4D74A

1.57 a crystal structure of erwinia amylovora tyrosine phosphatase amsi
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
151
structure length
151
Chain Sequence
b'NLYFQGAMVNSILVVCIGNICRSPTGERLLKAALPERKIASAGLKAMVGGSADETASIVANEHGVSLQDHVAQQLTADMCRDSDLILVMEKKHIDLVCRINPSVRGKTMLFGHWINQQEIADPYKKSRDAFEAVYGVLENAAQKWVNALSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN-TYROSINE-PHOSPHATASE AMSI
publication title Characterization and 1.57 A Resolution Structure of the Key Fire Blight Phosphatase Amsi from Erwinia Amylovora
pubmed doi rcsb
source organism Erwinia amylovora
molecule tags Hydrolase
total genus 57
structure length 151
sequence length 151
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2014-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d74A00
4JASB 1JFSA 3IPCA 4QYWA 1MB3A 1YK0A 2FMIA 4NQRA 3OLYA 2CD7A 4Q6BA 5EWJA 2FKAA 1YIOA 3TX6A 2FMHA 4W5RA 3EJWA 1D5WA 1E6LA 1NATA 2HQOA 4G0MA 1DP4A 2NT4A 5HM6A 4E7PA 3QEKA 5I4CA 1CYEA 2WRZA 1NXXA 3C3KA 3NHMA 4P98A 3UKJA 4KFCA 1H9CA 2GX6A 4LE1A 1M2EA 4YO7A 3FDFA 5F64A 3I09A 3TD9A 3W9SA 2CHFA 2PAFA 1QQBA 4DADA 4ML3A 1QP0A 3RVNA 1LK0A 2FLWA 3T38A 3M9WA 3EDCA 1BA2A 1SXGA 3Q7RA 3TB6A 1QPZA 2MYNA 5IX8A 3M9XA 3F6CA 4RY9A 2IPMA 2JVIA 3OLVA 4G0QA 1RNLA 2GKGA 1LJUA 1JFVA 1U8TA 3KYIB 3LKBA 4MR9B 1RPJA 2WJWA 5BRJA 1VRVA 4OLAA 2O20A 5IBQA 4Z4IA 4Z4CA 4KV7A 1TVMA 4KREA 5HSGA 2E4XA 3CTPA 5DGCA 1SRRA 5GQSA 2ZAYA 4MR7B 3FGZA 1DCMA 1QO0D 2QZJA 3FFTA 4HNQA 4N76A 3OO0A 1K68A 2ID7A 2QXYA 3H1EA 3N0XA 1LJLA 1QP4A 6ABPA 5ED4A 2PL1A 2LIVA 4RY0A 3BREA 4LDAA 2PUEA 1TM2A 1ABEA 1ZDMA 1ABFA 4RK5A 1NXSA 2PJUA 3GL9A 3I42A 4EVSA 1GCGA 2E4WA 1A04A 3HEBA 1FQWA 3NNNA 5BQ3A 1Z2EA 2L19A 3Q7SA 3HXMA 1LBHA 4TMYA 4DQDA 1PEYA 1M2FA 3C3WA 3EQZA 2OENG 1USGA 3HUUA 3N6VA 3URMA 2QU7A 5TQ2A 2WJAA 4W5OA 2MYUA 2HQRA 4MS3B 5IUNC 3JVDA 4RSMA 5TPZD 3KS9A 5KQPA 3GBPA 1APBA 3OM1A 4RK6A 4XASA 1CHNA 1CEYA 1U0SY 3HZHA 3IP7A 5IEBA 1M5TA 4MS4A 3CU5A 4OG2A 4OATA 3LUCA 2NZUG 3Q9SA 3HUTA 3R0JA 1K66A 2VUHB 3MF4A 3O2SB 2W42A 1DC7A 4FE4A 3QLUA 1FFSA 3O21A 1C4WA 3ILHA 1DBWA 1DZ3A 4XAQA 3ROFA 3HV2A 