X1OA 3EGEA 2WJAA 1VCOA 4QUKA 5H1YA 2D8MA 2HQRA 1E9SA 1TYBE 4L8LA 3I30X 3ROXA 2G76A 3SR3A 4LFBB 4G0YA 1HDIA 3KLOA 2VTEA 4JUIA 5AHKA 5A05A 5GIPE 1P0IA 5I51A 1OFHA 1R0ZA 4Q7QA 4I8IA 3ONVA 1QJCA 2P7IA 3AP2A 4NE2A 3ZLVA 4YQFA 4AJHA 5IX8A 1KO4A 4LQ4A 3F49S 4O4LA 1H0RA 2EP7A 1MJHA 1GUZA 2BFOA 2EZ4A 2HU8A 3AONB 3DFFA 3QEOA 5C52B 4O4JB 4ECAA 3QX3A 3V1LA 3NEAA 5DLYA 1NF9A 2JFFA 3QMWA 4NBKA 1YZLA 5DLPA 2XCSB 5ALLA 2IS6A 1CY2A 1Y5LA 5FYDA 4BJ1A 1X80B 4XIGS 3ROGA 3UJ7A 4IIJA 3AO0B 3T99A 3PKJA 2I6SA 4IDEA 3ZD6A 1KPIA 3GNQA 2H8KA 4TKUA 2BF4A 3F46A 4NCBA 3CPSA 3KV3O 2MIIA 1G3MA 4BVFA 4TMYA 2JHGA 1N34B 4Q15A 5L4SA 2FOLA 2NQTA 2IX9A 1AC5A 3PS9A 2ONJA 1J0XO 2WIBA 3F9IA 5B57C 2ZSAA 3BXPA 3BF8A 4CL8A 2CSUA 1TJNA 5FL7D 3KSUA 1WXQA 4D9MA 3RTAA 4FI3F 4BEWA 3WGOA 1TAHA 1YBHA 5A4AA 4HBZA 4P1ZA 3ZIDA 4P7FA 1YJ8A 3C8DA 3U4IA 1QH9A 2Q7OE 5CD9A 5A04A 2IP1A 1A2QA 3D6TB 4AJNA 5REQB 2WYIA 4R68A 5CJJA 4HNUA 3L77A 5EYPA 3OUTA 2J4CA 3TJMA 4DJDC 1XQYA 2REXB 3AVQA 3EGIA 2QTWB 3JZMA 5EKXA 5L3RA 1Q74A 5JS2A 3OAAD 3PZBA 1UANA 4XJTA 1RWKA 2ALJA 1V35A 1LLFA 1XQVA 1V11A 2OXEA 4C1NA 2FN3A 4PYLA 5LQRA 2J5QA 3BMQB 2AEEA 1U3FA 4R8RA 4MKZA 5KNDD 2WFZA 1OXUA 1D2AA 1RXCA 1UJ4A 1BMQA 1L4UA 5SY9A 1USIA 3RT9A 1A04A 1LUAA 3FWNA 2HUPA 1ORRA 1ZH8A 2HADA 4L9AA 2CEAA 4CM7A 5LQMA 4CETA 5F1PA 2XZPA 3KJIA 1SXHA 2LR0A 4XGKA 1K7SN 3CVJA 5KTMA 2GPNA 1ECLA 3CLSC 1UBEA 3M34A 4ZC1A 3T3HA 3V3KA 3U13A 1DWOA 3WYAA 2PR2A 3ZWCA 1GY8A 2HMTA 3UJBA 1YHYA 3OU2A 4IHJA 2QY6A 4G85A 4LBWA 1GFZA 2PV0A 1E89A 2I1QA 1FZTA 4HGNA 3W7AA 4MWGA 3HG7A 4YMWA 1YA6A 3HA2A 1NV8A 4P53A 1QIIA 5CEFA 4GOND 1XC7A 3D8RA 3I9FA 1N2CA 3IXQA 1E59A 1HQCA 2JJ2A 3AV0B 3E3AA 3QOXA 3QPUA 1I6LA 5DNYB 1C0EA 4GBED 1FYWA 1LBSA 1DG1G 2Z6UA 5EUCA 3TPFA 1EWKA 1KY5A 1YWGO 2Y1XA 2GPTA 4L7QA 4B3TB 1E3QA 2Y93A 2EIHA 5TQJA 3ZCUA 2ZKLA 3MEQA 2FWRA 4X8LA 4BVBA 4W5QA 3F1LA 1CSEE 1TT5A 2O8VA 4HXYA 4KVAA 3DO5A 1NTOA 1ESDA 4QQ8A 