4D74A

1.57 a crystal structure of erwinia amylovora tyrosine phosphatase amsi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
151
structure length
151
Chain Sequence
b'NLYFQGAMVNSILVVCIGNICRSPTGERLLKAALPERKIASAGLKAMVGGSADETASIVANEHGVSLQDHVAQQLTADMCRDSDLILVMEKKHIDLVCRINPSVRGKTMLFGHWINQQEIADPYKKSRDAFEAVYGVLENAAQKWVNALSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN-TYROSINE-PHOSPHATASE AMSI
publication title Characterization and 1.57 A Resolution Structure of the Key Fire Blight Phosphatase Amsi from Erwinia Amylovora
pubmed doi rcsb
source organism Erwinia amylovora
molecule tags Hydrolase
total genus 57
structure length 151
sequence length 151
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d74A00
1DCKA 3OM1A 3RVQA 3T6KA 4XASA 4MR7A 4E7PA 1P8AA 3A10A 1D5WA 5EWMA 1OXBB 4N0QA 1JDPA 5DGCA 2PUBA 2FKAA 2GI4A 1P6UA 3CKMA 4KNYA 3EQZA 4OLBA 1HEYA 1FFWA 1QPZA 3GV0A 2PKXA 3JY6A 2RJOA 3LUJA 5ABPA 1U2PA 1ZN2A 4MQFB 5GOTA 3OQNA 5TQ2A 4P1ZA 5ED4A 3ILHA 4LE0A 1L5YA 3R0JA 1PNRA 1ZESA 3HV2A 2H0AA 1P6QA 2HQOA 5IX8A 4Z9AA 1RZRD 3CFYA 1YIOA 2PUEA 4Z4EA 1BA2A 3Q9SA 4KREA 1CEYA 5IC5A 3L6UA 4W5QA 1SRRA 4G86A 3OLWA 3FFWA 1APBA 5CNIA 2E4VA 3KYJB 1DBWA 2MSKA 3MQ4A 3QELB 3SM9A 3IP6A 3QLUA 4RY8A 3RVPA 3P9YA 2FXIA 3H5LA 4LX8A 2TMYA 3Q41A 4PZ0A 2NUBA 2MSLA 2PMCA 2PAFA 5FWYA 4RKRA 1U2QA 4LDAA 4ZMRA 4Q6BA 3DLBA 5B3JC 1NXPA 5CHYA 4D6XA 1NXWA 1GCAA 1QKKA 1TVMA 2RJNA 2FSPA 2LP4Y 4YLEA 5JNVA 2NZUG 4OATA 3IDOA 4HNRA 3HXMA 3I42A 5C5EA 3CS3A 5T3YA 5BQ3A 4Z4IA 3GBPA 4YCSA 1QP4A 2QSJA 3T8YA 3O1HB 4ZJPA 2IYNA 3HK2A 1YS6A 4MR7B 2L17A 3EODA 4RY9A 1GUBA 4WT7A 3LTEA 3EJWA 1Z26A 3O75A 2RDMA 4RK1A 1VRVA 1ZGGA 3HS3A 3H1EA 3G85A 2JRLA 3VNAA 4RY0A 2IPMA 4YWHA 4KV7A 3URMA 2QZJA 3DLHA 5B3JA 3RQIA 3C6QA 4XLTA 2QW1A 4TLMB 2YHBA 1AB5A 4KMRA 4RKQA 3TO5A 1FSPA 2LPMA 5TQJA 1ZHHA 1U0SY 5KQLA 1JX6A 2PUFA 3LUAA 2A9OA 2A9RA 4MQFA 5BRAA 2LIVA 1JH9A 3QLTA 1Z15A 2FVYA 4Z0NA 4EYOA 2QVCA 1DC7A 3H6HA 4ETMA 1KRWA 4UHKA 1SXHA 4TMYA 3L49A 2VYCA 1BDJA 4KQ9A 1P2FA 4PYRA 3H1FA 3RVJA 5JS1A 1GLGA 1M5UA 5FWYB 3QELA 3OQOA 2GWRA 3C3KA 3C97A 4Z4CA 5EWLA 2CWDA 2B1JA 3DGEC 2JVIA 3G1WA 3LKBA 3CNBA 3KG2A 4KRFA 3SG0A 3VNBA 1Z17A 5JNTA 5CNJA 1DBQA 1YTUA 3QX8A 3UKJA 2QV0A 2QR3A 4TLLB 2FTKE 2A9PA 3HDGA 3N0WA 3H5VA 1Z2EA 1DCMA 3BRSA 4MR8A 1EWKA 1FFSA 2GBPA 2VK2A 3GWGA 3I09A 4MS3B 5F64A 4W5RA 4S05A 3GRCA 4MQEA 4DN6A 1MB3A 2P4UA 4MR9B 1Z18A 4F3TA 2FMIA 4Z99A 1JF8A 3IPCA 2NZVG 3NNSA 4LE1A 4Q6WA 5IULC 3QLUC 2M1ZA 1D1QA 3HDVA 4ZYLA 2CHEA 3NNNA 3LUDA 3TX6A 4QYWA 3N6VA 3RVMA 1PHRA 3BBLA 4E7OA 4D6YA 1USKA 1JFVA 3OMXA 1DP4A 3H1GA 1I3CA 4NQRA 2FEWB 2WB4A 4LE2A 5BRJA 4WZZA 3CU5A 4Z4GA 4YS6A 2FN9A 3OM0A 3DZDA 2JB9A 3BREA 4MYRA 4EGSA 5TE9A 1NY5A 4JAVC 3CRNA 5KC8A 1BDHA 3OO0A 5FBKA 2PL1A 4EYQA 1PEAA 3CG0A 2WJWA 1ZGZA 4N03A 4D74A 3SY8A 4EVQA 1VPWA 1TJYA 3GL9A 5FBHA 2HJ9A 1RNLA 3JPWA 1NXXA 5IUNC 2KYRA 1EFAA 2HQRA 3JVIA 4RK4A 3M9XA 5EWLB 2P9HA 2FMFA 4RWEA 4KFCA 2PUCA 2JCGA 3C3MA 4HNQA 1A04A 4ML3A 2PLNA 3N53A 3N75A 2PUGA 3OLYA 3Q15C 4S04A 4MRMA 1DCFA 4FE4A 2PJUA 1D4ZA 1W25A 3MF4A 4JP1A 1YVUA 4RXUA 3KLOA 5DTEA 3QEKA 4G0ZA 4WXEA 1K68A 3A0RB 4ETIA 3HZHA 3OO1A 4MR8B 4XXHA 2OQRA 3RVKA 5IUJC 2JBAA 1NXTA 4HYEA 4RK6A 3KSMA 4ZMSA 4MQEB 4N76A 3LOPA 2F8TA 1Z13A 4M88A 1TLFA 1EAYA 1MAVA 1NXVA 2I6FA 1XHEA 2AYZA 4H3KB 4IRXA 1T34A 2GKGA 3LFTA 4MS3A 4XFKA 3RVRA 4W5NA 3QLVC 4KQCA 4MR9A 9ABPA 3D8UA 2W42A 3NHZA 1BDIA 2FQYA 1A2OA 1M5TA 3KJXA 2RGYA 4KVFA 5E3JA 4IMJB 2OENG 1JBEA 3F6CA 4GNRA 4EY3A 2FMKA 1QO0D 2FQXA 3FMVA 1C0EA 4KK4A 4RU1A 3LUHA 1CYEA 3MM4A 3E3MA 5JNRA 2FMHA 3O2QB 4QICA 3TD9A 4YP9A 4FB4A 3LUFA 2ZAYA 5EWJB 3RVSA 4WWHA 5KQMA 4Z4HA 3LKVA 1JFSA 1ISRA 3T38A 5KQGA 1FQWA 2R25B 1LJLA 3KCNA 3NHMA 1MB0A 5KC9A 3LUCA 2R47A 5IUKC 1JL3A 2NT4A 3CG4A 1RZRA 1ZH4A 3QK7A 4LDZA 3KLNA 1U04A 3SNKA 3TB6A 3EULA 2DRIA 4N47A 5CNKA 5HSGA 5TPZD 2ID7A 3QLVA 2FEKA 2YHAA 3M6MD 1QNLA 3BILA 4NCBA 4XARA 3H5OA 3NBMA 3JPYA 1E6LA 2IDMA 3HM9A 3CHYA 4MRMB 2X7XA 3K9CA 5PNTA 1TMYA 1LBHA 1PUXA 2ID9A 3ROFA 4EYKA 1USIA 2JVKA 2M98A 2WY2D 4NV3A 3GBVA 2FQWA 1MVOA 1ISSA 3RH0A 1KRXA 1R8JA 4Z4FA 1W9HA 2JBAB 1QP7A 1VLZA 2E4YA 2QXYA 3OMWA 3TMYA 1S8NA 2FEPA 1M2EA 2BGGA 3EDCA 3C3WA 1YK1A 4MS4B 3BRQA 4RK5A 2IKSA 3GT7A 3KHTA 1A0OA 3EAFA 3O74A 3JVDA 2F8SA 1MIHA 3N8IA 1YS7A 2HSGA 2WRZA 2R48A 3MYYA 2FN8A 2L2QA 4RK0A 4YRZA 4EUKA 2NT3A 2L18A 1JFTA 3KTOA 1EWTA 3H6GA 1RXEA 4N41A 4F06A 2JVJA 4L4UA 4QYMA 1Z16A 1EWVA 4PE5B 5TPWB 4MAAA 3QEMA 1SXIA 3DGFC 1NXOA 3F6PA 4OLAA 1NXSA 3A3KA 1Z25A 4MLCA 5TQ0B 4WUTA 2PUAA 3FFXA 5KI6A 4PEVA 1ZVVA 2IOYA 1KMIY 4NICA 2LUOA 3JS5A 4FE7A 4RS3A 3S99A 1FFGA 4F8JA 3Q7SA 5IEJA 4LRQA 5EWJA 3UUGA 1VKRA 4OBBA 3Q7TA 5JNSA 4IF4A 4G0OA 2O20A 3O1IC 5FWXB 3KKEA 3SQNA 5IEBA 1ZAYA 4O1HA 1CHNA 3H5WA 1EHCA 4H3HB 1XHFA 4B09A 5JNWA 4KK3A 1GUDA 4G0XA 2IPNA 4KZKA 5TPZA 1E2BA 3O2SB 2CHFA 1JWLA 4NCAA 3UK0A 4CBVA 4JB0A 3A0UA 3IP7A 5T7BA 4WXMA 3LUKA 3HUTA 4F12A 2MSWA 2MYUA 4LZLA 3KYIB 1ABFA 2FLWA 1DRKA 1F4VA 3FDFA 1F51E 1JDNA 2IPLA 1Y1LA 5HM6A 3F73A 3H75A 4UHJA 2MYTA 3K4HA 3KS9A 3RVNA 2A9QA 3GA5A 3HEBA 