2YHBA 3UUGA 1B00A 4JAVC 2P4UA 1DRJA 3SY8A 3JTEA 4RV5A 2JBAB 3FFXA 1ISRA 2FQYA 3N0WA 4TN5A 4Q6WA 4EVRA 4Z4HA 1RXEA 4JB2A 2L17A 3HDVA 2JRLA 5T3YA 5JNRA 3UK0A 3QX8A 4LE0A 2FN8A 3BRSA 1TLFA 3P9YA 2VUIB 5DKFA 5C5EA 1Z17A 4MRMA 3DZDA 3H6HA 1JL3A 1MAVA 1UDRA 3ROTA 3SQNA 1YMUA 4KVFA 4YWHA 5FWYA 4IF4A 2M1ZA 3G85A 1E6MA 1USKA 3G1WA 5KQGA 1JYEA 1KMIY 3Q41A 3Q7TA 4IRXA 4OLBA 1ZH2A 4RZSA 4RWEA 5CNJA 3GYBA 1F4VA 4Z9AA 4MYRA 3QELA 3HO1A 3N53A 2DRIA 2WWVD 2J48A 3QLTA 5DTEA 4PYRA 4O1IA 3CZCA 1JWLA 2R47A 2N9UA 5ABPA 2PUFA 1BDIA 4EYQA 1JHZA 2MSKA 3H5IA 2FLKA 2BGGA 3HK2A 1YMVA 4YR7A 4EUKA 3DGEC 4MQEA 1R8JA 2F8TA 5PNTA 4LE2A 5JS1A 4EY3A 5JNWA 1P2FA 5JNUA 4WXEA 3T8YA 3GA5A 4W5TA 1U2QA 3LUKA 2JK1A 2ZWMA 2NT3A 1IIBA 1MB0A 3N8IA 1D1PA 5B3JC 4WWHA 2AYXA 4G0ZA 1QMPA 3RVSA 4XFKA 4G97A 1PEAA 2FMFA 4MR8B 2NUBA 3QLUC 1L5ZA 4YLEA 4F11A 3GWGA 4JB0A 3KSMA 1USIA 1DBQA 2PUBA 4MS1B 4D6YA 4RS3A 4NCBA 4WUTA 1D4ZA 4EGSA 3NNSA 1XWWA 1Z25A 2MSLA 4LX8A 1Z15A 5TE9A 3SAJA 5T7BA 3I5AA 4Q7EA 4MR8A 2YHAA 5CNKA 4ZPJA 3EAFA 3JS5A 2GBPA 1WETA 1VKRA 3CZ5A 4EYGA 4NCAA 6CHYA 5JNSA 2FEPA 4MLDA 1FSPA 3H5WA 5JNVA 4MR9A 3RQIA 2LUOA 3KKEA 1P6UA 2PKXA 2R48A 2WB4A 3KCNA 4Z4EA 1OXBB 4ETNA 3EULA 1HEYA 2E4ZA 3CNBA 1Z18A 2M98A 2IPLA 2L18A 4JP1A 1DG9A 1Z26A 2FSPA 4N0PA 3S99A 4F3TA 2FEWB 1EHCA 1P6QA 4MR7A 5C5CA 1QO0A 5IULC 1J56A 2B4AA 3DGFC 3O74A 1A2OA 2FXIA 1GUDA 2H3HA 4WXMA 1EWKA 2MYPA 3BBLA 3MMNA 4G86A 3CS3A 1JX6A 3GV0A 3MQ4A 2JCGA 1BDHA 5EWLB 4O1HA 1PUXA 3KLNA 3LUAA 4EYOA 3OQNA 2AYZA 4PICA 2MYTA 4YRZA 4IMJB 4LRQA 3IP6A 1PNRA 3H5LA 3IP5A 5TQ0B 4WT7A 1EWVA 5IUKC 2QW1A 1DJMA 3JPYA 4RK7A 4XXHA 1ZHHA 5B3JA 3KG2A 4Z4FA 3RVRA 4RK1A 3T95A 1XHFA 5FBHA 2P9HA 4MS3A 3GT7A 1YS7A 4KQ9A 1JF8A 1JBEA 4ETIA 3N0RA 3F7NA 4UHJA 3M6MD 3MYYA 3VNBA 1KGSA 5TPZA 3H75A 3A3KA 3MIZA 3QEMB 2IYNA 5TQ0A 3IDOA 2TMYA 3CHYA 1L5YA 4OTZA 1Z13A 1JYFA 3RVJA 4RK0A 5FWXB 3D8UA 1GCAA 2E4VA 4OBBA 3QK7A 4KRFA 3OLXA 3SNKA 1ZH4A 2FEKA 1U04A 3KJXA 4F12A 3VNAA 4RKRA 1SXIA 3OLWA 4GNRA 3QEMA 4IMIB 4XLTA 4YS6A 3OQOA 5HKOA 4KQCA 4YP9A 1ZAYA 1DRKA 5JS2A 3HJFA 4ETMA 1JDPA 2A9OA 1W25A 7ABPA 1NXOA 3LMKA 2LP4Y 4YV7A 