4D74A

1.57 a crystal structure of erwinia amylovora tyrosine phosphatase amsi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
151
structure length
151
Chain Sequence
b'NLYFQGAMVNSILVVCIGNICRSPTGERLLKAALPERKIASAGLKAMVGGSADETASIVANEHGVSLQDHVAQQLTADMCRDSDLILVMEKKHIDLVCRINPSVRGKTMLFGHWINQQEIADPYKKSRDAFEAVYGVLENAAQKWVNALSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization and 1.57 A Resolution Structure of the Key Fire Blight Phosphatase Amsi from Erwinia Amylovora
pubmed doi rcsb
molecule keywords PROTEIN-TYROSINE-PHOSPHATASE AMSI
source organism Erwinia amylovora
molecule tags Hydrolase
total genus 57
structure length 151
sequence length 151
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d74A00
3C3KA 2E4WA 3FGZA 2IDMA 2QR3A 3KSMA 1ZH2A 2JBAA 3CS3A 3QLVC 3QLVA 4ETMA 2PUDA 4TLLB 1E6KA 4FE4A 1CYEA 1P6QA 2JVKA 1XHEA 3JVDA 4ETIA 3MMNA 4G86A 3M9XA 3EGCA 1WETA 5IUNC 1KGSA 1USGA 2B4AA 3JPWA 5C5EA 1EHCA 3OMXA 3RVLA 5EWLB 2E4XA 4G0ZA 3CKMA 1JYFA 3BRQA 4PZ0A 4Z9AA 3ILYA 3IP5A 4QYWA 1VKRA 2DRIA 4EUKA 2PUCA 4IILA 1ISSA 1ZESA 2NUBA 3H6HA 4ZJPA 4F3TA 4MRMB 1LBIA 3HUUA 5KWSA 5DGCA 5FWYA 2NT4A 2RGYA 4G0YA 4FE7A 4RY0A 3BRSA 2IPMA 3KCNA 2H0AA 1SXIA 1MVOA 3HVRA 2QXYA 3A0RB 5TPWA 5FWXB 4ZPJA 4OLBA 4UHJA 2OQRA 3TO5A 2PUGA 2PLNA 1PUXA 2FMKA 1W25A 4LE1A 3SM9A 3UK0A 1RXEA 2P4UA 1DBWA 3K4HA 2IPAB 3OM1A 4KQCA 4WUTA 5JS2A 2FVYA 3ROFA 3RVOA 2I6FA 3VNBA 5JS1A 1MIHA 3DGFC 4ZMRA 3O75A 1NXPA 3H5TA 1QO0D 3CZ5A 2CHEA 3MIZA 4UHKA 6CHYA 1SRRA 4EYGA 4Z9BA 4D6YA 3NNSA 3BREA 2MYPA 2E4YA 3O1JC 5IEJA 3HM9A 4MPTA 1VLZA 4OBBA 4D74A 4S05A 1DC8A 2FN8A 2ZWMA 1BDJA 4MQEB 4NCBA 3FDFA 4MQFB 1CEYA 4MS3B 3EQZA 4O5AA 1DRJA 2NT3A 5JNUA 4GPAA 3GWGA 4IMIB 4G0MA 4KQ9A 4XLTA 4JA2A 2MSWA 2BGGA 3HDVA 3OLXA 4MR9B 4HNRA 2WWVD 3H5OA 5FWXA 3FFTA 1A0OA 1Z18A 3RH0A 2LP4Y 4MS1B 3T95A 3IP7A 3CG0A 5F64A 2JK1A 3GYBA 1JHZA 2JBAB 1QP0A 3LUHA 5HKOA 2YHAA 1KMIY 4Z4IA 2FN9A 2WMYA 2ZAYA 4G97A 1SXHA 1DBQA 3RVNA 1MB3A 2PJUA 5C5CA 3A10A 5HQJA 3GBPA 3Q7TA 1B00A 1GLGA 3LUKA 4ML3A 1XHFA 2MSLA 3IP9A 1I3CA 3LUJA 5TPZA 2VK2A 3RVRA 1E2BA 2FQXA 4KV7A 4YLEA 2E4VA 1Z25A 4JAVC 2A9PA 3LMKA 4KK3A 1J56A 1K68A 2PUBA 3GBVA 1AB6A 2WB4A 3KKEA 1KRXA 1EAYA 4Z0NA 4KZKA 4RSMA 3H75A 4OLAA 3LUAA 4Z4HA 4NICA 5TQ2B 3DLHA 3HZHA 3H5WA 3I45A 2OENG 5CHYA 3ILHA 1U2PA 3MF4A 1YMUA 3N8IA 1QMPA 4MQFA 4RK6A 2A9OA 4FB4A 4MS3A 5TPWB 1ABFA 3MM4A 4EYOA 2CHFA 1PEAA 3H5VA 1QQBA 3RVMA 2H3HA 3KG2A 3SG0A 1S8NA 3Q9SA 1U04A 1ZHHA 3CHYA 3EDCA 3N53A 4LZLA 4RWEA 4MLDA 4DQDA 5BR1A 8ABPA 4EVQA 1JFSA 2E4ZA 4MS1A 3RQIA 2Q5CA 4OG2A 3EJWA 1YVUA 2A9RA 6ABPA 2FMHA 4ZYLA 5CNMA 1D4ZA 3H1GA 4HNSA 5T7BA 4S04A 3H1EA 4TMYA 1EWVA 4RK0A 2QW1A 2GWRA 2GX6A 3FMVA 3KTOA 3OO0A 4XXHA 4DN6A 4N76A 5TQ0A 3DZDA 3NBMA 3CNBA 4F11A 4JP1A 2IOYA 3HDGA 2PL1A 3O2SB 1JDPA 2L2QA 2RJNA 3CRNA 3LUDA 2FMIA 2FEKA 5B3JC 5BRJA 5B3JA 1DCMA 2RDMA 1PEYA 5IX8A 2HQOA 3IPAA 1PHRA 4LE2A 1U8TA 2FLWA 1NXOA 1FSPA 4MGEA 2JVJA 1L5YA 4PYRA 4PICA 2FQWA 5TQ2A 3HJFA 4ZMSA 3OQNA 1FQWA 3E61A 1BVHA 3HCWA 4RY9A 5CNJA 4KREA 5IULC 1FFGA 1DCKA 4B09A 4LRQA 4NCAA 2YHBA 1YIOA 3O2JA 4JOQA 1D5WA 1K66A 4PEVA 2JCGA 3IP6A 3SNKA 1RZRD 1EFAA 1H9CA 5JNTA 1YMVA 2P9HA 1URPA 3D02A 1Y1LA 2AYXA 3LUGA 4Z4EA 4KK4A 1TM2A 4YP9A 3IPCA 4NV3A 2ID7A 3KLOA 3LFTA 1ZGGA 1NXVA 4QPJC 4N0QA 2ID9A 4KFCA 1GUDA 2FQYA 3BBLA 3QX9A 4O1IA 5EWMA 2TMYA 1RPJA 1TVMA 4WZZA 5KC9A 5IEBA 1QNLA 4PE5B 1M2EA 3LUFA 1Z12A 1JF8A 3QLTA 4TLMB 3C97A 5PNTA 5TPZD 1NXXA 1ZGZA 1ZN2A 5TQJA 1JLKA 3O1IC 3RVQA 3CTPA 4RY8A 1ZDMA 3CG4A 3RVKA 1ZH4A 4LDZA 4M88A 4QYMA 3SY8A 1QP7A 3HEBA 3KHTA 1NXTA 3IDOA 3A3KA 3OLZA 3Q15C 3G1WA 3GRCA 3CFYA 1W9HA 1OXBB 1RZRA 3C3MA 3H5IA 5JNRA 4OTZA 1ZVVA 1ABEA 4RZSA 1RNLA 4W5QA 3M6MD 4EYKA 5EWJA 5T3YA 1USIA 2HJ9A 3JVIA 4H3KB 3HXMA 1FFSA 3CLKA 2LBPA 1BAPA 2VUHB 4MLCA 2LUOA 3LOPA 1JFVA 1F51E 5BQ3A 3HO1A 2V0NA 4Z4CA 1AB5A 1GCAA 4YR7A 4JASB 1EWKA 4YRZA 3I09A 1QO0A 4NQRA 5IC5A 1ZY2A 1NXSA 4OATA 2FXIA 2GKGA 1QKKA 5TQ0B 5ED4A 3N75A 2RJOA 3KS9A 4RXTA 1NY5A 4XARA 1MB0A 1T34A 1C4WA 1Z15A 2A9QA 4WXMA 4LE0A 5FBKA 4ETNA 4Z4GA 1DP4A 7ABPA 2F8SA 4RK7A 3TB6A 1JL3A 4EVSA 2HPHA 3DGEC 4W5TA 4HNQA 2XDYA 5JNVA 3N6VA 3EAFA 4N0PA 2JB9A 2HQRA 1MAVA 1D2AA 1NTRA 3JY6A 4H3HB 3NNDA 3KYIB 4QICA 3EQ2A 3Q7RA 4XASA 3CU5A 3OQMA 4KVFA 2FEWB 1F4VA 2NZVG 2PKXA 5KQMA 2IKSA 3EULA 3O21A 4N03A 5HSGA 4E7OA 3OLYA 2PUEA 3H1FA 2JVIA 3QELB 2QZJA 4G0PA 4RK5A 5DKFA 3TD9A 1U2QA 4F12A 4Q6BA 4Z4FA 2WJAA 3UKJA 4YCSA 2MYUA 3HUTA 1LJLA 2QVGA 1VPWA 1C0EA 3LKVA 3CZCA 1JDNA 4EY3A 2E4UA 2R25B 3NNNA 2CWDA 3T6KA 1JWLA 3HV2A 5EWMB 4RXUA 3E3MA 3GT7A 2FSPA 9ABPA 3K9CA 4RV5A 4TN5A 1YK0A 1P8AA 2PUAA 3LKBA 5I4CA 1D1QA 2FMFA 4W5NA 2FEPA 1IIBA 3KLNA 3BILA 3P9YA 4LDAA 4JB0A 4EVRA 3T8YA 2IPLA 3QLUC 3QLUA 2LPMA 3A0UA 3VNAA 4MR7A 4N47A 4RXMA 2R47A 3DBIA 3NHMA 2L18A 1GUBA 5IBQA 1LBHA 3N0XA 1BDIA 2JRLA 4P1ZA 2FKAA 4HYEA 3Q7SA 1PNRA 2WRZA 2N9UA 4RK4A 5EWJB 4G0QA 1DZ3A 4XAQA 3T38A 5ABPA 1L5ZA 2PUFA 3QK7A 2HQBA 3QELA 4RDCA 4O1HA 2WJWA 4MYRA 3S99A 3W9SA 1M5UA 4F06A 1JYEA 3OMWA 1BA2A 3C6QA 4G0OA 2X7XA 3OLVA 3LUCA 2PMCA 1Z13A 2MYNA 