4D72A

Crystal structure of a family 98 glycoside hydrolase catalytic module (sp3gh98) in complex with the type 2 blood group a-tetrasaccharide (e558a l19 mutant)
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
586
structure length
586
Chain Sequence
EVDKRREINNEHPLLMMPLYANGEEFNQGKYTFWGGDTLTGKWENIPDDLKPYTVIQLHPDDLPKRDGAARDFYEHMLEEAAKYVNPKTGKNEPIPVILTVYTAGNMPYHTSAHWLSTSWIDKMYQKYPNLHGIFSTASYWIWANDIENKAADYLKVSAKNGGYFIWAEQNSGSAIEKAFGKNGKIAFQKSVDKYWKNLIFMFKNTPAAEGNDSTTESYMKGLWLSNHTYQWGGLMDTWKWYETGKWKLFASGNIGKSQGDRQWLTEPESMLGEEALGVYLNGGVVYNFEHPAYTYGVNNKESLLFSEVIKEFFRYVIAHPAPSKEKVLEDTKVFIHGDYSNKGNGKFFVNVNTDREQTPLYMTGRYNVIPAIPGVLKTDKLKESVSSSRIQIKEITSPEFSSTQARKEYLNKLYPMNYEGDIFAQKLDNRWFVYNYKVNENVKQTGKLKFNSLEMNVEFEPHTYGIFERISNGLKVNLNNFRTNKDSLWSNAQDANQAKKLPQLTKKGAIKWIEEHYIKDTQFGEKRVTKIVLRGIDKLPTIHSLSGTNNSYDQPSLNFDQKNHMVTITINSNGNLEFELHFLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCOSIDE HYDROLASE
publication title Towards Efficient Enzymes for the Generation of Universal Blood Through Structure-Guided Directed Evolution.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 216
structure length 586
sequence length 586
ec nomenclature ec 3.2.1.102: Blood-group-substance endo-1,4-beta-galactosidase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08306 Glyco_hydro_98M Glycosyl hydrolase family 98
A PF08307 Glyco_hydro_98C Glycosyl hydrolase family 98 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.220.10 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Polysaccharide lyase family 8-like, C-terminal 4d72A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4d72A01
3.30.2330.20 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold family 98 glycoside hydrolase 4d72A02
3EBVA 1KQZA 4CKQA 4XUYA 2W4XA 1ODZA 3GBDA 4M24A 4HOWA 4MB4A 4JFVA 2QMJA 4HZ7A 3AIBA 1G1YA 5I24A 4RE3A 3CTTA 5JUVA 1RWHA 2WKLA 1RH9A 4E2OA 3MV11 5HXMA 2G4FA 1UA3A 3AROA 3ARYA 4GI6A 3WF4A 4XV0A 3GXDA 2ZUMA 1KFWA 2DIJA 3WDPP 3NSXA 2EPKX 4PCSA 1NOUA 9CGTA 2WSKA 4QAWA 4FLQA 4PTMA 2YA0A 1E70M 3EDEA 4R27A 4AEFA 3SCNA 4PSRA 1RWFA 1QNRA 4L4PA 3AIWA 4RE4A 4D6EA 3WSUA 1W32A 1DWAM 1MW3A 4EK7A 2VR4A 3ZOAA 4H8VA 1HJUA 3HN3A 1LXMA 4HZ8A 1R85A 4MNLA 1QNOA 1TA3B 2W67A 3WELA 4B15A 2DT1A 3EYPA 3SCOA 1XC6A 1OWQA 3FY1A 1CXLA 3L4YA 4AWEA 2XVGA 4HTYA 4FLOA 4J28A 1ECEA 5BYWA 2JIEA 4CU6A 3OZPA 1RPKA 3M46A 4M8UA 2BY1A 3ZQ9A 3PZMA 1LL4A 5KZ6A 2GVYA 5A2AA 3OLGA 3CUJA 1HMWA 3LPFA 3MANA 1CXIA 4TVUA 1UR4A 4XZBA 3BLKA 1CGXA 5DF0A 1KGUA 3VDAA 4HU0A 4UZSA 3O2LA 1QBAA 3WF3A 3AIVA 3CZJA 1PIFA 3VNZA 1W1YA 2VR5A 1QW9A 4DWSD 3T0DA 4M1RA 2BVDA 3MMWA 3NYDA 1BYAA 4JFUA 3OIHA 3CBWA 1HN0A 1FFQA 3MUIA 1XYZA 2CEQA 3T09A 5BXPA 1GJUA 4AY1A 4EANA 4LYPA 1TVPA 3ZJ8A 3RM9A 2J47A 5DT5A 3WH5A 1EO5A 4Z2IA 1OCQA 3MS8A 1NARA 1XSKA 2YDQA 3BSGA 1R7AA 3CGTA 4M80A 3ARZA 5GPRA 2WDAA 1EDTA 2J7GA 2VOTA 2EPMX 5A8PA 5FL1A 4CGTA 4EAMA 1JAEA 1VEMA 3VUPA 1UD2A 2Q8XA 4W7VA 3WQWA 1B3ZA 1UWUA 3M07A 2V5DA 1US2A 1H1NA 3QGVA 4B3KA 2CESA 1BAGA 1BSIA 1EDQA 4P7LA 3VIKA 4E8CA 3AFBA 4FK9A 2UY5A 1HJSA 1JFXA 4QLLA 3LPOA 5ABFA 3GM8A 2CKSA 4M56A 3WUBA 5HPCA 2WC3A 3SUTA 2ZE0A 3BSHA 2WXDM 4DUXA 3S6TA 3U57A 4AXNA 3GH4A 4UZUA 1G5AA 4E4PA 1W3HA 1RW9A 3WNOA 1OSEA 1UYQA 5JIWA 1KR0A 3AS2A 1C92A 1K9EA 3FW6A 1E6SM 1J0YA 4JFWA 4NSBA 1GPFA 2GK1B 4TXEA 3W81A 1CYGA 3RDKA 1UHVA 3CZ8A 3A4XA 1ESWA 4OOZA 1JYXA 3FAWA 2AOSA 3THCA 5CGTA 2E3ZA 4PMRA 1OBAA 3CO4A 1UH3A 5E6YA 2WVSA 7A3HA 3N04A 4TX8A 2BY2A 3OA5A 2V3DA 4GKLA 1CXEA 1KQYA 3RO8A 2F2HA 1XCWA 2HVMA 1JYVA 1EGUA 1W9BM 1LL7A 1JXKA 1X1HA 3T0AA 2J8GA 2XM2A 3VDCA 1XYFA 5E70A 1HKMA 1UD4A 1XRVA 1FH8A 3BMVA 1PEZA 3L4TA 3EDDA 1CWYA 3VMNA 1VENA 3MUY1 1GOOA 3SCSA 4H7VA 2OWWA 4AD4A 2X0HA 2EXOA 3WD2A 3MV01 1IV8A 2EPLX 4H8UA 3DHPA 5CPSA 2J8FA 1NWRA 1XH1A 1H4PA 3AHVA 1IZJA 3L4UA 3HJEA 3WEOA 2ZUTA 3K1DA 1EQCA 1US3A 3N18A 4NRRA 4UQCA 2D0GA 1EA9C 3EMQA 4FMVA 4TVDA 3VILA 1OJPA 1M03A 5CGMA 2DGAA 2D24A 2ZXQA 2CXGA 3BAKA 2NT0A 1OGBA 4PTWA 4P8VA 4IUGA 4UFMA 5IFTA 5FCZA 3F5KA 4QLKA 4HOXA 3GNOA 3IAQA 2YIHA 3SCPA 1X6LA 3W29A 2XG9A 1CLXA 2WWDA 2XTKA 1SMAA 1HN1A 2PBGA 2ZX5A 1XH0A 4W7WA 3WENA 4C7DA 1V03A 2FH6A 4HMEA 2V38A 3TP4A 3GZAA 1G0CA 2YA2A 5A6BA 1OGGA 1LQ0A 5FD0A 3T2QA 1BYCA 3POHA 3VIIA 3VM5A 1JNDA 5DMYA 1JZ7A 2WKGA 2ZWZA 2WWCA 2PWFA 1V6VA 1BPLB 3DYMA 5EBAA 4BQ3A 2J4GA 2XHYA 3M6DA 3MO4A 3PTKA 3AHYA 2VX4A 3UR7A 5LA1A 3UG5A 2V3FA 2UY3A 4JFTA 1JZ4A 4XB3A 3CLWA 5I23A 2WHKA 2D0FA 4PSPA 5A8NA 5IHRA 1KWGA 1H41A 2WANA 3CZGA 4U33A 4GZEA 3AIRA 3OB8A 3UERA 5DO8A 2XVNA 4AD3A 2XYLA 4D71A 1TZ7A 3DYOA 2J25A 4M82A 4PMUA 1BYBA 1JYNA 1UOKA 4HP5A 5A8QA 1WE5A 4P7QA 1V0KA 4J3XA 2D3NA 1WNOA 2C8NA 3AZTA 3BH4A 3CH9A 4ATWA 4P8XA 1WDQA 4Z2GA 4GO8A 3AMDA 3U7VA 1PZ2A 2ZUNA 3WQ8A 1GCYA 3ARVA 3K46A 4UFKA 3WF1A 3FHQA 2PF0A 4J3SA 2O9PA 1GOIA 2WMIB 1MW1A 5A1AA 1NQ6A 1MQPA 2EBNA 1ZBWA 1G94A 4CCCA 3FXYA 4LXFA 4AD1A 1H49A 6CGTA 2VRQA 1Y7VA 1EQPA 1QOXA 1XH2A 2OYMA 1UR9A 3KE0A 2J78A 3KEHA 3WKZA 3ZO9A 2VVSA 4J27A 2E8YA 4F9JA 2E9BA 1CNVA 4PUDA 5HPOA 2OWCA 1MW0A 3BMWA 3WDJA 3E1F1 8A3HA 3CZKA 1UH4A 5LA0A 1ZU8A 1NM9A 2EJ1A 5I0DA 3WH9A 2X03A 3AIUA 3AS0A 1W2VA 3WD3A 1Z32X 2XGIA 2J75A 4AISA 4NF7A 1J0IA 