1I3CA 2JBAA 4RKQA 3RVMA 5KWSA 3JVIA 4G0OA 1MIHA 5BRAA 3RVOA 1URPA 1JDNA 1EWTA 5HQJA 5KC8A 4H3HB 1FFGA 5DCLA 3IP9A 4ZMRA 4F8JA 4JOQA 1E2BA 1TMYA 1ZN2A 4N0QA 3C6QA 2PUGA 4FB4A 3JY6A 2CHEA 3O1HB 4Z99A 1NXPA 4MAAA 4S05A 1GLGA 1DBPA 2JVKA 5KQMA 3HCWA 4Z4GA 1YTUA 3DLBA 4TLLB 4RXTA 2PUCA 1QP7A 1QKKA 2IPNA 2QV0A 5EWJB 2FW0A 3T6KA 2R4QA 2VYCA 2IKSA 1BDJA 3KYJB 3LUGA 5CNIA 3LUFA 3HVRA 3DBIA 4FE7A 4IGAA 3DLHA 3CRNA 3CG0A 3NHZA 1DCFA 2FQXA 3LOPA 4HYEA 3GRCA 4KPYA 1Z16A 3C97A 3KTOA 4GPAA 5EWMB 2JB9A 5DLEA 3A0UA 5TQJA 1QQAA 3O75A 1NXTA 3O2JA 4PEVA 3QX9A 4RU1A 5CHYA 1JLKA 3A0RB 2OQRA 3EQ2A 3F73A 4S04A 2QR3A 4CBVA 2PUAA 4G0PA 3HDGA 1YVUA 2A9PA 5KQLA 2FTKE 3E3MA 3EODA 4HNRA 3L49A 3CKMA 1Y1LA 4KNYA 2A9QA 5JNTA 3FFWA 3KLOA 4Z9BA 5EWMA 2HQBA 4Y9TA 1QNLA 4RXUA 3MM4A 4KK4A 3Q15C 1ZY2A 4PZ0A 2LBPA 3OM0A 3LFTA 4W5QA 1KRWA 3I45A 2IPAB 2JVJA 1ISSA 2FQWA 3O1JC 3QLVA 4MS1A 5D2CA 4ZJPA 3RVLA 4ZYLA 1JH9A 3NBMA 1OXKB 2IDMA 3OMWA 2V0NA 3EGCA 2L2QA 4KK3A 3RH0A 4YCSA 3LKVA 1F51E 2GWRA 2QVGA 4KZKA 1VPWA 1BVHA 2ID9A 3H1FA 4E7OA 3O1IC 1GUBA 2HJ9A 1M5UA 1XHEA 3OO1A 3BRQA 3A10A 3RVKA 3SM9A 1ZGGA 4RXMA 4N03A 2FVYA 4RK4A 4N47A 3CLKA 1ZVVA 2QVCA 3FMVA 3N75A 3KHTA 1YS6A 4EYKA 1JFTA 3B2NA 1ZESA 1RZRD 2X7XA 4LZLA 2F8SA 3ILYA 5TPWB 4H60A 5FBKA 2IOYA 3BILA 3JPWA 1A0OA 4H3KB 4LDZA 4P1ZA 1ZITA 2FMKA 3LTEA 5TQ2B 1VLZA 3H5TA 5E3JA 3GBVA 4MLCA 1MVOA 1KRXA 4IILA 2RDMA 4JA2A 2E4YA 4B09A 1P8AA 4G0YA 5IEJA 1RZRA 8ABPA 1AB5A 4Z0NA 3L6UA 2H0AA 5EWLA 2XDYA 5TPWA 2NZVG 4MS4B 3C3MA 4UHKA 2KYRA 4F06A 2CWDA 2PL9A 3LUHA 4N41A 1LBIA 1BAPA 4DN6A 4D6XA 3NNDA 5IC5A 2B1JA 3HS3A 2PLNA 2I6FA 1SD5A 2VK2A 3O2QB 2RGYA 5BR1A 2PUDA 2R25B 1DCKA 3H6GA 1EFAA 4PE5B 3MA0A 1DC8A 4TLMB 4L4UA 4WZZA 3K4HA 3IPAA 4G0XA 1SXHA 1Z12A 2A9RA 1D1QA 1C0EA 3HSYA 4MQFB 1FFWA 2HSGA 1W9HA 5FWXA 3OMXA 3D02A 3QLVC 5IUJC 1U2PA 3E61A 4M88A 1YK1A 2MSWA 4QPJC 4RDCA 4QICA 4ZMSA 1NY5A 4L85A 4MRMB 3SG0A 3RVQA 4KMRA 3TMYA 1D2AA 2QSJA 5FWYB 2WMYA 1RXIA 4MQFA 5GOTA 3TO5A 2HPHA 4NICA 4QYMA 1NTRA 4YGXB 5KC9A 3LUDA 4O5AA 3QELB 3LUJA 1S8NA 1PHRA 2RJOA 3H5OA 1E6KA 2GI4A 3K9CA 4NV3A 5KI6A 3H5VA 2WY2D 3OLZA 2Q5CA 3H1GA 4D74A 1T34A 3HM9A 2PE5A 3CFYA 4XARA 1Z2DA 1ZGZA 1NXWA 2E4UA 1NXVA 3F6PA 2FN9A 4MPTA 9ABPA 4W5NA 5CNMA 4RY8A 3OQMA 2LPMA 4HNSA 1TJYA 2PMCA 1PNTA 3RVPA 1AB6A 1EAYA 3CG4A 4MQEB 2RJNA 4EVQA 4MGEA