3N0RA 1QPZA 2MYTA 1SXGA 3D8UA 3H5LA 2F8TA 3QX8A 3OQOA 1Z2DA 5BRAA 4MS4B 3C3WA 3GA5A 1ZITA 3QEMA 1APBA 2AYZA 5GOTA 4IGAA 1JFTA 1XWWA 1KRWA 1ZAYA 2QV0A 1SD5A 2IYNA 1U0SY 3LTEA 5GQSA 5KI6A 3KYJB 3DLBA 4KRFA 1TLFA 1NXWA 3HS3A 3HSYA 3Q41A 4IF4A 2WY2D 1QQAA 4WT7A 3MYYA 1FFWA 5DCLA 4DADA 1Z16A 3FFWA 5FBHA 2PE5A 3TMYA 5CNIA 1JX6A 3SAJA 4KMRA 1DG9A 3JTEA 1QP4A 4WXEA 3F6PA 4EGSA 1CHNA 3N0WA 1JH9A 1YS6A 3I42A 4XFKA 1ISRA 5D2CA 2VUIB 4LX8A 4D6XA 5EWLA 2LIVA 4Z99A 4YWHA 5JNSA 1TJYA 1E6MA 4GNRA 3H6GA 2PL9A 1LK0A 1JBEA 1PNTA 3MA0A 4WWHA 3JPYA 1OXKB 3O1HB 4MRMA 2B1JA 3B2NA 3URMA 2HSGA 3L49A 3G85A 1DCFA 3L6UA 3M9WA 1P6UA 3OM0A 4MR8B 5TE9A 1R8JA 1YS7A 4H60A 4JB2A 5KQGA 4KPYA 2QU7A 1BDHA 3F6CA 2L17A 2J48A 4MS4A 1NATA 1M2FA 3OLWA 1DBPA 1DRKA 1YK1A 5IUJC 5KQPA 4MAAA 3F73A 5E3JA 3OO1A 5HM6A 4RS3A 4MR7B 1LJUA 2QSJA 4KNYA 4W5RA 3F7NA 1GCGA 4EYQA 3SQNA 2NZUG 3QEKA 1RXIA 2GBPA 3MQ4A 4YGXB 1A04A 3O2QB 2R48A 4G0XA 4Q7EA 1USKA 3KJXA 3JS5A 4N41A 1Z26A 5DLEA 4P98A 2IPNA 1DC7A 1EWTA 2O20A 5CNKA 3RVSA 3RVJA 2W42A 3TX6A 2MSKA 4Y9TA 2FLKA 2R4QA 1DJMA 1M5TA 1E6LA 5KQLA 5KC8A 1UDRA 4Q6WA 2PAFA 5FWYB 3HK2A 3UUGA 3I5AA 1A2OA 3O74A 1D1PA 4IRXA 5DTEA 2FW0A 4F8JA 4YO7A 4RKQA 4W5OA 4L4UA 2GI4A 4MQEA 4IMJB 1P2FA 1TMYA 3ROTA 2M1ZA 3FFXA 3QEMB 1VRVA 4L85A 4MR8A 4CBVA 4RU1A 4YV7A 2M98A 3NHZA 2KYRA 4MR9A 3EODA 3GL9A 4YS6A 1Z17A 3RVPA 1YTUA 5IUKC 2FTKE 2VYCA 1Z2EA 3GV0A 4RK1A 5JNWA 1HEYA 2L19A 4RKRA 2QVCA 4E7PA 2CD7A 3R0JA
chains in the Genus database with same CATH superfamily
3GF4A 4AZ3A 4EI8A 1IZ9A 2ZIEA 2CVQA 3N8HA 1Z4LA 2G5CA 3FCOA 4HFRA 4PN7A 4R6WA 1Y34E 4XQ9A 4GMGA 3ZGXA 1XZMA 4FBGA 4AD8A 4L07A 1X0XA 2VWHA 3RBVA 3IP3A 2OHHA 4QOSA 1WMFA 1SAYA 1TIKA 1XU7A 4D7AA 3GGGA 1TKRA 3JQPA 3EBLA 4UE3S 3WYDA 3M9XA 3NTXA 1N9ZA 1EFRD 3QY0A 4V3CA 2IHJA 2GXSA 3UT5A 5AVJA 3UKDA 3WQBA 2AF4C 1UADA 4NECA 3DKKA 3FPBA 5FBZA 3FNIA 3C87A 2X4LA 5K0ZA 1U2GA 2J3HA 4OBWA 4KLZA 5K20A 2JJMA 1VE7A 1N2GA 4MHOA 1KIAA 5D3MA 4HP8A 2A86A 2PX4A 1A76A 5HOEA 2C31A 2MSEB 3L84A 4TV9F 3QWHA 3R9KA 4G09A 2UXBB 3R0QA 1P3Y1 2AG8A 1SG0A 3HUUA 2GJ8A 4AX8A 3N6RA 4RHYA 2QU8A 5SZHB 4AP5A 2B9VA 2OBLA 1E2JA 1MF7A 1R4MB 3C7AA 1OX4B 1UBFA 1OXXK 3PHGA 4KLRA 5DK6A 4MB0A 3GR6A 2EF0A 2YY7A 1DO8A 1M0TA 2ZI7A 3TO5A 1ZHOA 3C3DA 3M6UA 4MKZA 1CV2A 3CN9A 3IR7A 2ZT8A 1HM5A 5T3UA 5CDYA 2C94A 3PE6A 4L95C 4PC3A 3ZHVA 2W58A 5IK2D 2A33A 5CA1A 2ZS9A 1KZYC 5JDCC 1O0CA 1XXHA 3MLBA 2J9ZB 4BUJA 4HTFB 1TDJA 4KBYA 5B12A 2FSVA 5JXWA 1JEQB 1FSGA 1QFMA 4FNMA 5EHGA 5I5EA 2CJFA 4KTTE 4S1WA 4BFSA 3QRWA 1IN6A 4JVOA 3W5VA 2O8FB 2Y1XA 1SKMA 2SKEA 1BYIA 2CHEA 4C0AC 1NIPA 1FK8A 3EA0A 4Z9BA 4KAAA 5IBPA 3UJPA 2PKRA 3OM8A 1ZO8A 4UAJA 3V5NA 5HQ3B 1JWBB 3CNNA 1QRUA 3PLAE 2CF6A 3HM9A 3RJMA 4WQMA 3MC1A 3VR4H 2ZVQX 2NUTB 1R5NA 2JFXA 3C85A 2ZWMA 1O94D 5EQTA 1DAEA 4I8XA 2VXOA 1H5QA 2VHQA 3F49S 4P3YA 2W98A 4R8LA 4LPKA 2YV5A 3EF0A 3K9LA 3P9CA 1PIWA 4X60A 3IPXA 1QG6A 4JN6B 1ACJA 4Y2GA 1ODKA 2AF3C 3GT4A 4N6NA 1KYQA 5J1TB 1XALA 5FQNA 3BDVA 3CW9A 4GVPA 4OGKA 5E9WA 4JEUA 1USWA 2P4QA 2IZ7A 4RABA 3LVFO 3THWA 1V11A 2H7CA 2AVNA 5ITZB 2J9XB 3GYBA 2ZM5A 4EGCB 1FRNA 2WD8A 3GVPA 3PC6A 1F8GA 1SZJG 3GJRA 4GLLA 1KKUA 5HP4A 1BRMA 1O97D 2C4TA 2LGJA 1U0EA 4LAFA 4B3FX 4NFHA 1PR9A 1KEKA 4MI9A 5F78A 1RYYA 1GPWB 1OBVA 4AO6A 2G4CA 2IQ5A 3R41A 3I1FA 1XAIA 1A5TA 1J23A 3K5HA 3R6GA 4G5SA 4IM7A 2ETVA 4RNDB 5AHXA 3V46A 4ZI7F 1T9AA 1QV6A 2HMAA 1EHYA 2I8LA 3NHYA 2CD9A 4ED9A 5B2EA 2RAVA 2WBLC 2ZCJA 5C8YA 2HNBA 1P1IA 3L79A 2Q28A 4WBNB 1MZPA 2CSXA 2OE2A 3CNHA 1CJTC 1EESA 1IFXA 2R9VA 4CIVA 2GVZC 3FKSD 1GL7A 1D0SA 3D4BA 4UC0A 3U1TA 5T8KC 4QU0A 4LTDA 1B16A 1RBYA 1U2PA 3R3SA 4LHEA 4YMLA 3ZW8A 1YL7A 4RK6A 3EEIA 2X1LA 5IRCD 4IJWA 3ZNPA 3HXKA 1QQTA 4FGLA 5THXA 3WHPA 1CZOA 3VHXB 2J3MA 1G64A 1NOJA 1W1WA 5HILA 1I4OA 4AG5A 4BBPA 4LC0A 1UP7A 3Q3CA 4A7PA 4IUCS 3CX8A 3PR2B 1XD8A 3OAAD 3QOFA 5KX5B 2AFIA 3EZ7A 1WOMA 2V9CA 3VZQA 4JX8A 2C5LA 2VRCA 4MLPA 2Q5CA 2X76A 4A6PA 3PPIA 1EDEA 1W0CA 4NYMQ 2AFHA 2NSJA 4J0QA 1EEXB 3MK31 3DLPX 1IHPA 2QPLA 3MLAA 1D7AA 3GLHE 4KP7A 3X1KA 4ADSG 2YV3A 5EJ7A 5LJLA 1EWVA 3ECAA 4P31A 5JXIA 3TSWA 2FMUA 3WK8A 1H6DA 1WO8A 1F4LA 1XEWX 5DMHA 1JTFA 3D2LA 5BP7A 3NBMA 3VYWA 5K0LA 1O6ZA 1GN9A 1PZEA 2WT4A 2XMBA 4V2IA 3GAZA 3AF3A 1QQ7A 4HNVA 4ND8A 1QGUB 4GMKA 5A06A 1DWUA 9LDBA 2HUPA 3VKHA 4UTRA 1KTVA 3EEBA 1LLCA 3C7DB 3P2EA 3KYBA 4TV9B 3TIVA 5H02A 4JLKA 3GCGA 4CQLB 3ETLA 3RARA 2X3FA 4JT8A 6Q21A 1GPBA 4MTCA 1ONPA 4OQLA 4XYMA 5CR9A 1FZTA 1Z0FA 3E61A 3L1JA 8ADHA 1ZNXA 5JUWA 1NURA 5KPJA 1K5DA 4G5QA 3HKBA 4M4SA 4BY9E 1NUPA 4EG0A 3U80A 3MINB 5ILQA 1YE8A 1MO4A 4NS4A 1IUOA 4PGMA 3D0OA 1NYRA 5LB2A 4WZAE 1TUIA 3L18A 4ND5A 1YCHA 5AKEA 1WVIA 5A3RA 3JALA 4HI0E 1WSBA 4PSUA 1O58A 4Q3NA 5EP2A 1GKIA 4JLPA 4WNAA 4CM7A 5BVHB 3LUGA 3KB2A 4ZAZA 5LD2B 4D3XA 3KU4A 3GAMA 4FBLA 4NV3A 3SCZA 3WRXC 3JWJA 3KV3O 3QKSA 1H0HA 5ALMA 4BLRA 4R5MA 4E22A 2OCBA 1MC8A 1RI3A 4UKDA 4YRMA 1R88A 2FQYA 3R9WA 2RSLA 1K27A 2JGJA 4M0EA 5EGSA 4JC5A 2C8LA 2VWPA 3PF9A 4QFDA 3VX4A 4XDYA 1XMJA 3NEPX 5FNVA 4FYXA 3GAFA 4JQSA 4PIMA 1LPPA 2H31A 3U7JA 3GJYA 4H3SA 4S1OA 2I91A 3AI1A 3DQZA 