3G6MA 3AMKA 1QVBA 2RGLA 3ARRA 4PN2A 1ISYA 4QFUA 5E6ZA 1JI2A 1E6QM 2AAAA 2WLZA 1CGYA 1GJWA 3VIOA 4BQ5A 3N13A 3WH6A 1ODUA 1ZL1A 3WQ6A 1OIFA 2A3EA 1CGWA 1HX0A 4L4OA 3GBEA 2G3IA 3AOFA 2XSAA 3VGGA 3WFZA 2D23A 3N12A 3AJ7A 2VURA 5TD4A 3UR8A 1UH2A 3OGSA 4MB3A 3OLIA 5BRPA 1KR1A 1C90A 1GW1A 1J9YA 3NIYA 3N11A 3W26A 1FFRA 1J0NA 2ZUUA 1EDGA 5E0FA 1J11A 1J0HA 4LPCA 3ARQA 1I1XA 2DSVA 1R86A 1E3ZA 3WBAA 2BRVX 4CD8A 2WMJA 3CHFA 4LX4A 3UETA 4U3CA 2XJ7A 2Y2WA 1UKQA 1MFUA 4D6JA 2FHFA 5LA2A 2DH2A 2YL9A 2ZX8A 2WMIA 3IJ9A 3ARTA 5ABEA 1MFVA 1JI1A 3VGDA 2WSPA 1KGXA 5BCAA 1JXJA 2FGZA 1E6RA 1UR2A 2X0YA 2EEXA 1N7OA 2XIBA 4PYSA 4NRSA 1QPKA 2CBJA 2XUCA 3A47A 3AXXA 3BAYA 2CBUA 5A95A 4OBSA 1GQIA 1X1IA 5JIPA 3MUZ1 1UWSA 2WVVB 3NSNA 1LWJA 1RD6A 1NH6A 3FNDA 2XGBA 3W27A 1KWKA 1E6XM 3BAWA 1UG6A 1HVXA 5A6SA 5GQBA 1Q6CA 3GXFA 4PBGA 1V0MA 2DT3A 4CN1A 2Y8VA 1KGWA 3B9EA 4KGJA 2A3BA 5D4YA 4W8AA 4M81A 3J7HA 4GIAA 2O9RA 4AZIA 3VIHA 4HA1A 4YHGA 1I75A 4EE9A 1WZLA 2UWFA 3KZSA 1JZ2A 3L4VA 3WDQA 1F4HA 1B30A 1W3YA 5CQ1A 3K8LA 2X09A 4WSKA 3THDA 2BNJA 4ACZB 2VQTA 3PZVA 5A6LA 1UWRA 1NWSA 1XSIA 4JAWA 3VGBA 1GHRA 1X6NA 3WEMA 2ZUVA 3MMUA 2V3EA 4AIUA 3FN9A 5IXEA 2J79A 4TX6A 4HA3A 4AIOA 1TVNA 4OKDA 1JF6A 1CGUA 4P8UA 4H2CA 4CVWA 3NDYA 3OGRA 4JKLA 3LPGA 5DEZA 3MMDA 1E4IA 1W3KA 1CZ1A 2E8ZA 3T2OA 2QPSA 3B9AA 3WIJA 3VIMA 1RP9A 3AXIA 4UQEA 1V3MA 4V28A 2HISA 4LYQA 2WZHA 1E6NA 3PBGA 2VO5A 3RMEA 2VI0A 1I8QA 3SUUA 2F61A 4MNJA 3CUGA 3HMCA 5GNZA 4V2XA 4JZ5A 4WKAA 4AZGA 4MPKA 1OD8A 3AYSA 3ZMRA 5I78A 3VMPA 2VX6A 4D6FA 4DUWA 2WCAA 2CERA 5ECUA 1M7XA 1A3HA 2BHYA 4JL2A 5A69A 3K4AA 4PMXA 1UD5A 3MKKA 3AI0A 2DT2A 1JZ8A 4M29A 3BLPX 2Z1SA 1E1EA 3QOMA 4CN6A 1ZB5A 1V0NA 3AHTA 3AISA 3ZIZA 4D6GA 4LQ1A 1E0VA 4Z2LA 2ZIDA 1GQLA 1KBBA 4CD7A 1E56A 3KL5A 2X1IA 5F7UA 4AEEA 2QF8A 1EOMA 4X9YA 1SYTA 2G3MA 4PRWA 1HP4A 3CIVA 4DM1A 1QHOA 4Q7NA 3TONA 4ZXLA 3CMGA 1E5NA 3K8MA 2D3LA 4TOQA 3W0KA 4ACZA 1BVNP 2WZEA 3WUGA 5CLTA 1AMYA 2D22A 1VFUA 3G6LA 3SURA 1PZ3A 3N9KA 1CEOA 1KXVA 2WAGA 3VIPA 4X0NA 2OWXA 1QNPA 2D1ZA 4U3AA 1H0GA 4UQDA 5A6MA 7CGTA 1D3CA 1TA3A 3SCUA 1TUXA 1E43A 1KCKA 4PMZA 4H8HA 2IXUA 4AZBA 3GNRA 2JFEX 3WD0A 4HMDA 3RJXA 1HJXA 1GHSA 3W4RA 1Q6GA 1QW8A 2VRKA 1QI0A 1NWTA 5KEZA 2WC7A 1FHDA 1WZMA 5GNXA 3AZSA 2BY0A 4V27A 1CXHA 4LGXA 2WB5A 1B3WA 3TOPA 3WMBA 2G3NA 1GQJA 1C82A 1OINA 3QHMA 2EPNA 4JHOA 2GUYA 5FIPA 4W7UA 2XPKA 4ZE5A 5E9AA 2DDXA 4C7GA 4OIFA 2O92A 5D8WA 1V02A 3IJ8A 3SEPA 3CUFA 4D1IA 3T0BA 4J3WA 1AVAA 1K9DA 5CJ5A 4AC1X 1FA2A 4UOZA 2VVNA 1C91A 1BQCA 1XHGA 1B90A 4FF5A 2WW5A 3S2CA 2QPUA 5AC4A 4BZYA 2ZX7A 3WH8A 3CPUA 2YLAA 3ARPA 4UR9A 5C8BB 2PWEA 1W9PA 2FDMA 5I6SA 4AD2A 5D8ZA 2YLLA 4PEEA 2C0HA 6TAAA 1TCMA 2WMKA 4MAVA 2DPEA 4PMOA 5DT7A 2BS9A 4P7RA 1KB3A 3WEZA 4DWSB 1E40A 1JGIA 4AD5A 3VOCA 3VDHA 1TR1A 5LYRA 3EDKA 5EB8A 2WCOA 4OOUA 2PI6A 1GVIA 2JEQA 2WHLA 3RJYA 4OJYA 3BAIA 4DM2A 3QR3A 3OG2A 1AQHA 1DHKA 3VKKA 4TVCA 2DSKA 1JNEA 1ZJAA 3TTQA 1HF6A 5AYIA 1FP8A 1E71M 1NOFA 2OYKA 1UD3A 1CB8A 5M5DA 3A4WA 3EDFA 1YQ2A 2JALA 1XD1A 2J7HA 3ARXA 3T2PA 3F5JA 1QI2A 2WBGA 2RGMA 1M53A 1W3JA 3VIGA 3ZJKA 3VGFA 3CHDA 3MUAA 1IZKA 2WZIA 2GK1A 1J0JA 3ARWA 4D6IA 1LL6A 2J7FA 1U33A 3ZR6A 2GSJA 4MB1A 1E9LA 4F8XA 5E0CA 1JDAA 1HKKA 1UUQA 4AZ5A 2XVLA 3VTRA 1GNXA 4URIA 1J01A 3F5LA 3UG4A 1G01A 1M01A 1E3XA 3VGHA 1XGZA 4ATLA 2VT0A 3PZIA 1W9VA 1ISXA 2XWDA 2ZWYA 4B3LA 3LPPA 3A6OA 4PTVA 3TTOA 4FLRA 4KH2A 3SUVA 1E0WA 1W91A 3N1AA 2V3GA 1O7AA 1GOWA 1BGGA 2JF7A 1GUVA 3GXMA 1E1FA 3WH7A 4AZ6A 1K9TA 3WQVA 3NUKA 2DSUA 4DWSA 1OJOA 4BQ4A 1XCXA 1ISZA 1BVZA 2F8QA 1V6WA 3RM8A 5JBEA 3AHZA 1E6ZA 3GTNA 3VX0A 4WIWA 1UR1A 2UY4A 1JZ6A 3ZSSA 2J7CA 4HMCA 1H0IA 4P7OA 3W28A 1N82A 3AQUA 1NP2A 2BHUA 3L4ZA 1HL8A 2CITA 1PPIA 4PCTA 4PMDA 2VQUA 4UOJA 1MQRA 1WPCA 2YDSA 3BCDA 4XX6A 4NZCA 3ZR5A 5I77A 3I3BA 4AZHA 1CLVA 2XVPA 1HL9A 1W1TA 3CUHA 2XFFA 1HKIA 4WJXA 3EDJA 1KXHA 3WNMA 3K8KA 1W1VA 4D6CA 3WMCA 4OZOA 3II1A 1DWHM 1F4AA 4W5UA 1HJQA 1JL8A 1V3HA 3W6LA 4IPNB 1UZ1A 2ZXDA 3SCVA 1J0ZA 4W84A 2BVTA 2NW0A 1VBUA 4W8LA 4S3KA 3NJ3A 3I3EA 1J0MA 1H5VA 3TTSA 1EHNA 3IANA 4C7FA 3UCQA 1PAMA 2D20A 4U5KA 1J0KA 4LYRA 5A8MA 4WKFA 3WFLA 1OIMA 3VU2A 1MXGA 1E73M 1WZAA 4TTGA 3TA9A 1TG7A 2X8RA 1A47A 2WHMA 3ARSA 4MB5A 1MWOA 4D72A 5D9NA 1MYRA 1G9HA 1CENA 1QHZA 1JG9A 2G8ZA 4UQBA 1V6XA 1UD6A 1Q4NX 4HA4A 2GJXB 2WK2A 1EH9A 1WDRA 3VINA 1MXDA 4UFLA 1M04A 3UG3A 3CMJA 1B1YA 3WBEA 3O9NA 5AY7A 2DIEA 2X2YA 1BTCA 1JF5A 1FH9A 1BFNA 4BCEA 2Q1FA 1EGZA 3JUGA 4AMCA 4U2YA 2VZOA 1Q6FA 3B9DA 4CD6A 2JIWA 2XWEA 3WNNA 4D6HA 4MADA 1N7PA 4ZE4A 3ZT7A 1JZ3A 1JAKA 4YPJA 2QMKA 3OLEA 5C71A 4BS0A 4AYSA 1U30A 5D9MA 2E24A 2A3HA 1R87A 1TE1A 2VZSA 1YHTA 3BGAA 5C70A 4UFJA 1BF2A 1VF8A 4ZENA 4GZIA 2ZX6A 3U5YA 4P7NA 5FOOA 1DEDA 5CZKA 5M03A 2W63A 2WVUA 1EOKA 1HIZA 4PUEA 2GFTA 3AS3A 2ZXAA 4EKJA 4MNMA 4KRUA 2YBTA 1E55A 3WDRA 2YJQA 3GNPA 4RE2A 1V3IA 1VB9A 1HT6A 2AMGA 1EIBA 2QHAA 5A2CA 2G3JA 1V3JA 1RWGA 1WAWA 3RILA 4UTFA 2XVKA 2WM0A 2ZUSA 3NCOA 3SCRA 2BRPA 3PZQA 1ZJBA 3AHXA 3A3HA 3GYCA 3VIJA 1VBRA 2VJXA 1X1JA 1XSJA 4ML4A 4ZFMA 1OT1A 4R5EA 1E15A 1UQZA 3AS1A 5I5RA 2B31A 1PIGA 2IUZA 1JZ5A 1PX3A 2VX7A 1X1NA 2GJXA 2VL4A 4UNIA 4JCMA 5I79A 2C7FA 3AIQA 1W2PA 1UR8A 3AYRA 3BXWA 2CETA 5M17A 4S3JA 1F9GA 3CHEA 