chains in the Genus database with same CATH superfamily
3CEHA 3HVJA 4JASB 1E9RA 3RTDA 4I1VA 1EB9A 3HACA 5CTJA 2C5BA 5DX1A 5FOVA 5INTA 2A7XA 2C59A 2QL6A 3ANTA 3IO5A 2DFTA 1N4DA 2Z8YM 1V11B 3IR6A 1E98A 4IDDA 4ARSA 3MWEB 4Y9UA 4RQAA 1UOEA 5FR1A 3SC2A 2QRKA 1KSFX 5F1YA 1PGOA 3K0HA 2BFPA 2ZJBA 3QEKA 4N6NA 4CG0A 4RTOA 1VECA 4KJXA 3HY4A 3CZQA 4LC0A 2PT5A 3TOSA 1QF9A 3LT1A 1UMKA 5ECDA 2YN0A 4JJ7A 4GKKB 2Y0PA 3TCKA 1JHAA 2ZUCA 4G5HA 1OXTA 1EDOA 1TTQB 2QM7A 3OOHA 4S0XA 3WA7A 1QP0A 2EFCB 1IVYA 2KQUA 2W58A 2QNBA 2ZJZA 3HXLA 3M6UA 4GICA 5EKXA 2WF6A 1XYVA 5CDSA 1IXYA 2O6HA 3AFNA 4QEKA 4RPHA 2XTJA 1CHDA 3UAWA 3CVXA 3L4SO 5BPHA 1N2CB 1L3IA 4P33A 3MPOA 4GMXA 1GZ4A 4CF4A 1T9GS 4R2LA 4LDJA 1JR4A 5IYZF 3GJ4A 4B8WA 2OECA 2O20A 3HNOA 2QDKA 5KKNB 13PKA 1TO1E 1VL0A 3C41J 3RARA 5HR5A 3FNRA 1ZMRA 3AF3A 3QPWA 3FYHA 3L06A 1NPDA 4UZEA 2D06A 4I6GA 4UC0A 4JGIA 2CL6X 1WTCA 5AXAA 3OF5A 3EUAA 3PDJA 2FUNB 3EGWA 1RP7A 4TV9B 4AJ4A 1Y81A 2QAGC 4JUFA 4N3GA 5K8CA 3SS9X 1AV6A 1LQUA 5HWSA 4ND5A 3HI4A 1W47A 3L79A 4HLQB 1DQRA 4PV7A 4H6XA 4AF7A 5KYXB 1X86B 2AOXA 3WC4A 3JQ9C 4DLRA 4CXMA 1ABEA 4TWAA 4DSOA 4DAEA 2CKMA 3A27A 3REOA 1ZM3A 2EFGA 3SI7A 3REFA 4NCIA 4Y1GA 2E4WA 4CCSA 4DDKA 1KEEA 4G4JA 1PJAA 5CH5A 3BL5A 4BVBA 1YF3A 2IITA 3N74A 3NHFA 3GLFB 1BJKA 3O82A 3QBJA 4II7A 2ZDHA 3I2HA 5DBFA 1M3SA 1TYEB 1IM2A 5DTIA 4KN5A 4YY3B 3VX4A 2MYUA 4B47A 1Y42X 1T2NA 1M6VA 5EZSA 4A6PA 1FY2A 2DFLA 3DCJA 1QZZA 3QKSB 2B98A 3C87A 1GGKA 3GFQA 1AOXA 1XOIA 4JI8B 1UPFA 1GA4A 2AC2A 3GJ6A 2W48A 3DULA 3Q9NA 3QP9A 4XASA 5HFAA 3MOSA 1UCFA 4YCLA 1RRGA 1US8A 3BK1A 5KNDD 3JASA 2I6GA 2WYWA 3IJPA 3KL2A 1IOWA 4YJGB 121PA 2VSNA 5BSWA 5KDOA 1WU7A 1KMMA 3G88A 3MF4A 2G07A 1SHJA 1MX5A 3Q0TA 4L4RA 2RI0A 4FE4A 1NQAO 2CDAA 4OQDA 2Q0SA 2WJGA 3OSZA 1RE0A 4P86A 1RWKA 1RR6A 4ISBA 4E1VA 1L7OA 2P4UA 1YASA 3EWIA 2R4UA 1GL9B 1KQNA 2PRKA 3JTEA 4GVXA 4IIEA 2PPLA 2GPWA 1U7HA 4RV5A 4DNXA 1G0OA 1U3CA 