5F77A 2HFJA 2QTLA 4JLWA 3KTDA 4OMUA 3SKYA 4BLQA 1P81A 4BNNA 2YCLA 4JC4A 1IPEA 2UZ3A 3D4BA 4I4TA 4BLRA 1FW6A 2EIXA 2QI9F 5B6IA 5M2QA 1NM5A 1JIIA 1MOZA 1M6VA 2C9OA 3A11A 1OXVA 3G23A 3H5LA 2OB2A 1QGUA 3PL1A 2VNKA 4RQTA 4BFZA 2ZB8A 5ALYA 5C4MA 2DU8A 1Z34A 2GWHA 3JY6A 3B7GA 1ISIA 5JVDB 2Q4TA 3L7LA 1O7JA 2ZVPX 3H3JA 2A88A 2QP9X 4MWOA 4UULA 3OX3A 5DFAA 1VKJA 2X8WA 2R8ZA 2F6RA 1VSUA 3CKYA 4DM7A 1W29A 3FVQA 1M2WA 3OE4A 1E4OA 1XXHB 4YAOA 5BUQA 4BY9E 1DINA 2HSGA 4MI9A 5EUBA 1KVSA 3OCVA 3GN1A 1DAEA 4G01B 4LRUA 3UH0A 1Z73A 2VPPA 2BEUB 1XYGA 1I1QB 1DDIA 2F8LA 2GFQA 3R8CA 2HR1A 4LG1A 4LEIA 2LNDA 2JGDB 3QM1A 5C8XA 2QMUA 3W8FA 2O3RA 1CUEA 3ZDAA 2XNDD 2X7HA 4I14A 4DNOA 3IKMB 4EM6A 2VI5A 4OHUA 3RVDA 1GGKA 3GRRA 4UBLA 3H2SA 1YB7A 4IHJB 1SULA 3NKVA 2Q6OA 1M2JA 1K4KA 3N3AC 4MWDA 4OOEA 1GQRA 4X7PA 2R96A 3NMUF 1K0UA 3LCRA 3DOIA 2HSZA 3M6FA 1AHHA 1N2CB 3Q7QA 4Q9HA 5BSTA 4ATNA 2AEFA 4B3CA 3MMXA 3S44A 1PI3A 1HE2A 2EF1A 2F8MA 4OCZA 4WUTA 5TIIA 1Q1NA 1NKVA 3GPBA 3M2PA 1R0RE 1SIWA 4FZVA 3OFJA 4KN6A 4RETA 2NX2A 3OWHA 1T5BA 2C07A 3C4QA 5AIBA 4S1TA 3KK0A 1DTEA 3QMVA 3ZWYA 3I8XA 2WM3A 3IAS1 4EVRA 2NSYA 2FMIA 1U90A 2EL9A 6NULA 2H1HA 1XYVA 2PVPA 2O20A 4NPAA 2HJGA 2PYZA 4I4TB 1M8GA 1OBOA 4JFAA 4S0ZA 2PLAA 5DN6A 3UJHA 1P1KA 3ICQB 1RXVA 1CX9B 5EESA 1T10A 4YCJA 4MGKR 3PYMA 4O0MA 2OENG 3TEJA 3TTXA 4EK9A 5C1IA 3KT3A 5JSQA 2A78A 4BWYA 1EGHA 1IY0A 2C7BA 1D09A 3ABOB 1X38A 3LHIA 4L5CA 5HCUA 4O4IA 2VNAA 3TRIA 4IQFA 4F1KA 1I3KA 2VJAA 5DXFA 1MUUA 3FTQA 2DKFA 2VP4A 1GGMA 2QN7A 2C99A 2JFYA 1DL5A 3U7EB 3LQ2A 2R1VA 2DUWA 3EGOA 1QF7A 5C8YF 5K3FA 5KNCD 1Z25A 4WK6A 2RDMA 1HLPA 4YA6A 2W2NA 4B3FX 3PPIA 4BO2A 2UVPA 2X1MA 2UU9B 1GCGA 3E70C 2ZE6A 4Z8YA 4KQCA 2YN2A 4KQ2A 5EVCA 5EAIA 3EZ6A 4YRJA 3LP5A 5DWDA 4DCMA 4DV3B 2XZDA 3DNPA 1V1JA 2D00A 5LP6A 3MWDB 1VE6A 1Z33A 3DVAB 4BRSA 1NPYA 3CYFA 3EVFA 4L9WA 1I3CA 2JH3A 3TZLA 4B9EA 2PZAA 3BIFA 1E7QA 2FWPA 3ZE8A 3L0DA 