4MDPA 3AICA 1TMQA 2PWGA 1JDCA 2ESCA 2QLYA 4H04A 4W85A 2VTFA 1E4LA 2J62A 2VNCA 2BXYA 4AD0A 3HU7A 1HM2A 1UZ4A 3WNKA 1CBGA 1SR0A 1K9FA 2FGLA 1MQQA 1OD0A 2QV4A 3ALGA 1V3LA 2BXZA 4U5IA 3ARUA 2GDUA 5EMYA 2V5CA 4Y7EA 1I1WA 2ZXBA 3PTMA 4YN5A 2W5FA 3IJ7A 3WDHA 2W91A 1HJVA 1LG2A 2EPOA 1LLOA 5GNYA 2VZVA 4Z2HA 3BCFA 1FP9A 1LG1A 4UQAA 4QCFA 2XFYA 4BQ2A 2CBVA 2Z1KA 2WMGA 1HKJA 4W86A 2WVVA 1HNYA 4CUCA 3WUFA 1RWAA 1H3GA 2WPGA 2JF6A 3N17A 1HMUA 1UWQA 2MANA 1C7SA 3SUSA 5A6BD 2WLYA 1KCLA 1VFMA 5ABFB 2YKKA 3AMCA 1QI3A 4F79A 4Q22A 4JHZA 2NSXA 1B31A 5E09A 3T08A 3W25A 3RIKA 2A3CA 4JCLA 1TFVA 1ISVA 5I3DA 4YHEA 1VJSA 1DP0A 1W9DM 3AIEA 2JEPA 3VD4A 3F4VA 2J7BA 4J3TA 2DQXA 3OLDA 4J3VA 3PZTA 2X05A 4MJ4A 3MSGA 2VUYA 4WLCA 5A6KA 5HBFA 1MVYA 2PB1A 5CG0A 4CD5A 1HP5A 3VD5A 1E72M 5BRQA 5A8OA 1V02E 3WNLA 3AZRA 1VFOA 4AZ7A 3DYPA 1R7OA 3ALFA 4GPNA 3IK2A 4H41A 4QCEA 2PWDA 3O6AA 4TTUA 1V6YA 1BLIA 1R8LA 3WD4A 1U2YA 4WK9A 1CGTA 1S46A 1FHLA 4CVUA 1CXKA 2E9LA 4W5ZA 1L0PA 3WMSA 4AZCB 2BVYA 1E0XA 1WZKA 1GZJA 2O9TA 4GO9A 1UWIA 2O9OA 2Y5EA 1B2YA 2VZTA 1E6PA 1LOHA 1H2JA 1W3LA 1D7FA 3PZNA 1C8XA 5A2BA 4PTXA 3RPMA 2YL5A 1P6WA 1HVQA 1WO2A 4WF7A 5BXTA 5IFPA 1LWHA 1KXQA 1EO7A 4IISA 3WY1A 3K4DA 2DEPA 4ZXOA 2D0HA 1GONA 1OT2A 3AMGA 2NT1A 3ZM8A 4W89A 3UEQA 1OGSA 2GJRA 2VC9A 1NP0A 5ABHA 2WC4A 5AC5A 1WCGA 5FL0A 3U7BA 2WCGA 1B3XA 3PZGA 4N42A 1Q6EA 2ZOXA 5D9OA 2VMFA 4UOQA 4WSJA 2CBIA 6A3HA 1N7QA 3ZT6A 5IHSA 1C8YA 5CSUA 4GQQA 2EQDA 2J7EA 1AQ0A 4XZWA 1H09A 1V08A 1KBKA 1C93A 2CYGA 3APGA 4B16A 5BROA 3ZJ7A 2PC8A 1UKTA 3WDIA 4J3UA 3VD3A 1NWUA 3VX1A 1OJMA 2W61A 5HNNA 3ZT5A 3VGEA 1N7NA 1NOWA 3MU7A 3N15A 4GXPA 2WHJA 3GXIA 1VJZA 5CSYA 2W62A 3CUIA 1GOQA 1DWJM 3FHAA 2J74A 3L2LA 3WF0A 4E8DA 4AZCA 1V3KA 2E40A 3EMCA 3TTYA 3WF2A 2PWHA 3WQ4A 1WDSA 4HOZA 3M7SA 1D2KA 3CZLA 1QNQA 1CTNA 4DUVA 2YOCA 1CGVA 3VD9A 4PMYA 4IPLA 5EFDA 4A4AA 5CPTA 3PTQA 4W87A 3W24A 1DWIM 3WUEA 2YBUA 3RM4A 3LMYA 1PX8A 2TAAA 1JFHA 4BF7A 3QHNA 2WYSA 4IM4A 1CECA 4PMNA 3GDBA 4GI9A 1UD8A 3W82A 1ITCA 2UY2A 4HU8A 3KL0A 4JKMA 1UKOA 1V6UA 2DT0A 4GZJA 5I2UA 4QDMA 2BV9A 1QI4A 1XV8A 2OLHA 2ZICA 1Q6DA 3PZOA 1BGAA 1JYWA 4ATDA 1UKPA 4Z2KA 1CIUA 1KXTA 3D3AA 3NSMA 1WP6A 1GVYA 1SFSA 2CHOA 4CU7A 7TAAA 1AQMA 4MJ2A 2CPUA 3OGVA 4KWUA 2XFRA 4U31A 2FHCA 3KL3A 2IXVA 5EFFA 3ZJ6A 5CLWA 2FHBA 1C8QA 3VDBA 2GJPA 3L2MA 2OSXA 4Z2JA 2WBKA 5IDIA 3VM7A 4RL3A 2E0PA 4W88A 1C3FA 4QP0A 3SCQA 1BHGA 2PBOA 3QHOA 1GOMA 1J12A 4X0VA 4W93A 1B0IA 4PMVA 2Y8KA 3DHUA 4F66A 1LJYA 5JBDA 3BAXA 4CN4A 3SCTA 3CZEA 2CNCA 1B9ZA 1VEOA 3SIMA 3I3DA 2ZUWA 3WN6A 1QBBA 4MAZA 3W53A 5A6JA 3BC9A 5JBFA 1VIWA 4KRTA 2YL6A 1E4MM 1UKSA 3W6MA 2Y4SA 5CXPA 1GORA 3A4AA 3W37A 2J7DA 2GDVA 2OSYA 1WDPA 2YA1A 1V0LA 1CPUA 5A94A 4WKHA 1FOBA 1ITXA 1VRXA 1VEPA 1FH7A 1UR0A 2E4TA 2EO7A 1PX4A 2ZX9A 5DFAA 1QNSA 1DTUA 2W66A 3WL0A 1N7RA 1B3VA 3ECQA 2CIPA 4U2ZA 3WNPA 1ISWA 1PJ9A 3KWXA 4AW7A 4ZEPA 3NDZA 3GH5A 1B3YA 3VPLA 1HJWA 2YDRA 4N0RA 3WQ5A 5FKYA 4NI3A 3U5UA 3ZSTA 1ZS2A 1GOKA 5D9PA 4CD4A 1L8NA 1J18A 4D6DA 3PZ9A 3SUWA 3VNYA 4OUEA 5A3HA 1LXKA 4GINA 1XD0A 1UQYA 1WKYA 1UA7A 4QLJA 3W38A 4HPGA 4UCFA 1JDDA 2WNWA 1VAHA 4UFHA 5HDRA 3CHCA 4OBRA 2D2OA 5BWFA 1E5JA 1CDGA 2FH8A 1JD9A 1H11A 1WB0A 4BA0A 2VZUA 3PN8A 4ACYA 1JIBA 4P8WA 4FLSA 1O6IA 4W8BA 3PHAA 1EHAA 2CHNA 2OSWA 4A3YA 1PBGA 4A3HA 2WMHA 1JD7A 1W9XA 3BAJA 4DWSC 4PMQA 4CCEA 1LF1A 4MDOA 3VD7A 4JL1A 3WD1A 2BFGA 1HXJA 2WVTA 4CCDA 2VCCA 1DWFM 3D5HA 1W1PA 4K68A 5BXSA 1GQKA 4HZ6A 3AXHA 4J7RA 4B9ZA 1HM3A 3DECA 3VMOA 2WMFA 3AMLA 1IT0A 3IAPA 4UFIA 3DC0A 2XIIA 2YL8A 4GI8A 2JE8A 3QOKA 4AIEA 8CGTA 1ZBCA 4JIEA 3RCNA 5M3WA 1OJNA 1VFFA 3POCA 2CKRA 1K6AA 4MNKA 3EMZA 3OZOA 3L4XA 2WCSA 1OB0A 1J10A 4KMQA 2VCBA 2DSWA 2CCRA 4CU8A 2BY3A 4JKKA 5CPQA 5AYBA 1C7TA 3OBAA 1CXFA 1BG4A 2VX5A 2G41A 3PZUA 5ABGA 2E9MA 3GH7A 3L4WA 2XSBA 1F1SA 3MSDA 2W92A 1W9UA 2A3AA 3UESA 1QI5A 1OM0A 1EXPA 1RP8A 4KGLA 2DH3A 1ZBKA 2XM1A 4GQRA 3B8SA 2Y24A 1UWTA 3VVGA 4TUFA 3VO0A 5HOSA 4UQ9A 4JFSA 2DSZA 2VRJA 3WL1A 4D1JA 3SCWA 4F9DA 4HPHA 1QHPA 1SMDA 2BHZA 2BRWA 1ZBVA 1BG9A 1DWGM 5BXRA 4MTVA 2OYLA 1RWCA 5A6AA 1BYDA 1E4NA 2J77A 2VCAA 2E22A 4B9YA 3VIFA 1MW2A 3FAXA
chains in the Genus database with same CATH superfamily
1SZFA 1MUCA 4CKQA 1ZCCA 4J35A 4DXVA 1Z42A 4M6PA 1SZGA 4M24A 4FALA 3KHDA 4JFVA 3G1XA 2QMJA 4KFNA 3F59A 4H7CA 1SFTA 4IFKB 1FKXA 4JTUA 1U22A 1UA3A 1AJZA 4PFHA 3GHUA 3HG2A 4EF9A 1MEHA 1ADDA 3GXDA 2ZUMA 2Y63A 4PCSA 1NOUA 4C1KA 5FSEC 3VNMA 4GVIA 4PTMA 3IIPA 2YA0A 4E4FA 1E70M 3M5ZA 4AEFA 3IGXA 4PSRA 2FVMA 1YE4A 1OX4A 2H9AA 3ANUA 2Z24A 4EK7A 5C0QA 4H8VA 3LZ3A 1LXMA 4HZ8A 1TA3B 1VFHA 2DT1A 1XC6A 4JEQA 4YWIA 4HTYA 4X2PA 1MUWA 1ZALA 1H61A 5HQEA 5BYWA 4H00A 4CU6A 4LUYA 5K7JA 2FB2A 4PRTA 3MHUA 3PZMA 4MJMA 2GUBA 2PRMA 5KZ6A 4IICA 5FACA 1D3HA 4FX8A 3KVJA 4Y9MA 2PMQA 4WRHA 3OLGA 2KXSA 3OJGA 5I3IA 4DJFC 3PK7A 3KOZA 1PTGA 5DF0A 3QSTA 3KFTA 3O2LA 3WF3A 1ZCOA 4NNAA 3CZJA 3UZZA 4FP1A 2VD8A 3VNZA 2O4MA 4M1RA 3PANA 2BVDA 3ITGA 3MMWA 3NYDA 4ZVJA 1BYAA 4JFUA 4Q33A 3OBEA 5CZTA 4IGSA 4ADSA 3HV8A 2GJNA 5BXPA 3EA3A 3WLHA 2VENA 4YYCA 1UP2A 1TJ0A 1B4EA 2J47A 5DT5A 3WH5A 1AZ2A 1A3WA 1QFEA 3GDMA 4H9ZA 4JQ3A 4AX6A 3H24A 2WDAA 4K8EA 1YBQA 2ZZ5A 2Y0FA 4AXKA 1KRBC 4NJKA 2IPWA 1UWUA 5FJOA 1H7NA 