1YK0A 2E4WA 1JYFA 3O2JA 1TM2A 2WJAA 3N0XA 3Q7RA 4MGEA 7ABPA 4G0YA 3T95A 4W5TA 3EQ2A 4GPAA 6ABPA 4MS4A 5D2CA 2E4ZA 1J56A 1QQBA 3HCWA 3HUUA 1RXIA 5CNMA 5BR1A 1JLKA 4RSMA 4Z9BA 2R4QA 3QEMB 2J48A 2ZWMA 3SAJA 4YO7A 3MIZA 1PEYA 1SXGA 1ZY2A 4MS1A 5DLEA 1U8TA 2Q5CA 1XWWA 2QVGA 4RV5A 2E4XA 5TPWA 4G0MA 1DG9A 1QQAA 1D1PA 3I5AA 4O1IA 4P98A 4OG2A 1USGA 3OLVA 4Q7EA 2HPHA 1DBPA 1RPJA 3N0RA 5TQ0A 4KPYA 1UDRA 1QP0A 1NTRA 1DZ3A 5EWMB 3CLKA 4L85A 1OXKB 2IPAB 5KWSA 5C5CA 4W5OA 2LBPA 4N0PA 2GX6A 3IP5A 4OTZA 1L5ZA 4HNSA 4EYGA 1Z2DA 3CTPA 1SD5A 5I4CA 3IP9A 2E4UA 2FW0A 4RZSA 5JNUA 5FWXA 3LUGA 1BAPA 1PNTA 2QU7A 4JOQA 3I45A 2PL9A 4DADA 5TQ2B 2VUHB 2VUIB 4G0QA 5KQPA 3MA0A 3LMKA 4YR7A 3HVRA 3M9WA 4YGXB 1E6KA 1JHZA 1ZDMA 4MPTA 3FFTA 4G97A 5HQJA 3ROTA 3MMNA 3IPAA 3HO1A 2N9UA 5JS2A 1M2FA 2B4AA 1NATA 3CZCA 4IILA 3CZ5A 1ABEA 1D2AA 1YMVA 3OQMA 2FLKA 3OLZA 3W9SA 4IGAA 4JB2A 3H5IA 3ILYA 4RDCA 2XDYA 1WETA 2L19A 3OLXA 5GQSA 1DC8A 1ZH2A 2MYPA 4ZPJA 2CD7A 4MLDA 3H5TA 4DQDA 4XAQA 4O5AA 3RVLA 5HKOA 1ZITA 4JA2A 1AB6A 1B00A 5IBQA 2WWVD 4ETNA 3HSYA 2WMYA 1DJMA 1YMUA 3E61A 2V0NA 3F7NA 3DBIA 3O21A 1GCGA 4TN5A 3GYBA 3JTEA 4YV7A 3RVOA 4H60A 4EVSA 1LBIA 2AYXA 2JK1A 4G0PA 4MS1B 1LK0A 4QPJC 4Y9TA 3B2NA 4F11A 8ABPA 3FGZA 4RK7A 1LJUA 2MYNA 4RXMA 3HJFA 1H9CA 2HQBA 1IIBA 3NNDA 1QMPA 1DRJA 2PUDA 3QX9A 4JASB 1URPA 5DKFA 1Z12A 3EGCA 4PICA 1E6MA 1JYEA 4RXTA 4EVRA 1QO0A 3O1JC 2PE5A 1KGSA 3D02A 4IMIB 6CHYA 1BVHA 1K66A 1C4WA 2H3HA 5DCLA
chains in the Genus database with same CATH superfamily
5FEUA 1U0TA 1DIRA 2BN4A 3LNCA 4J7UA 4IO1A 3AY6A 5CVJA 3AINA 2CMDA 3MLAA 4YQFA 2WSYB 3OEYA 3DAFA 3O8RA 1NX9A 1RADA 4HWPA 2DPYA 3WGJA 2YW9A 1CUFA 2VPWA 3EVEA 2DUJA 3CKMA 5TNXA 4QHYA 3OM8A 2GPYA 3EQZA 1FFBA 2HU5A 3MD0A 1HEYA 1W59A 3M5WA 3PPWA 4R40A 5HQ3A 3QYPA 3TRHA 3IVMA 5DT2A 4L2IA 1P39A 4JC5A 2QT9A 1ZN2A 5B12A 2IEDA 3QOXA 1SOWA 2XMZA 3VOAA 2D1QA 4MULA 3AOGA 1XX6A 4JI6B 2ILVA 4D3DA 2APJA 2IYEA 4CG3A 1E1CA 2GN2A 3JTMA 4DNXA 2YCBA 2HA4A 3WKEA 3A4IA 2AUTA 4Z2YA 1D04A 1P18A 3RR2A 3DR3A 1WPXA 2W6MA 3TJRA 1KJNA 5D01A 4ZAWA 4BAUA 3V4RA 3DCNA 3ONDA 4UXIA 2IEGA 3NP9A 2A57A 4ZEWA 1IRXA 2AJCA 1YR3A 2CLMB 1HDRA 2PZLA 1I2CA 3SOPA 1JKFA 4KRGA 4A0FA 2Z6AA 3I53A 1TPYA 5CD1A 3OFND 5FWDA 4PO3X 1T5LA 2B6HA 4B45A 3QPAA 2O0LA 1UDXA 4LDAA 5F1OA 2Z0MA 4KFTA 3K1JA 3ZBQA 4D9EA 4FQ8A 5DN9A 1ECJA 3RJMA 1ORIA 4M87A 2RH8A 3BCHA 1U28A 1GCAA 2BMJA 2XEXA 4I1RA 4IIXA 5AVJA 3FOFC 2COEA 2XX3A 5ALMA 1NPYA 2WFMA 3AHCA 3SZMA 4Q3BA 1BXRB 1CY4A 2DTDA 3QXJA 5COBA 3RT9A 2QE7A 4RAQA 5BQPA 1DUVG 2R7MA 3P97A 1BS9A 5FUBA 4BAGA 4C5CA 4Z4IA 3KZCA 2PO7A 5TEWA 3NT2A 1L9KA 4KWEA 3O1HB 1MQSA 1H65A 1SUFA 1L2TA 3INGA 2R8ZA 2N1MA 5IDVA 2Z04A 4NIMA 3PRYA 2B25A 5AJXA 4LNUA 5BPFA 1ABBA 4YMVA 2Y92A 1IY0A 2OB1A 2DPGA 1OXVA 2VAVA 2X3UA 3GRAA 4M1ZA 1E2JA 1EQAA 4IMPA 5G0WA 3RBXA 5HE8A 1WZ2A 2HDHA 4A03A 1J1ZA 1XU9A 3E53A 2PNJA 4AM8A 4IIHA 4EA6A 4ZCRA 3OZFA 4GOXA 1P4GA 3CCBA 2JI8A 2WJ3A 3O93A 2UUBB 4M53A 3AUFA 1TQ6A 3K09C 4G1VA 4KMRA 2NX2A 2C04A 1DAGA 4ENRA 1GTMA 4RUKA 1U0SY 2BHTA 2QRQA 4KE9A 4D8TA 1I14A 1O54A 2BI4A 4YECA 1TM1E 2NQ2C 4GC5A 3L01A 4LZAA 3KYDA 4CQMB 5AW7A 4BTLA 1V4VA 3JV7A 3OFKA 3BMOA 4UTZA 2X0DA 4TS4A 5K3SA 3ET4A 5AOCA 4NARA 1S89A 4GLJA 5FHRA 4YAWA 5EJ5A 1L7OA 2BEVA 3QW4B 1REQA 2SHKA 2Y2VA 1P5RA 3B3AA 3FDIA 1VKOA 1RWKA 1X1SA 2IE0A 3QJGA 1G2QA 4FFSA 4IIJF 3T3EA 5JS1A 4EMBA 2YIMA 3OQOA 5AOBA 2AT1A 1Z5OA 3EQ8A 2ADFA 2Z1NA 3LQ2A 3PXCX 2OSBA 3TW8A 1PLLA 2D2FA 5IJ9B 4I6JA 4LYAA 2YYAA 4LWZA 5KYWB 4OI0A 5F9HA 1PGQA 4PFJA 3B53X 1MO3A 1GGNA 3MMPA 1SQ5A 3IC5A 3TM5A 2O7NA 4K9OA 2QT0A 3UIEA 1GA4A 3SHTA 2QOEA 5JNTA 4LHEA 2XRZA 1QIEA 1ANKA 3MJSA 3OSUA 4NBTA 2FK8A 2QZ4A 3DAOA 3HDHA 5K0ZA 2XKBA 1DIHA 3H2YA 3UYKA 2E0IA 1H8HD 1T29A 2A9PA 3HDGA 5TR9A 3RGWS 3N0WA 2FR8A 4UPDA 1MH9A 4DLLA 1N6HA 2FE1A 2OLEA 3QU4A 4KQKA 2OZLB 4ZO4A 1T2UA 1PBNA 2GBPA 2PA3A 4HQKA 4MS3B 1HQKA 3WTCA 5EJ9A 2O8DA 1N5KA 1FNDA 2R6JA 4R68A 3D6NB 5HF9A 3U7HB 3PPXA 1UDCA 1NYQA 3N1UA 3THXA 3N05A 4WY8A 3UBTA 1LU9A 1PTJC 1Q0PA 4DA9A 5C46F 4KJZA 4XD7A 5LQDA 4S3MA 1VJCA 4YRJA 1Z5PA 4BQIA 3SFZA 4BJ3A 3NNNA 3CT4A 4XYLA 3BK2A 4D79A 4D4GA 3PPVA 5AW6A 3Q3GE 1FUUA 4LV6A 4X6LA 3PKZA 2JBWA 4ER7A 1RU3A 3II6X 4XDYA 3A6PC 3BE6A 4QU8A 4W5JA 1V11B 121PA 3F4LA 1IATA 1KVSA 1A9TA 1SULA 2NIPA 1WUTA 2BR5A 4CL2A 5HZHA 5C8YF 1X8KA 4DRXA 3ZWDA 2PHZA 2A3NA 3CSUA 5ALZA 1OI3A 1GM5A 2OK7A 5IDYA 1DBSA 2NZWA 3OPMA 3COVA 5DBOA 3IXLA 3NG1A 2Z6QA 4NFSA 3OOJA 1C3LA 1MJGA 2OQ2A 2P4EA 3L0ZA 1GG8A 1OV4A 4TKVA 2QSYA 4NV1A 3NZEA 1K2WA 5AUQA 3LBNA 2QQFA 3NLLA 2J7PD 5KVQA 5CVEA 3DDHA 3RBAA 1CR1A 3HUDA 3TR0A 3JQQA 2WJYA 2F2TA 5JJCA 3TVTA 2V9PA 3LZDA 1QAMA 4KXXA 4YP6A 4BO6A 3SCZA 3EDMA 2DHRA 2HX1A 3AEYA 3I0NA 1JHMA 1K9VF 3A1WA 3GFOA 2YZGA 1DJQA 3CVJA 3NCTA 4MRMA 4TS1A 3P19A 4ECEA 4EITA 1WW2A 4B35A 2YJ3A 3EXG2 2JF0A 2IOQA 2C5EA 1M6NA 2CXUA 4L8VA 3I9V1 4YAOA 3UT0A 4EELA 1NKSA 1TO6A 1NE2A 5K99A 4XJVA 5M04A 1BSVA 4B32A 1YDEA 1L4HA 3AZPA 4GOLD 4OJQA 1MC5A 4RZXA 3UTDA 1G9SA 1T8RA 2C4VA 5KTNA 4IKOA 3ZHQA 4DMFA 3AL0C 4J2HA 1QGAA 1Y8CA 2FZGA 1T34A 2D1SA 3E2MA 1VIAA 5ECWA 5JWOA 1PLJA 