1V4NA 4A91A 4CCYA 1GV0A 2GLXA 4FC7A 4DCUA 3TINA 1UWCA 4E5NA 5HJ2A 5DGTA 2QU8A 5EZYA 5F35A 1QBGA 5AXDA 3HU5A 3S2YA 4RFLA 1A98A 4BUZA 1YE3A 2CD7A 3MFQA 5DHFA 2ZULA 1X39A 4C6HA 4JOQA 3KTAB 3NASA 5DDIP 4C4OA 3C24A 2R8YA 3INTA 2WJJA 1VSVA 3HP7A 1RWVA 1OA1A 4EO4A 2I6GA 1JT9A 1J0BA 2WC1A 3SIRA 2IYRA 3C1AA 4O6VA 4P5EA 3EVBA 3ORRA 3T7AA 2QTVA 3KJQA 3FPCA 5IYZB 1UOQA 1RAGA 1T8SA 3KOOA 3EASA 1AVTA 1XCBA 2REQB 3A1NA 3ZDQA 2VZ8A 2LIVA 3IAEA 3LHFA 3DULA 3M70A 1IN7A 1X14A 4O59O 2FWIA 3X2EA 1VYTA 5LIPA 2NSJA 1GGVA 3RT7A 3EXIB 1F38A 3MD9A 2B35A 4D45A 5KVAA 1YJ5A 3UT5B 2PL3A 3OOJA 4ZEXA 2YZGA 1JA9A 2CDRA 4OAOA 3NIGB 2WIGA 2CUKA 4G97A 2ON6A 3I2FA 3L4EA 1P2UA 1Q50A 2HXYA 3HSSA 3U9SA 4OJNA 4OGWA 3TAXA 1WU7A 3IBTA 5JS7A 1UPUA 1KHHA 2QZ9A 4C2AA 5HM6A 2A9VA 2R1VB 3JVDA 4K87A 4LZPA 1O95C 4QQFA 2GWRA 1R8JA 3SX0A 3WJ7A 1YA4A 5CCDA 1KU0A 4DT1B 2SKCA 4O2BB 1LGYA 4KSYA 1L5SA 1LSUA 4L9SA 3U7FB 1U0OC 1YI0A 3KLBA 3K2BA 2VT2A 3BM5A 3T6KA 2O54A 3GT0A 5JJIA 1M5RA 1NNUA 2NU9B 3MT9A 5JDCA 5LP6B 2PBFA 4G4GA 3CR7A 4ZO6A 1T8TA 4PS0A 4Z7JA 4GR5A 3A9SA 2ADOA 2CJFA 2QL9A 3WDSA 5FBZA 1UZAA 3Q2OA 4POOA 3HS3A 3W2HA 2O4CA 4CCYB 5CHYA 3LA6A 3VYTB 4DVGA 1MRNA 4L2IA 3CE6A 3NS7A 3QYAA 1P91A 3IRVA 5EZYB 2PRSA 2XRFA 3PXXA 1QG4A 3EOZA 4HDCA 4UDXX 5KYVA 5KWVA 5BVGA 1PTKA 1OTYA 3I61A 3SAJA 2RD2A 2IEDA 1ZNWA 3LHDA 1DV2A 1XEWY 3MJTA 5FI5A 3I53A 4FMBB 3V1UA 5DU2A 2NZ2A 2FX2A 3O73A 5T6BA 4F4UA 1YXMA 1JQBA 3MBKA 1NXWA 4FMCF 1PEDA 1R8QA 1E5TA 2BJWA 3L1UA 4DV7B 5H9VA 4LWZA 2QTRA 3GDFA 1QV7A 4LZAA 4UPVA 2YKGA 2W98A 3NWEA 5CURA 4PLTA 1I4WA 2OBBA 2ZI5A 1HDCA 3ND5A 4GKAA 1Z5OA 3ROQA 4BFXA 4CODB 10MHA 4IXMA 4D4JA 2DSTA 3GRYA 5F5XA 3H0KA 3QG5A 4JQOA 3PNYA 3LDUA 3B1JA 3DDNA 4FX2A 1K9VF 1LD3A 3ZV4A 3PI6A 4Q9NA 2X1LA 4KAJA 4JITA 4KQXA 4UFPA 5C53B 1PHPA 3OOEA 3LT1A 2W8ZA 2Z98A 2YXPX 3AM5A 3IE0A 5BN5B 1BJRE 2L17A 3LVRE 2QBYA 2IP4A 2VUSA 1AB6A 4HJXA 3I62A 3X1WA 1WMEA 4BNDA 2J7KA 