1H1NA 4B3KA 4EPDC 1BSIA 4P7LA 4E8CA 3AFBA 2UY5A 2ZRWA 1HJSA 4QLLA 1QJWA 4M56A 3PBUA 3M5YA 4KETA 2BDQA 5G2WA 1BKHA 3GSMA 2WC3A 2ZE0A 3SGGA 2WXDM 4DUXA 3S6TA 4MHBA 4AXNA 4UZUA 3TVAA 3T4WA 1AD1A 4DEFA 3AS2A 7ODCA 4XSMA 3BG9A 3EX3A 4TXEA 4PB4A 1PHWA 3NEHA 2V5JA 2EKGA 3E02A 1Q45A 3BUVA 1JQVA 4REQB 4C6EA 2QEZA 1OBAA 3EWYA 2D69A 2BY2A 3N3TA 3OA5A 5E5CA 1KQYA 1F3WA 4A05A 4Q4KA 3L21A 1XI3A 2PDGA 1LL7A 1JXKA 1SPQA 1EJUC 4LAOA 2C91A 1HKMA 3TCEA 4FIRA 4OUIA 1QT1A 1R0MA 2H3BA 1FH8A 4Q4MA 1Z8AA 1A5MC 3GO2A 3K30A 3VMNA 1F5ZA 3H4WA 4H7VA 3JR2A 2X0HA 5K9DA 3BV7A 2EXOA 1NWRA 1IZJA 3RR4A 3HJEA 4WXZA 1BF6A 1EQCA 3TZNA 1WBHA 3N2XA 2C18A 4ILSA 4ZR8A 4N9EA 4GJIA 1OJPA 2OELA 2DGAA 4QS6A 2OOFA 1YYAA 1OGBA 2VFGA 4LANA 2TMDA 1JCJA 5IFTA 3ONCA 2VD9A 5I09A 2V4IB 3USZA 3U2CA 1CI1A 1R2SA 1NF7A 3UFYA 3S5ZA 2XTKA 1HN1A 1VFLA 2ATMA 3S2MA 2NXGA 4IPJA 2PD9A 3OTRA 1V03A 3TP4A 2HBXA 5A6BA 1LQ0A 3C86A 4A3QA 3VE9A 3B3DA 4NNCA 1JZ7A 1XRSA 1RHCA 3GUWA 1BPLB 3M6DA 4O18A 2FDSA 3M0HA 1VYRA 2ZDSA 3UR7A 2V3FA 4LYKA 1TE6A 1ZQ5A 2I5GA 4XB3A 2D0FA 5IHRA 4B3ZA 1H41A 3V35A 2PDNA 1JCLA 1A5NC 2Y7GA 2XVNA 5F2GA 3W7OA 4GYJA 2ADAA 3MKVA 2H8ZA 4UCGA 5HULA 1RY0A 2J25A 1BYBA 4GQ0A 2DZVA 1UOKA 4O8AA 3CU2A 3RPTA 2Q8ZA 2E77A 5A8QA 2TYSA 4P7QA 2QCMA 1O4UA 3AZTA 3BE7A 4QSFA 3E0FA 5H8MA 5BOEA 4UFKA 2FJKA 2Z25A 2I57A 1MQPA 3BTNA 1JPDX 1G94A 4OTKA 4LXFA 4DJDC 1PHQA 4Y9NA 1I60A 1R38A 1Y7VA 2PGFA 4Z1BA 2GWGA 1F05A 3LLXA 2ZCGA 4K36A 2J78A 1LLWA 1OFBA 3WKZA 4J27A 5EMMA 3HPSA 3K2GA 3NFUA 4NXSA 8A3HA 1UH4A 1W8GA 1NM9A 2EJ1A 5LNVA 4LUTB 1W2VA 4H3DA 2QJNA 3WLOA 5EMUA 3WD3A 3WQDA 1GEHA 4NF7A 5GJNA 2BGQA 5EMKA 1QVBA 2R24A 2RGLA 3NDOA 4AWSA 1DBTA 4PN2A 4QFUA 2ISSA 1JI2A 3G18A 2GGIA 1I2RA 4BQ5A 1AH0A 5BZAA 3N13A 3KBMA 2WJFA 3FVDA 3WQ6A 1CGWA 2PDPA 3GBEA 3GG7A 3E12A 3MCMA 3VGGA 4C5ZA 3KW3A 3ABXA 3P80A 1GYLA 3C0QA 2PTXA 2FVLA 3TW9A 1TZ9A 3W26A 2WZTA 1J0NA 5HMFA 4GJJA 4LPCA 5HQMA 2YCLA 2DSVA 1R86A 2BX7A 2BRVX 3UWVA 3L2IA 4PULA 2OTDA 2Y2WA 1MFUA 3RFAA 4XZIA 5KITA 3BLOA 3IJ9A 3I4KA 2PEVA 5M1TA 3IV8A 1U1JA 2X7WA 5BCAA 1JXJA 3QV6A 1W0MA 3ID7A 4NASA 2X0YA 2EEXA 2FVKA 2XIBA 1FX6A 3BAYA 4OBSA 1GQIA 1EFZA 5LNSA 1K02A 3EXRA 3NSNA 3VNKA 1VRDA 4IMCA 1F9CA 5LSMA 3DFPA 3REQB 3BAWA 5XINA 3H53A 5GQBA 3LZ5A 2GJLA 1PO9A 3NA8A 3SADA 5JXQA 2OXNA 3NNTA 4PTDA 2YXXA 3A4JA 4HPJA 4O4WA 4M81A 2W6RA 3LN3A 1MEIA 4LCQA 2O9RA 4AZIA 4UTHA 1XX1A 2XDFA 1EP1A 3BW4A 2UWFA 3PY2A 4Q8TA 1Q4WA 3KP0A 3K8LA 3WLLA 5A6LA 5CBIA 1UWRA 1XSIA 3GIPA 4JAWA 1NSJA 4Z17A 3VGBA 5FAJA 2V3EA 3LHTA 4AIUA 4ENLA 3AAMA 3G1YA 1UP3A 3SRDA 5J5RA 1JF6A 1LQ2A 1CGUA 2DVUA 2EG6A 1VRAB 3OGRA 4JKLA 3NM3A 3WZ0E 3TN3A 1EKOA 3F2CA 2OO6A 5D30A 2HISA 4LYQA 2WZHA 4AHOA 3RLVA 4I3GA 2VI0A 3A9IA 2DZXA 3TAKA 4MWAD 4O54A 2ABBA 4JZ5A 4WKAA 4LFYA 1OCBA 3BLEA 3V5OA 1XRFA 4AVNA 4JDYA 5I78A 5I3GA 4LSBA 1JULA 5ECUA 1M7XA 1OVDA 3U0HA 1U5HA 3MKKA 2I14A 4D2JA 4P61A 2P53A 2Z1SA 4UIOA 1E1EA 3UQNA 1OF6A 3LV6A 1ZB5A 1V0NA 1OFDA 5AHNA 4UWMA 4D6GA 4CQDA 3T1GA 3TSBA 4HNTA 3I6TA 4YTTA 1EXBA 3HA1A 3V18A 4IIDA 3QGAC 4AEEA 4NYYA 5F7UA 3CUZA 4OV9A 1EOMA 2C6QA 1SYTA 1HP4A 4CEXC 1EBHA 4Q7NA 3S83A 4ZXLA 1QOPA 3CMGA 3A3WA 4ACZA 3ENLA 1F74A 3G1HA 2WZEA 1LOLA 1XRTA 2CLIA 4XBSA 1PZ3A 2HTMA 3N9KA 3STCA 1CEOA 4HYRA 3P8JA 4U3AA 1PZ0A 4FX7A 4W4QA 3M43A 5A6MA 2A79A 1KO0A 1D3CA 1KM5A 4PUJA 3O0FA 1GW9A 3SCUA 3IARA 5I03A 2NVCA 3ERPA 3CB3A 3UD1A 3SI9A 4F2BA 4HN8A 3W4RA 2HSAA 4HK5A 2X0SA 3ORWA 2VRKA 1QI0A 2INEA 5IOBA 4Q7BA 3CXOA 3SM0A 2BY0A 2OKTA 2WB5A 1YNYA 3TOPA 2AMXA 2G3NA 1XXXA 4R7OA 4M6VA 2EPNA 4QX4A 2GUYA 5FIPA 4FXSA 4W7UA 4GACA 1YTDA 4I9AA 1XISA 2DDXA 3K13A 4HCDA 2X41A 3UZ5A 3CQHA 1K9DA 2QR6A 5CJ5A 1GKRA 1XGEA 1QRQA 3TWBA 2B4GA 3HG3A 2F6XA 1OCJA 1C91A 2BOGX 8TIMA 4CQAA 3S2CA 3KTCA 3KVMA 3D6NA 1UC4A 2YLAA 3SQSA 1Q66A 2X1RA 4DO7A 2FDMA 4US5D 1IT7A 4AD2A 2CLPA 3EOEA 4G2DA 4PEEA 3ZYZA 3NO5A 6TAAA 3TNOA 2FZDA 1OC6A 3XIMA 4WVXA 3D3FA 1JCNA 2DPEA 5CPOA 2BS9A 3H21A 1QUMA 4R9XA 3DESA 2JQXA 1E40A 4MF4A 4AD5A 4DZ5A 2QDHA 5LYRA 3EDKA 2WCOA 2PI6A 2JEQA 2Y8UA 3UA4A 4BI7A 3RUBL 4IGHA 1JNEA 4I5RA 5LIXX 2R1KA 4MM1A 1U1UA 5AYIA 4HCHA 1E71M 1CB8A 5M5DA 1XYAA 3FJ6A 3B0XA 3EDFA 1YQ2A 1ZY9A 1GPWA 4MPQA 3ARXA 3T2PA 1QI2A 1LUCA 2WBGA 2BZNA 1M53A 3HG4A 2V69A 2G95A 4UMAA 1XW8A 3MUAA 3PPGA 1G4EA 4QJ1A 4BEQA 4D6IA 3RCYA 1B4KA 5CGQA 2Y5SA 4JTIA 4MB1A 1E9LA 4F8XA 5E0CA 4KCVA 4JNMA 3VFCA 3LCHA 1UUQA 4MZYA 2Z26A 3FVMA 4AZ5A 4H4IA 3UG4A 3TMQA 1G01A 4LAKA 2VM8A 1M01A 1E3XA 3VGHA 1XGZA 4ATLA 2VT0A 1W9VA 2VEMA 3DDMA 1GKQA 3LCFA 2XWDA 2MNRA 3UZJA 5HWMA 2BWGA 4GNKB 1MNSA 4U28A 2XIMA 3N1AA 4EVZA 3QQWA 4R7JA 3WH7A 5FAGA 1Q6OA 4MYXA 1YRRA 3V75A 2DSUA 4IHCA 1UUOA 2ZVIA 1V6WA 2Y7EA 3RM8A 2NQHA 1H51A 2V2HA 1IEVA 1OG6A 5T9CE 3TKFA 3ZSSA 5HNUA 1U5JA 1TREA 1H0IA 4HMCA 3IIZA 3W7QA 4RDWA 4P7OA 1N82A 1KV8A 5AYYA 1NP2A 4RCXA 1ZZMA 1HL8A 4H01A 4NJIA 2OT1A 3D47A 3BZJA 4XX6A 2J27A 2QUMA 4M3PA 3DBNA 5I77A 4AZHA 1CLVA 5FEXA 2Z27A 2XVPA 3RNDA 4KW2A 3U3HA 3ZVHB 1HL9A 1VR6A 4WDWA 1YPIA 1ALDA 1RD5A 3I6RA 2ACQA 1FWDC 3OODA 1CLKA 3W7KA 4O12A 3CM4A 1XFCA 3NXLA 5C9XA 4OZOA 3ITLA 1UIPA 1A5AA 4LV9A 4ZSUA 4R7WA 1UZ1A 3TQVA 2BVTA 1VBUA 4W8LA 4S3KA 3NJ3A 4P2VA 1GQNA 4KBXA 1J0MA 1H5VA 4HGXA 3S1UA 1PXGA 2J6VA 1EHNA 3WLRA 