3FYUB 3CEAA 1NBOA 3ML1A 5K0EA 3IIIA 2QROA 3PHHA 1OX4A 5CYOA 5JSHA 5LN1A 1OBHA 3CUWA 4UUMA 2EV9A 3B52X 3HFGA 1O03A 5FNZA 3FPAA 4J3JA 4BJHB 2AC7A 3DBVO 3CR7A 1QO0D 1Z0IA 3R09A 3SLKA 2GARA 3TD9A 1Q0QA 3CX3A 4JS0A 3HHPA 3AVPA 2PSJA 3PC8A 4M1MA 3HBNA 2AS0A 4TTRA 2EFDB 4ZV4A 2H2GA 2H9YA 2Y0PA 3SXUB 1E1LA 4FUQA 1JFSA 2Y05A 2CDBA 3RUFA 4INJA 2H31A 1N0WA 4CTNA 4B3IA 4QJ3A 3VBEA 4XB1A 4C22A 3IYLW 3WRVA 3NHRA 3ZPXA 4FMDF 5JJKA 1OX6A 5DLDA 4ER3A 4YJGB 3ZZUA 1O94A 1ZCZA 3CC8A 1G8FA 1U1CA 2YY5A 3UWMA 4KR0A 2AK3A 1D0IA 5CA0A 1ZHFA 3E3LA 1SHTX 1OYOA 3F8SA 1IOLA 2E1PA 4AD8A 4MVWA 2X7XA 1RBQA 4JVOA 4BBPA 1BHQ1 1U2RA 1FDUA 5AW1A 4TQUS 2V65A 1U0LA 4JC8A 5KWJA 2O14A 2X19A 2FG5A 3T9BA 2X0FA 2O2HA 1GUZA 3NPMA 1YC5A 4GPIB 2I7DA 4HDKB 4YPOA 2HXYA 2D7DA 4JEMA 1DT5A 2YC4C 3TMYA 3ENNA 1H2HA 2YQZA 2FP4A 3EXHB 4W7SA 3WGNA 3VR4A 1N2BA 4N5MA 2OV6A 1A0OA 1N7JA 4KQEA 3LCRA 3PUWA 5EMJA 3RBVA 3L7YA 1UPUA 3N8IA 4EJSA 1YS7A 2HSGA 3SMQA 1ML3A 3DOOA 3F5MA 3MYYA 4B0OA 4DJTA 2NPIA 5DP2A 1KO8A 2IXAA 2NT3A 2WWRA 3H1TA 3VHRA 1XZEA 4BCCA 1P31A 2V0CA 2IS1A 1YO6A 3VHLB 1UXIA 2B9VA 5KKCA 3RYCB 4YRMA 2JFWA 2J6IA 1KFBB 2Z2XA 3LDFA 1M10A 4QYMA 2PMEA 3JAWB 4QLBA 4HD8A 1W76A 4KO8A 2QE7D 5KNDH 4MAAA 3H19A 3HYSA 1FYDA 3IDZA 2OC9A 4LNHA 3WJ7A 1BRTA 1TVKA 3H97A 4MH0R 1P5ZB 4OHWA 4WUTA 2YOGA 3ZE9A 1SD1A 1MB2A 2UVDA 3RS7A 5EIXA 1XDZA 2VUTA 2ZVJA 3TRIA 1SVSA 2ZSKA 5IAOA 1ZUD1 3NTUA 3I2IA 3UATA 1QYVA 1NVXQ 4J0IA 2E5FA 1XQ9A 4TTVA 4MCJA 3V2UA 4D2IA 3H9UA 1EE2A 1EJ2A 5B7GA 1I0ZA 1T2FA 2EP8A 1LDNA 4E12A 1M34A 4OUDB 3OCJA 4P7JA 3PQEA 2VQ3A 2N46A 4WLFA 3WYFA 2E49A 2LGJA 1UMBA 2CHFA 4MGYR 2WILA 3R9IA 4BVEA 1G5PA 3AJEA 2ZBFA 4AS3A 4RADA 4G5HA 2VEDA 1V8FA 1TYAE 1J2RA 3HUTA 4FGLA 4WCFA 3TB4A 4V24A 4CG1A 1O57A 4DNPA 2MYUA 4PINA 4RDXA 1O58A 3CMCO 1LH0A 1E6CA 1UADA 3OEEA 3G6KA 1F4PA 2NTNA 4G4GA 3TG8A 3GLFE 1G1AA 1AGYA 2CUTA 2ZE7A 4Q0MA 4OPMA 3KVOA 4XWGA 1U2EA 1TOAA 1UKBA 1ZIOA 1O2DA 4PRKA 2DR0A 3HEBA 3MBIA 4JBHA 4HNUA 4ZI7A 1XNQB 5CLFA 5AO9A 4RZUA 3LQQA 3N0XA 4UULA 1PCXA 1V3VA 3EQ6A 3N0VA 3GR6A 3SYTA 3WK4A 3EQ2A 5CXXA 3IULA 3L0SA 4EA9A 4NJMA 1W5SA 2NYRA 4Y6QA 2Y0BA 2RG1A 1M72A 3ZDFA 4LRWA 5AHOA 3MVEA 3L40A 1XTSA 4YMSA 3NUQA 2WT4A 5LUAA 1P91A 1ZJZA 4MUXA 4W63A 1RI1A 1UBNA 2Q41A 1DWOA 1N6KA 1U5CA 3OFVA 4L8WB 2Q3BA 3QEMB 3W8RA 3W5VA 5KJ1A 4XKJA 2Y93A 1K8YB 4CR6A 1ICIA 3ZJVA 4DHEA 3GCXA 1TLTA 1HV8A 1H3NA 2QVGA 3AC0A 1CP2A 3M6AA 4OK3A 4AMBA 4D4JA 2JNWA 1L5QA 3CJRA 3U39A 1Y9ZA 4PLWA 3TLBA 1KP9A 1VG9B 3WK8A 3FN4A 3GLFB 3R4VA 2FX5A 4U2EA 4PWYA 3WLTA 3IE1A 1IBKB 3QU5A 5TXGA 2H48A 3BCUA 1JI0A 4OTZA 5HUHA 4E5VA 2ZRGA 5FT9A 1NURA 5BNWA 3STTA 4AS2A 4CTMA 4URVR 1LI4A 2J59A 4KE7A 4FZ5A 5D1HA 4H1TA 1ND6A 2VHJA 5IXSA 1JLHA 1ELOA 2CGEA 5FOSA 3ODPA 3ASVA 3IAHA 4Q4JB 4YJHA 4BZQA 4LSMA 5F76A 3KFLA 5AHKA 5DSTA 2XGOA 3D4OA 1OREA 1Z4PX 4J0GA 1CSEE 4XUDA 4BFYA 2QXTA 1T9KA 2A5GA 2EJBA 3ROTA 3NHYA 2WJ6A 3ECCA 4P8RA 4Q05A 4CCYA 4EKYA 5BVGB 2BEUB 3KVRA 1Q0SA 2WAOA 3TK1A 2IF2A 3Q8KA 4ZGBA 4U7JA 2BFFB 3DBRA 2G7ZA 5C81A 2G72A 2A1TS 3PNYA 4IGAA 3HCDA 3O9ZA 4L74A 3ZJ4A 1RYYA 1YR9A 2EKLA 3H5AA 1QV7A 1XL1A 3AJ9A 4D92A 3KAQA 4W9MC 1SG6A 5H4HA 5DW0A 2NSHA 4LC9A 2X14A 3EMBA 5LLTA 4LV8B 1N6OA 2VP2A 3RB8A 1J8QA 3L6RA 2FEMA 4ARAA 4E4TA 5BR8B 3K6JA 5IARA 5I4BA 3KHUA 1P7PA 1YMUA 4K6FA 1IG0A 1YCHA 3FOWA 4J0JA 3M6XA 5A3VA 1ATIA 3D31A 3FAZA 2OGUA 5DULA 1DV2A 4XIJA 2I99A 4AX4A 1UXGA 1VE1A 3N87A 1N5OX 5BT8A 4Q1AA 1TADA 4IDAA 4P3OA 2AXPA 3I1YA 5CCXA 4D9JA 5G0UA 3WXMA 4P86A 1EFRA 5EJAA 2C4NA 3QWHA 5BN3B 4LZJA 4ZVUA 2ZB7A 3HXKA 1TO2E 1ZWKA 3OZCA 4PICA 4QQ8A 4CU2A 3WLEA 5FI0B 1QYIA 1SQFA 2GZAA 4IMIB 3WFZA 5A03A 3FZGA 2Y9MB 3KR9A 4OYLA 4WINA 1HNXB 3QSYA 2ZYDA 4O4LB 4QTZA 3EARA 4MDYA 2LVBA 2ZDGA 3X44A 1CUAA 1KY4A 1PS0A 2HF9A 4JLMA 2PD6A 5JHHB 1IZ0A 3ORQA 2R2AA 3A10A 1ATZA 3LLVA 4J16A 3U3RA 2PSFA 1R88A 1ZXBA 4J6FA 5EGSA 1CUHA 1VZ2A 2QLFA 3PQ6A 4MKHA 3PLRA 2OQIA 3FWPA 3JASB 3AJAA 4IEFB 4UUBA 5BSRA 5BWMA 1UKZA 5M3BA 4B6GA 4KG7A 3QUAA 4MINA 3Q4GA 3SEQA 3K94A 4J8PA 5E8RA 3LUJA 4LMRA 3FCEA 4MQFB 5THXA 4CFSA 2DP4E 1GITA 3HVIA 1XPRA 3HWRA 5KSWB 1N3YA 3R5SA 1NLUA 3CM0A 1DQYA 1AUVA 3EXAA 4TMZA 1P6QA 3ER9A 1GTSA 4NTZA 3PFNA 3UFXA 3TL3A 1UBJS 3CURA 2YVUA 4CM5A 3THWA 3L8DA 2HH9A 1MJ5A 3ZI7A 1V26A 3ADBA 1QHNA 1PUIA 3PXBA 4TS9A 3L7CA 5F1PA 5KCMA 1QFJA 3IMEA 4I14A 1TD9A 3L79A 1Z4MA 1C8VB 5E7IA 1RQRA 1Y3AA 3KT6A 2IE8A 2G71A 4F4IA 4K6MA 2AQKA 1DPGA 5KPJA 3C7DB 2DOKA 2I4LA 4LX8A 4MWSA 2B1QA 1E69A 3RAJA 5FH9A 4PG7A 2NUBA 5LQRA 1E3LA 4MITA 3UJNA 3VC2A 1JYSA 3DE2X 3V4OA 4BO0A 4GX0A 1SELA 1UXOA 4KL8S 1FMLA 4CTOA 4D6XA 2QNIA 3GDHA 4W1QA 5LM3A 2VPZA 2XPCA 2EBFX 4UUOA 3S5JA 3F5QA 4E21A 2QG9A 5CDGA 2NU6B 2PZFA 3QVLA 2KX7A 3DEIA 2BCEA 5AVVA 2X0KA 2YHIB 1OC2A 3KOMA 4RSRA 5DT9A 4BKOA 3NJRA 3W6UA 1U6KA 1GG9A 2A3RA 4XFJA 3RS3A 3VX3A 4BAZA 4EPXA 4P5PA 2CNKA 3HK2A 4OA5A 1PI3A 2VCYA 1KOLA 1DLJA 1FPMA 3LF2A 3N8DA 3PSHA 4X7BA 5DSXA 2ZJBA 5IYZB 4QJ5A 3O4FA 3FX2A 4OHZA 3H1EA 3Q88A 2RBGA 4YJ2F 4UUQA 3S2IA 2X8WA 3LQFA 3VO1A 3GQBB 4ZXPA 3Q3VA 5WRFA 3TLYA 1OFVA 4MUFA 5B3LA 5IXJA 5AUOB 1NUSA 1RLJA 1UKAA 2WM8A 1N57A 