3U7GA 3QV2A 1KKLA 3JQFA 1QK3A 1VB3A 3CUVA 3NFYA 3QQ5A 4HLUC 5AKGA 1HEIA 1CDZA 5EIBD 5G0TA 5L4LA 2B7BA 2F59A 5IXJA 2YY5A 4JIGA 4D9HA 3ONDA 4H6WA 3ENZA 4ZYVA 1DQRA 3AL0C 1UT5A 1XAGA 2DKNA 2HGSA 3ONFA 3QBDA 5DVZA 1FTGA 1LQ2A 3FBGA 4W5JA 1VDZA 5F9FA 3CGWA 3AI2A 4DMKA 5FA8A 2ZSHA 1DTWA 3C0KA 1AMUA 1G5TA 3USZA 4KN9S 4EATA 1S2GA 2PX8A 3L8GA 4HXEB 3EPLA 4XDZA 3S27A 5B1YA 4XWTA 1LQUA 3FF1A 4KXFB 3I9V1 1OOEA 1ZQ1A 1JDVA 1UDRA 1CWUA 3QPWA 4TLDA 1O94A 1H8HD 2D8AA 3ICCA 3FSEA 3Q3IA 4Q7EA 5DTJA 3TJRA 4RUKA 4EI2A 4BVAA 5A4IS 4IJ6A 1A9RA 1RLJA 4MWSA 1H6AA 1U65A 2WPNA 2GI4A 1VPDA 1YULA 5J59A 5F23A 3OZXA 4GKVA 1M0SA 3IUPA 3D02A 3JZAA 3KKLA 4KRXA 5FJJA 4DMMA 3EA0A 3QU7A 4IXDA 5ECYA 4F4IA 1YR7A 2D0DA 3HL4A 4JT9A 4KR0A 2Q4BA 2VSYA 2VTKA 1CZRA 4N0PA 3R3VA 4JGGA 2VYVA 4JGIA 4OOFA 1MEJA 4AQYB 4FYIA 5E6RA 1FDIA 3M7IA 2ADFA 1IHUA 1O6GA 4QJ5A 4D3YA 4YLYA 2OHFA 3TSZA 1QFXA 1Z83A 2P30A 2MSDB 3OBIA 3BH6A 3A1UA 3PWSA 4BCDA 1TUGA 3GP3A 1Z5VA 1POXA 2FFQA 1VYUA 1UOOA 2JIQA 1BX0A 4YHBA 3DZGA 2EF0A 4FIZA 3H65A 4I55A 4CCWA 2IH2A 4B31A 1CC1S 4D9NA 1Y63A 3BK1A 1FQWA 3ROPA 2HBZA 2Y27A 4RZ3A 4JBYA 4AJIA 1UAAA 1CVRA 2AG0A 3OF2A 4GP7A 2QMHA 1F2TA 3IVAA 1ODJA 3ESRA 1PSDA 4NCKA 5ITZA 4H7IA 3ZDDA 1I30A 1Q2XA 4ZODA 3BD9A 1W0KA 1RC8A 2R5FA 3R7WA 2BM9A 4EABA 2FVYA 2PSEA 2UUCB 1O8CA 3GLGE 4P6VF 4D8WA 2BMJA 3L8YA 1ULSA 3ER9A 4B3DA 3R0JA 1CVIA 4AJLA 4B82A 1OKKA 3QXHA 2CYAA 2X4DA 3BL6A 3RS4A 1UBNA 1GCAA 3TQSA 2WMYA 1LPNA 3OESA 1JLSA 3OO0A 2GZ3A 1IPHA 4BUJA 4EJFA 1K8YB 4YNBA 2O2GA 4B1FA 4EVIA 5BW4A 4Y2HA 2IPNA 2P62A 2GBGA 5EMHA 3VRHA 4XLLA 1OWLA 5U1PA 1QZUA 1SXJD 4BLUA 7GPBA 4H1TA 2B8JA 3CEJA 2OPBA 4HAZA 4O1HA 1NOKA 4OH7A 2JAHA 2HH9A 1E61A 3BFXA 4LJ9A 1TOAA 4CV1A 4EKNB 3NAQA 5I3CA 2P91A 1RYHA 5AO9A 1JR4A 3ZE2B 3RWBA 2JGAA 3HB1A 4ZI2A 5FWYB 1P72A 1A9OA 3FPKA 4AJ1A 1IBSA 4LDAA 4KVFA 3RANA 3R5JA 5IWCA 1JHZA 4FB4A 3IAUA 4GSYA 4B0OA 3ED1A 3RF7A 4OKNA 5E6RB 