2FZ9A 4U5KA 5AFDA 4WKFA 1MXGA 2QYGA 2QGYA 1XLGA 1WZAA 1K8CA 3C2OA 3TA9A 4QJ4B 1TG7A 4PCNA 2VEIA 3GUGA 1KCZA 1W37A 4HVXA 1VH7A 1IIGA 5I02A 5D9NA 1QHZA 3ZS4A 3DEQA 2XH7A 3S1XA 4NIRA 4IMDA 3IVUA 1WA3A 2GJXB 3PVFA 1WDRA 3VINA 1ZP4A 4G7EB 5DRIA 3A12A 3ABRA 4KWOA 3S5NA 1FH9A 1JF5A 1BFNA 6XIMA 2Q1FA 5HJYA 3GNDA 4NZ1A 4AMCA 2ABAA 4U2YA 2CZ5A 3L0KA 3FDGA 3W87A 1IEXA 4NYUA 3WNNA 3C8FA 1JZ3A 1JAKA 4YPJA 1XR2A 2P3ZA 1U30A 4DBSA 3LCGA 4Q4RA 1K1DA 4ES4A 4UFJA 3UR2A 5DMLA 4Q4SA 1NVMA 4YTQA 1VF8A 1G6CA 1DEDA 1S5WA 4IFRA 5M03A 5CZ0A 2W63A 1XBZA 1EOKA 5FF4A 2PDHA 2AQOA 1OX4B 2V5KA 3AS3A 2H9AB 3UWZA 2ZXAA 5D03A 5I7GA 4AU0A 4EKJA 3C6CA 3CL6A 1R2TA 2YBTA 4GVGA 4P5UA 1BVWA 1EIBA 3UJ2A 3GAYA 1YPXA 1TV2A 3LYEA 1WAWA 2NLIA 2WM0A 5ABTA 2ZUSA 3URBA 1GVFA 3BOFA 3AYVA 3M47A 2C0AA 2PLMA 3MUCA 1S2AA 4MGGA 2VJXA 4ZFMA 4ML4A 2DZTA 3KOFA 5A6TC 1UQZA 2Q09A 1PX3A 3TQPA 4F40A 2IMRA 2BB0A 4JCMA 4M19A 1J2BA 3UWWA 5C7HA 3DKJA 3G1AA 4MDPA 1TMQA 2PWGA 1JDCA 1EBGA 2QLYA 3GXPA 3HTWA 2VNCA 4S23A 3SN4A 3HU7A 1VCVA 2YSWA 1HM2A 4N6EA 3WNKA 3RN6A 3QY8A 1MQQA 1OD0A 1V3LA 3M0IA 1W56A 1XPYA 2Q3RA 2OX4A 2Z7GA 3TJ4A 3BANA 4U5IA 1F8IA 2XFWA 1IXPA 1MSSA 5HMEA 3ZLGA 1I1WA 3PTMA 1YBQB 2ZKMX 2DV0A 2W5FA 3GFYA 2W91A 3MDWA 1LG2A 5C9ZA 1LLOA 1KKOA 2VZVA 3BCFA 1FP9A 4UQAA 4QCFA 3TYBA 3L0NA 1I45A 6PTDA 2WMGA 3B8DA 3DERA 1EX5A 3CIWA 1HNYA 4CUCA 4QG8A 1H3GA 3B8IA 4H6RA 5B7ZA 3SUSA 1PL9A 2OQLA 2C79A 3BURA 3CNYA 2ISDA 1SM9A 2NSXA 1B31A 3T08A 2PLKA 3DFHA 5I3DA 3VD4A 4ERGA 1NELA 1QW7A 4KS0A 4J3TA 2DQXA 3KVLA 3OLDA 1KW1A 1Q13A 1ZUAX 5CJMA 1HP5A 3TYCA 3VD5A 4HK6A 1K77A 3FJ4A 3SW6A 3W86A 3AZRA 3G2GA 3PPHA 4GUIA 3IJ6A 2V0TA 3DX5A 4LRSA 3E38A 2RUSA 4F0MA 1UIOA 1QOQA 1BLIA 5HNTA 1R8LA 4O1DA 2YGYA 1S2CA 1FHLA 4CVUA 4PL1A 4KIEA 1XLIA 4Y6GA 4TU1A 3R89A 2BVYA 4OGZA 1WZKA 3WQFA 2O9TA 2ALDA 2PURA 1EC7A 3QC3A 4NQ1A 1KRMA 2O9OA 3WJSA 3NWRA 1YTKA 1W3LA 2CLEA 5E9XA 3TFCA 1C8XA 2WO5A 3E0WA 3GTXA 4JTEA 4KERA 4QTGA 2YL5A 4FNQA 4WF7A 4QRNA 5IFPA 4OECA 1XKJA 4N4PA 4IISA 4UTLA 3K4DA 1XIBA 4RNHA 1GONA 3P62A 4ZO6A 1R46A 3T8LA 1XIGA 2NT1A 4HHMA 1OGSA 2GJRA 2YCKX 2YEPB 2DW6A 3W1AA 3VZYA 4DJEC 2WCGA 1B3XA 4IIGA 1QPNA 3I10A 3SIZA 4JN7A 3ATZA 2P0IA 4UOQA 3NPWA 2OLAA 3GC5A 2CBIA 4R34A 4NL1A 1VS1A 4PCPA 1C8YA 2BOEX 2OFJA 5CSUA 4GQQA 2GVEA 4RNFA 2FIQA 2J8TA 1KBKA 3NL3A 2ACSA 2PDJA 3MYOA 5BROA 3E6EA 1UKTA 4XBJA 3M0VA 2W61A 1XCFA 1XDMA 4LT9A 2WHJA 1IR2A 3CUIA 1P7TB 1VD6A 1RR2A 3NZRA 4QG6A 4CNNA 1V6TA 2PWHA 2Z4GA 3SDOA 1XLCA 4HOZA 3M7SA 3W07A 3CZLA 1QNQA 3N25A 1CTNA 3SO7A 4YLWA 4K39A 4I8YA 4A4AA 2ACUA 3NQDA 4Q7IA 3UD2A 3M0MA 3OP2A 2YBUA 3RM4A 4XD3A 4HB7A 2TAAA 1TYGA 2CZDA 4FR1A 3GDBA 2DT0A 1R3TA 4JTRA 8RUCA 2V30A 4QDMA 5XIMA 3E0VA 1VLWA 3BGJA 1UKPA 3D3AA 1IZCA 2VWSA 4C6KA 2CHOA 3FEQA 3IS4A 3OGVA 4RDVA 4BR1A 1UBPC 4BWLA 3L2MA 2WBKA 5IDIA 2XN1A 5G1MA 3UNTA 3UXDA 3SCQA 1BHGA 3QHOA 3LM3A 1GOMA 2ZADA 1MRQA 1J12A 1JRBA 3N2TA 1B0IA 1M7PA 1K7XA 4PMVA 3R12A 4D8ZA 4S3AA 3BAXA 4CN4A 3SIMA 1MW2A 4ZMGA 3I3DA 2ZUWA 4WDXA 1QBBA 1WKDA 2WM1A 3OHIA 3W53A 5JBFA 1ZJIA 3O6CA 4JTGA 2H6RA 4XAFA 1R9YA 4KRTA 4GQBA 4Q32A 2AQWA 1GORA 4ZQRA 3W73A 3W37A 2GDVA 2E5CA 4HNCA 3OQEA 4YVVA 1FOBA 1A0CA 1FH7A 2E4TA 1N8FA 3A22A 4AX7A 2QGHA 3PJUA 1OYAA 3WL0A 1N7RA 2CIPA 3WNPA 2P0OA 1ISWA 3KWXA 4UR8A 4AW7A 2QW5A 2R94A 5AKQA 1B3YA 2GSEA 2YCLB 2CFFA 2YDRA 1KTCA 4WEVX 1KFJA 4AVFA 2NWSA 2B81A 4LNCA 1GOKA 3GG8A 2B0MA 3L65A 4GYFA 3SUWA 4DN1A 5D33A 1LXKA 1UQYA 1UA7A 3DXIA 4IX2A 3W7RA 5TBOA 4BWLC 4UCFA 1VAHA 4UFHA 3CHCA 2UV8G 4JQ1A 1T96A 3BK0A 3WLSA 1JD9A 1WB0A 3PF3A 3W7CA 3APTA 2VZUA 3I7RA 1X6UA 4HPXA 3EWZA 1KM6A 4INFA 4FLSA 3PHAA 2CHNA 1TPH1 3DCPA 4LC6A 1PBGA 1KD0A 1JD7A 4Q4PA 2GPTA 3BAJA 3FYYA 4DI8A 1UP0A 2VELA 4CCEA 2OEJA 3ATYA 1LBFA 1FQ0A 2BFGA 1ITUA 3LGGA 3QRHA 4DXKA 2VCCA 3RITA 3D5HA 3RRXA 1JCMP 4K68A 1N8WA 1POKA 3T78A 4HZ6A 5LXXA 2ZYFA 5AHIA 4B9ZA 1A5UA 2WMFA 3NQ6A 4L1XA 1EEPA 3B0YA 5T91A 4YIWA 2YL8A 4GI8A 2JE8A 4IQLA 3SRHA 1ZBCA 5M3WA 5C9UA 4UXDA 1A5LC 4JTKA 5EPDA 4MNKA 1ONRA 3OZOA 5BMWA 1G69A 2DJXA 3QW4B 2DSWA 2O7SA 2BY3A 4CU8A 4F0HA 3W7PA 4XIAA 4LALA 1NFBA 3HFTA 3WLIA 2X1SA 1UBSA 4POCA 5ABGA 2OZ3A 3QMTA 1F1SA 4FB7A 2W92A 3KVKA 1W9UA 4AYGA 2A3AA 1QI5A 4YCOA 2FGBA 4AWUA 5G4WA 4GIYA 1UWTA 4S1FA 4TUFA 3VO0A 5HOSA 3TQKA 1W1ZA 4D1JA 2DSZA 2PLCA 2VRJA 2CZEA 2X1TA 1Q8JA 3FA4A 4F9DA 4LBSA 1DQUA 1O5RA 1C9WA 2BRWA 3VKJA 2ISVA 2E6DA 4MTVA 2E28A 1BYDA 1E4NA 2J77A 2XINA 4S3EA 2E22A 4B9YA 4E5TA 1RCQA 3VIFA 4ROPA 4ALDA 3LBCA 4XUYA 1GKPA 3GBDA 3O15A 4HOWA 1JQXA 2CZFA 5FESA 2A6LA 1G1YA 4ZO7A 2LLEA 1RWHA 3TROA 2WKLA 1VGAA 4E2OA 1FCUA 2G4FA 3IJDA 3ARYA 4M51A 3VC5A 1GTEA 4DBDA 2XSXA 3WF4A 4XV0A 2VFHA 3C5QA 1NJJA 3UY8A 4MY8A 3NSXA 2EPKX 4R27A 3OVQA 1RWFA 1QNRA 3LDVA 1YKWA 5AYZA 3S9IA 1VCGA 2XN0A 3AIWA 3WSUA 4D6EA 1W32A 3QZEA 1DWAM 3CPGA 2PAJA 2VR4A 1HJUA 2GQ3A 2PDKA 4ZL1A 1KM2A 4JTTA 3EYPA 4XG1A 1OWQA 3LD5A 3DZ1A 4DBEA 4FLOA 4J28A 1ECEA 3UZYA 3TU9A 2YCJA 3OZPA 1RPKA 3L12A 4M8UA 2NX3A 1XQKA 4CNOA 2GVYA 5A2AA 2FZNA 1E51A 3QPEA 3CUJA 3KWSA 2PWVA 4FZIA 3OG3A 4IQDA 5FF3A 2YB4A 4XVEA 4X9SA 1CGXA 2C1IA 4F0KA 3VDAA 4UZSA 2XZ7A 4UMCA 3DG6A 1KKRA 3S3GA 5FJRA 4Y90A 3R0DA 1QW9A 4C6MA 4DWSD 4A8IA 1QWGA 1FFQA 4PGLA 3MUIA 1EPXA 2CEQA 3T09A 