2BMEA 2AQHA 5EJIA 3CG4A 1E2NA 1QRDA 1T9GR 2TMGA 4G9GA 5E7QA 1XTIA 3IIEA 5BSRA 3JZFA 3FZNA 4QGHA 4UZEA 1BGXT 1WCYA 3VR5D 2R7NA 1K0UA 3OLZA 2H2WA 3OT1B 4ZZ0A 3BGVA 3WL8A 5ICCA 1RMTA 4IIXA 4NOJA 2BTQB 5TMEA 2VHCA 1RP1A 4G89A 5UKDA 5C9ZA 1MEOA 1NQUA 1QK3A 1ZIPA 2Q07A 4E13A 1ATZA 2H54A 1RZRA 2J8ZA 4UTXA 2GCIA 3ESRA 1HPLA 3KQYA 1TLLA 3OZAA 3R3YA 1RNLA 1TQ8A 2RH8A 2VT2A 3NTQA 3HXMA 4ZCPA 1QTNA 1SJ9A 1WHTB 5AJXA 3GFQA 3MPOA 4RF5A 2HU8A 1FXUA 4MWCA 3U26A 2ZQZA 3UM9A 4HGZA 2QTZA 4ES6A 5ARBA 3LCCA 1C30B 1GM5A 4GI5A 1G6Q1 4GDFA 2V0NA 3R5XA 4EKIA 4QOFA 4BEWA 3WDKA 4I6GA 5T4BA 1E3MA 5SY4A 2CKMA 2UYOA 2P30A 1VHLA 1G63A 1V35A 3ZD6A 1DEAA 4Z54A 1C8VB 2ZGVA 3IEKA 1PWXA 4ZI7B 5JR3A 4DEXA 3GN2A 4Z4GA 1E79A 1N1EA 2GBCA 4MQBA 5FBQB 1V43A 3JYPA 4B6EA 1YKFA 1OAOC 3D31A 4EJFA 2QMOA 2OPHA 1E7QA 4HNQA 4ZRMA 3IPYA 2X2FA 1LQ2A 5JNVA 1YDFA 3M4NA 5ALJA 3C5EA 4TXMA 3EGXB 5DV9A 3KC2A 5G0UA 4H3HB 1K8RA 4MWOA 4RY2A 2R2AA 2WJVA 2P0AA 3IKJA 2VLIA 4COOA 2C7OA 3WGLA 3JQGA 2XMGA 3Q7PA 3SHOA 4UVHA 3V8MA 2NZVG 1H2FA 3M1YA 2R1UA 3DE7X 3UA3A 5CG2A 1E0AA 2IKSA 4N03A 1AZWA 3ZWNA 5AESA 2O8CB 3ENQA 1W6RA 1I32A 1Q2XA 1CNEA 4ZKDA 1XVAA 2QSZA 3SGLA 4MITA 5EJFA 1RQGA 4D5EA 1U9YA 3I6MA 2XB9A 4YY3B 4FFDA 4LSMA 1QAQA 1Y48E 3G13A 4JUDX 4QLAA 1N4AA 5BYAA 2P41A 2Z0MA 5E8RA 5HUHA 5J3JA 2NO0A 4DBZA 1OC4A 4L7QA 1C0EA 4LHXA 4ZVOA 1YRYE 1TYCA 2ZE8A 4AIRA 3WWPA 5ILOA 3ICEA 4RDIA 4JI6B 1RYDA 3IGFA 3MCZA 3B8HA 4X8OA 3LLVA 2FSPA 1UXGA 4C89A 1I7DA 4PQFA 4I5FA 2ZANA 1TVKA 2OG1A 4DLUA 1WF6A 5IFKA 1NUUA 3FOFC 2REQA 1DEOA 3NM6B 4IIYA 3FPLA 3LKBA 4RMJA 3RSQA 3UC9A 4DABA 2YICA 1DQZA 2GYYA 2BEJA 4OXXA 3MT8A 5EXSA 3EXG2 3AU8A 1ZUNA 4KGVA 2IVFA 1UXJA 4BNTA 1H42A 2PTGA 5LP6F 1D4OA 3IQWA 3MTIA 3OQPA 1V41E 3TPFA 2MINB 1U3FA 3QPDA 4ZO9A 4ZI5A 4HYEA 3R24A 1Z29A 4KQ6A 1EVIA 1JVNA 4G1UC 1Z0IA 1QH0A 4FOPA 3WYGA 2PH5A 3GW8A 3MVEA 4Y9SA 3TDNA 2D1QA 1A9TA 2VPXA 2CNNA 3CEPB 4EJSC 3VAYA 3LBAA 4RH0A 2BF4A 1L5WA 2OHFA 4ZV9A 4ZOLB 4M1OA 4DWJA 1Y6GA 1ZG3A 3UB2A 3DM9B 3OMWA 2F3QA 1UODA 3CM0A 4ZJZA 1HNWB 3FCUB 2YNMD 2XEXA 4IEEA 4CPDA 1QVZA 3OPVA 1KKLA 4F5DA 4ZFNA 2YN0A 4TL7A 3TOZA 2I4RA 1LXCA 2NSLA 4FYIA 3OOEA 1G18A 1KSHA 4NBVA 4EI7A 5AJYA 1SZDA 4Q47A 4Q9DA 5GPBA 4JJ8A 1NQAO 1YZTA 3DVRX 4ZQFA 4GS5A 3LF1A 3RLFA 3IVRA 2HPZA 4WXPA 4AN0A 3FNHA 2EJUA 3OQ1A 4RKWA 3DLBA 2HLDA 3C98A 4BX0A 3H3JA 2OV2A 4BVBA 2VVTA 1NI5A 1J9GA 3DFKA 1EIWA 1ETHA 1KOJA 1XNGA 1GRVA 2JH9A 2NZJA 3HUEA 3NBYC 1KE2A 5CW2A 3DVLA 1X8LA 2OV4A 3LS2A 1DOZA 3PHBE 4GI1A 4KN5A 5B53A 3R5JA 1QYCA 1T4CB 3TLYA 2PA0A 3SYRA 4A26A 1JKJA 1P0FA 4PVCA 1K86A 1DQYA 1UM9B 1BD4A 1XDGA 3L92A 1BMFA 4QPCA 1PKXA 1MHTA 4OB6A 1Q91A 1QHFA 4HGYA 3VMFA 2XY4A 1I4TD 1J09A 4DOMA 3W5AA 5D2CA 1ONSA 2C9DA 3FR8A 2H17A 5HFJA 5JPCA 1NG9A 4ZOBA 3DLCA 3HYLA 1NN0A 2O0JA 2I4OA 4PS1A 4YWHA 5F3WB 1CUFA 3COZA 3WYBA 2ZETA 3H6GA 3NXSA 2B6HA 1ICIA 1JJAA 1MT3A 3RSFA 4DM7A 5DTMA 3V6LA 2ORVA 2R97A 4B7AA 3JPYA 5ELLA 4NMMA 2PSEA 1NBOA 1TFRA 3KHKA 4HH4A 1M7GA 4WRRA 5EIOA 3SDZA 2AW5A 4IV0A 4LXTA 2AMJA 3KYCB 4FMPA 3AOGA 4RPHA 3D64A 4HX5A 4GH5A 2NPIA 3BHJA 3SMQA 1MTOA 4P9NA 1HDCA 2J48A 3A9RA 1IVSA 2WMDA 2DPGA 1CUHA 1YZVA 3SZMA 3UQYS 4TUYA 4RTSA 3OMLA 1VHTA 1EUCA 4CMEC 3H19A 2AKAB 3RRJA 1B43A 4HEA6 4DUYB 4KFRA 2DP4E 2GVDC 3DFFA 3EBOA 3LDGA 4QBKA 4K9MA 2HLPA 3HMKA 1UIMA 3LGSA 4EVIA 3FPEA 2AMLA 4QGBA 2CBZA 3Q8XB 3IVAA 1LSUA 1GCGA 2I1LA 3IXLA 4M9SA 2O2SA 1M2OB 2IY8A 5BRNA 3U3OA 4BKMA 4ZCRA 1CQXA 1KO8A 2G09A 3HWRA 3I64A 1BE1A 1NBMD 2QA5A 2OXEA 1AF4A 3I28A 3MJEA 1EAMA 1K98A 2HDOA 2AG0A 3MILA 1II8A 5IJ0B 2YZ2A 4WECA 1YJCA 1XZHA 4J1TC 1I6WA 3I9KA 4JUCA 4HEQA 3X1DA 3MTEA 3NH6A 4FD2A 3NC0C 2IPNA 1DC7A 1GG9A 4R7GA 1IMJA 5IKPA 4H3VA 4FEEA 2X0EA 3TCKA 1EEHA 3DT8A 3CX4A 4HRVA 5KQLA 1R0WA 1NBME 3G6WA 1BS2A 3F5QA 4L7VA 3OFNA 4Y0AA 3I5AA 1H6BA 3EW7A 1RZ3A 1Y82A 4KXVA 2CZCA 2YY6A 4UPEA 5EP3A 3JD3A 4ZAXA 1RWOA 3Q0TA 1P0PA 3I9V6 3EVEA 2V96A 1C7JA 3SVZA 5H9WA 1VCMA 2G4LA 2QJWA 3OCUA 3OSUA 1QHHA 2NPOA 4I3FA 5LA6F 2ZRFA 4Q03A 3RU3A 4A6XA 1RLMA 1ZVJA 3QOWA 2HF8A 2J9GA 2PH1A 3MNFA 4LFCB 3WB9A 5IUKC 5FBVB 1K6MA 2VDMB 2QTCA 2VJNA 4CIDA 2G80A 4BLTA 5E3IA 2QVCA 1K97A 1AGRA 3HVUA 1TRKA 3ZUPA 4E7PA 3KVRA 1UUFA 3OJOA 4MP8A 3I12A 4RHXA 2F43A 3HWWA 1MABB 5DOZA 1JE0A 2V7UA 1OLSA 5ALOA 4F8EA 5K1ZA 4LQCA 4ZAVA 4B3SB 3DSRA 1U63A 3EZXA 3FM9A 1E96A 4C04A 1QVAA 1BGWA 3QSYA 3U2QA 1I5EA 2SNIE 1N3LA 2ZPAA 3DFZA 3FCAA 4JCCA 2CMDA 5AKGA 3EY9A 3GHYA 5FDFA 4Y98A 2CFSA 3O3CA 1J99A 2IE8A 1LLFA 3VU9B 2C2OA 1U6JA 1BOOA 2HSJA 2Q9CA 3ZC3A 1I1NA 1UBNA 1LLQA 3M6FA 1HE3A 4WEOA 3M8KA 2GHIA 3MS4A 3SX0A 4TLDA 1Z5PA 2PJDA 4QDKA 5KEIA 5DYNA 1Z37A 2V0CA 4PLWA 5F5XA 4CF4A 1S7GA 3OA0A 4C4RA 1XXHE 2GEBA 4BQOA 2HLNA 3PGA1 4UUOA 3HMQA 3LPCA 3UWMA 3M2PA 2XNSA 2XE8A 3IOYA 3U81A 5ES4B 1RC8A 2QZSA 3D8BA 2Y93A 4KNVA 4KDEA 1U99A 4KO3S 2PR2A 2UYGA 3OE1A 2C5FA 1PAUA 1L7VC 1W25A 2YCLA 1MA3A 5MN5A 4IYRA 2V1UA 4M46A 2HRBA 2P4UA 4C0SA 1WUTA 2AFRA 4NQZA 1ISHA 1G6HA 1XTJA 2Q7XA 1A5BB 2PZAA 5G4LA 3UHAA 5A7GA 1YJAA 4RS4A 1EIZA 1PX0A 5DHUA 5BQPA 2RC6A 1PQYA 4JMLA 4A0FA 5JS1A 1UXHA 2XXJA 2Q1SA 3FYSA 2PZKA 5TMPA 4FFRA 1C3XA 