1J8YF 5JSYA 3F73A 1E1QA 1YRWA 4LVOA 1PS8A 3S2FA 1UXIA 2OE2A 1ZXBA 2LE0A 2TMDA 2ZBEA 3NHSA 3DJYA 3OJXA 3PUWA 4FOSA 5DBGA 3CW8X 1E96A 5FPYA 5LP1A 5HOQA 1JQJC 2ID7A 4R41A 4Y9SA 3U4MA 4BMVA 2YDXA 1HM5A 3SD7A 1CUJA 1VJTA 4US1R 4BNIA 1T4CA 1U0EA 3OZUA 2VDOB 3P9CA 2H4ZA 4PC3A 2WU3A 4MS4B 4JVNA 3USCS 2EGHA 3A4LA 4Q93A 4RK7A 4X20B 4F92B 2HHAA 2OCXA 4LNUA 5TMBA 3GJQA 2IZZA 4P7GA 3UAVA 4X65B 5IZCA 3EDRA 5FNVB 3ZGVA 2QEQA 3K8YA 1OAOC 2XUPA 2NTYC 2Q2VA 2VF7A 3GFOA 4EQ6B 1JLKA 1IVSA 2KBFA 4KHPB 2R1TB 1P1FA 4I5DA 1BNCA 1JF8A 1VHTA 3DE4X 3K9FC 1KU6A 4EPYA 1ADBA 1NN5A 4F56A 4CG3A 1R16A 5J5AA 3IQEA 1RYBA 3K1YA 2ZI9A 3OP4A 4BE4A 1CQZA 2CJPA 4E08A 2IY9A 5LXTF 3B1XA 3NVAA 2OHOA 1TIBA 1JR3E 3EIOA 2C4MA 1DAIA 3X1KA 5ADWA 2N47A 2HHJA 5CPBA 1AGNA 2Z2XA 4AG3A 1LX6A 1KMNA 3A4VA 4KPUA 4Q1BA 3D7RA 4BMXA 4D3FA 5CXUA 4CKWA 1ZVKA 2IHJA 2OO7A 4E2WA 1FQJA 3IQXA 2JHCA 4RY9A 3WQRA 3QVSA 1EXMA 4BYMA 3NIBA 3PZRA 5KYNA 3AT1A 3WP0A 3NCHA 1JUDA 2Y2UA 3ETGA 3W3AA 4DSTA 3BFVA 3KIPA 4L51A 4XEHA 5F1OA 3SZMA 4DKXA 5DX1A 1QLJA 5ABPA 1T1EA 5I6DA 3RIYA 4Y0VA 1HQDA 2I2AA 2HF8A 3TLYA 4O5AA 3W1WA 2P75A 2B98A 4YRFA 1CY4A 4HDMB 1UJ2A 5IBRA 4P4NA 1RMQA 4KXYA 1OLUA 3ZS9A 2FMUA 1R6UA 1DP4A 4DLUA 1OWOA 4GVXA 3DNMA 2WHRA 3HCEA 4L8VA 1IN6A 1MA3A 2ATCA 2FP3A 1H85A 2ZJAA 1XQ9A 2M1XA 2R8OA 3C3WA 4IG4A 1IIBA 4YPOA 5A9SB 3DB1A 3EUEA 3K6RA 2MMCA 3U6KA 1IY1A 3FPBA 1USWA 4NHEA 4GE0A 3UPDA 4BRZA 1S7GA 1JMKC 1NMQA 4I6JA 3ZVNA 3S2IA 3A2NA 3UYLA 5JJLA 4ZCTA 1KI8A 2HDOA 3PNMA 5J40A 4LNUB 2NU6B 1ENZA 2KLHA 1CRQA 1FOEB 1Y98A 5CBPA 2DR0A 4OQMA 1GKKA 4TV9A 3WHIA 2N3ZA 3BULA 2GD6A 2WSLA 3AF4A 3OPYB 4WGFA 3MIIA 3K70B 1DRUA 3WRWA 4OQ4A 1YFLA 3B1FA 1GNSA 2Q9UA 1DBIA 3ND8A 4UBJA 2FDXA 5HIAA 3NH9A 1C29B 1KI7A 3CF0A 3TX6A 4P58A 5YASA 1NRJB 1JHMA 4PLGA 1K4MA 3IUJA 1D6MA 4N0DA 3GAMA 2W43A 3UN1A 3F67A 1AS2A 4DIBA 4GI5A 1PKEA 1Y8QB 5AIAA 4OXRA 2I4RA 1KAEA 1L1RA 2FW1A 3HV2A 4D4HA 4CM1A 3LDGA