1GJUA 4AY1A 4LYPA 3WK0A 1Y0EA 1TVPA 4I6KA 3RM9A 2HPIA 1KBJA 3MS8A 1AQFA 3IGSA 4ADUA 4IP5A 3FA3A 4JIPA 1R7AA 1P0DA 4QBXA 3CGTA 3R11A 4HMNA 3WBWA 2ZFAA 3HGSA 1W5QA 2J7GA 1WUFA 2VOTA 3HMJG 4M6UA 1P6CA 3TX9A 4EAMA 3VUPA 1UD2A 4W7VA 2P5NA 3O1NA 4AIBA 3M07A 3IGHX 3DFQA 3QGVA 3W85A 5AZ0A 3NOYA 1OYBA 2CZVA 3AWOA 1BAGA 1FCBA 3LGEA 4FK9A 4B92A 2Q02A 2YCEA 2CKSA 3P6LA 5HPCA 1LRQA 1LDCA 4IL0A 1RQHA 2YBVA 3BSHA 1LCOA 4I9TA 4NZJA 4S39A 2HE5A 2V5BA 3MI2A 1S39A 1KNWA 3U48A 4E4PA 1RW9A 3WLPA 3WNOA 3QLDA 1KR0A 4NZ4A 2H3DA 4ZOBA 1E6SM 1J0YA 1PCWA 4JFWA 4NSBA 4Y8FA 3P81A 2HPMA 4HNUA 1V5XA 3LHYA 3CZ8A 4NKCA 4IMGA 1DE5A 1ESWA 4OOZA 2Z1VA 2PDFA 1H7RA 3THCA 5CGTA 4PMRA 3CO4A 1OK4A 3N04A 4DO6A 3LCWA 2VR2A 2V3DA 3LERA 4GKLA 1CXEA 1KM0A 2HVMA 1N7KA 4PL2A 3GRIA 5KZMA 3HPAA 1XYFA 4IMAA 5E70A 4GWEA 3ITTA 3LCIA 2NV9A 3PBVA 1CB7B 1PEZA 4D8AA 1VENA 3MUY1 1GOOA 3EWXA 3SCSA 4AD4A 4R88A 3MV01 3IK4A 4ZQCA 4B90A 2EPLX 3AWNA 1QASA 3AHVA 1H5YA 5G4EA 1VQTA 1DYSA 4XTIA 3FGCB 2ZUTA 3S5OA 4MLJA 1US3A 4HJFA 2W79A 1XKYA 4NRRA 4UQCA 2HQAA 3VILA 3UWEA 5TAOA 5CGMA 4IT1A 2D24A 3BAKA 1VBGA 2R1PA 1S5TA 2DQWA 1ZGDA 3LHWA 4ZGYA 1GZ1A 1QK2A 2YIHA 1TMHA 3W29A 2XG9A 4MWAA 1KM4A 4IP7A 4GRSA 4US6A 1THFD 2PBGA 3MUXA 1XH0A 4XZHA 3WENA 1W54A 2FH6A 4HMEA 3P84A 1MXSA 3OVRA 5FD0A 3ANYA 3MI3A 3VIIA 5CEWA 1AG1O 3WO8A 4O13A 1EEXA 3W2JA 1XQLA 2WKGA 4H2HA 4N02A 3P67A 1V6VA 2I9EA 1O66A 3DYMA 1RBOB 2XHYA 4BQ3A 1QMLA 4FAMA 3AHYA 3UG5A 3FIGA 2UY3A 1JZ4A 3WX7A 1PTDA 5I23A 5A8NA 3H55A 2WANA 4U33A 3GFXA 4EF8A 3AIRA 3IJLA 4ZBCA 5AZ1A 4AD3A 2XYLA 2RDWA 2XH0A 2VOMA 1V4YA 3KOWA 3N4FA 1ME7A 1V0KA 4J3XA 2D3NA 4NXKA 5D04C 1WNOA 5HWNA 5F1VA 4RXFA 3EA2A 3BH4A 3W01A 3MC5A 4ATWA 5EKYA 3DU0A 4N4QA 2QULA 1PZ2A 3W71A 3WQ8A 1G67A 1GCYA 2VGBA 2AKZA 2CXEA 2PF0A 4J3SA 1ONXA 1WYIA 2QJMA 5AC6A 4CCCA 3FXYA 4AD1A 1H49A 3EEZA 5JVLA 6CGTA 1OJXA 2VRQA 3N2BA 1EQPA 1RUSA 4MWAC 1AW5A 1QOXA 1R3SA 1UR9A 4FXJA 3ZO9A 2VVSA 2E8YA 3NQCA 1CNVA 1A0DA 5HPOA 4NZ3A 2OWCA 3NEVA 2OVLA 2WOQA 3BMWA 3LBOA 3WDJA 4LVDA 3E1F1 4E8GA 3VKAA 5LA0A 1F3EA 1ZU8A 4MZ1A 3WH9A 3PJTA 5GJMA 3AS0A 2Y70A 4TQTA 3QY6A 1JCTA 2J75A 4AISA 4C6JA 1S38A 3AMKA 1ISYA 2AAAA 1CGYA 3VIOA 4LWWA 4JY8A 3GVVA 3WH6A 1TPVA 1V7YA 1OIFA 1R3YA 1DJGA 3GVQA 2ALRA 2G3IA 4UTWA 2PU1A 2UBPC 2R1LA 1RSCA 3N12A 1F3XA 1FXPA 4ZQOA 3UR8A 4US5A 5BRPA 1C90A 2Y1HA 3FFSA 1TPFA 3R8RA 1A0EA 3WG6A 3N11A 4TV6A 1ZENA 3GU2A 3PG9A 1FFRA 1SFLA 1UZHA 3GG0A 3BARA 5E0FA 1ZAJA 3W7DA 1C9DA 5C2XA 4UTTC 3WBAA 1BWKA 2WMJA 5K4ZA 2GQ8A 2DW7A 1IXNA 1UKQA 4EIVA 4D6JA 2HXUA 4AG0A 2ASHA 3H2MA 5AHEA 1AL8A 4UR7A 4YNGA 2ZX8A 4JX6A 1V51A 1JI1A 3VGDA 2WSPA 1KGXA 1E6RA 1IGSA 1UR2A 4NY2A 1IQ8A 1JR1A 3R25A 4B4HA 4GCXA 3W02A 4NRSA 4C60A 1TRDA 2XUCA 3W22A 1NDZA 3MUZ1 1KV5A 1UWSA 2DUZA 1NH6A 3VCCA 4AUBA 3FNDA 3W27A 1KWKA 4DNMA 1UG6A 1HVXA 5A6SA 4LCRA 3LHUA 3GXFA 3EB4A 6REQB 4PBGA 1KGWA 2REQA 3B9EA 2IKIA 4KGJA 2CLMA 4W8AA 4UTWC 2ZE3A 4L4LA 2NUXA 3VIHA 1RJQA 1XUZA 2HVNA 3FKKA 4HA1A 3BQ6A 3HQNA 3WLTA 1WZLA 2P10A 2G5WA 1F4HA 1FTXA 4D8LA 1W3YA 1FXQA 4DY1A 1R30A 3W7HA 1YTEA 1QNVA 4WSKA 3CYVA 1J8VA 2BNJA 3NURA 5GVJA 3G5EA 4RDZA 3WEMA 2ZUVA 5D2VA 3P82A 4TX6A 2ZA2A 3S4TA 1R3RA 4AIOA 3EB2A 4MFDA 4OKDA 4H2CA 4CVWA 2Z2AA 2ZTJA 5LIWX 1K8YA 3CAWA 2L5HA 3MMDA 3W2KA 3VKCA 5CAKA 3WIJA 5KTLA 3WJXA 5JU6A 1U1HA 2NVDA 4N9CA 4V28A 4I8DA 3G1DA 3WJYA 1E6NA 1I8QA 4I6VA 2PSNA 1NQKA 5HAOA 3UR5A 4GGBA 4MNJA 3CUGA 1IEWA 3RG6A 1EWDA 1GGOA 4E3TA 2ATSA 3DC8A 3TLLA 4XK2A 2ZZ3A 3UCDA 5LIKX 4FF7A 3ZMRA 3QPZA 1R9ZA 2WCAA 4DUWA 2CERA 3GW3A 1A5KC 1A3HA 4AWTA 2BHYA 1NFGA 2DT2A 2ZA3A 3MVIA 3QW3A 4WQ6A 5IBXA 4C6BA 3QOMA 1EC8A 3ZIZA 3F1QA 4LQ1A 1FHVA 1E0VA 4Z2LA 2ZIDA 4B91A 1EX1A 4Q4QA 4CD7A 1X1ZA 2ISWA 3KL5A 2A4AA 2V8ZA 2DORA 1BEUA 3WMLA 4X9YA 2J13A 4JQ2A 4JTLA 1QHOA 3TONA 3GIQA 1FWIC 2D73A 3S2LA 5H1WA 3L68A 4C6CA 4Z0SA 3WUGA 5LNRA 1KM1A 3EPMA 1JDFA 3GHTA 1LP6A 5DBTA 1QNPA 2D1ZA 1LLQA 4PRRA 1H0GA 2A85A 4S38A 7CGTA 5CC5A 1TUXA 1FWAC 1OFEA 1E43A 1KCKA 5F4SA 4PMZA 1S2VA 3GR8A 4H8HA 1XYCA 2A6NA 2IXUA 4AZBA 1CB2A 1GHSA 1Q6RA 3CL8A 1Q6GA 1NWTA 1TTJA 5EGRA 2WC7A 1JJKA 4BFAA 1WZMA 5GNXA 3AZSA 4ERAA 4HNOA 4V27A 5K9XA 4HA0A 4LGXA 3IPWA 4LV4A 1O68A 2QCDA 1T99A 1GT8A 1OINA 3QHMA 2ZRYA 4H9YA 2XPKA 1F3TA 1JEZA 4LU0A 5TQLA 3M7WA 4OIFA 3QV7A 2O92A 3IJ8A 3CUFA 3T0BA 1AVAA 3OOQA 5IBXC 4ONVA 4DZHA 1WAUA 4RE0A 2OT0A 4CEUC 3U9IA 4JY9A 4ICNA 2VVNA 3W7IA 5G1TA 4E2BA 4FF5A 2QPUA 4LS0A 3BLLA 4BZYA 2ZX7A 1L9WA 4AFYA 2QCHA 1UR3M 1X7IA 3BLDA 2AGTA 3LG3A 3S9YA 4B5WA 3GDLA 1DORA 5CG7A 2J88A 3PS7A 1RPXA 5E0KA 4ZSTA 1JPMA 2CHRA 3G8EA 1TCMA 2GDQA 4MAVA 1AH4A 5DT7A 3GZ3A 4RZ5A 4Q8UA 1KB3A 3GTHA 3WEZA 3NZQA 5CSSA 6ALDA 1PUDA 3IACA 1JGIA 1ML1A 3H70A 3UGRA 5H6HA 3VDHA 1TR1A 3S2JA 1EP3A 5EB8A 3JRKA 4OOUA 2WHLA 3SJ3A 4C5YA 4LVGA 4KWWA 3QR3A 1AQHA 4JXCA 1BD0A 5G1YA 4LEFA 4TVCA 1ZJAA 3TTQA 1HF6A 4JIHA 5REQB 3W2NA 4YTRA 4GXWA 2W27A 3L0GA 3A4WA 4GBUA 4IWWA 2JALA 2YYUA 2QCLA 4ICCX 4IG2B 2BGNE 3E2VA 3PBMA 1SZNA 1TJ2A 3KX6A 2GGJA 5AVNA 1EYWA 2R14A 4UTUA 3OPSA 1L6YA 2WZIA 2C1GA 2GK1A 1J0JA 1LL6A 2FPTA 2J7FA 3S1WA 2FTPA 4ZB5A 1U33A 1YXCA 3ZR6A 4PODA 3KBNA 2Z1BA 3CHVA 5CBBA 1VHCA 1HKKA 3UPMA 4IIEA 2PTZA 3WBXA 1GNXA 1J01A 4QXIA 3B05A 4IGMA 1TWZA 2A7RA 3MA8A 