2GB4A 2QTZA 1EGAA 2MWMA 2PX4A 3MUOA 1LRKA 4I55A 3CINA 4GG1A 2SCUB 4YAEA 2XKKA 2V9PA 2C78A 1NQTA 3OOSA 5I4BA 1YZLA 4YLGA 2JI8A 3HDVA 2XT6A 5ILOA 1XF1A 3UWMA 4BZQA 1X1DA 2QL7A 3V80A 2CXHA 2R85A 1R8SA 4LE0A 1AK9A 4OHCA 5B5SA 2PBRA 3H9GA 2QBYA 3DEJA 2ORED 3GLQA 4RBNA 4OHZA 2VUIB 1VJRA 4GI2A 4DMKA 4MNTA 5CLFA 1XP5A 1K8ZB 5C4IA 2I80A 3IP3A 4WX2B 1VHQA 1FTYA 1M34B 1GU1A 1SM4A 2W83A 4PZCA 3VFDA 1PG0A 2UDPA 2BHNA 3O5AA 2C92A 2H4WA 2ARKA 1PFVA 2FPLA 4ZZ3A 3U7GA 1II9A 2EBHX 1EZ4A 3DVRX 3E81A 1P3Y1 3FOWA 3D6FA 4A6EA 1F4VA 1YJ8A 4RTSA 1PZNA 3BJMA 2YH2A 2EDAA 4LCJA 3OEHA 3H9CA 2R6FA 2HPAA 1IBCA 2HWKA 2ZYIA 4Q9DA 4CTJA 4E4YA 3V9AA 3LP5A 4LV8B 1J1ZA 3CR8A 2LGJA 4XSHA 4JI7B 1QYIA 1ORDA 2ZSBA 3TL3A 1V9SA 3RPEA 2ZBGA 3C3BA 3OQIB 4MWOA 4DCNA 2WYUA 4EY4A 1QGUB 4PFJA 3OI7A 5D3ZA 4F46A 2WZDA 5KYTA 3K5IA 1CRWG 1LI4A 4EUKA 3DV0B 4NYIR 4M1SA 1X6VA 1L5RA 1P2DA 5T6BA 1NAHA 2D1TA 2XSZD 2GN8A 1TUGA 2VRCA 3CIFA 4L4XA 2I29A 1FS6A 1NNSA 1W46A 1PQYA 2ABWA 4I5GA 4CCWA 5JZBA 1EMDA 1SURA 1T1IA 2BKXA 5EP3A 1Q91A 1CUUA 1U2QA 1ULAA 2WMOB 2QUJA 3KB8A 3R3XA 4D4LA 1HYEA 2AMFA 3AMVA 4ODIA 3KKNA 3B9QA 3FYTA 2YFYA 2XQFA 4GBJA 3LQFA 4MYDA 3TLGB 4CIVA 4OXNA 5C37A 3NHUA 4JYMA 1Q1GA 5FOSA 3RC2A 4I08A 3AR7A 3L7LA 4MR8B 1OAKA 5EN4A 5IYZA 3NGXA 4HWRA 4F11A 3MCTA 1E5VA 4J6EA 4CQLA 2WFMA 4JB0A 4WASA 4CLRA 3L8EA 1OBFO 5L7YA 1NSFA 3SKXA 3G1UA 1NUSA 1MN6A 3SNHA 1PVOA 1Z74A 4C0AC 1EFLA 4EDHA 1XDZA 5KMGB 1XEXA 4NCBA 1B6GA 1D2NA 2LR0A 1P0FA 1RFLA 1XWWA 1IE3A 1Z25A 2O2EA 2VDPB 2XB9A 4H7HA 4N54A 2CXXA 1U1FA 1HPLA 1N0IA 4FJ0A 2WPNA 5IW8A 1YQQA 2JH9A 2P3OA 1KE1A 2E5WA 1P9OA 3ESQA 1ORVA 2PRSA 4K8OA 1GRCA 4XQCA 3V6MA 1CUEA 3AJDA 1EFDN 3F97A 3C24A 3IOCA 1OYWA 2ZATA 3NKVA 2W71A 5JVDF 4AULA 3M3DA 2WM9B 4TOIA 2FFJA 4J0IA 2WV9A 2HIGA 1XDBA 2ZTMA 3ZY3A 2IF2A 1QE0A 3RG2A 1NNUA 1ULBA 4X8MA 5AW0A 4P4UA 4PSDA 4N9QA 1X2EA 4FHDA 2DUMA 2OMEA 2B4QA 4UHCA 1AE1A 1SOWA 1F6DA 1QLJA 3MB8A 5JD3A 5KHOC 4TWBA 1H2AS 2TYSB 2O54A 1XN4A 3F5SA 1J56A 3P96A 4LPKA 1E1QA 3BWEA 4UU8A 4ZZ1A 5BQOA 2ZRHA 3EOZA 2XVMA 2ZS9A 2BBTA 1XQ6A 3NWOA 3BIFA 3QKIA 4V0LA 4C4TA 3H1BA 1L7BA 1BHSA 1W5FA 3QH4A 2ZJ1A 