2C3PA 4ZQEA 4YMIA 2Q7DA 2HRZA 2PEZA 5GM2A 3UW1A 1JWBB 4GEKA 1AHIA 1AKTA 1PSZA 4UKDA 2UAGA 4IS3A 3EPKA 1U3VA 2FPUA 4CDRA 3P0JA 2OC4A 2ACEA 2JAPA 3CF6R 3PNOA 5DOVA 3ZZMA 3VYRB 4Y67A 3J81k 2H1RA 4BFCA 1KI2A 3DONA 1L7XA 3BZWA 3PGMA 2W2TA 5T64A 3TLXA 5IKMA 4DARA 2Q2VA 4C7OB 2XBMA 5CB4F 3L49A 5I48A 5DMXA 4KQ9A 2YMQA 2WPDA 3RVJA 1ZEMA 4F2GA 5CBKA 5KJ6A 2PYZA 3B36A 3JYPA 2CMFA 4ZXFA 3VDMA 2NSLA 2ZANA 4D3SA 2QZ9A 3GDWA 4MI1A 5DGXA 3VFDA 3G6WA 1U2SA 4K28A 3NIWA 4LV5B 3COSA 1YBMA 3WYBA 1I32A 3AF0A 2JEZA 4PPYA 1Z63A 3B9QA 1B3BA 3C7KA 4P80A 3B85A 4RA6B 3ROEA 3NHAA 2J6BA 1L7PA 2XMDA 2CCKA 3AY3A 4KGDA 3NC1C 3OPYB 4LTNA 4KSBA 4G4SO 5TT1A 4V0ME 1DXYA 3P0FA 1EG7A 2R00C 4HV4A 4LJ5A 5J5VA 5DCWA 3ROKA 2QR3A 4WN9B 4ENQA 5IM5A 1OBOA 2PH7A 1E5VA 5FOTA 3ZH2A 1MXFA 3LWBA 4IOLA 3HJAA 5G53C 3RYHA 4Z3KA 1J25A 2NG1A 3UJPA 1X9HA 2BMVA 1Z6PA 5CVUA 3V33A 5ALQA 4I4TF 1KH1A 2JJYA 2VA8A 4U7FA 3KELA 3OE1A 1YRQA 5JJ5A 1E3TA 2C4WA 2VSQA 1QRUA 2PNFA 2ZIWB 4M9UA 3QLUC 3LU1A 4RQTA 1C29B 3ICWA 5FBQB 2OCBA 2C59A 3UWDA 2CHEA 2NXJA 1M33A 1N6LA 3FNEA 2ZRCA 1GY8A 3NC0C 5KNLA 3RVMA 1PHRA 1BJTA 5F1KA 4QLOA 1AA9A 4ILEA 1HZJA 3RBZA 4D6YA 4E7OA 1HMYA 5EJ6A 1OXTA 5FUMA 3WVNA 1E2MA 3WAKA 3UT6A 5EP4A 5EIWA 5AJHA 4EP1A 1NV9A 1QCDA 1WU8A 1XVIA 1ESZA 2FN9A 1O89A 2I6UA 4LAFA 3MC1A 3VH1A 5B4VA 1YJCA 4DUGA 3O8QB 3BHNA 4H15A 1D0SA 4BQSA 3EUEA 3FB1A 4GRIA 1P3JA 2PL1A 4QYSA 5H16A 1JJFA 4GS5A 4KNVA 4E46A 1FU4A 3OJWA 3VR6H 3DUWA 2OHXA 2DLDA 3T7DA 1ZN7A 1E1RA 2FQ1A 3V7WA 5LJIA 1S2DA 1QFXA 1IQ0A 1HE8B 2KYRA 1IXSB 2WTXA 1CUDA 3HNPA 1PQ4A 5IP5A 1ZUIA 1KY2A 3ZLJA 3OBBA 4QPPA 1ZL2A 1KXJA 2O2CA 3ZNQA 3L9WA 1VLLA 2FDRA 4UNRA 3DDOA 3JZAA 3OZIA 4MQLA 1P7WA 2QNBA 4P2BA 2JCGA 1U65A 3CNQS 4PCAA 4RKFA 1YQDA 5H3HA 2CB9A 3HA2A 4M76B 1GHTA 5FB3A 4HH0A 5I5EA 1YQWA 2NO9A 1VMAA 2ZITA 3NVKI 3MF4A 1IOWA 4BNDB 2FEOA 3PIDA 1G6KA 5DTEA 4E5UA 4G0ZA 2ZJOA 1NDHA 4GMHA 4DMKA 1OC4A 3AEKB 1GZSA 2ZYRA 2CUZA 1FUKA 4OAOA 2YZMA 1R0YA 4CODB 3BKXA 1RQGA 1F8FA 2H1CA 1DOHA 3CN9A 2JLXA 5DM1A 1BCRA 3PQ4A 3NWBA 2AHRA 1FF9A 3H5NA 1G41A 3ENZA 3Q40A 1YACA 5A5VA 5AVUA 4IWYA 5AVXA 5KVCA 2VXOA 3DLIA 2HLPA 3QITA 1G18A 4PSUA 1N2OA 1O4WA 4UAJA 2OA0A 2NZ8A 4I5DA 1RSZA 5D3MB 2CNBA 3R3WA 3UH1A 2WYOA 2P4HX 1Q0ZA 3FLEA 3I6IA 5ALNA 3TOSA 1NHWA 2BUBA 1KI3A 2QMUA 4RPGA 4DIKA 1C2YA 1T3HA 1RVV1 3VHXA 2ECKA 1J21A 3DMTC 5HA5A 1E79D 1X1BA 2DY0A 2ZTHA 3ZGYA 5NLLA 3KOZA 1UPXA 1I5OA 3FCOA 4MLZA 1QFMA 4UREA 3ONWA 3DJYA 1WZCA 1L4KA 2JCBA 5DTJA 3VJLA 4QELA 2ADMA 2V6FA 2BL4A 5TVKA 1ST2A 5KQMA 1KIMA 3O3CA 4YRNA 2OCAA 5K6AA 1OYYA 3ZE0B 5TY0A 2GN1A 1SU7A 1XKQA 3OZTA 1HFWA 4OMFG 1EDZA 1QM5A 1MR3F 1FFXA 2FGJA 1FFEA 1QYXA 4DA7A 5IUKC 2WG0A 2NXNA 4TYNA 1ZH4A 5CB6A 4MRRA 4QX6A 1U04A 2BFPA 2C7BA 3HYTA 2F9MA 5CCEA 1GLNA 1TDJA 3QLVA 1NVDA 5BQXA 3AVOA 3HL0A 3DLCA 4A8HA 5E7JA 2QK4A 4JBYA 3WK9A 1Z9BA 2YHAA 2P6RA 3M6MD 3NBYC 2YZ2A 1P45A 2ZJ1A 3A9UA 3ROZA 4RF5A 3GOQA 2HJWA 4MDEA 1Q2UA 4DCPA 3RUCA 5PNTA 1AIPA 3U61B 2R7AA 1T1JA 4PCUA 1C0LA 1YIDA 2BGIA 5FJIA 4NV3A 1CDEA 3E0XA 5DIFA 1QH8B 5C8VA 4CM9A 3JQFA 5I8ZA 4LYYA 2QUZA 4RJIA 4IY1A 1CUZA 3JYLA 3AEZA 4HQLA 4FONA 4DC1A 2F4VB 3INTA 3FPHA 4TMXA 4L3OA 4DUYB 5AKGA 4AKHA 3PFFA 5JTUA 2RONA 1GGKA 1EP3B 3GLUA 4GMKA 4Z4QA 3JXEA 5F7JA 1A8PA 221PA 3JVDA 3MLEA 3VZCA 4KYTA 2C2WA 2W7TA 4GIBA 2J46A 2XCOA 2YHSA 3LO8A 2V1XA 4C3UA 1GPBA 1E94E 4KO2S 4RACA 2C4KA 3RM3A 1JFTA 5JV5A 1VIMA 3OIWA 3I9MA 1FDSA 4OHPA 4AUNA 2HBZA 1TEZA 1YHYA 4EFLA 4AYXA 4QGFA 3O3OB 3IX7A 4EATA 2YXEA 2J9GA 4RTKA 2PS9A 2CNDA 1PNQA 4KYIB 8LDHA 5LIRA 2W6PA 3UENA 3GP5A 1QH1B 3K1AB 4L08A 1I94B 1SMKA 1Y0BA 3EPRA 2UUPA 4C0HA 2H07A 4TVBA 2P90A 3R7LA 1U0GA 1H9BA 2J0QA 4I5FA 5AKIA 3RRJA 4ND5A 4XUEA 5EKXA 1VSQA 1RKBA 4RGVA 4FZ3A 3WOHA 2C9DA 3R40A 2VKTA 4EMUA 1IXKA 3B6MA 2B4YA 3NIBA 4H1HA 4ISCA 4MQ5A 4L9SA 4RF4A 3RJTA 1Z8FA 2DPMA 2HMSA 1RQXA 4TQGA 3M83A 3NGMA 4F9GA 5KU1A 3MFQA 3BQNB 5DNYB 2O2IA 4G0XA 5TPZA 4CT4B 2QZSA 3DB2A 4RF2A 4URXR 4KXMA 1DO8A 4RD6A 5JJBA 3DXXA 3VVBA 4BRWA 4M8KA 2BELA 3WI7A 4BB0A 5C18A 3PPIA 4LJAA 4MPDA 3TRDA 4LZLA 4R1LA 3Q7PA 1LDBA 5G40A 1UZMA 3BSYA 1OZ0A 1T1GA 2TMGA 1AN0A 1D6SA 3O47A 4BNKA 1RPTA 2WPDD 2Q3HA 1THTA 3KS9A 1RRGA 2EL9A 4P58A 1JHDA 2C99A 4BUCA 1AHHA 3HE3A 2GD2A 2YUTA 1YJ5A 4EY6A 1KEKA 2ZYTX 1WNFA 3EGOA 3DUFA 1W9MA 2X1MA 1SJ9A 4G85A 4NYMR 5I51A 5LZ9A 4XWWA 1JB1A 2X9QA 1XIVA 5TB5A 1Z8DA 4XQGA 4PQGA 2DC1A 4B71A 4CKZA 2F6RA 3GLGE 2C5AA 3DFFA 2FPMA 1T9DA 1Z0AA 5L3QB 1TAGA 1YJBA 2SKEA 4ZQBA 3RQSA 1WLSA 3EN0A 3ETCA 1OWMA 1F2TA 4NCIA 5KNBD 2IXEA 4WBNB 3L2OB 4ND3A 4NLLA 5HIIA 3D3JA 4UNQA 5BOVA 1HNZB 1QE5A 1ZGHA 3W8EA 4FYXA 3DNFA 1C9NA 4HWSA 1KJ8A 2BJWA 1UDRA 1QYDA 3BCRA 5BW6B 2R8RA 1T6ZA 1J06A 5SY9A 4DQVA 2AMLA 3MCVA 4B17A 1N5JA 4PQRA 4DCUA 3GGGA 4WL0A 5C5CA 5ALLA 3BTVA 4MVJP 2J0EA 3Q3CA 4F4FA 1A9XA 1PVOA 3K8QA 2JFQA 3PQ8A 5D85A 3ROMA 2BFWA 3CTPA 1SD5A 2IEBA 2QLNA 3NANA 3VSBA 4R2XA 2ZAMA 5M29A 2OMEA 3LUGA 1BAPA 1OT5A 2LR0A 2Y27A 1XC7A 2ZCUA 4N6NA 1F8YA 2HMAA 2NTEA 2Y4NA 1L5WA 5CM2Z 2V7QD 5E2IA 3TQIA 1F6DA 2XBUA 2C7PA 5HK9A 4RTSA 4X1KB 5GIOE 3TD6A 3IUEA 1XYVA 2GASA 1VPEA 5FNVA 1SCAA 4EGAA 