4GABA 2OZ8A 3LPPA 3TXZA 4G6CA 4FLRA 3SUVA 1E0WA 2V3GA 1O7AA 1GOWA 3I68A 2DIKA 1EJWC 1PZ1A 4AZ6A 1SJBA 2PCEA 5KETA 3RXZA 4BQ4A 3V4BA 1XCXA 2RKXA 1ISZA 4KIRA 3P14A 2HZGA 2F8QA 1M65A 1VFSA 1SO5A 1E6ZA 3VX0A 3A9BA 1XYBA 4UMBA 3SB0A 2UY4A 3ES8A 2J7CA 1W31A 3W28A 3PJWA 1VZWA 4OHQA 3SFWA 1PPIA 1S5MA 4O15A 2E67A 1MQRA 3CV7A 3QXBA 2I9UA 3W7MA 5HJXA 5KSWA 3GVRA 1SR9A 2FMOA 1VJIA 1W1TA 3CUHA 3UXLA 4AEOA 3A3XA 1C8VA 2YW3A 1FCQA 3QZ6A 2PRLA 3W2UA 3W1RA 3WNMA 3K8KA 3GNXA 1W1VA 4D6CA 3TEVA 3WMCA 4L9XA 1W8SA 1F4AA 3MQTA 2F6UA 4GUFA 3P7YA 3UWYA 5C54A 2ZXDA 2EPHA 3SCVA 1J0ZA 5C6MA 4A35A 2Z29A 2JKEA 1UMLA 1PAMA 2TRSA 1J0KA 4LYRA 1GVRA 3I7SA 3LSBA 1E73M 2X8RA 4JYDA 4O50A 2WHMA 5LXEA 4MB5A 4LBRA 4D72A 3V1HA 5LIUX 3UA3A 2G8ZA 3P8IA 2NX1A 4UQBA 1EZWA 1UD6A 3VCNA 1HUVA 3M16A 2FB3A 1B5TA 2CC0A 3GFZA 1MXDA 2GOKA 3UG3A 1B1YA 3O9NA 5AY7A 2DIEA 2X2YA 4BCEA 1EGZA 3VNIA 3JUGA 1OG0A 4DYJA 4NILA 4ZO9A 1PB0A 2JIWA 3M6YA 4MADA 1N7PA 4B5VA 1PCKA 1WBJA 2QMKA 5C71A 4BS0A 2E24A 3H7RA 2VZSA 3TN6A 5C70A 2O4QA 1BF2A 2FZ8A 4HYVA 5BOOA 1UROA 4GZIA 5FOOA 4P7NA 1TELA 3UPWA 7XIMA 3CPRA 1I4NA 3IJIA 2PUZA 1IIHA 4ORMA 2WVUA 1H63A 3PUOA 3IIXA 1UCWA 4O8RA 2ZA1A 1S2WA 1QAPA 2PGWA 4C6NA 4RE2A 2QJIA 1FDJA 5PTDA 1HT6A 4YJ5A 4UTIA 5A2CA 4J2PA 2QUNA 1DJIA 3RILA 3PUDA 1VC4A 5J8LA 3KBJA 1FWRA 4WY0B 3NCOA 5CZJA 3SCRA 4C1LA 2BRPA 3PZQA 2PDWA 3VIJA 1VBRA 5LHEA 4Z1DA 4GISA 1X1JA 3VUSA 4DJFA 3OVGA 1OT1A 4R5EA 3UYIA 1S5NA 4ZO8A 1QDSA 3AS1A 2B31A 2P3EA 1PIGA 4Q8NA 2GJXA 3LB0A 2VL4A 4UTMA 1ZLPA 3WLKX 1DQWA 4G7EA 5I79A 2C7FA 3AIQA 4JOMA 3P2VA 4QHRA 2E1DA 4G7FA 4S3BA 3QVQA 4S3JA 3AICA 4DWDA 3S1VA 3QC0A 1HO1A 3C3NA 5FF7A 3IWPA 2J9ZA 1KFBA 2J62A 3LEPA 1QPRA 1UZ4A 1VFTA 1AUSL 1SR0A 1JRCA 2I1OA 2BXZA 3O8AA 1A80A 1M9HA 3ARUA 3NXFA 3PP7A 1KFEA 2ZXBA 3HGOA 4G1NA 3H7VA 1RALA 4DAIA 4EP8C 5D38A 4Z2HA 5AN7A 1TSIA 2XFYA 2CBVA 1EA0A 2Z1WA 3EX4A 1HL2A 1N2VA 1X96A 2WVVA 5K3VA 1I2QA 1FDYA 1BQGA 5CKSA 3WUFA 1RWAA 3ZWSA 1LOQA 5MF5A 4XBKA 2JF6A 1H7OA 4V1YA 1HMUA 2MANA 1XFBA 3TTEA 5A6BD 2WLYA 1FWTA 5CPLA 3EKLA 3HGJA 1QI3A 2I16A 4NUWA 4Q22A 3W25A 2A3CA 1ISVA 1FBAA 4YHEA 1W9DM 3M1ZA 1IGWA 3F4VA 2WNNA 1KLZA 4GVHA 1XBXA 3PZTA 3MSGA 3LLDA 5A6KA 2PA6A 5CG0A 3GHRA 1F61A 5BRQA 4JN6A 3B4YA 4IMEA 4WJ8A 3GS6A 1VFOA 4KEVA 2AL2A 3PR2A 4XVDA 2Q3OA 4Q8OA 3IK2A 4XKYB 4OQVA 4A2RA 3O6AA 4DBUA 2V82A 5DY2A 2QDGA 1U2YA 3L5AA 3GDTA 1PKMA 2E9LA 4O1AA 1W5NA 1UJQA 3LI0A 4AZCB 4PMJA 1I8JA 5C55A 2XU2A 1GZJA 3GVWA 2Q71A 4GH1A 1S3TC 5M2FX 1EC9A 1UWIA 1A49A 3NG3A 4N2YA 3XISA 2VZTA 2B7QA 3OA3A 3S46A 3TJLA 3PZNA 5K9CA 4QSHA 4PTXA 2A3LA 4G1KA 1P6WA 3R13A 4EPEC 1WO2A 5BXTA 5J5DA 4PEKA 1LWHA 1KXQA 4QNWA 1EO7A 4Z0JA 3RU6A 3WY1A 3H8AA 2HXTA 2D0HA 4O57A 4XKMA 3B8TA 1Q63A 2BBFA 4W89A 4I5UA 1I2PA 2WC4A 5AC5A 1WV2A 3U7BA 3TXVA 4C6LA 4D9PA 2VMFA 1I6NA 3O0KA 3W7GA 1N7QA 5LKYA 4MWAB 1GG1A 2FQIA 2EQDA 2J7EA 3C2FA 4XZWA 1MEWA 1YPFA 3WDIA 3VX1A 1OJMA 3TYDA 1QO2A 2YFOA 3DFSA 3B06A 4CNPA 1NOWA 5CSYA 1VBJA 1DPMA 2J74A 3L2LA 4XTDA 4HBKA 4IPPA 4AB4A 3NZ1A 2E40A 3TTYA 4XSLA 1WOAA 3G77A 3O6YX 4PMYA 2ODOA 4MVAA 4B2DA 4H83A 4Q8QA 2IKGA 1RBLA 1PX8A 1XL9A 1VKFA 3PPCA 3LHZA 1ZPTA 4RUBA 4JPGA 5D32A 1F2JA 1AD4A 2UY2A 3KL0A 4JKMA 1V6UA 3M44A 3G1VA 1FCVA 1XV8A 4H6QA 2IPFA 3PZOA 1JYWA 4I7VA 1DIEA 3E5BA 2WZMA 1GVYA 4EXBA 3EA1A 2CPUA 3MP3A 4KWUA 2XFRA 4U31A 3LK6A 1LROA 5EFFA 4RX0A 2FHBA 4C6DA 4JTFA 2GJPA 2OSXA 4JTJA 3VM7A 3OZYA 4DJDA 2QAFA 3QQ1A 2E0PA 4IF2A 4K7VA 3M0JA 3DFOA 4F2TA 5DELA 1KM3A 4UNKA 4F0LA 4IH3A 3HG5A 6TIMA 3MP5A 5D2TA 3SCTA 1QK0A 1L6SA 2CNCA 1VEOA 4IMFA 1E9YB 4J3ZA 4WDUA 2V6AA 2J6XA 3RO6A 1VIWA 1P7TA 2CU0A 1MMFA 1MNZA 1U83A 4L61A 4TR9A 1NAL1 4E2VA 4HN4A 1O5XA 3SZ8A 3NM1A 2YA1A 4O16A 5A94A 2G4JA 4DUOA 5EBUA 4DLMA 1SW3A 2EO7A 4WZHA 1M41A 3HJZA 5DFAA 3LTSA 1X38A 1DTUA 2W66A 1RAKA 1DXEA 3ECQA 4U2ZA 2OCZA 3VOGA 5D2WA 4DYKA 3GH5A 3QTPA 4UTJA 1CW2A 3TN4A 1TPC1 4N0RA 1KTNA 4CD4A 1L8NA 4D6DA 3PZ9A 4GD0A 3VC6A 1XDLA 2Y62A 3DKLA 1M7JA 4A8NA 3C52A 2E09A 1R3QA 1JDDA 4MKVA 1X7FA 2ZRUA 3DHDA 1T5AA 1CDGA 2FH8A 1I0BA 2AAMA 2C3ZA 4BA0A 3T6CA 3EKZA 4C90A 1ME8A 4FNTA 4ACYA 5I00A 2XH4A 4P8WA 5U7SA 3URAA 2OSWA 4A3YA 3W7EA 1IXOA 3NPUA 3EX1A 4UNLA 2NUWA 1LOSA 3G0XA 3QF0A 4DWSC 2PP1A 2FJUB 2BSLA 3OHMB 4MDOA 4LH8A 2RH9A 3PUEA 1H7XA 3GIYA 3CV2A 4OT7A 1HXJA 1YNPA 4FNRA 2WVTA 3M5XA 4JIQA 5EYWA 2REQB 2VFIA 4QEHA 3E0IA 3EPNA 4J7RA 3LI1A 3VZZA 4GIRA 1M1BA 1IT0A 1EL3A 2V9DA 3CASA 3FV9A 4ML9A 1YDOA 3C4UA 3PUGA 3QOKA 3T7VA 8CGTA 1N55A 1TTPA 3RCNA 1OJNA 1PDYA 1AFSA 3C0LA 4B5UA 1MI3A 2R1NA 3L4XA 2WCSA 4KCUA 4KMQA 2CCRA 3Q37A 5AYBA 3QLLA 1C7TA 2PP3A 3H2OA 2VX5A 5D2XA 2ISFA 4QITA 3EWBX 5FF2A 1NTHA 3PZUA 3GQYA 3A21A 1E0UA 1MDRA 3QYQA 2XSBA 1H7WA 4KGLA 4NAEA 4GQRA 4LB4A 2Y7DA 3COTA 4JFSA 4XZLX 4HPHA 2JBMA 2BHZA 4Q8PA 4FNSA 1XLEA 1DWGM 1XIMA 5BXRA 3C61A 5LHFA 2OYLA 1RWCA 4GKTA 2HWGA 2YR1A 2X42A 3FAXA 4UB9A 1L8PA 4JQAA 3EBVA 1KQZA 3UJEA 2P50A 4NZ5A 4MB4A 4Q4OA 4XIMA 3NOEA 1R47A 4HZ7A 5I24A 4PR4A 3TCSA 4RE3A 3RRAA 4ZOEA 1UB3A 3IVTA 3H26A 1BSLA 5I3FA 3S0CA 4FX6M 4OE7A 1P1MA 1J4EA 3MV11 5BW6A 2NWRA 4DELA 1K4GA 4GI6A 1KFWA 2DIJA 3B0PA 4EPBC 9CGTA 2WSKA 3QR0A 4ZOCA 2R9RA 4FLQA 4DPPA 3WQPA 2HK0A 4MIMA 2BOFX 3SCNA 3IT4B 2O0TA 3KAOA 3MZNA 4L4PA 2ACRA 