3BMQB 4CKYA 3C3EA 5AQ1A 4JS0A 1P45A 4TV8F 3WSTA 1RYHA 2VDRB 3HHEA 3LWZA 4GO1A 4HNAB 5CT9A 4TT8A 3WG9A 3AP2A 5IWCA 1BWQA 5EKTA 3DDWA 1VKOA 1L4UA 4KXLA 1X7WA 2PZ8A 3IIJA 3ZPXA 2OK8A 4IGFA 3D5QA 3G7NA 1R37A 1VKJA 1P2GA 1SIWA 2RH5A 4WLFA 4CQMA 1HO3A 1LXCA 1JFRA 2GA8A 5U4QA 3HHPA 1GLNA 2CYAA 3T1TA 4GLBA 1WP4A 2WVJA 4G5XA 4JOCA 4PRYA 1TJNA 3GT7A 1YS7A 3EQ8A 3FRHA 5BQ5A 4ZVUA 1HEUA 1WTAA 2R8YA 3DFIA 1OB5A 4KSBA 5EMLA 4K9MA 2A0YA 3T7IA 5LUAA 3AB7A 1JRLA 3KFXA 1TTPB 1HFKA 3D64A 2WJJA 4L8YA 5A9TA 5TGDA 1UMCB 4WN9B 2JGDB 2FW9A 1DAOA 2IYSA 2VLIA 1LVGA 2QVYX 5FD8A 3WTCA 4BO8A 3W2FA 3K9QO 4BMYA 5J5AA 5TVGA 1WB5A 1XGKA 2XUKA 3WYDA 4ZOLB 1IN6A 2B4RO 4IMIB 3A70A 4YS6A 4JFRA 2YJGA 4OF4A 4XUEA 3HJFA 1AXGA 2HIAA 4TTRA 2CJWA 4RD6A 1C4OA 2KE5A 3JWIA 1SK9A 3JVIA 4WOCA 1C1HA 1EE1A 2OM2A 1H94A 3W7BA 1XZQA 4QX6A 3ZY5A 1ZD4A 3OQJA 2V4ZA 4NDZA 4P3XA 1KNQA 3JAKA 4WRRA 3RIEA 5F52A 4TYWA 1N32B 3IP9A 5CLIA 2ZRFA 4ZANA 4F8JA 3AEKA 3ORQA 1QOPB 1FP2A 1Z07A 4OP2A 1XLTC 1XJ5A 2ZR8A 1HT3A 2X86A 2IYTA 3W8DA 3M81A 5DLQC 2V8OA 3JY6A 1ONPA 1V4VA 2QRUA 1GUAA 1I32A 2JLBA 2VBFA 4A8JC 1Y5IA 4F1KA 3R23A 1V39A 2F8LA 5NLLA 5K3DA 1SCJA 4E13A 2XOKA 1MZPA 5CLGA 3KUXA 4MIKA 2Z4RA 3G6WA 3IMGA 2M6KA 1T4BA 1KZGB 3BRCA 1A4XA 4TLAA 3KTFA 5H3CA 2OHVA 1X38A 4W4TA 3KYJB 3GF4A 3HUDA 4WA8A 5DW0A 3BIOA 4ENPA 4PO1A 3EC7A 3M3PA 4XGKA 3EHEA 2YXLA 4EMUA 5CIWA 5I9LA 4DM4A 4RVNA 3P45A 1DT3A 3RAGA 4BMOB 1NRIA 4NDNE 4L78A 4TS1A 5EJ4A 3SEZA 3KLPX 1QAQA 3C6MA 2LDBA 3S28A 1O95A 4CF7A 3A32A 3IODA 1YFZA 1QIKA 1IL0A 2BFDB 4Y1RB 2YMQA 1XEAA 3O8QA 3F73A 2PUAA 1ZBQA 5K03A 2FR1A 2IYVA 4TROA 3DW3X 3E3MA 2AXEA 4PGGA 4WKCA 1RM5A 2NV6A 3WIBA 2C5HA 3Q3CA 4KQGA 3SIWA 4IZIA 2B30A 1YQWA 1DDOA 3FLBA 4JL8A 4W8OA 4XYGA 3G2OA 3VOBA 3R9XA 2CK3D 2O1WA 3OCUA 2IZ0A 4NE2A 4Q19A 3WGHA 5HZMA 1AQIA 3OM0A 4HFNA 1C4KA 3NWBA 4R9SA 3U7IA 4QDOA 1NMXA 2A84A 4D9JA 2F9FA 2PJDA 3H1PA 4NAVA 4EIWA 2CUNA 4REQB 4PO3X 1DFGA 1NOKA 5D2CA 1FJGB 4DE5A 2NM0A 1RTTA 3B1ZA 4YRGA 4F5DA 4Y6QA 5I9MA 1IBMB 1J0XO 2JLSA 1R0YA 1UL1X 2PS9A 4P35A 3EPPA 4Q4CA 4KK3A 3A11A 5A3VA 1L5MA 2DVMA 2VAWA 3IAFA 5FB3A 4MUJA 2OLKA 2LCFA 