1UF9A 4EO9A 4FI3F 4TTQA 1C30B 1D2MA 1E61A 3O8OA 3ZKAA 4TVSA 4JROA 2YCLA 1EVZA 2YQ4A 1ABEA 3SZGA 1LDEA 2DMRA 2HMVA 2R6DA 1NG1A 4IVQA 5TSDA 2GXSA 3PRJA 1AX9A 4QU9A 3TRKA 2Z56A 1BE1A 4FGSA 1IK4A 3ILYA 4MWGA 1SVUA 2FFHA 2OECA 2PL3A 1EXMA 4RTLA 4R7TA 4DCSA 5GQSA 4BBAA 1MVNA 4KOAA 4JR1A 1R4MB 2J3JA 4TSFA 5CRIA 1XMVA 1UXJA 4JI1B 2SKDA 5A4MS 2PYDA 5K3FA 3QX7A 5DBIA 3I8SA 4ZKEA 4HT3B 3ZDAA 4RHCA 2V98A 3R0ZA 5A3QA 3HABA 3QG5A 4D9GA 4LXXA 1Z2NX 2BGTA 3HJBA 3P1JA 3OE7A 4IQFA 1SZDA 1YVDA 3ZCQA 3DFZA 3E9ZA 3NDRA 3R5KA 5EXTA 3TTYA 4D9CA 1TL7C 1N7IA 4BY9E 4CMIA 2A67A 1QYCA 4LGYA 3BBPA 5DNEA 4GM1A 5DKFA 1Z12A 1WMEA 3OKAA 3WJ2A 2I4OA 2ZSHA 3D02A 1W0JA 4TL7A 2A1UB 1ZCJA 2WZDA 3FKSA 2W6IA 4RVGA 1HI9A 4LVNA 5FR2A 4N0EA 2G6BA 3BMQB 1GQSA 2E48A 3OP4A 1ZO8A 5DXFA 3VM6A 4IMRA 4JI4B 2XVAA 1P8AA 3ICPA 2DPLA 4WNIA 3PX3A 1JEAA 2BGLA 2ZRKA 4K6CA 3OTGA 4N0QA 4DA4A 1COWD 4WZBE 2ZREA 2TS1A 5ARDA 3PXDA 4FHDA 3Q6NA 2M6LA 4YMUA 3D3EA 2H29A 4FZJA 4GE0A 1X80A 1QPZA 4YYEA 1KK2A 2ECFA 3H83A 4RA9B 3D6AA 4GGMX 4WACA 3Q3IA 4I8IA 1BOFA 2A0WA 2IVFA 3N6XA 1Z4QA 4Q5IA 1XG5A 5CM9C 4B3DA 4PGGA 2IXBA 4UU8A 4XWTA 5DYYA 4QJIA 1C9MA 1ZESA 1IBRA 3GCDA 3SMVA 3HV2A 3BSFA 4HAUA 4E2WA 1P9NA 1LPOA 2JFZA 1ZAKA 2IQIA 5EHXA 2BJHA 1TYBE 2IGBA 4LS3A 1IMJA 4X3PA 4XRRA 1GAWA 2WSMA 3BFXA 1UODA 3MQ4A 3OIDA 4JBGA 2GHTA 5EP1A 4FINA 3WMXA 1QBKC 3SXPA 1FS4A 1VMKA 4L22A 4OCZA 4XGIA 4A26A 1XTIA 4C2TA 1PP4A 3U6KA 2D7JA 2G67A 1GVHA 4IO0A 5G3YA 4TZKA 5EE5B 1ZIPA 4QM7A 5D3ZA 1Q2XA 3ECAA 4Q6BA 1XEWX 4U00A 4K40A 3V4FA 4CIXA 4QQFA 1AY0A 3T1HB 3NYRA 4CM9D 2Y77A 3QYAA 4JKIA 3AVVA 2EDCA 2JGEA 5KTSA 4B2IA 2NZUG 3BRCA 3PXEA 4KX3A 3K6SB 1CG6A 3SIRA 3SYKA 4C0LA 2ACKA 3OQ6A 1IZ9A 2FX3A 5GTDA 1T0IA 2GKSA 4HN9A 2VAPA 4PAQA 5AJTA 1YQGA 4EEKA 1I2BA 2HXSA 2QMEA 3PUZA 4TPKA 4ESHA 3BE8A 2V59A 3TZLA 1O08A 3Q11A 1N0UA 1P0FA 3C70A 4M0KA 4ZJPA 5H8WA 2QG4A 4TTAA 5JEDA 2OEPA 3CUSA 2RG7A 3TZHA 3H9JA 3PIRA 3I9OA 5AKLA 1J2TA 3BM5A 1EFKA 1ECPA 2CJWB 3F5FA 3HYRA 1F60A 3PQ2A 4B7CA 1LRJA 1PNVA 2WNSA 3K0HA 1SKAA 3CR8A 1NQ5A 2JIQA 3WE7A 4RY0A 1JI3A 4WK6A 1IL0A 2QZJA 4DMUB 4YRIA 5LNK6 4AJ4A 4CIDA 1AZSC 4WASA 3MAJA 4HWKA 1D07A 3ZKWB 5TQJA 4L5BA 2BFCA 3RWOA 3RREA 3WLOA 5KHLB 1JX6A 3TEJA 4B2YA 2GZRA 1EFHA 3N8HA 2A9OA 2WUFA 1UIRA 2A9RA 3D2BA 4JCOA 5BRAA 4N40A 3L6EA 4HWGA 2J3DA 1BCSA 4Z0NA 4CLHA 3ZK7A 1V5WA 1LNQA 4MW9A 4ETMA 1KF0A 4C5BA 3NTLA 2I67A 3GH1A 2AW3A 2VF8A 3ZBPA 3DVAB 1GAJA 4JIGA 1QGUB 4BO1A 5BVGA 3MT7A 3KSZO 2CLKB 5CDFA 1UINA 1A2BA 5LQUA 1HZZA 2IYLD 2ZIFA 1V37A 2B61A 3DDZX 4K8OA 4RIHA 4BC1A 1KDRA 2GWRA 1MQAA 1PQUA 2QVLA 5SZJA 1DL5A 1ZD9A 1PJZA 2QUJA 2REBA 3D2AA 3DGEC 3REQB 3EPLA 3L43A 4RESA 2FJPA 4NABA 3AHFA 2C9YA 3FDZA 1NA5A 4LY0A 3E15A 1BRMA 2J3KA 2CDAA 1A4XA 2FN4A 2WVJA 3QX8A 1NJ2A 1ZD4A 4MVJG 1H4TA 4N8SA 3ZHXA 1XMJA 2RHDA 1PHPA 3WK7A 3IP3A 4XWKA 3CLTC 3LT4A 1KI4A 2Q9CA 2I6TA 1NUHA 3FBGA 3V8EA 4MR8A 3V55A 2E9SA 1UJ4A 4ER5A 2D0IA 3OZSA 3VVMA 2PH3A 4YDSA 4FVTA 3GRCA 1RZ3A 3DOUA 1GQRA 2ZYUX 3KT3A 3H86A 3LP5A 4LRXA 1V4NA 3V8QA 4KAAA 4I4IA 2QTMA 4Z99A 3T9DA 1EA5A 3U44A 3BGVA 3P9SA 4ZHQA 3C5VA 1LFAA 2I4RA 3OT1B 1JSXA 1ACMA 3SBEA 4B4KA 1QB8A 3MUNA 1IZYA 1DOZA 1E6UA 1SG9A 2PQ6A 4WN3A 2GVNA 3M7IA 1PZFA 1XEAA 5J4VA 4B3HA 4QYWA 4XVCA 3NT5A 2H5EA 1T36A 2BFOA 1AQNA 2WIDA 3AFNA 1JFVA 3AVQA 3FUCA 2PZJA 4HGNA 2OGSA 3CNNA 3LDGA 3F90A 4FEGA 2CT8A 4WZZA 3W3AH 1E9FA 1AURA 1T43A 1GSAA 2WYVA 2YHUA 2JB9A 2JFVA 4QKQA 4MARA 2WF9A 5BRNA 4NE7A 1NWCA 3KKOA 3M5CA 4MIOA 3NTOA 4OMUA 3VNQA 3CG0A 4ZZ2A 4E13A 5B2EA 2HA0A 1GNQA 1ZD2P 1QKIA 2WJWA 3JRNA 3MJVA 2QD4A 4FFNA 4RAOA 4DCTA 4EVQA 5IFLA 2BYTA 1P7VA 3H9CA 3B2EA 4LOKA 4HAWA 4RSHA 4AF6A 3ANYB 3EEYA 4Q9HA 3DG9A 3RC7A 4C9BA 2DWOA 1QQTA 1T4GA 4JXJA 1ZCAA 4YCNA 2XDWA 1CQJA 1PR5A 2H52A 3I3SR 3ND8A 4KTTE 4O4IF 5IH3A 5FAXA 1LXCA 2NACA 1ZX1A 4DMMA 1PL8A 4TMVA 4F2WA 3C6ZA 3N53A 5EPUA 3U7QA 2CJPA 3PUYA 1M2GA 4GP9A 4PG6A 3WGVA 1G42A 1IQRA 3JAKA 1MX5A 3K0AA 2OO3A 2YV4A 1EHIA 2NYUA 4L4RA 3H8WA 4ECAA 3HM2A 4TV8B 4OSPA 3A0RB 4TT3D 4ETIA 5K8CA 3KVNA 4J43A 3JQAD 4D43A 4JVNA 5EJ4A 3U3KA 2W8BA 1LDYA 1RRKA 2JBAA 2FETA 1KH2A 4A7PA 1VE9A 2DLNA 4EB6A 2V03A 3EUAA 3IMFA 1P4SA 2BZ0A 4ZEVA 4JYCA 5AKYA 2D8AA 2BTQB 5J1TB 1T3ZA 1EA7A 3HKBA 3MJTA 1E6EA 4GI1A 4XFKA 3T5CA 3LGXA 1NAHA 4GECA 5E38A 5I7AA 1NJFA 3UGQA 1B6GA 2VIIA 2O8EB 3WL4A 2OHVA 4PNEA 5FPTA 2H08A 1VB5A 1Q0LA 1YONA 3HXLA 1IXZA 3HJTA 2YQ5A 2GZMA 3KJXA 2Z2YA 2ZJZA 3IKMB 2D5AA 2RHJA 1Q11A 4MJXA 4MRVA 3ZGZA 2P1RA 1W0JD 5CH8A 3N07A 4YJ3F 4MA5A 2IZZA 3E3MA 1DAOA 2Q2QA 3O26A 3FKSD 4BXOA 4TM7A 2RBEA 4NENA 4BQRA 3EVBA 4BLRA 3AIIA 3ZYCA 2Y6UA 1PJAA 3NUGA 2ZIUB 1MUUA 5LU8A 1L6IA 1KZ4A 2G28A 2EQBA 1UT6A 3NHMA 2DQSA 4NR0A 1XAIA 3YASA 4B7UA 2C29D 5KC9A 4B3GA 3Q7EA 1UPBA 5B6IA 1RE0A 3NB0A 3EZYA 3OESA 3JYOA 2P9EA 4RGBA 4BIIA 1V0JA 4EG0A 3TB6A 3CKKA 3M6FA 4MW6A 3ZCTA 4C4PA 1U4NA 4UEWA 1NBWB 3UCEA 1RPZA 4DSOA 1SUEA 4HO1X 3N2LA 4NCBA 4PTLA 5KTMA 4LHZA 1VLMA 1RQNA 3UJ3X 1R00A 1SPXA 1KU0A 1E5XA 3QF4B 5A3JA 4RMHA 2QMOA 4CM3A 1OH8A 3IBGA 4EB0A 5TC4A 4EYKA 1USIA 3PG5A 4QRIA 1PL6A 4LGCA 1WXFA 3T4PA 4GM0A 4NVRA 4F3RA 4X8LA 2FQWA 