2E6YA 3NQVA 2ZC1A 1MW3A 1W5PA 3ZOAA 1TWDA 3KM8A 1R85A 1EZ2A 4S3FA 2VYOA 2W67A 3W88A 4B15A 4M5PA 1TQXA 1CXLA 3MCOA 3L4YA 4AWEA 5EU9A 2JIEA 3M46A 3P5ZA 3ZQ9A 3F2BA 1LL4A 4AAJA 2PODA 2W9MA 3HURA 2QCDB 5C7VA 3MANA 1CXIA 4TVUA 1UR4A 3BLKA 4LF1A 1TV5A 4D8OA 3NQGA 3BV4A 5HWJA 5CCZA 1QBAA 3RU8X 5DCDA 3EXTA 3SY1A 3T0DA 3KLLA 4NAFA 1DOSA 3T81A 2WJZA 3OIHA 3I4EA 1HN0A 5HNRA 2KX9A 1LORA 4EANA 1W3IA 3MKCA 1P4CA 2PDBA 1XIIA 4M6QA 3ZJ8A 1EO5A 3UG8A 2QPXA 1L6GA 3PG8A 4ZOAA 2YDQA 3BSGA 4EAYA 1EJSC 3ARZA 5GPRA 3DENA 1M7OA 3U2ZA 4GC3A 1TPB1 5FSDC 5A8PA 4CGTA 2F2KA 4DVOA 1Q7QA 1TZZA 1B3ZA 1PVNA 3B8WA 2V5DA 3CTLA 4EX4A 3L5LA 1US2A 3N29A 4GX8A 3B03A 1SW7A 5AHFA 3OEXA 3F2DA 2Y7FA 1HW6A 1RCXB 4N9DA 1EDQA 3VIKA 1O5KA 4AY8A 5U4NA 1J6OA 1OQFA 1JFXA 1JUKA 4XQ6A 2D2HA 2A5HA 1YXDA 3WUBA 3FX4A 4IJCA 3BDKA 2DZPA 3UNDA 2BP1A 3B40A 3U8GA 4ZQPA 4PH6A 4IL2A 3GH4A 2GVGA 3PNUA 1G5AA 4PFMA 2VDIA 3NVTA 1OSEA 2NQZA 3O06A 5AHMA 1K9EA 3WLQA 4ICMA 4GK8A 3RR1A 3VAVA 2GK1B 4LCSA 2Y61A 1CYGA 3B9NA 1DJHA 4N7QA 4QROA 2VGFA 2BVWA 2E1WA 2E3ZA 5E6YA 2WVSA 4LW7A 1O1HA 2F2HA 1XCWA 4DZAA 1JYVA 1W9BM 1KRCC 1X1HA 4DNHA 1NU5A 2Y89A 4NX5A 2J8GA 1F73A 3VDCA 4PE8A 3G1SA 2QIWA 4LNYA 3RAOA 1QWKA 5C2GA 3EDDA 1CWYA 3KRBA 4FOKA 1BWVA 4Q8WA 3N3MA 4H8UA 2OGJA 3DHPA 3CQJA 3SJNA 3R5EA 1H4PA 4OWGA 3L4UA 1UZDA 3WEOA 3V1PA 3K1DA 2HNHA 2YX0A 5FJTA 2HS8A 3P93A 3BOLA 3R0UA 2ONEA 1EA9C 3EMQA 4FMVA 3N2OA 4TVDA 1M03A 4ZFCA 3MSYA 2ZXQA 1O94A 2NT0A 5AHLA 4S3GA 4PTWA 1IWAA 3VOFA 4L1GA 1DIKA 1S1RA 4IUGA 1M5WA 1F6YA 2PDIA 2O7QA 4UFMA 1DJWA 2PCQA 2V2CA 2V68A 3NQAA 3SCPA 1X6LA 4HCLA 2P76A 1TR9A 4QQ3A 2WWDA 3PFMA 3L7RA 1QCWA 3NQ7A 5HR6A 4F3HA 2QJGA 2ZX5A 4C7DA 1OFPA 1J96A 1G0CA 2YA2A 1OGGA 3T2QA 4DAFA 4QR6A 5JH1A 3POHA 2E68A 3VM5A 1V7AA 3CO8A 5EBAA 4YWSA 1FVPA 1Q7ZA 4BF5A 4MY1A 5LA1A 2A7NA 3R10A 4LUJA 4QE1A 2WHKA 1K8ZA 1RK6A 2IQ0A 1K7FA 3LX9A 2VZKB 2EG8A 3CZGA 1AZ1A 2ZBTA 2WJEA 3UERA 3LCLA 5EL1A 2POZA 2J9XA 3N2MA 4D71A 2PRHA 1A3XA 3DYOA 1S3HA 4M82A 1JYNA 1AA1B 4HP5A 5FJJA 1WE5A 2J9YA 3FGCA 5KMYA 4R85A 4IUOA 3A64A 1REQA 4AY7A 1ZSXA 3CH9A 3W6YA 1WDQA 3UWUA 1KCXA 3U7VA 3AMDA 3BQ5A 1XLLA 3ARVA 3FEMA 3FHQA 2O9PA 1GOIA 5BRBA 2WMIB 1MW1A 1NQ6A 2PTDA 1J93A 1AJ0A 2IQDA 1SJCA 4NT0A 2GSHA 3SSJA 4M7TA 3N2CA 4IJRA 1MW0A 3SN0A 3N9SA 1V79A 3TNBA 2X03A 3AIUA 1DJQA 3SECA 1W17A 1FWSA 1XG4A 3C2YA 3UBPC 3R0KA 1J0IA 2X7VA 3G6MA 1XC4A 3ARRA 2HCVA 3O7UA 2A2IA 5F4WA 1E6QM 1GJWA 4JX4A 2YYTA 1ODUA 1ZL1A 1ME9A 4V15A 1FDZA 4MOZA 1HX0A 1DXFA 3RX3A 3WFZA 5TD4A 3L67A 4H7ZA 1UH2A 3OGSA 4MB3A 3OLIA 4KEUA 2XN2A 3CQKA 2YZRA 1DXIA 3Q2DA 1AH3A 4LRTA 1GW1A 4YMZA 3T0CA 3TV8A 3M0LA 1OC5A 2YW4A 4RPPA 3NIYA 2H90A 3W3OA 3TR9A 1Q7MA 1S2UA 4J40A 4LVAA 3CB8A 1J5TA 3MTWA 9XIAA 3FDKA 3MYPA 3UETA 4WX2A 4U3CA 2XJ7A 3LS9A 3B8VA 5D37A 1K8XA 3NYZA 2FHFA 2DH2A 2C13A 2J24A 4H1ZA 3ARTA 3IEBA 3B04A 1PDZA 1LWIA 5ABEA 1MFVA 2Y88A 2PDQA 1MRAA 1PV8A 3LQGA 2FGZA 4LY4A 1UMYA 3O07A 3DFYA 4AH7A 1N7OA 1CT5A 4PYSA 3CV1A 2CBJA 3E2RA 2CBUA 5A95A 1X1IA 1A5BA 5JIPA 2WVVB 3NR0A 4L56A 2VC7A 1LWJA 1ZRQA 3NQ8A 1XIJA 1OADA 2VXNA 3CS2A 2XGBA 2Y6ZA 3LCXA 1E6XM 3CWNA 3T8QA 1Q6CA 4DB7A 1FWEC 3KHJA 4O19A 1V0MA 2DT3A 1HFBA 3DI1A 2Y8VA 4WJEA 2GGGA 5D4YA 3TSMA 1BXBA 5HR7A 4JEJA 3MP4A 1WXJA 4EE9A 1Z7AA 3KZSA 3UXIA 2HK1A 3JVAA 3L4VA 2OOGA 3WDQA 2GVLA 5CSRA 5CQ1A 1WKEA 3EWDA 2X09A 3THDA 3NTYA 2RDUA 3RLGA 2VQTA 4JIRA 2AL2B 4EXAA 3GLCA 1GHRA 1TIMA 1H60A 1QR7A 3THQA 4H9TA 3P0WA 4E3VA 5IXEA 2J79A 2I56A 5HUPA 4HA3A 1TVNA 4ORIA 4I7UA 4P8UA 3W84A 3A23A 1GVEA 4K3ZA 3QMRA 3NDYA 3ZWTA 1E4IA 2Z1XA 2QIIA 2E8ZA 2QPSA 3B9AA 3QR8A 3AXIA 3MBFA 5DXXA 1W3TA 2VO5A 1QU4A 3RMEA 4QS5A 3S6DA 3EPOA 3KZPA 2F61A 5AECA 3H2AA 1Q5MA 1XLJA 2EJAA 1A4MA 1XIFA 3K4WA 3CL7A 3AYSA 4D6FA 5D02A 4GX9A 4TIMA 3TJXA 4JL2A 4QQUA 1MZRA 3L23A 5A69A 4PMXA 1G4SA 4E38A 1UD5A 5F2MA 6REQA 4HHPA 1JZ8A 2OB3A 3BLPX 3R2GA 1NFPA 4CN6A 4DJEA 3AHTA 3EGJA 1DTNA 3TUUA 2ZRXA 3EAUA 1H50A 7ENLA 5EMLA 1GQLA 1KBBA 3D0CA 1E56A 2Z6JA 2X1IA 3AO0A 2A1YA 2GGEA 3N14A 2G3MA 4PRWA 4E4UA 2OZ0A 3CIVA 4DM1A 2B7NA 1P1XA 1E5NA 3K8MA 4HNLA 2D3LA 3W0KA 3GG1A 4GMEA 4C1NA 1AMYA 3GC2A 1VFUA 2D2GA 3BL3A 4QIUA 4WXYA 3MHFA 1YDVA 1DIDA 1KXVA 2WAGA 4JN8A 3ELFA 3W7LA 1VP5A 5CPNA 2F7FA 3GB6A 4FXFA 4A29A 1LBLA 2P88A 5DN1A 1GTHA 2NVAA 1LT7A 1UPPA 3Q94A 3GNRA 2JFEX 4QEEA 5DANA 4LAUA 2ON3A 4Q6JA 1K4HA 3HFYA 4QGCA 3MPGA 2V2DA 5KEZA 3CV6A 4JHMA 3NPVA 3UJFA 3EX6A 5DQPA 4GXMA 3U6WA 4PCFA 4XAZA 1SO6A 3IUDA 2HBVA 3MCNA 5DBUA 1U5VA 3NZPA 3SRKA 3U2OA 3WMBA 1P43A 1GQJA 1C82A 4LUSB 3NAVA 4JTSA 3NZGA 5E9AA 1E9IA 1PKNA 5D8WA 1V02A 4D1IA 3E3HA 2Y85A 2H8XA 1FWHC 2OO0A 5JH2A 3JU2A 4AC1X 1WDWA 2GZXA 1ZFJA 2F84A 3QBUA 1FA2A 3RMJA 2QQ6A 4GY0A 4MUZA 5A8GA 1BQCA 4AC7C 1XHGA 2WW5A 5AC4A 1DE6A 5EY5A 3WH8A 2NQJA 3OVPA 3ARPA 4J2MA 1RQBA 2PWEA 1W9PA 2Z0IA 3E96A 3MWAA 4C6OA 1GOXA 4MWAE 5HK4A 3L9CA 5D8ZA 2ZVRA 4GYKA 2OEMA 1JCYA 2C0HA 2G37A 4JIIX 1TV7A 2PDXA 3CQ0A 2A0NA 2ZZ1A 4E0CA 2Z7KA 5HUOA 3JZUA 1HQTA 4DWSB 3OO2A 2YEPF 4H9UA 5H8UA 3VOCA 4HSOA 3N6JA 1JPKA 3RJYA 1GVIA 4JNYA 4DM2A 2POTA 4O53A 4RXGA 4ZTXA 4BF9A 4J5NA 4OU1A 2DSKA 1X8FA 2E25A 1LYXA 4FR6A 1UD3A 1UOZA 1XD1A 1R9XA 2J7HA 5HMDA 3DBPA 3QN3A 3ZJKA 3VGFA 3CHDA 2RFGA 4S2BA 2TODA 3CAQA 4HQVA 5EMJA