4IF6A 1UK9A 4TTRA 3ZGYA 3AQ4A 1YR9A 5G02A 4ZVUA 4OQ4A 3FSGA 4LY3A 5C8YB 2P2GA 3W06A 4QTUB 1NC1A 1NYQA 3HP7A 3W3AA 3T3OA 5DU2A 4L4YA 1OIXA 1F4PA 2LXNA 2NXJA 3BKXA 2EG5A 1XJCA 4C78A 4H18A 1FPQA 2X5KO 1YZ3A 4K3UA 4PF1A 4NHOA 1IPFA 4DV6B 1DKPA 4A2CA 1WCIB 3ZLJA 3DW3X 2HW8A 4JJ6A 1M33A 4EF4A 1G19A 3KALA 3EQZA 4O5AA 4G1EB 3F8TA 2ZWVA 1Q95A 1PBNA 4LY9A 3FB4A 3WL5A 4HEHA 4Y0NA 1TQ4A 3B5JA 3FZYA 3NETA 3QXJA 3UGJA 2IOQA 1NUAA 2FMTA 2DUMA 1NDQA 1FSZA 3PUHA 3PITA 4FDUA 3C1TA 1H0RA 3UVEA 2XH8A 4G8BA 3MRXA 1ULBA 1GQOA 5CJ2A 2XCRB 1AXRA 5DLPA 1Y3CE 4PXSA 2J6CA 3UMCA 1XFDA 2ZIUB 4CMCA 1Y6FA 2BP7A 2P9TA 2I34A 3OCXA 3OY2A 5DBFA 4H7JA 2VR1A 3UB4A 4MVJD 3DVQX 1Y1PA 1HE1C 4FGUA 1Z4NA 1SXHA 4NOLA 2ZQ5A 3D3JA 4UBNA 4AMBA 5BSEA 5HIKA 2VRCD 3SHQA 3L7IA 1MD9A 2EFEB 2PJUA 3MG9A 4GE0A 4CN9A 1B00A 4GICA 3RSCA 2JLSA 4G4SO 3V00A 1XHFA 4B7XA 3IOCA 1E0KA 4F04A 2HD4A 3DBOB 2FQXA 1FUEA 1L7XA 5IM4F 2PTHA 4A10A 4MVJE 4XJSA 1KHHA 4F6RB 4EABA 5I4IA 3LYAA 1XKTA 3BH0A 2AB0A 3IIMA 5ALWA 2JG3A 2AFIE 3A4TA 2YASA 3A06A 1HL3A 2N42A 4JKYA 4LIPD 2C2MA 4N82A 4X7PA 5TVGA 3STVA 1ZZGA 2IDKA 5FI1B 1VSVA 4CNQA 2ALJA 1N7JA 3OX2A 2C0PA 4DUGA 3U60B 3TIGA 4QTTB 4Z51A 1FDVA 3ZHQA 3FMIA 5LA6B 1VMAA 2CLMB 4WVFA 1II9A 4CKCA 5IKEA 4RE6A 4ZAFA 3VR3A 1GTL1 2VAMA 4ZICA 1MPXA 3EIEA 2AHOA 1XMXA 3HABA 3EGWA 3T5TA 1JFSA 3NWOA 4V38A 3DW1X 3D7SA 3DMDA 3EJWA 1YUNA 1XELA 3CO5A 3DAFA 3K0AA 3ORRA 4DUZB 3QKSB 4REMA 3LWDA 1WXQA 1EP2B 4TMYA 1XP5A 2BKXA 3SYKA 1EJBA 2BBOA 1IG3A 4NATA 3DF9A 4NU8X 3IT2A 1YD7A 1CUCA 3PYMA 4OXKA 5ICEA 4KL8S 1U7WA 1HQDA 4TSKA 4NG5A 4OLHA 3O4IA 1AHIA 4XQ0A 5I9LA 3AQIA 3TNDA 3ITDA 1IU9A 3LUDA 5CFOA 2I2AA 3R3XA 1OU4A 4LECA 5IN4A 1IK4A 1TCBA 1DCMA 1U28C 2VHJA 2XHZA 1NONA 2BFNA 4PRZA 2XNJA 2GZDA 1CW2B 2AH5A 2PPVA 3GH1A 1N8TA 1ZJZA 2AN1A 3IYLW 2P65A 4M21A 4L5YA 3VVCA 3ZV5A 1N8SA 3TAUA 3KFXA 1A9XB 2ZVJA 3EUWA 2IODA 2YVQA 5F7XA 4CI9A 2PVPA 3FW1A 1CY2A 1PJ4A 2MHCA 4TZTA 4UJ3A 5JTTA 2ZYWX 4LYAA 1JIVA 1DT3A 2C5SA 3M49A 1D2GA 2SCUA 2WMOB 4FWIB 4Q9HA 3REQA 4HGPA 5KDOA 4JJ4A 5CCEA 1DUVG 2BHNA 1XLVA 1D5WA 3NALA 4R2LA 5TGZA 3W5IA 2YZMA 4RGVA 2GXUA 4F5ZA 2DQYA 2I7DA 4S1PA 5JZSA 1RZRD 1DS6A 1PU2A 3LKDA 3G7NA 1URPA 3LAWA 1OB2A 4MJ3A 1EGQA 2ASVA 3PL1A 4IX9A 5M2QA 3PKZA 1Y7HA 2JLXA 2X4DA 2GB4A 2H92A 5ICSA 2H0RA 2BE7A 1JV2B 3GRZA 1OV4A 3QYFA 4LOIA 2DUJA 4W9MC 1Q7CA 1RFGE 5EWMA 3A6JA 2I4IA 1V47A 3K0FA 1YHYA 3WNDA 1K7CA 3LBHA 2O19A 2PRJA 4J0EA 3UJAA 5FWNA 2ZE5A 4A27A 3WXBA 3RSLA 3IHLA 1TAHA 2EZUA 2CNDA 4YH1A 3GEIA 3HYRA 3RVQA 4D8TA 1HTTA 4ZT7A 4LXGA 2VSFA 3ICWA 4MI1A 3CX3A 3IO5A 3N59A 1RM4A 4R1LA 4UOZA 1C80A 1MGOA 1E79D 3NPAA 1YNOA 1Z6PA 1YJQA 2BZ1A 1S01A 2QTWB 3KQPA 4NVRA 1GV1A 1G20A 1I51A 1KYYA 4OLJA 3EIHA 4GKBA 5FLYA 3V1MA 4CM4A 2QK4A 4LDRA 1JDBB 4CIBA 3RI3A 3KBOA 3CFYA 2PO7A 5JZVA 3H5IA 3A1FA 3TBHA 3UAZA 4PCUA 4L9RA 4DLNA 5HRUA 1TTTA 1IY0A 2O2JA 2QTBA 3F47A 3ROGA 2P6NA 2GHTA 3UH1A 2XUHA 2VBFA 3PR3A 4AJNA 2HAEA 4F5EA 1FXWF 1NW7A 2GCNA 4OEHA 3OOJA 3RUEA 3T9DA 2X0KA 1RHMA 5BWCA 1TCAA 3WSWA 1RSZA 4A4DA 2VH5R 2R85A 4HRXA 4Z4CA 3JQAB 2EX4A 2CKDA 1WMDA 2A0KA 4NQRA 2BZSA 5D01A 2HCFA 4KVGA 1JIUA 2Q4EA 1FUKA 3N7TA 3N75A 3EXIB 1U5CA 3VYRB 4JXKA 1J0EA 4GUAA 4J8PA 2C7PA 4LJ9A 3DL2A 1C4WA 2C5GA 4FJ2A 3NHFA 4D3ZA 1UWKA 1VB5A 2O5VA 3KJNA 3DOFA 4YTEA 5SYAA 4EVSA 3DGEC 3WJ2A 1QPBA 3W2HA 1ESZA 4AN1A 3CBGA 3AVWA 2W6JD 4JDPA 5DGDA 1QK5A 5E1OA 3CJRA 2H5EA 2O54A 4BO6A 4CQMA 4X7BA 4QICA 3PXEA 2OFPA 5DO9A 1BMTA 1SKYB 5KQRA 3MWEB 4BX8A 3MTJA 1GY8A 4UFNA 3TDKA 3AJ8A 3DUWA 3ASYA 3EFOA 3IP1A 1WLSA 4FN4A 5DHFA 1OUMA 3FHTA 1DBIA 1PDVA 1LPAB 2WJ4A 5C46F 1F0NA 2P2CA 1I3KA 4JR2A 4R0MA 1XTQA 3JYHA 3V8QA 1I7PA 4OVKA 5FTMA 4P35A 4MULA 2NYVA 4YCSA 3ZE9A 2CNWA 1KQNA 3TZCA 1QYVA 4I0WB 1JS1X 4ESEA 2FWRA 3DEIA 5K4GA 5AOBA 2OY0A 3WOVA 4OQFA 4ZJUA 4RF2A 4W5WA 4ENWA 3OPXA 1O9BA 4GXTA 5KVVA 1SUBA 1WPXA 4QT0A 4R9SA 3T6KA 2V59A 3WGZA 1FSFA 2XCLA 4M38A 1XDWA 2ESRA 2JIPA 3E3MA 1N5MA 3GT7A 1OLOA 3NJ8A 3JVUA 4JDUA 4GI3A 3TEMA 3GLRA 2G3YA 3BAFA 1V8FA 1CTQA 4UDYX 3ZE7A 1ECJA 4LYJA 3P19A 5BWNA 4P22A 4HH3C 1K4MA 4F6LA 1P5HA 4P92A 3DVAA 2HRQA 1R10A 2FHSA 3QNWA 2QNRA 5BW8A 4BNJA 2Q4DA 1LVUA 4CJXA 3V8BA 3I2YX 1SKQA 3KPUA 1MRSA 2HLDD 1SBHA 2DWOA 1E3EA 2XOKA 2PZGA 3V4VB 2FKAA 4IIDA 4GWKA 5DI3A 3PRHA 1SO8A 1IEWA 3RROA 4MW7A 1D7OA 4B32A 4BVHA 5BN3A 3PBKA 2GCEA 1Q11A 1OFUX 1Q1ZA 3CCCA 7ADHA 4GW3A 2J7PD 1V7QA 4R16A 1CJBA 3W2FA 2R6GA 2UZAA 4I4TF 5IJWA 2IIPA 3BCHA 3UTDA 3L1HA 4CEHA 5F5NA 5KYWA 1ZWLA 5LYYA 3D1VA 4RMNA 2O1SA 3IALA 4UNRA 4Q21A 1J8MF 1XCMA 2HL6A 5TGDA 2RHHA 2IOFK 1KMHA 1Z4KA 2FLVA 4XQGA 4M7OA 3G8AA 3ZS8A 4D2IA 3BIXA 4OSEA 5B6PA 3MQFA 5C4IA 1XA4A 4JBLA 1B2RA 3U7QA 4OKNA 2VZ9A 4RLSA 4BPBA 4CLHA 2OECA 2HRCA 1QQ5A 4LOJA 3GQBB 2I7VA 1YRWA 2QN7A 2IYNA 4EB6A 1OH8A 4MJ7A 4MX8A 1LC3A 3T12A 5CLJA 3OCVA 1T9GS 1PT8A 2QUKA 3Q8WA 3ZG6A 2Y1OA 5C3UA 1MOQA 2FRDC 1RJ9B 3BSYA 3C5WP 3H5RA 5K4HA 1CK4A 2I71A 2PZLA 3FGPA 4JGBA 1T3GA 4N4AA 1DAIA 4RQAA 2Z9DA 3B51X 4WKPA 4RCZA 4O0MA 5CFRA 2O48X 4UMEA 1Y8ZA 4KMRA 4J43A 4M7PA 2ZI4A 1B6GA 5CBPB 1CY7A 4WY8A 5TF4A 1YF3A 3ISVA 1H6AA 2X7JA 1QP4A 3NTLA 5C1DA 