4TWZA 4U7FA 3G8DA 5E8RA 1OBVA 3JX9A 4MWEA 3EA5A 4HYYA 3OX1A 1Z68A 3LP6A 1JLHA 2FWNA 3WGGA 2JKVA 4WCVA 1IAVA 5AXDA 3RSCA 4CTNA 1Q1QA 4URVR 4HAVA 5ADUS 2AN3A 1YT5A 4K86A 2PXHA 4TV8A 1Q0PA 1P5HA 4KLAA 4CL3A 5KKCA 1UWLA 1RZRD 1FVFA 3WQBA 1GTMA 1S4QA 1ZVKA 5DH9A 1YTLA 4KYTA 2IOYA 3WLLA 2OO5A 2Z2IA 1Q11A 2PGNA 3EY4A 4LHZA 4HV4A 3NYQA 3IEUA 1OFUX 3T1OA 1JE1A 4A36A 2QD3A 1I1QB 3IEKA 2GPJA 3EUWA 4V1CB 1GFZA 3IUBA 1NBOA 5EIEA 2J9RA 3KR0A 2JIOA 4W5WA 3O95A 3TEMA 1FJHA 4JC0A 1XT6A 2E6UX 1JJBA 4ECEA 4LTNA 1RACA 2UUAB 2ATVA 1E63A 3N2LA 1MW9X 5A62A 3GRFA 5CFZA 5MN6A 1H8HA 5KBYA 1JQ5A 1OILA 3DM9B 1V3TA 2BEKA 1WKCA 4M1OA 4UXIA 4YREA 3UB4A 5C8VA 1RPNA 4DN6A 2FZ4A 4K6KA 4DTCA 5LB4A 2DPXA 1JPVA 1VLVA 5LZ7A 3R0XA 1YKGA 2B1JA 3CE6A 3V3KA 2PUDA 2I6FA 1L5KA 3A6DA 4XX0B 1E0DA 2JLWA 1UWCA 5HPYB 1IU9A 5AW2A 1IY0A 4XUGB 5KOYA 1E2FA 1QRRA 2A0UA 3QENA 1VIAA 1Q92A 1VHLA 2WWTA 3NHJA 5LXTA 1RRPA 3BK2A 2QRZA 4BP3A 5HNKA 3K5WA 3OEEA 3I1YA 3H99A 3AETA 3IPRA 5CLQA 5GVRA 1AO0A 2RAPA 4FHFA 2XMRA 2B8NA 2IXTA 2VBCA 1N75A 3E70C 1VE1A 3IIEA 1I1NA 3GRVA 1QK4A 3LWDA 4DARA 5GGYA 4QPJC 3UMBA 3WRYC 1SVSA 1D04A 1R6AA 2JGKA 1GN9A 4FDAA 2ZIXA 4NC9A 5NULA 2NU9B 1IYZA 5I8WA 1PJCA 3RAEC 1NWCA 3SWWA 2ZRIA 2TSYB 2PUHA 2GDZA 3GD7A 4XYBA 2I87A 4LYAA 3UATA 2C9CA 2IQ5A 3K1JA 2IX9A 2HPHA 5EA2A 2IBSA 2QYOA 1K6IA 2NZYA 2JCBA 3CLRD 4OQQA 3IPLA 2J4CA 4GZ3A 3NJ4A 4R8RA 2DUJA 3HMKA 3ZYCA 1I4TD 3UJ8A 1G6KA 4E4RA 5KS2A 3Q5GA 1XLVA 2JJ8A 2R62A 3A3NA 3VU9A 4A8PA 4BB6A 2O2ZA 4EX7A 3HM9A 2CV2A 2RSLA 3K1TA 3OCCA 2ZB7A 1VQ1A 1KI9A 4MPTA 3EZXA 3GEPA 2ST1A 2HO4A 4MTCA 5WRFA 4DL9A 2FB9A 2XUIA 4Q1CA 3Q2KA 5AVOA 1XROA 4HS9A 2A14A 2D1YA 1TOAA 3F8WA 4MQEB 1E3WA 2HIHA 4CFYA 5HZKA 3TPCA 3O93A 3G7SA 2OYCA 3PNYA 2QTWB 3M5WA 4WINA 2FMIA 3W5UA 4C3VA 1Z6TA 3A1DA 4HG2A 1GHTA 5DYGA 1EDEA 3L43A 3SIXA 4PYOA 1ZR4A 4E5NA 1HE4A 3TX6A 2ODAA 3PS9A 3RODA 3G8AA 1A9SA 4G0MA 1DP4A 4XIIA 3LGXA 5I4CA 1VMIA 4UJ3A 3ASZA 1YDFA 4E15A 5J47A 1BD4A 1SJ9A 3H0CA 3ZJ4A 2OBNA 3BC1A 4MA0A 1EX1A 3C6BA 3PK0A 4B0PA 1GITA 1V11A 2UUPA 3EPRA 1NULA 1NFQA 1GU7A 5CIQA 6GPBA 3IKTA 2QRHA 4Y2TA 3VSCA 4OHWA 4YRIA 2J87A 5F3RA 