5C7LO 3HB7A 1QO9A 2WYWA 3K5WA 1R8JA 4FC6A 4Q02A 3AH8A 4TTTS 3EPPA 1HE2A 3SJBA 4BNYA 4CG2A 1WG8A 3HB9A 1NDUA 2OB2A 3LX8A 4YR9A 5A1JA 3NHWA 3H3FA 1Y3IA 1OR8A 3FLMA 3K0KA 1U31A 1U5BB 2PUVA 4WVFA 3KHTA 4XYBA 1Z74A 1OXXK 2FFBA 3RNOA 1E2FA 1XLWA 2EKDA 4MYCA 2F8SA 1KPHA 1D09A 3ZIDA 2AH5A 2HADA 3EW7A 3NETA 2Q5OA 4MYDA 4YRZA 2XF8A 2C03A 3AKCA 3HLKA 3OTQA 4OQLA 4ZICA 5LQNA 4IX1A 1CJCA 2XNJA 3G0IA 3QU7A 3FLAA 4K03A 1A9RA 3H6GA 3P96A 1BW9B 4HJRA 5L51A 1GKYA 1P4HA 3WNDA 2P62A 1V4BA 4UM8B 4XPIB 3EOBI 4K2AA 1VECA 5DHRA 2XXAA 1PT8A 1X38A 3HCBA 3HCFA 4UD6A 3UOWA 5BV7A 1XK7A 3QENA 1E1NA 1NXSA 2H17A 2OHHA 5TQ0B 1SVOA 2IJGX 4DVGA 1QB7A 3RADC 1NN1A 1E64A 5LLDA 4D5EA 3T4EA 2XVXA 1A9QA 4C04A 3G7SA 2R79A 1K7FB 2W00A 1N1EA 1JKIA 1XJQA 5TJ9A 4F8JA 5K0BA 1KWGA 2RGNC 2H06A 4X44A 4IHAA 3KQUA 2ZIVB 2XMQA 1TA0A 5CA1F 4TL6A 4IF4A 1LSSA 2HF2A 3HN7A 3QBVA 3HXQA 2UZIR 1K8RA 3CUVA 1M2VB 1E3IA 4L5YA 2Q1TA 3B1ZA 4KN8A 4MGHA 1ZK0A 1EFUA 1L5RA 1K4MA 2ODTX 4OLJA 5T4EA 4JD5A 3PD1A 5C1PA 5C8DA 3KJQA 1V8DA 1KYXA 5DCUA 2IQ5A 4ARZB 4BX2A 3LX4A 1KZ7B 3QQPA 1Q57A 4I9NA 5GVRA 3FTQA 3ZY5A 4Z51A 4GE3A 5MN4A 4B48A 2R85A 2H0RA 4FHZA 1AT1A 1CIJA 2EJUA 3D3QA 1NTOA 3F6RA 2VJNA 3GRFA 3UMBA 1YQEA 4CCAA 2IXGA 3AKYA 3MQFA 1GV1A 5KMGA 2O23A 1P29A 4IDNA 4DFDA 1JYFA 4LWOA 1OI7A 4JI3B 2HSJA 4QC2A 1CNFA 1PD1A 3TBHA 1PN3A 2DHEA 3DE4X 1ZI8A 2DECA 5KSPA 3HKCA 3KDPA 3A8TA 1V8ZA 2J4FA 4IJVA 2ZUTA 2J1LA 4UMVA 5IWCA 5H5JA 1OAOC 1I80A 1OGIA 3B13B 3OURA 3IPLA 5EN4A 3U5ZB 4N3AA 2Q6LA 4NHOA 4YQZA 1NR5A 1N7HA 2PVCA 5JAPA 2C9OA 3L84A 3NHSA 4QUHA 5I9IA 3PHLA 3LKZA 1FTYA 4S1TA 2GILA 3WRYA 3G2QA 3I04A 4IIYA 4K9RA 4ZVTA 2NU8A 2CJFA 2OCKA 4P98A 3E22B 2R96A 3PUHA 1RPJA 4FOTA 1GFWA 4HYQA 3IKLA 2FWIA 5CJPA 1QFYA 2HRQA 4FDMA 1VHDA 4DV7B 1GPLA 5A4DA 4LFBB 1LQ2A 3LWZA 2JARA 3F0TA 3DKKA 1C9KA 3HI4A 4LZNA 4YEDA 4JYBA 3I9FA 3PT5A 4HNSA 1U9IA 3BB4A 4RNCA 4K0KB 3F2IA 4HNAB 5FWXA 4PHFA 3ZNOA 5FX2A 2E6UX 4D9IA 2C2OA 1PNTA 3ZJTA 3GLKA 2XTNA 1DIOB 4IUCS 3IFSA 1CY0A 1RQ7A 4EIWA 2WF8A 1KE1A 5LQKA 1P81A 3TTSA 4BRUA 4YR7A 1M54A 4UM9B 4MPTA 4ZJZA 4D98A 1GCUA 4G97A 1SC4A 5ERGB 3ETEA 4HDCA 2JCVA 3CCCA 4YUWA 3HO1A 2VCHA 1EUCB 2H2AA 4NZZA 2KWIA 2DWCA 1D1TA 1E7RA 3NALA 1T9AA 3ILSA 3R4CA 4OHCA 4V0RA 4B0PA 1SXJE 4O5OA 1OXUA 5FBRB 2WF7A 1S8FA 1CC1S 1RAHA 4A8JC 4P0QB 4Z49A 4MLDA 2BY4A 4Y1RA 1R4ZA 1ISPA 1L7QA 3H5TA 2ZLBA 3B60A 3GEPA 4OXQA 3WADA 5HKKA 5K03A 2OQVA 4CEJB 1Z0JA 1AO0A 2G7MC 4AZ0B 1CQIA 2WWVD 4HQNA 3IGFA 1PVVA 3GGCA 3QE4A 4RYDA 2GK3A 3VR1A 5CJJA 2O5EA 1GCGA 1TXGA 3GYBA 3H7IA 3KKLA 1W4LA 1XZHA 3RVOA 3TNLA 3MINB 1AUOA 2CVHA 4D4HA 2RHWA 4YI5A 5BSUA 1Y4UA 1NF3A 3GFTA 1G20A 1N9GB 2R7LA 4LXUA 1MOQA 3C16C 4JEHA 1I51A 1PLKA 3I1JA 4M38A 5CH3A 3AHHA 1PT5A 4KIGA 3Q8MA 2CNOA 2HTFA 3NNDA 1SIUA 3S2GA 1IVNA 4E03A 2PUDA 4OHXA 3ELYA 4KI7A 4WXYB 2GEFA 4UHDA 4WKPA 1NMYA 3USZA 5BXYA 4FXOA 2YDXA 3MRTA 3U40A 5KSYA 2HAEA 2QP9X 4WHMA 1BVHA 5DCLA 1VJ5A 3OOEA 1C3EA 3KXPA 2RMKA 2XMRA 4F6LA 3QP9A 1XRLA 3B1WA 1DCKA 3DZ8A 3HYCA 4EPWA 1SXJB 5AUPB 1ZVQA 3UPUA 1OOEA 2PMBA 1K3FA 1OAKA 3I2JA 3M49A 5EXEA 4QDJA 3TUIC 4YCCA 4BCBA 2C88A 1TZMA 1KDZA 4B6JA 5JR3A 5HEKA 2I91A 2YL2A 4M46A 4KNYA 2B8NA 4NJOA 3BGWA 3ZI0A 1FFWA 2CCGA 3F7MA 3K53A 2ZVDA 5JXHA 1EWQA 1HC7A 5AVWA 2ZJ2A 1PJ4A 1P80A 3F9RA 1E2GA 3UHPA 4H27A 1ZH0A 3WYDA 2SICE 4BEBA 5JZMA 1ES9A 2CL5A 1PG5A 3KV1A 4PRLA 3D4LA 5DX1A 3ZD7A 3JVEA 2HWWA 3L93A 1KMMA 3PFKA 4EI9A 2TRSB 3CFYA 4O8CA 2CNWA 4DV0B 4M8NE 3GGPA 4RKYA 2C3UA 3HV0A 2VT6A 3L6UA 1PQPA 3NEJA 4KJXA 4QOFA 4MV7A 1K98A 2X4IA 3OVMA 2G76A 1NT4A 3LHDA 4MQBA 2WWYA 3AVYA 2XCUA 1UFVA 1GCOA 3GJTA 3B8HA 4NFHA 2QTHA 3O9MA 5JEEA 2PS0A 1L4GA 2G0NA 2Z2ZA 5DGDA 1IN1A 4BS9A 1UEIA 2V5VA 1S3SA 2G9VA 2HYDA 1TNDA 4Y6SA 3VU8A 1U7TA 1U2DA 2OZEA 3KJGA 4NK4A 2PKQO 7YASA 4HHEA 4W1RA 3RFXA 3ZQ6A 2O19A 4F21A 2ZKIA 1BWRA 5J5AA 3B8EA 3NU1A 1L3IA 1T6NA 5KYWA 2UYHA 3TAUA 4ARCA 5F9FA 1T35A 1TVMA 3GJRA 4RTRA 1NP6A 3QM1A 2RJNA 4GRAA 4JMPA 5CIQA 3ZE8A 5BORA 5JIBA 5JSZB 1AV6A 3FPLA 2WJVA 2XKJE 2Q4TA 2YXLA 4D0RA 4CN8A 1MC4A 5BSFA 2AOTB 4YAKA 1T15A 3CZRA 3H2IA 1K7SN 5C5EA 4ZAZA 1FRFS 4DB4A 3D0QA 3DEAA 5BN4A 2OZLA 3BQ9A 3KZKA 3NWJA 1DIAA 1R5BA 1L0BA 1THGA 2IYOA 2XR1A 1YNSA 4GT1A 4HFRA 4JOSA 4BEVA 2ZI7A 2AEMA 2IYXA 1W4AA 1UL1X 1Z26A 2VCEA 1I3OA 1VXRA 3GGJA 4N6OA 2BSQA 1N2GA 4NAVA 1B6RA 2GEDA 2WP0A 3LNTA 2HHCA 3PGLA 4E5YA 3ZZ0A 1GP2A 1N2HA 2J0UB 2RJ3A 1E3QA 4INZA 3PR3A 2B4QA 4D97A 3NEPX 4EG8A 2YS6A 3QZUA 5DGTA 1VYTA 3D8SA 4HAYA 3TO5A 7REQA 2BH2A 4W5WA 3PFBA 3IAXA 3A1TA 5H80A 4BLWA 1GD1O 1C8BA 1UEJA 2X0JA 3UC9A 1NVAA 2FR0A 4GYYA 1TW2A 2HJGA 5IH7A 3QVGA 1V11A 2XGJA 3V1KA 1XKLA 4AJLA 2FY8A 2QP4A 3RABA 5HGXA 2IIPA 1M2JA 2DWUA 4PBRA 1T9BA 1VI2A 1C9EA 3WNQA 3FVQA 2GBLC 2B9EA 2VOEA 2KHZA 5E4YA 1TTTA 3IA2A 4LZPA 4KQ2A 3I12A 5C4MA 5ITZA 2YFKA 4WGGA 2OBMA 1BDJA 5CP8A 1M1NB 3D4NA 3SE7A 3QRWA 3EG5A 5HIMA 4N48A 1I2DA 1E92A 1KAEA 4ENTA 4IDFA 4RJTA 2CVFA 1DC4A 3QXCA 3IRVA 3C97A 1GL3A 3E0QA 1AV7A 4MJLA 4O2AF 4Z4CA 1KAGA 1SVMA 2BCJQ 1ZXLA 3T1NA 3K9NA 4R8LA 3H99A 5G4LA 2CFRA 2BSXA 2EQ5A 2ON6A 3DCJA 2XUJA 2Z4TA 3A6EA 3FI9A 1JH8A 1PX2A 4WFIA 