1YACA 4DMLA 4QNRA 3RTCA 3QIVA 2UZ0A 1N36B 3SQMA 4DWOA 4HAZA 1K9VF 4LRSB 1BU5A 4A6EA 4C1NA 1RPNA 4D6XA 2I54A 5BW5A 8ATCA 1NVVR 4R54A 1EWYA 2GT1A 2A1IA 2COUA 3A1WA 5DNVA 2YDYA 3THYB 5LCXA 2NNWB 2YVUA 4OQYA 3Q87B 1P4GA 3ZE6A 4QDTA 4WGFA 3G0OA 2HNKA 1ND6A 1TEXA 2FR0A 2HSGA 4TYNA 3BDIA 3FAZA 1EG2A 3UBMA 1OBFO 4UHFA 4DS3A 4KV9A 4KPYA 2C0CA 1BJTA 4GAEA 1T0PA 5EA2A 4PO3X 1ST3A 4EA8A 1NATA 3EEFA 4MRSA 5I9MA 4GKKB 5JQGB 1K06A 1H05A 4MKXA 1YBFA 4R9NA 3OE7A 1Y3HA 1SA0A 2IPOA 1C29B 1K1EA 3GROA 3K09C 2F43B 2CF5A 4HPWA 1KI6A 5HM6A 1D03A 1S5PA 1SVUA 1LUAA 3UH0A 4IHKA 2W11A 3KUDA 4DLYA 2Y0BA 1RI5A 2JFVA 2QLNA 2N1BA 1L4UA 2OZKA 5JDIA 3FUXA 4H1VA 1FFXA 3QGMA 5IDQA 3D0RA 5CIYA 2H2IA 4D82A 1VZ3A 4ZMBA 1DOHA 3O8OB 1ECPA 4UHBA 3VH3A 1X15A 1ZI8A 3I34X 2Q41A 4UZSA 5DASA 4GLBA 3KHSA 4QECA 1XU9A 2GFHA 3DONA 4UEWA 5K6RA 5GONF 4MVWA 2UXCB 1B1AA 3GT3A 3MCWA 1CB7A 2H4HA 2C2GA 4AY4A 3M1IA 4RCVA 3EZ6A 1I6KA 3N9IA 4J1QA 1A2OA 3HQ4O 3ZJ5A 3G17A 7REQB 2ET6A 4Q4DA 3ID6C 4Y6QA 1V48A 5J2UB 5JRZA 2ZR0A 1GGJA 1XRNA 3BGIA 3NFYA 4EJ0A 1CWUA 1N25A 4Q7JB 2YUTA 2QQEA 3OFKA 2M98A 2CXPA 2HA3A 3EODA 3W8DA 2ILVA 1SGWA 1MBZA 4WK6A 4E4YA 2FTKE 3NTOA 4X84A 3H3XA 1P1CA 2EARA 5A4FS 2D7DA 3UAVA 1ZH0A 1VLVA 1XO1A 2GUGA 5EFOA 4N5LA 3PNMA 1EFUA 2ANBA 4MDYA 4XVRA 3VVBA 3ZV6A 3ANMA 2WM9B 3H1AA 3EC2A 5A6SB 2ZBVA 1VYTA 1GXSA 4G86A 4ZU1X 3G1TA 1WETA 1ZJ5A 4W6ZA 4JLVA 1E7MA 5BUQA 4XVHA 1CUIA 1PNVA 3ZI4A 1Z5NA 3N8DA 4UDXX 2GPTA 4BO1A 1DIHA 4FI3F 4RVNA 4QTYA 3M34A 1PFGA 4I4TB 1ORRA 3SQWA 3QE2A 3V8NA 1YJ8A 3EQ7A 3HJGA 2BF7A 3QFCA 5DRYA 4DYDA 4JBGA 1QR2A 1UT6A 4JGGA 4BTVA 4B3RB 4E1VA 3FWYA 1FTWA 3UG7A 4QDOA 1LC0A 5F9MA 3V4RA 1DJOA 5KBYA 3EPKA 1F17A 1FTGA 5KTYA 2RGYA 3DR3A 3HP4A 2CYCA 1LWOA 3NYRA 2IPMA 1NNSA 5A4AA 3KCNA 3LYHA 1NW4A 1E2QA 3E2IA 3NEAA 3T99A 3WIEA 1LW7A 2AX4A 3LIPA 4BP8A 4R1UA 3WBKA 2EJBA 3RS4A 1UOPA 3FNFA 1VG0B 1V3VA 2WVGA 2OO3A 3KQKA 4OSOA 2NO1A 2X0IA 4TWZA 4G1BA 2IXAA 3CGGA 4CCYA 1PD1A 1FFAA 4Y2RA 5A0VA 1CS0B 3OTQA 3AR2A 4DL9A 2A59A 4JD5A 5C37A 5JCXA 1SELA 1R9GA 3GX1A 1Z68A 4B3CA 3V1NA 1P4AA 2MTBA 4IIUA 3H2BA 1C7RA 5F52A 1C8LA 3FSRA 5KYUA 2V7BA 2JD2A 3GRAA 4UUQA 2UYHA 2GFQA 4YPFA 2AJBA 5LKAA 1KEPA 1MV8A 3UJCA 5GADl 2P11A 3RRBA 3MIZA 3JQRA 2BPOA 3ZWCA 4B2LA 3C74A 3CKLA 4NBWA 4EYGA 1U4NA 5BQ5A 4F9EA 4LI3X 1T0JB 2E4YA 3LDUA 4QDXA 2AOXA 3KZMA 1YRAA 5HGXA 5JSHA 2Q3JA 2CVFA 2RBKA 4E5DA 1DC8A 5F1KA 5HDQA 1BDJA 1XT6A 2H11A 3AXSA 4DSOA 3K1AB 4YJFA 5HW0A 3I6ZA 5B30A 5BORA 5K3OA 3KXLA 2XW6A 5JNUA 3ED5A 2VJBA 3QNMA 2NZ2A 5TEWA 3C15C 4DT1B 5ALRA 3VISA 3OEED 1O96A 3ZZ1A 2I2WA 3I3SR 2VJMB 5GAJA 4BOYA 3CUKA 2WWVD 4HZGA 3NHPA 1QIKA 1VHJA 2W43A 2LR0A 3CWZA 2IZ1A 3FA2A 4DV4B 5JVDA 3UFBA 4DUGD 3LA6A 4HAIA 4XW2A 1DXHA 5C53B 4OBEA 5HCUA 2Z2YA 2ECQA 1Z8FA 2BFDB 5JW6A 5KWJA 3TTVA 4YC7A 1ZNWA 1H8EA 2R8YA 2WDPA 2ZRAA 3ECCA 2RGGA 3DHWC 2WTMA 4MIYA 1KK1A 1Y9EA 1IM5A 1D6JA 3S29A 4DREA 1KVRA 1QJ4A 4AJPA 3BFJA 1TKCA 4WW0A 4D79A 4EQ6B 5C5CA 1GQYA 4BEVA 2R44A 1YSCA 3C5CA 2PGXA 3O4VA 4IG9A 5KYTA 1OWLA 1P75A 1CQJA 2B7LA 2XYQA 2WV7A 4NV1A 4KK3A 4ZCMA 1J56A 1CE8B 2DCMA 2FETA 3ROEA 3L0SA 3ILXA 2ZBFA 3TTUA 1PW5A 5EJ6A 2PS3A 4LTMA 3CH7A 4U7TB 1EAYA 4I19A 2OG2A 1M1ZA 3I9MA 3LUAA 4ILEA 2R6CA 2L42A 4GP6A 1ACMA 4AW9A 3QVOA 2GF9A 1ZRHA 2R1TB 3N8IA 2A5YB 5IT4A 5GINE 2EJTA 4RANA 1MH9A 1R37A 3TEFA 3EFHA 3V2IA 3W7AA 1GZ5A 1W9MA 2SCUB 1BE6A 1PEAA 1RRKA 2Q8QA 3ST7A 4BE7B 2V74B 2Q3FA 5KNCA 1NE2A 1RXYA 3FDZA 3NIWA 1I4LD 1SCQA 4AIIA 3HRKA 5FOUA 1P7PA 3QNUA 3TZHA 1Y37A 3HXQA 1ZJ4A 3ZBQA 3N53A 2LKDA 2C3MA 4YPVA 3B7GA 5IAAA 2HK9A 4EHBA 1T5IA 1YL6A 1KYVA 5IZCC 4HNSA 5IVDA 4A3SA 4OHVA 1PQUA 5EZYF 4C5CA 2GWRA 1S7CA 2DCUA 3OO0A 1MRZA 1ES9A 2CFTA 3QWFA 4YDSA 4BMYA 4DN6A 1SXJA 2IYLD 1YZYA 1JN0A 3K0FB 3K7EA 4JCOA 4L73A 3W5UA 4BNYA 1UFKA 1JH8A 3LLCA 2HDWA 2WD7B 3PQ6A 4TS3A 2WYVA 4AMGA 4BE4A 1PBTA 2GDZA 1C9KA 3PRKE 1YR1A 2PRKA 1UP6A 1AHHA 4UJ5A 1YH3A 1P4HA 1AKUA 2VZLA 4U7GA 3AEQA 4F85A 1D0IA 3NEYA 1MG0A 1NSTA 1X2BA 4LPSA 3ZHCA 2XVZA 4N65A 1AKEA 3RRXA 1NTOA 3U09A 5LDHA 3ESCA 2YV1A 1RXVA 2FUNB 2IZOA 1YBHA 4X8MA 4EPVA 5C7IO 4RY9A 1C9EA 3ORYA 2IYTA 2HA5A 3IMFA 2RIPA 4IQ8A 1UDAA 4B09A 2CB9A 3BJRA 3EVNA 3PCRB 2REXB 2GO1A 3A11A 5KHAA 3AR3A 1CS4C 1DKMA 4WN3A 3DBLA 4XYEA 3FGOA 5K3FB 2WWIA 4UVIA 2XT9A 3UIEA 3GU3A 3PNYA 1AV7A 2EJWA 2PUHA 3BMOA 3BSWA 1O2DA 1X0VA 4LCEA 4ZHQF 5J4YA 2I33A 1WW8A 3NJRA 1DAMA 4O3FA 3SS9X 3UPDA 4I1UA 4YCDA 2XNKA 4B85A 1SUAA 2JHCA 4OMFG 4P3NA 5AJVB 1DTWB 2EQ5A 2GKOA 3MFYA 5CFNA 1NXVA 1MH1A 3GGOA 2EQAA 4JBHA 4MJLA 1G20E 3U9SA 4HBZA 4F0JA 2QLJA 5HPYB 3EZLA 2IYQA 5KC9A 4FZJA 1R5OA 4XX0A 5K0SA 3RK4A 2B2CA 3WQQA 4TROA 4IIJA 1MTZA 2NU7A 3EDQA 4XGQA 4IVPA 5MFPA 2QBYA 3AG5A 1GT6A 1OT5A 2XLBA 2QRQA 1PZMA 1J8VA 2QZPA 2FQQA 4FX2A 4TYPA 1NXQA 2I3BA 3DDHA 3RD5A 4YI3A 1OLXA 2PVCA 1NXTA 1KIMA 1A8QA 1FYWA 4ZHSA 2I3ZA 4C20A 1EK5A 3T0GA 2O3RA 2Q9AA 5DEOA 2RBGA 2HK6A 3COVA 3KVVA 2GD6A 3R6LA 3AEKA 4FR2A 4TWBA 4Y3UA 1CUVA 4KGZA 4MHSA 5AK0A 3VM6A 5EKXA 4E5KA 1BU8A 3AF1A 4EYKA 1USIA 1H3FA 3IMCA 1N6IA 2JIZD 3CXUA 2F4NA 4F3RA 1F2TB 2NXEA 4MO2A 4S12A 2X0DA 1R7RA 1F51E 2M9MA 