4DLKA 5DN6D 4FBMA 2RHHA 2HO5A 2C3YA 3LP6A 1ADJA 2WM2A 1SBCA 4HC4A 1J8VA 3O3MB 1H0HA 3UKJA 1NE7A 8OHMA 1RBYA 2R0QC 1FYWA 1M8JA 1ZG3A 2P5UA 1R8QA 2E37A 5F9MA 5FTLA 5IN5A 1CEQA 1CFJA 1QC5B 3OIUA 5IC6A 3ISVA 3WGIA 2YVLA 1K7CA 2CMKA 3T7CA 1U81A 3VPGA 4JUIA 4RORA 4B5LA 2DPHA 2IV3A 3WC4A 2ORVA 4DBLE 4CGZA 3CO0S 3FMOB 2FMIA 1PQYA 1YB4A 3FR8A 3LT1A 1NVMB 3VVCA 2NZVG 3JQ7A 3IELA 3SSAA 4LCEA 3RS2A 3R9XB 2B4TO 1EK1A 1Z28A 2PGNA 1AUXA 4YRQA 3W7AA 2M1ZA 4DYHA 1BN7A 2CFOA 5HP4A 1VGQA 1D1QA 3FYUA 3G23A 5J4KA 3DWFA 1IY8A 3TFWA 4OQFA 3I34X 1YZYA 4N3NA 3FNGA 2BKLA 1TMOA 3Q8LA 3NIGB 3V4SA 3VQTA 1Q44A 3GRVA 3RD5A 3TZ6A 1WR8A 2XODA 5EXDA 2Y1EA 4K26A 4MVXA 1CS4C 2P6MA 3LCMA 4E08A 1CV2A 4CM6A 4EZEA 1OI2A 5GJWC 4DV1B 3I6QA 2BI8A 5FFMA 2IYYA 4A2CA 4F3NA 3D0OA 2LRHA 3SXUA 4AKTA 1J23A 1Y5IA 2W22A 4B1FA 4DQUA 2I4TA 2JA2A 2HT6A 2IUUA 2W9XA 4D3ZA 2I2AA 2WKSA 3EGDB 3L41A 2PIAA 3QNUA 1TIKA 3M9XA 2VK4A 4D9MA 3QOFA 1FEZA 2HK7A 2C8LA 2VDUE 1X1QA 3LOQA 4XLZA 2DQKA 4YJGA 5EWLB 3D7RA 4AWXA 1Q7EA 4EQ6B 1A8IA 3UWSA 5JNLA 4RWEA 4KFCA 4QQRA 4IXMA 3VR0A 4J0QA 1SGWA 2PRYA 5HFAA 1FK8A 1U4OA 2IGTA 1WAMA 2VDKB 3TQRA 3WIEA 2XUIA 2JFXA 2WHXA 3VA7A 1JDTA 4WK4B 4YTEA 5JCXA 1S7CA 1CW2B 1YVUA 3IRUA 4PC1A 1AKYA 1UT5A 2JLAA 5K3CA 5C34B 3V4ZA 2WUVA 2C7RA 2RHLA 3A70A 3OO1A 3UMFA 1R6UA 5HKKD 1HOXA 4RC9A 1GPMA 2HL6A 1E89A 1MV8A 1NXTA 1RDFA 4RK6A 4BP3A 3RSFA 4N76A 2Q3JA 2GSWA 2DHDA 1Z13A 4M88A 3QX3A 1TLFA 1YRLA 4KFRA 2VF5X 3DMGA 4F71A 3IT2A 1DAIA 2DFTA 5EVCA 1VCHA 2IV7A 3C4JA 1SOMA 3MUEA 2Z2IA 5ENDA 4KO3S 4M4SA 1OLSB 4DXHA 4TUYF 2PCJA 2NWQA 2R9VA 4DWVA 2PZBA 5EMLA 1M75A 2D0OB 4TOIA 5EJGA 3T9FA 2O2EA 5P21A 1WMFA 3SKXA 5DYNA 3WIBA 3EISA 4NG5A 2F00A 4KODA 5L4NA 3RYCA 4JXXA 5U4QA 3EMVA 3JAWA 4GNRA 1RI4A 2WWFA 2JRCA 2LE0A 3FGPA 3QXHA 3KAJA 2J5QA 3MM4A 1HG0A 2ZQ5A 4H3VA 1L4FA 3LUFA 1ZUNB 5CT8A 2HUPA 4BJ6A 4PSCA 1IHYA 3V00A 2C4HA 3HU5A 4WWHA 2NUAB 5JH7B 1PEDA 4UEOA 3T4XA 4H4CA 3QTTA 2R25B 4TT8A 1OBFO 2HF8A 1YGYA 3BHIA 5T4HA 1TGVA 3EXEB 3QWFA 2Q5QA 4H0CA 2EX1A 4OXRA 4EMSA 2WSLA 1M67A 1H1DA 1A77A 1XGKA 3IE2A 3OCZA 3LQ4A 4MPRA 4P82A 3SNKA 3O03A 1JV2B 4C6TB 2W8ZA 2PS1A 4GLLA 1JG1A 5CNKA 1J0DA 2CF6A 2FEKA 3A06A 3G02A 4G5FA 5AMXA 1SBHA 2BJVA 3GX1A 2QTTA 3NT4A 4HAZA 4OUDA 4A23A 1XJWA 1FJ2A 3EE6A 5E1OA 4CUZA 1J97A 2WAMA 4RVSA 5CW1A 1TAUA 3LWNA 4AMYA 2IHYA 3DW3X 1LBHA 1ZQ9A 2WIKA 3R5JA 4NNOA 4YPFA 4CKXA 4DQ0A 1W0CA 5E6UB 2ANCA 1KJ9A 3EVDA 2B1GA 3VX4A 3HMQA 3PDCA 2JVKA 2CHGA 3MGKA 3THRA 5HZMA 2EQAA 2XNHA 2AR9A 4EF5A 2RI1A 5A5FA 4Q01A 2AYYA 3LDHA 4CKEB 1JLRA 1S8NA 3I2HA 4KBGA 1RKVA 5TS3A 1E58A 2P78A 2GM3A 4N18A 4B4OA 5JYBA 2JCXA 2VUSA 2ES4A 3GDFA 2I3AA 3A4MA 4JUAA 4M1QA 4XOIA 5DRYA 2OG2A 1ZPDA 3IQXA 1W96A 2NU7B 3CLRD 1Z3IX 5HM8A 1Z34A 3DMFA 2I6SA 3F4BA 3GP3A 3SBXA 4C7VA 2DKFA 4C03A 2XWJI 1WOYA 3H1BA 3OQ1A 1RXEA 4WVLA 4DCNA 4N41A 1XK6A 4J0FA 3DTVD 2QRJA 3QWIA 4DCOA 5GOZA 2DU8A 3WIUA 1G60A 1Z88A 3E3NA 4AN0A 2H6EA 2OCGA 4MV1A 4QG3A 5JXJA 5LIPA 3QEMA 5I9MA 1ECLA 1RHMA 5DTQA 3ZHSA 4OLAA 1WXDA 3HBAA 4ZDJA 2XCRB 1Z08A 2WJIA 1TI7A 4WERA 5AJYA 3P7MA 5KI6A 2PUAA 2C5GA 3OCCA 4UDYX 5AFSA 3EASA 5J3JA 2CLLB 4I3FA 2R7KA 3WGZA 4DREA 2FK7A 4KYUA 1NUAA 2Q1UA 4GL2A 3NBAA 3FAKA 3CUEF 2GS9A 1Q0HA 2YC2C 3ELWA 5I9NA 2HLHA 1QPGA 2YV5A 2F17A 2YNMD 1MPXA 3AESB 4PYOA 3GLFA 3A9WA 4B9EA 3T5DA 5TARA 2YMPA 1OH5A 3TIGA 1E9RA 2RGXA 3FFAA 1CVIA 3E3AA 3PEWA 1CUIA 4HH4A 4TV9F 2IKQA 3LQYA 4YP5A 5DP1A 4KCGA 1PF7E 2F9LA 3VNSA 1HE5A 2WG2A 4B73A 1BGXT 1YE5A 3CLRC 2X0RA 3O2SB 4EBBA 3I2KA 4MVJF 3AF1A 4Q4JA 4MA4A 4IG4A 1HR0B 1W30A 3H1AA 1I9CA 1P73A 3VVLA 1GU0A 1A2KC 1X70A 1X7GA 3L82B 4WZAE 2Q1XA 5DM60 3TDNA 2FH5B 2VH5R 4F12A 3IXQA 2VNIA 1OT3A 1YDWA 4GBED 1D7OA 4TYPA 2G8NA 4XM0A 1FP4B 3RC2A 4PG5A 5FL3A 5KYXA 3EIFA 1E1MA 5DCYA 5E95A 3ZWKA 5G0SA 1S6YA 3AI7A 2C5FA 3D3WA 4ON9A 5E6SB 3TZBA 2BFFA 4TLEA 4TX1A 7ABPA 3VYSB 2ZJ3A 4MVYA 4E2XA 1CWUA 1SKBA 3NEAA 1WD7A 2Q62A 4PGAA 5DNVA 2E4WA 1ORRA 3O2JA 4LYHA 4QD3A 4XB6B 3JZMA 5HJ5A 6PFKA 4EUEA 3BKWA 4ALNA 5JU6A 1KSGA 1FVXA 1KORA 2Q2OA 1FNSA 2YNMC 3O4RA 4K1LA 2Y1CA 4AP9A 3CVVA 1DAKA 3EFBA 4HB3A 5FPSA 2JCYA 1E0JA 1ZNYA 3E70C 5JRJA 5A5GA 2ONCA 3EGXA 3DEKA 4WLEA 3KEFA 2EEZA 2R4QA 3LK7A 5J5CA 3ITNA 3M4JA 4KQGA 3EMDA 3L8MA 1I0LA 4QFBA 1D6NA 3SX4A 3THSA 5B30A 5IT4A 1PEYA 2ORIA 2IU3A 5FADA 2FP3A 4CEIB 1T2DA 2JK0A 2JZOA 4LC0A 4M8IA 3MQ2A 1LLUA 2NSYA 2ALJA 1I6MA 1X1CA 3GG9A 4IXWA 2XB4A 2BFDA 4WZAB 5HKBA 4O1IA 2R4TA 1Z5UA 2XTAA 2ZIZA 4Y18A 2RGEA 4DTIA 3EIEA 4Q7EA 3NOXA 4BTEA 5ESWA 1DBPA 5CU7A 1UKEA 2CJYA 4KDFA 4QOHA 2OHOA 2AQ8A 4AJPA 3DV0A 2PT9A 2ERCA 4HPXB 4R3WA 4WXRA 1OFUX 1RI5A 3HZOA 4O4LA 4WI1A 3DDNA 1BDBA 2IHJA 1G2OA 3AQIA 4H7HA 2GX6A 2GUGA 4OL9A 2P6OA 3ACCA 4HAXA 5AW2A 5FA5A 4H3SA 1XMQB 3RSZA 4CLXA 2FW0A 4QBIA 4LRTB 1Z4LA 3HO6A 2DKOA 4YGYA 3LVBA 1XTKA 2QM3A 4L2IB 4CLRA 2WZBA 3ABIA 3BSWA 3K7EA 3RS8A 1HYBA 2JIPA 1WCXA 2VUIB 3VH2A 3N2KB 4DSUA 5CTAA 3JASA 5KQPA 1OQAA 3LMKA 3M9WA 1V5GA 4YGXB 4LJKA 4N0MA 1GV0A 4KQ6A 5DM2A 3KZNA 3BRWD 2P9GA 4B3XA 4A6XA 1R0ZA 2PRSA 3E3OA 1CCWA 1EFVA 1IHDA 2XDAA 1B41A 1HBJA 2VDNB 3I9LA 5ALVA 4CDGA 3WZLA 1BFUA 1D2NA 