3H99A 4ITUA 4KXXA 4CKEA 3HO1A 4RMGA 1C50A 2QM0A 3JAMA 3VH1A 3IQDB 2XZLA 3ZXUB 3VYTB 1FJHA 2GEDA 1R2QA 4OATA 2DETA 3KL4A 3BEOA 1GZVA 1TEZA 1E20A 4QFMA 1LI4A 3ORQA 1EVZA 4WZBB 4HV4A 2XNCA 2ISCA 2V6FA 1TB4A 2O2XA 1NW8A 2PKEA 3IUYA 3QQPA 2XRZA 2F8SA 3DKVA 5BSTA 5H0IA 3CYFA 3F97A 2P1ZA 3WLSA 2YS6A 1CRWG 5CM8B 1THZA 3NHAA 3PD7A 3S5UA 3PUKA 4CDMA 2VUTA 1GNSA 2J0SA 3BFPA 3TK1A 4E33A 3G49A 1D2AA 3THXA 1FTSA 4I1PA 5L7WA 5F1OA 2C77A 2RHDA 3ZW7A 1NX6A 3UJ3X 1NAIA 1ZM3A 4KVFA 1F4VA 4Y6RA 3WL7A 2VJCA 1Z36A 1YOVB 2R7LA 1DEXA 1PLKA 2KWIA 3SHTA 3SLKA 1CUZA 1NMQA 2VP0A 1LNZA 4UARA 1XEFA 2PUEA 1IEVA 3G6KA 2GN6A 3GNTA 3IAHA 5AVYA 1X9HA 3AHCA 2LTAA 5DKFA 4BRUA 4DSZA 2VTBA 4LBYA 4CTKA 2DM6A 1HQKA 1ZCBA 3UJ9A 5DK4A 4QELA 4AECA 1KU6A 2Q2QA 3AYXB 1ODTC 3FBGA 3LO5A 4LY6A 3WADA 1WZ2A 4HGOA 3LY7A 2FZLA 2IU3A 3H0KA 1I0ZA 4K8RB 4YRPA 3T5GA 3O4FA 1KMHB 5AM2A 3PIRA 5AJZA 1ZXBA 5EZYB 1GSIA 2Q5EA 3CZCA 3FDIA 3JWPA 3LBNA 5BOVA 2FZ5A 3ORSA 3NNNA 3U4HA 1GQRA 1JWLA 2NU6B 2H29A 1KH3A 4ZVRA 4OM7A 4LZAA 5FLKA 4RTPA 4C2TA 2XMSA 3TUJC 2HA6A 1GLVA 3NUQA 4WACA 4D8XA 2YMMA 4DIDA 2NUPA 2OOSA 3USCS 3QE9Y 2WZQA 3KV1A 2VA8A 4URYR 2PNFA 4GE3A 1LX6A 4EB6B 4FFPA 2R96A 4W7SA 1F14A 3RJ5A 5K6TA 1IY2A 2FEPA 2GBFA 5GWXA 3ZE0B 5EYPA 1LS6A 4AJKA 4RULA 2XZDA 1OH5A 2IS4A 2Q45A 2XUDA 4GOLD 1Y6ZA 5EPUA 4LY0A 8MHTA 1UJMA 3W5HA 3WISA 4MRNA 3SEFA 4E1BA 3AERA 1J24A 3QVTA 1GUBA 1KHTA 2WUWE 2YUIA 2ZG6A 4QGSA 2IBSA 3OZFA 4WKGA 3OEHA 1SOVA 4EIWA 1I2BA 1FNBA 1N0WA 5DVZA 4KQGA 1A8IA 3SC4A 3B1YA 3AUSA 1QLHA 4EYEA 3FOZA 4IXMA 4OX9Y 1L5ZA 2QL5A 2H5JA 3NHUA 4LJKA 2O3JA 4RD6A 3AW9A 2X8LA 5CX4A 3ZEAA 3FUWA 5E1BA 4ZHQB 3GLIB 5TT0A 3FI0A 3RUFA 4YAFA 2VK8A 3ZVRA 1U81A 4XUEA 4AAYA 2CZGA 2PMCA 1A7KA 2HMWA 3LL7A 3G2IA 1THGA 3QX8A 3RYHB 2ZU6A 3GI1A 2BV3A 3HYCA 4HAUA 3T1OA 1N1GA 3HU5A 3IERA 1EK2A 4LUCA 1FVOA 3ZWYA 1N6LA 1Z2NX 3UQZA 2BAGA 2OD9A 2E5WA 1SA0B 5IXJA 1XRJA 5LR6A 1ZAYA 1SD5A 3O47A 1V8ZA 3HWSA 4Y2QA 1R9MA 1P1KA 4PLGA 4EEZA 2BDTA 3B60A 1DPFA 5KOHA 4RVCA 2YHIA 2Z5FA 3NS7A 3P0RA 1FFXB 4JLWA 4OHOA 2WHEA 1T25A 5ALSA 4BAUA 2C4MA 1JSZA 2OAP1 2Q1UA 4BV8A 1W5BA 1EFPB 1JMKC 1V6AA 2FP3A 3KVYA 1IM8A 4B71A 2CXRA 1YR6A 2JF0A 3TTTA 2DQSA 5C52B 4CLXA 4WSOA 3EIWA 4FCWA 4EGSA 3CPSA 1JA1A 3CMCO 2XGSA 4MV1A 4DAOA 6YASA 1JH9A 2HJWA 3E9CA 4M0KA 3VC1A 1RIIA 2QN8A 4U6NA 4YQZA 5CP8A 3AILA 4Y1FA 2WM8A 3ZWVA 4GO1A 3FE2A 5J40A 2H7YA 2W2PA 1KL7A 4WMLA 3OZBA 1JPNA 3I4LA 1E6MA 4RPGA 3T3GA 5JNSA 2I9KA 4KQMA 4OI2A 3LPDA 3TSOA 2GRJA 1PNTA 2HRRA 3I9LA 5JJBA 2J0VA 1U3VA 3HVKA 1AKYA 4CTJA 1Y33E 4HDAA 1YRQA 3BERA 1PW7A 1U7HA 4B7CA 1OFVA 3OM0A 4U2EA 3GRUA 3CF4A 4OGGA 5K3AA 2ZKLA 5IZ4A 2EIXA 4XGRA 1P45A 1Q7BA 2HJSA 4O2LA 4X9XA 3NZEA 3SZGA 4JVSB 1VJRA 2YMQA 1LLDA 2ECKA 2Y76A 4IUYA 1YR3A 4EZBA 1ETUA 4PYNA 2QKYA 4ZYWA 3UZUA 1NBIA 1EP9A 3B13B 2FUCA 4RS3A 4Z9XA 2RB4A 2B30A 2VATA 1E94E 3IQXA 1A2KC 1J2EA 1HT2E 2JJ1D 2RKWA 2PS1A 3E27A 3F7NA 3L7YA 3TWOA 5LJIA 5MDHA 1N5LA 2I7CA 4J90A 1MQSA 4JUIA 4B43A 1R1DA 1RLIA 5KMGA 2BUCA 1A04A 2QAGA 2G7ZA 3DDOA 4YJDA 5AW1A 1O6GA 1QE0A 3MWKA 4YRQA 3Q4GA 2QTLA 3ITKA 3LV8A 4L57A 3MZ0A 2CV1A 1CY6A 1M1YE 4O8CA 1M76A 3U9TA 1N3BA 1ORIA 4WX2B 2PU5A 5EZQA 3R7NA 2DU8A 3WYAA 3ZU3A 2CJPA 1P81A 2ODBA 3EPLA 4CLOB 1RAHA 2KI5A 3WVNA 1I6MA 3QJ5A 3R7DA 2Q5IA 3B9PA 3JQEA 3W4KA 3AESA 1L7EA 2I1WA 3EWSA 5B4TA 4E4TA 1Q74A 1ICEA 1UP4A 2HF7A 3TTWA 3QFFA 3PTAA 1E77A 3NO4A 2D0OB 4IMJB 1NFQA 2W7TA 3OLCX 5E4FA 4LYDA 1BMQA 1OY1A 4L8WB 5DN6A 1K9SA 2IH5A 1P7CA 2YVKA 4G5RA 4BZWA 3ETHA 2QTMA 1GPAA 2B99A 1DNPA 1OPXA 3EWAA 1SOUA 3HC7A 4JJEA 5EQFA 3RNOA 5B6JA 2J6IA 4OQDA 4CU2A 5REQA 2C4NA 5DM70 1SUWA 5C1BA 2XBLA 4ZCIA 1UBTS 4DB4A 3G8CA 1AVTA 1VL6A 1L4GA 2NG1A 2XD4A 3EMKA 3K8QA 1XYYA 1JPUA 1IBLB 3WGYA 5IT9A 4RZIA 1E3WA 2ZYDA 4HQ6A 3ZKWA 5KYUB 2C57A 5LQMA 4LFBB 2PBFA 2EWMA 2D5IA 1KY4A 4YUAA 1YDHA 5KAMA 1B7GO 4YAUA 1KGSA 1WKVA 1QGOA 2ZJ4A 3ICQB 4XPIA 4REOA 5ESRA 5CBKA 1UBCA 3NHBA 1UKVY 3AR4A 1JEAA 3ZOZA 1AGPA 3GRVA 2BM0A 3QW4B 3CY6A 3QI7A 4PCAA 4DMKA 2GXAA 2ADMA 2OQVA 3GLGA 2PUCA 5K3EA 2JLAA 3RS3A 3SXUA 4N48A 4K8OA 2IYPA 3WTCA 1JA9A 1UPAA 1KMQA 1UKZA 1L0BA 3QYJA 2ZUUA 4DILA 1EUYA 4WY2A 2IS6A 1BKSB 2BW0A 2WWFA 1Q0HA 2DBVO 2I62A 2QMYA 4L15A 5J47A 1I7QB 2DR0A 1FL9A 1KXJA 1RWNA 3AWDA 4PLYA 4TT3A 1LVHA 2HTEA 2F9FA 2ZJ2A 4BMXA 2JAPA 1LRKA 1YDMA 3CT4A 4BO0A 4D44A 5I48A 1XZAA 4I55F 4B6SA 5K0FA 2EBFX 1KE1A 4CE6A 1A1SA 3QP9A 5LUBA 3G0HA 4V1CA 4Y2YA 5C81A 5BQOA 3GA7A 2WHPB 2WICA 3NAMA 3EIXA 3C16C 4YECA 3DE3X 3Q7QA 1OZGA 2DOKA 2QLTA 3BEDA 3IP8A 4LA4A 5HKKD 1Y5MA 2PNJA 4EELA 1DAHA 1PVOA 3PUYA 2EX0A 2X8AA 5DNUA 1XDBA 4NYJQ 3GEPA 2HA2A 3P9SA 3GRRA 2Y8EA 1H8ED 2J67A 2VF8A 4OA5A 3D3EA 5K8JB 1CEQA 1XB2A 4MUIA 4O2AF 3OJXA 1RFLA 4O4HF 3U37A 1O6BA 4Y2UA 4OU5A 5D00A 3MRVA 4TXLA 5TJ9A 3UPUA 3STWA 4HF7A 3G2HA 4LZOA 2GH1A 1J5XA 1I1QB 4F2DA 5B2FA 3RU9A 3AIOA 1C8KA 3ZCXA 3B8EA 3L82B 1Z74A 5F77A 3A2NA 2Y67A 3EOZA 3FDFA 1WLYA 5I7OA 1JHUA 2H0QA 1M34A 1GIAA 4JXZA 3T7EA 1T6BY 3JCZA 2DH5A 3KDAA 3E22B 4FFBB 2WQ7A 4DLBA 3FDZB 4IFEA 5BSWA 2BGGA 2GS9A 1O4WA 4XWGA 3CPHA 3MIIA 5CYOA 3FY4A 2QN9A 2C00A 5LMCA 4KQEA 2GCOB 3WLNA 4DR4B 2LCIA 3JAKA 3H8VA 1FJ2A 1U2DC 1KZ7B 2PZFA 4ND1A 5F64A 1LFDB 2C9BA 3D4LA 4II7A 3LUHA 4Y9UA 3CX7A 5A9TA 3RHFA 1I5RA 1T9CA 1Z8DA 5DOVA 1XDSA 2IXDA 4M2LA 4YBRA 3BL8A 4RV4A 5FWDA 2C7QA 4HDKB 1SXJB 4L0MA 1VGVA 5BVGA 2XD9A 2C7BA 2RHRA 1RLTA 2FCRA 4YAKA 4CU5A 2JCSA 2QM7A 4E32A 4HNTA 1KI3A 1AHPA 3CRW1 2ZUEA 2MSLA 1YJBA 1I3CA 1X3LA 5AI4A 2VK2A 5AKZA 1VIYA 3RT1A 5EJ9A 1QS0B 2DXIA 2PSJA 1KKMA 4ACBA 4P3PA 2PXCA 4N6OA 1P5JA 3PVSA 4RZHA 3VTZA 1K8YB 3DHYA 5GIPE 2M32A 3GRPA 5ARDA 1T4GA 3JAWA 2ID8A 3KKEA 3SM3A 1VL5A 1KPHA 4HGRA 1VA4A 1P2DA 4OIFA 4X92A 1ECLA 2HZ7A 1DJPA 1WCWA 4IQGA 4BO4A 4IFBA 10MHA 4LWQA 5BWLA 4BNUA 3QE3A 5HYVA 1TA0A 1Y7IA 5JS7A 4H6XA 4OI4A 3AF6A 3U4MA 1MJNA 1U8ZA 3P32A 1Q1AA 1P5FA 2WTUA 1G7TA 2NU9A 4WKBA 4DNPA 3KXPA 4KI0A 4XB6B 2QWXA 4XJXA 5BSGA 1ZAKA 1RQNA 2Z8XA 4PLPA 4TX1A 4UMVA 3WJAA 2HT1A 5HRCA 3BMOB 3ZNNA 4CEJB 4RWEA 4PC2A 4IEIA 1HI9A 1NI4A 4C6TA 4HVLA 4DJTA 2C84A 5L3QA 2D00A 4MYDA 1WXWA 2X5XA 3CR3C 1A9RA 5E6SB 3TG2A 4Q93A 1FLDA 2WU1A 4QEZA 1GG5A 2WVJA 2YJGA 2G76A 3H1EA 5D6NA 3TLJA 3WGUA 2QMZA 3WXMA 4EPYA 2OPBA 2QW1A 4N18A 2PMWB 1KI2A 2PGAA 2X40A 1E6WA 3W7VA 4KVZA 1KQPA 4WXRA 1VL8A 4MKRA 4KLNA 4C4YA 3ABSB 4J3JA 1Z4PX 4OK6A 2BBTA 4DDVA 3UFXA 3H87A 5DULA 1O03A 1UBUS 3SR3A 1N0IA 2O0KA 3S8YA 3KKKA 2AR7A 2QBYB 1RDFA 1RP7A 2FMIA 2ZIWB 2QIPA 3LGXA 3SF8A 5E0KB 3WO1A 2OWEA 3A3OA 2RDMA 4ZVMA 4ODIA 1KYTA 2B94A 4MUYA 2YJ4A 4XFDA 1YQEA 3C6KA 2UUPA 3G7UA 2IIQA 2A7QA 2Q1XA 3BFVA 2XRFA 1VPDA 3OZXA 5CGQB 3ZXXA 5AHOA 3ISJA 4L6IA 5JSYA 4AL4A 3HKEB 5A02A 3RK1A 2FQWA 5J5CA 2RI0A 3UN1A 1KZ9A 1Z88A 3AEKB 5EGNA 1FQWA 1EI9A 2PS0A 5A2QA 2XKAA 3OZ7A 2VSYA 5C31A 3BQ9A 1TMKA 4AG6A 1E8MA 2JI8A 2Q1WA 4GPIB 4I55B 3ZYCA 1AG9A 1XQ1A 2COKA 2JDIA 1FNSA 1N1MA 3GG2A 3IXQA 2II6A 1UZMA 2V7QD 1KDVA 1C0KA 4QUDA 5CPBA 1M1XB 4G5YA 3W4IA 1JU3A 2MR5A 4J7AA 4OK5A 1WXIA 4QPPA 4QYXA 5JDCA 1F2VA 1ZJWA 3UBTA 3WX0A 4FZ3A 2C59A 4D4JA 2FPKA 1TAQA 3LFTA 4MW9A 3GK3A 3TLMA 4DIEA 4QPJC 3HDHA 3T52A 1CUDA 1A72A 1P31A 2PMFA 3PYLA 3RUAA 5I9NA 4KFCA 4E46A 1L4LA 1A77A 1M2VB 1DBRA 5FADA 4KKVA 1ZJYA 3WG9A 3FTEA 2DKOA 3QVSA 1I33A 1MT0A 1Z12A 3E58A 1FP4A 4K05A 2GJ4A 1QTRA 2JHFA 4O2AB 4O4HB 4BYMA 2ZB2A 4N0DA 2NPFA 1N2OA 5D8DA 1H93A 1RRFA 4E12A 3LP6A 1F9AA 3M5DA 3SY8A 1CR2A 2QTRA 1SD2A 3JASB 1ZXLA 3GEBA 5FIUA 1B8OA 4FLMA 4HGNA 4NEQA 5LP6C 1J42A 4I1OA 4OF4A 1MO2A 3BMXA 3H18A 2GEJA 4R9UC 4RSHA 5GONA 1J2TA 3GJ4A 5TNXA 4W4TA 5JXHA 3V7UA 5FOQA 2G1PA 2H63A 3SEQA 3Q5EA 3K92A 1YA4A 4MVJF 3PDIB 1ECBA 2OCLA 5EWJA 4FGWA 4GPEA 4AKHA 4KQJA 1XZPA 1PJ3A 4HLQB 3EZYA 2B92A 2N0SA 3J80A 3NVMB 1XU4A 2DBRA 2Z56A 1C9JA 2HR1A 5JIBA 4QT4A 5AUOB 4M7RA 4XUDA 1TVCA 2Q8NA 3LK6A 3OKCA 2G9VA 4V0MA 2DLDA 4KXMA 4RACA 5CA0A 1SCJA 3ON5A 4A23A 2PL3A 4BFWA 3OQIA 3M6WA 4DA9A 5CFQA 5H81A 1U3DA 5JBIA 1FJGB 3C3AA 1NQOA 2AQIA 1T0UA 1D2NA 2JJYA 2O4CA 2DH6A 1WMAA 5HF8A 3U3JA 1JQAA 1JRLA 3LF2A 4X6YA 3W8NA 2YXLA 1N1DA 1CG6A 1MB0A 2QY9A 1GL9B 1RKVA 1H2XA 2A9QA 3GEDA 3RAPR 3FX2A 4W8OA 3WB2A 4XIYA 5KTTA 4RZQA 4LGCA 5F35A 1KC3A 4C43A 4CFSA 5FPKA 1Y63A 5JJLA 4MGZR 3EMDA 1S4QA 5LQJA 1B73A 2OCYC 2RGUA 4R69A 3OCCA 2B1QA 1NPYA 3M5PA 5BT8A 2WFMA 2O0HA 4N0PA 2HQRA 4UVGA 3A3NA 4ZT2A 5AM3A 1NTRA 3AERB 5I7FA 5GTDA 5T8KA 1ZBQA 3N2IA 3UCEA 5A7FA 2WIGA 4MINA 2VNJA 5TS2A 1J22A 5HX7A 4C7OA 1BWSA 2AZDA 2FN7A 1KJWA 5B55A 2D4AA 1A9SA 5I47A 1EX1A 4QATA 1KETA 1P5RA 2V5UA 1NW9B 5KJCA 3DV2A 4TTTS 2H00A 1YA6A 2QZJA 5M34A 2H18A 1NN5A 4F92B 5T7BA 2ZT7A 2SECE 2QT9A 4LNHA 1ENYA 1Z38A 2QG4A 3NRCA 2W2QA 1IATA 1T1IA 2D5CA 2YW9A 3DTVA 4ZT5A 1FY2A 4X71A 1EQ2A 2C2XA 2E5FA 3AUAA 3HCOA 4DCUA 3DUFB 2GA9A 3W6NA 5I7HA 3LC0A 5JY1A 3ZY6A 3ZZMA 4BTEA 2X1HA 2LZ0A 4DXHA 4MOWA 2FPLA 3P0JA 1TYAE 1LTKA 1E9FA 4E5VA 4UM9B 5JANA 4PXYA 3GFOA 2OO5C 2W90A 1W59A 3A9SA 4FE3A 2J3QA 3C48A 2ATIA 3NEJA 1FDUA 3A3PA 3FNRA 4IRMA 4Z2AA 1ZQ9A 3STYA 1DG3A 2YHIB 4KQ1A 3ROMA 2HWWA 1WRBA 1S3GA 3ZKAA 3BD9A 2W8BA 4DG8A 4M89A 3PK0A 3KEMA 5JJIA 3FYHA 2HPVA 2XVYA 3QHPA 4D56A 2FY8A 3R75A 3DT9A 1YQUA 1TM5E 3WGIA 1XPOA 1X86B 1IL0A 1Z3IX 2OT3B 4AU1A 4BLQA 4QEDA 3OIGA 4G2TA 1FLNA 2C4KA 1OWPA 2FPXA 4G0QA 4QU9A 4WJZA 4Z53A 5FTLA 5ABPA 2RGWA 3LX4A 5FUWA 4KEAA 1M72A 4BMZA 3TI7A 3EISA 3L4KA 2G82A 1O9GA 4IJUA 3ZWOA 3GZNA 4KPEC 1HNNA 2ZBRA 1PCXA 5IP5A 1JSXA 1QOZA 5G1NA 4BCDA 3DE5X 4F06A 4YXWD 5JHGB 4MW2A 1QUEA 3T7CA 2INGX 5H4GA 4PZDA 2EZTA 1YS4A 3EFBA 1CXZA 1HE8B 1EB8A 4HDSB 3WRXA 4BGUA 2F8TA 4J4HA 3VKWA 1Z2DA 2O9JA 1D4FA 1YB2A 1XTUA 1E9SA 2GZHA 3K0CC 3L0BA 1MAHA 4MKHA 3SSOA 3TFQA 4DQXA 3DLTA 3MCAA 4XI9A 5C7OO 1TUGA 4Q4AB 4Q9IA 2CSUA 4YAGA 4HX9A 1E89A 3D2AA 4IXDA 4NENA 2O05A 5CHEA 2EWWA 3ADPA 3FZEA 3HBFA 3QUTA 4LGMA 4PZEA 5K4AA 3I04M 4YRSA 2AJTA 3H8WA 4M8NE 3SIWA 3WJ7A 1U7ZA 3HSYA 3HUDA 1KOLA 4IF4A 1TF5A 4G56A 3SYMA 1GA1A 3MYYA 2I8AA 3OZDA 5A7HA 2WT9A 1EM8A 5IWCA 4B5KA 4JHLA 3W3ZB 2PE5A 1PLJA 4J29A 4XQCA 3R3VA 4TRRA 4YT2A 3QMMA 3L6BA 3HCAA 1W2GA 2B78A 3W05A 3BXOA 3NUZA 3SC6A 1L5FA 3JQ8B 1BDMA 3GDWA 3SP1A 4XFKA 2HFJA 4NHEA 1ISRA 1PJQA 2GK6A 1RMYA 2OEPA 3DZIA 1RR6A 1ZL2A 3H9BA 5LBTA 3OM9A 1AQLA 4KQ2A 4YRNA 1P1BA 4M7WA 4X66B 1MKYA 2DQ4A 