4R1NA 1XDSA 3OT5A 5FCDA 2Z8ZA 1PG0A 2PO5A 2ZGVA 4XYMA 3E9QA 2PRIA 3CJQA 1VCMA 2VDJA 2CD7A 1FYFA 2OD2A 4NJEA 5F23A 2KE5A 2F1JA 1LTHR 1PYOA 4J3FA 2XA9A 1XD9A 4RJKA 4LJSA 2XNDD 3OG9A 5IT5A 4HMPA 4HUJA 2WMYA 2I2BA 1GGJA 4FI3C 5CT4A 1UP4A 2HO4A 1EVQA 1E66A 3MMZA 1TC1A 4H60A 421PA 3LDUA 5AW4A 1PKEA 4BQEA 1LLDA 1FUIA 3C98A 2ZRHA 4PR0A 1TZKA 3RTDA 2O4CA 1YFZA 1XV5A 2IUTA 2XEDA 3QX9A 2JGAA 4AJKA 2BFMA 4LHVA 1GU7A 1EX9A 3ZY3A 2WWTA 1E6MA 1DTWA 4UVEA 5C32A 3RT1A 3RU7A 1IQUA 5ALOA 1JNXX 4BIMA 1KYQA 1V9LA 1G64A 4B6FA 4DF3A 2QTLA 4LNUB 2YWHA 2YHIA 1W49A 2P0EA 3QE3A 3RTCA 4D0NA 4KEAA 3SZ3A 5K0TA 1ARZA 1F2DA 3I5UA 4NG4A 5EXPA 2GZDA 2V8BA 1V95A 1Z73A 4RVFA 2ZDQA 4AQYB 5ICMA 5LQSA 4PVCA 4LMPA 1FSGA 4K86A 3E5MA 4FKMA 1JDPA 4AJNA 5IYZA 2C07A 5JDIA 2JGIA 3RGGA 2ZM5A 1H6DA 2ZRAA 1QP8A 1MC8A 4PYIA 1ZKMA 1O6CA 2YYYA 2FXVA 4TRJA 3WAGA 1QIJA 1YU9A 4KO4S 2QVBA 1FFDA 4MNTA 4PXAA 4XX0A 3V8BA 5KMGB 3IOBA 1MJNA 2C1EA 5IT0A 4UEJA 2IV2X 2HJRA 2VRNA 4B84A 4NU8X 4BV3A 3BMOB 5K4HA 2ANBA 3ICQB 1YI8A 4DNFA 1GYQA 1XRMA 2QE6A 3DEJA 4OVKA 1H5UA 2EBWA 2HUNA 1BMDA 5DLQC 2H0AA 3RVDA 5ARBA 3ABZA 3L05A 2TECE 1YIOA 1XL0A 5A9RA 2BEVB 3PJEA 5IC5A 4KIUA 3K05A 1FNCA 2RD2A 2YWEA 1YU6A 5CNIA 4Z7NB 4FK8A 4EUNA 2IXFA 2YJGA 2FB9A 3OHPA 4C7OA 2J09A 4E5KA 3TPZA 1EVKA 1SCQA 4LTDA 4L02A 3P9YA 1R8YA 4Z3DA 4HXFB 3TLAA 3RSHA 4BLQA 4BO3A 4RTMA 1QHYA 1WUIS 2NSJA 4ZVKA 4WCVA 4C3VA 3HJNA 4DR4B 5J4LA 4ZMRA 2C7QA 4AZTA 5B3JC 3R9WA 2ZI4A 1JAXA 2R6FA 3QVVA 4JDPA 3GJXC 4O2BA 4S24A 5B2ZA 5JAUA 1NXWA 1CZKA 1J1IA 1U0HC 1KERA 3DAYA 1T8SA 4YLEA 3C1UA 1EP1B 5HKLA 2FFQA 4AL4A 4B79A 4F60A 4HNRA 2JIBA 2QTNA 1YC2A 1FXSA 1TT5A 3VTFA 5CYFA 4QA9A 2R5WA 4MXDA 1PJ8A 5E1DA 2WW8A 4R71A 4WN9A 5T3YA 1GAXA 4AECA 5KNDA 3OCXA 4G5YA 4R0NA 3OI7A 4YCSA 1T6YA 2L82A 5JXIA 3C5HA 2BMFA 4G84A 4AJHA 3THXB 3FZYA 4Z9FA 5J2TF 3H04A 4HDMB 1MT3A 4I9HA 2KJQA 3I4FA 3ICOA 4TMTA 5KWIA 3CN7A 4JYPA 2JGRA 1KO4A 3A32A 3R9KA 4F4UA 5H4GA 1ZISA 3GVCA 2X0EA 4RZHA 1B42A 3AEXA 2YXDA 3V1NA 4ZFNA 3NHUA 1Z0SA 4MW5A 5SZKB 4C2UA 4HNGA 1FVFA 5DLPA 5DZSA 5HJ7A 4HEQA 2MHCA 3PYXA 3L77A 5CX1A 5TDHA 3M2TA 3JRWA 3VJMA 4C76A 1VPVA 1LV8A 2YHBA 3U7GA 3Q3EA 3DF9A 3K2IA 3KB1A 3N2IA 4J1TA 4EENA 4JVMA 1R5OA 4M1OA 3K0BA 2L69A 5IAEA 3GLSA 2UYYA 1PDOA 4I9FA 1SWWA 3BHJA 2WV7A 2N3ZA 5EEHA 3MAGA 3UWPA 1HYEA 1U3FA 2G63A 1YL7A 4JP5A 2MWMA 3FWHA 2WYIA 2O1WA 2P9JA 4V0MA 5LOVB 1X1RA 2OP0A 4JBWA 3X1XA 1Q12A 1T5DX 4TMYA 5TX7A 1YFJA 4TKUB 1SB9A 4ITUA 4GLBA 4WUVA 3U4AA 3D4IA 1CX9B 1MGPA 4H1WA 3BIFA 2ASVA 2J3MA 3Q85A 1CZNA 1Z06A 1MRNA 5FUWA 4IH4A 2BI7A 3ZXYA 4BMDA 1L4EA 1Y3FE 3CLSD 1ZGBA 5EJEA 4Y2HA 1JIVA 1EXVA 3E05A 5CIYA 2JLBA 1AS2A 2Q4DA 4LCBA 4HMOA 3C5EA 2ZYAA 5C7IO 3QWAA 1Q1EA 1WNTA 1RHQA 1QR6A 3SYNA 4EPRA 3LXMA 4CDNA 3GFFA 1QTQA 2EW1A 2D13A 2R1TB 3QFHA 4JWKA 4U7PB 4IRUB 3O0DA 1WKCA 5REQA 3W4JA 1WBBA 4TLLB 4BNDA 2VJDA 3O5AA 1WZIA 3WMEA 1PFYA 1U0OC 1CUSA 1LQUA 1PTKA 3NKVA 2OO5C 4H6WA 5DHPA 2O59A 1KQ3A 3LLSA 2ZUFA 5GJVC 2QLMA 4M8SA 2X9VA 1OX4B 5CT9A 3PV0A 5EESA 2FPSA 4PONA 4N12A 3PA6A 2XYRA 3DCYA 3BDIA 5CM8B 1QJCA 1SD2A 2ENUA 2GEUA 1RM4A 2HHJA 3QKSB 3DVQX 4AUKA 2YBEA 5J4YA 3DE5X 1G0NA 1U02A 4R7ZA 2NZXA 5E4TA 3N6VA 5HIKA 3U1VA 3EVNA 4P53A 4CPDA 1A82A 2XWSA 3CLSC 1QCYA 1DP4A 1U3UA 1WB4A 1YJXA 1I3CA 3PEFA 4LNAA 1YUMA 2VDQB 5F7XA 3EB9A 4RLSA 4LE2A 3NJ8A 2WD9A 4EJFA 4YS6A 4I1YA 5HRUA 1KO1A 4BFZA 5TE9A 5ANRB 1QU2A 3GAZA 4IGFA 4R16A 5FBKA 4MRPA 3JW8A 3AR7A 4N03A 1Q77A 4Q7LA 2YASA 2FNAA 3GFVA 1I3MA 2PBRA 4LQLA 1UC9A 1VP3A 3I3OA 2DB3A 4FDAA 2GHIA 3VZSA 3FPGA 5CGZA 1DC6A 5CA0B 4FX2A 1UK9A 1Y89A 3ELDA 1C80A 3ZWPA 5I45A 3KOOA 3COYA 3B5EA 2C97A 2DTEA 3I52A 2P69A 3W5AA 4HUTA 3ZEIA 1N0VC 1VBNA 5A06A 4MI3A 2PX3A 4Q66C 1IOVA 3WRXC 3RW9A 1H2XA 3TRFA 4M0FA 3OLYA 1KA9H 4YXFA 1BS2A 1IN8A 3T1VA 4NDZA 4G5OA 1DCFA 4RD2A 4I2NA 2VJAA 4LEIA 2Q0XA 3CR3C 2CYAA 3SS7X 2X0NA 4BO4A 2A14A 1XFDA 2FP4B 3OOWA 3Q7IA 1R5JA 4ES6A 5AJVB 5J4HA 1T4DA 3G17A 4I6GA 3DEZA 1WU7A 3M6UA 2O9JA 4HYEA 4Q7JB 2G9UA 3IUQA 3FOEC 3BZBA 4JUCA 2OCXA 4L78A 2DKNA 1L4MA 2W2OA 3TW6A 5HS4A 1BDIA 1P6XA 5AI6A 4C87A 1XBTA 1X1AA 3PCXA 4X94A 3LCCA 4H3KB 5KYKA 2PKRA 2FRVA 5AK4A 2ZWOA 1PJ2A 2HR1A 2HCTA 1AK1A 1UDWA 2XTMA 1ENOA 1YZNA 2A7XA 3DA8A 3NHZA 5KNBH 2QQ0A 2EERA 1Z2CA 2LIPA 3MTIA 3GJ4A 1E9SA 1D2CA 1G5RA 2GVDC 5LKRA 3T3IA 1RKQA 2AN9A 4DKJA 1ISGA 1RMTA 1UWCA 4BOYA 1O97D 3DNMA 1VI6A 4AIIA 4PLPA 3LYHA 5D84A 2H8GA 2XQVA 3F3KA 4OFBA 1G291 3F8WA 1QH1A 3K1AA 2G9ZA 2Z09A 3VR5D 1X2EA 5BW5A 1GT91 1YVRA 3T3OA 1SA0B 3ZDQA 1Y1TA 4FSDA 3KSAC 3T15A 4IJQA 4JN6B 4EKNB 2J32A 4EKEA 3K9QO 3UGKA 5DJ5A 1Z2OX 3U2QA 3CG4A 2B6NA 4ILKA 3ZUPA 5DTMA 2IS2A 1A5SB 4CHTA 4JT2A 2DRIA 2YJTD 3OHMA 4RFSA 1KPIA 1UMBB 1I33A 3UV3A 1I7NA 2G4LA 4LY3A 3K0SA 3FNHA 4R5HA 1PJTA 4O4JB 4HQOA 5F78A 4N5IX 5ALWA 4DEXA 4XDHA 2JHCA 4C7XA 1M76A 3ABSB 2PV7A 3HCCA 3HA5A 1CUXA 1NW4A 2WYHA 2I9KA 2Y2UA 5CFLA 2W0SA 3VSAA 4EG5A 4Y9SA 4X93A 1W87A 3IQGX 3PUVA 1YDFA 3C8ZA 5HJEA 1WABA 3I76A 1I3NA 1ULZA 3SOZA 1SHUX 1XCPA 1DEHA 4MW2A 3VDRA 3KZXA 2YYSA 1MVOA 2QG6A 1VL2A 1KRXA 1O97C 5CHEA 1NVGA 2R6ZA 4L5JA 3ZY2A 5GWXA 2WWHA 4EG6A 1Q1ZA