3G0BA 4MB6A 1VC2A 1JR3A 2XUPA 4DJ5X 2FFQA 1NWCA 3BB1A 1K5GA 2JKZA 3QE4A 3I2FA 4DSNA 4ETWA 4YAWA 1A2BA 5CXQA 4JYZA 4OB8A 5HDBB 4L9SA 1IJBA 3IOEA 3R77A 5K7SA 1L4FA 1QH9A 4NABA 4PWYA 2ZJFA 1ZA1A 2GYVA 3ED1A 3HFJA 2NO6A 2C5AA 1T9KA 1RWBA 2W6OA 3A6HA 3LW8A 4MPJA 4Q0MA 2QX7A 3IAAA 1T1EA 5LDDC 2Q3DA 2P9JA 4OFWA 4RVFA 3ONVA 1OOEA 1Q5PA 3FNQA 1YFZA 4FYPA 1OAOA 4XD2A 1Q16A 2CXXA 2J5KA 3T5MA 1U90A 2DQZA 2H1LA 4ICIA 521PA 3W1VA 1L2TA 4N9WA 1KA9H 1Z0ZA 5FQOA 3MOIA 5AH0A 4ZPXA 9ATCA 4K26A 1Z0UA 3ZKWB 2HWXA 2P5TB 3LQFA 4TV8A 5AKKA 1CVRA 1WNTA 2Q0SA 4MMXB 2QZ4A 3D8HA 2P5UA 5KNBH 4L6AA 3EQ9A 1HZJA 3OE5A 3PC3A 4W1PA 3H8JA 3CVOA 4P98A 1NBAA 1VIDA 2O20A 1MFZA 3DP9A 4Q3KA 2VDUE 3RVSA 4BKOA 3AUKA 2WJJA 3CLTC 4U0JA 1JKXA 5FUBA 4XYLA 2FOIA 4E2YA 5HHTA 1LPSA 1Z2OX 2FLKA 4JJGA 1EX6A 4J0JA 4RHCA 2OCXA 2WF6A 4PR0A 3QVLA 2J87A 1XG5A 1LH0A 2EGUA 4HQOA 5BR8B 2XDQB 2WLTA 4IWXA 2GI4A 3KR2A 3RHSA 1JDBC 2XT0A 3EQ8A 2GEFA 3FMPB 4GSKA 1KAHA 1B4DA 4RHFA 4TKVB 2PMKA 4QYTA 1KZHA 4DLVA 1ZW6A 1DAPA 1NLZA 3HJCA 3CLRD 5AJHA 5EXPA 2YZGA 3ZH2A 1E3QA 1UM8A 1LNQA 4M8IA 4UBLA 4V1CB 5C1IA 1PYGA 5EXXA 3VZSA 1VBKA 3P2JA 1HFJA 4TMVA 1XXLA 4QFBA 3G2PA 3F4BA 5AQEA 3EVZA 4HYQA 5IKMA 2QR3A 3DXFA 1L7QA 3KSMA 4KPUA 3R74A 1IQ0A 4DSTA 3GLGE 2D7JA 3AZQA 3E35A 1MJHA 1P0CA 1Z4OA 4J16A 3BHNA 2PBZA 4YT5A 3NV7A 1JEJA 4I1VA 2QD4A 1FRQA 4R0VA 3RV3A 1HNZB 1XRMA 1ZC3A 3BMNA 4MV7A 3S2YA 1USGA 2WU0A 1C1HA 4M0FA 2VP9A 3DO8A 5D3QA 4K5QA 4EJSA 3FJ1A 4WUVA 4I3HA 4EUKA 5AK6A 4AC9A 2I2FA 1ZESA 5ESXA 2IRWA 2J9YB 1V3UA 4D4MA 1M34B 5AKXA 3HNOA 5CVTA 5JJCA 5FXMA 1Q1NA 3MMSA 4N7MA 1S2DA 4HS4A 4V0NA 2JGFA 4PZAA 1F7UA 2FZVA 4OOFA 1QLJA 2HH9A 3FVVA 3EGOA 1OYWA 3F3YA 2Z1DA 1V4BA 2X3YA 1V16B 4YJGA 1K63A 3ZVNA 3ZDYB 4ZDJA 3G2OA 3K2IA 1GL6A 5H59A 3VTAA 2QYSA 1RVV1 5CLQA 2DWCA 2ZR8A 3CISA 1L4NA 2A9KA 3DDWA 3LO8A 3EA5A 1JR2A 1U8CB 3P2KA 4RKFA 4IDPA 1R0KA 2FFAA 2ZYGA 3AR9A 3K4HA 3L0IB 1IONA 1RAGA 2N75A 3OM1A 4KN8A 4KQCA 5EP1A 1NT2A 4YMUA 1U0BB 4V24A 3U4QB 3OY7A 3V8EA 5BQFA 3N28A 3Q1LA 4QHTA 1NMSA 5A0TA 4X6XA 3UA4A 3VI3B 1OROA 2DLNA 2E21A 4UNIA 5FFFA 1XQXA 4FFNA 4CTNA 2ZSJA 3ZOKA 1WOYA 4R2WA 4NV0A 5G53C 1C4KA 4KQHA 4MQ5A 1F0YA 2H6EA 3TOCA 4PQGA 3JAWB 4C2AA 3ZLBA 2JZOA 5BWBA 2X9QA 5KOJB 1NBHA 2FGKA 1XTTA 2WIKA 4OBBA 3VO2A 4KE7A 1NMYA 4O02B 2FOLA 2FN8A 3RU2A 3V4ZA 3TGPA 1KMNA 2JJ2D 1BWPA 1JLMA 1Q0LA 3M6XA 2CE2X 5AUPB 1CJKC 5JWRA 3AB8A 1HLFA 2J3JA 2V5VA 3DV0A 2O8NA 4RIGA 2PGDA 4JA2A 2MSWA 4LOHA 4XEUA 1XC7A 4W9RA 2XLCA 5F2OA 1U0TA 1FOEB 3FLEA 2XI4A 3SI7A 4AMYA 5ALEA 4C07A 1A0OA 3CH5A 3AF4A 4CMEA 5L3QB 5IVKA 3HADA 3G02A 2VJPA 1LF0A 1AQYA 3TFWA 2FUG1 5DDIP 1TU4A 3P0EA 5HKOA 2ZSFA 2IEIA 4HH0A 2ADOA 5E4TA 1BXGA 2FWAA 4I9HA 1JPJA 1XMVA 2ORIA 4RVSA 2PXAA 2JIBA 4RJKA 2LE0A 3J7AC 4K2AA 1JMYA 5F2EA 4URZR 3B3FA 4LC9A 1C7ZA 3QPAA 4N3CA 2HSDA 3AK4A 4TXNA 3K9FC 2HIAA 2NSHA 3DMPA 3Q7TA 4J1TA 1E4VA 1GLGA 1UDCA 5LB4A 5TPZA 3LUJA 4JB8A 5KWIA 4FK8A 4KN6A 3SC3A 2PDAA 4IQFA 4ZD6A 3TH5A 3QPWA 1PD0A 4C6HA 1UXIA 1E5VA 4FVTA 4LK2A 4N3GA 1Z3CA 3PHIA 3KTAA 3KOOA 4R1OA 3E9ZA 3ZK8A 4JL6A 4RLHA 3ABZA 1T36A 4KXFB 3ZHOA 5JAQA 4AM8A 1COWA 5FOTA 4BUCA 2BYTA 3ORHA 1I13A 3EXAA 5FD8A 3VMMA 3DOEA 1K3TA 3ADBA 3ZHSA 2HZBA 1G5TA 2B1RA 3SYNA 4A16A 4MQFA 1MV5A 1XZGA 3NCHA 2JFUA 4W9NC 2A0UA 2Z09A 2ZK7A 3MM4A 4INOA 2C9ZA 4U2KA 2PRSA 1X7YA 3P9QA 3LU1A 3RDPA 5K0EA 1N33B 4XIFA 1G7RA 1BXZA 1GUAA 1QG2A 1T9HA 1RRGA 3D81A 1YQXA 1J1IA 1KK2A 3B6MA 4C9BA 2HBYA 4DQDA 2PLRA 3UT0A 2PX3A 5JWOA 1SH7A 4MUKA 5ALVA 2R66A 1AKWA 1HDGO 1YVUA 4ER6A 2VF4X 1K5PA 3VNRA 4DTCA 1T4DA 3DB2A 3F7TA 1EA5A 3K0EA 4ZT4A 1AC5A 4IWYA 1ZD2P 2ZBDA 3U31A 2IP2A 3LP8A 1M2GA 4O8ZA 3RIXA 4RSGA 1OB5A 2WF7A 1XTBA 3HJUA 5TQ0A 2OLKA 4BC0A 2IHKA 2IOYA 1DU4A 1VM6A 4EMBA 2YWRA 1JDPA 1P29A 2VT3A 3GNSA 4IHJF 5AM0A 1BCSB 3W5BA 3TZLA 4DPMA 2Q0XA 1SY7A 4GSLA 3PC7A 2G0TA 4DEYA 3EVFA 1Q21A 5B3JC 3RADC 2PGNA 4DCTA 4OGLA 3IDZA 2F00A 4X63A 4CM5A 3KQWA 3R4CA 3V1UA 4X1IB 3PJEA 2PMEA 4D8WA 1SC1A 4F6CA 1EU1A 4U2DA 1B8UA 4MVXA 1YBVA 4YIHA 4BL5A 2FWPA 2DMRA 4Z5XA 4JJAA 2JARA 3SS8A 4PICA 3GJSA 4TYYA 3ASVA 4QLOA 3ADCA 1WDWB 2YWCA 3NOQA 3U13A 3DMFA 3ELBA 3QEJA 1HFEL 2H65A 3E05A 3STUA 5LKRA 1TZMA 4RQTA 5AD1A 3QF4A 1VSUA 3I30X 2XYRA 3AKZA 3KKNA 2NM0A 3HCCA 4MMYB 4R8SA 2ZUCA 4RHUA 3RJZA 3WZLA 5KS2A 1TQDA 4Q16A 3N74A 5FAKA 1YMVA 1LCIA 2ZIXA 5COAA 1XCOA 4OUDA 3U9LA 3UMSA 1TKBA 1Y1LA 1X74A 3I52A 3OQIB 2PR7A 4HMPA 3KT6A 4K6FA 3W1EA 3KQLA 1N7IA 4QRHA 4A0GA 3EPHA 2A58A 3SZ3A 2ID7A 1NAHA 2Z1NA 3U7RA 4DLRA 2HJGA 2IW1A 3MPUA 4E88A 3DBRB 1R66A 3TIXB 1K88A 1M1NA 2BFCA 2MCFA 3CINA 5CM9C 1AURA 3AOEC 3ZUGA 4C5AA 4DPKA 4Z0PA 5I01A 1KJIA 1B3RA 1TVMA 2IC5A 2IBMA 2YC2C 3HY3A 1BXKA 1HT3A 3BT7A 1AF7A 5DNDA 4D9EA 2XQJA 3LUFA 3ZDXB 2X7HA 5K0NA 3UHPA 1E8DA 4EUNA 3RWBA 3WGHA 3RAFC 5A3SA 3WMEA 4RY8A 2HLHA 3GMDA 4D98A 1YFLA 2WF8A 1U3WA 1M6YA 1BHSA 3EXFA 4XJVA 5IVPA 2QL9A 4YALA 4TS9A 1W1UA 1P0IA 5AVWA 2BMJA 2NW6A 4TL8A 4V0ME 3UK7A 1YDWA 1G59A 3G1WA 3BD7A 3GRCA 3D8TA 4FQ5A 4EO7A 3AM3A 2P6MA 1PS8A 3H84A 2BGIA 5EJ5A 4ME6A 1OQAA 4BTLA 1UK6A 3IBFA 1EVYA 5JU6A 1HURA 2QW8A 1IOZA 2PWPA 1MQAA 3BB3A