1L5HB 4DAOA 2BFOA 3TB6A 1FW6A 1QUEA 4A0FA 3EEBA 4J7CA 1OGIA 1V5EA 2H2FA 4QBIA 1LJUA 2P9TA 1J00A 1OFUA 1CJTC 1U8TA 3CJQA 1U6IA 4FC7A 3PEVA 3U3MA 4LXUA 5DTQA 2JLVA 2Q3CA 1HFWA 1SU8A 4D9GA 5I7SA 1Z8DA 2EL9A 3USCS 1P2BA 4ZJUA 5EMKA 4Z4CA 1PJ2A 2X8BA 3JQAD 3JQAB 2H1FA 3INRA 4P0TA 2HMYB 2YZGA 4ND3A 4XJSA 5FT9A 3UGTA 1V41E 4BPBA 4I2NA 4OXRA 1YJXA 4V0ME 4XH9B 4X8HA 5ELMA 1X7ZA 1SCKA 3P4XA 4RA6A 3B48A 4N76A 4IDAA 2F48A 5I7RA 4N0DA 3T15A 3U3KA 1UBGA 2JANA 2C31A 1GTG1 4B44A 3W4IA 5ED4A 3CNEA 2FFBA 1R4ZA 2XE7A 4XA8A 1YZYA 1TT5B 4RPIA 4WUVA 1P0IA 1SQ5A 3KNZA 4GSKA 2FDXA 3SU8A 3I39X 4LX0A 1R0RE 3B9PA 3I04A 3S6JA 1XU4A 4LGCA 4F91B 1L9XA 2J3MA 4MMYB 3HXMA 1IIRA 2WJHA 3LA8A 1PEYA 4IJ5A 3VOSA 4DCGA 2O8CB 4FTWA 4N5NA 1UT6A 2X0DA 5JCOC 2Z57A 4R68A 5KYXA 5H16A 1XHLA 5GJCA 2NXNA 3HJUA 2C98A 1AKMA 1RQGA 2BCJQ 3OE7A 1NUAA 2B8EA 3FBGA 1RXSA 3PVZA 1EHIA 2HYIC 1ISHA 4X1YB 6LDHA 3JVDA 4KITB 3RS7A 3R5JA 1UZUA 1HQYE 2XBUA 5EJAA 4IP0A 3GLFA 5IEBA 3OCVA 1TQ8A 3FNFA 4X8LA 1JQAA 1VLQA 1N2ZA 1AA9A 1W2GA 3LO8A 1GT6A 3OU7A 2QRJA 4OQFA 5IU6A 1GPDG 3CLSC 3FDJA 2NLOA 5DWQA 1NG1A 1BQEA 4MYSA 5IDVA 1YB1A 3O21A 3TLMA 2VYND 3OIWA 3IAHA 1UP4A 3L8HA 3PHBE 3QVVA 3W2GA 4DV6B 2P41A 2P68A 2Q1UA 3NTRA 4BRWA 3S1SA 3U7FB 4GWGA 3BH6A 4JAVC 1W1UA 5IXYA 3PJRA 2DLCX 1PGNA 5KNDA 3MERA 4W63A 2GCPA 4XDYA 3DO5A 1OJLA 4DV0B 3QKRA 2JA1A 2FQYA 2I5PO 3DE5X 1GUZA 3KB2A 3GQBA 2GK4A 1PIWA 2BFAA 3I9V6 2WD8A 3MMZA 1G66A 1WW8A 3DZJA 3P2IA 1U28A 4N8SA 4O08A 4QHTA 1JV2B 3DOOA 2X8JB 4M86A 1U8YA 3QX8A 1PV4A 2FN8A 1NW3A 1ZD3A 3M4JA 1JHXA 1DKNA 2V5VA 4B3TB 3I2YX 1NVWQ 1P2SA 2QOEA 4JUAA 3RKRA 5A5GA 1W49A 3JQPA 5HG0A 5HJ7A 1QKJA 1LVUA 4FEGA 5CDUA 2DF8A 3H6HA 3A6ZA 4ZHQF 2SCUA 4WCDA 2WILA 1YMUA 3AVQA 2W8ZA 3GJRA 1IN8A 3JARA 2PL3A 3W1WA 1O54A 1EM8B 1USKA 3A4MA 3PJDA 3AESB 4NZZA 3VI3B 1JYEA 4AVYA 1FFHA 4GOMD 3C6ZA 5CNJA 4U7HA 1MC8A 3QELA 4TSFA 2NVBA 4ZRMA 8ADHA 1XQVA 2J48A 2Q6KA 3U60B 4KCGA 3VPDA 2QNIA 3RROA 1RI3A 1Z4MA 2P78A 2SICE 2ZAMA 5DHUA 4XW2A 1JWLA 1Z7BA 2BMDA 3W1VA 4B2IA 3CW9A 7ADHA 1PVVA 1I9CA 2FP3A 2AE2A 3JQ7A 3ZJUA 3VDNB 3GUUA 5DYTA 3PQ5A 2UZIR 1JDVA 5KTPA 1C50A 2NZXA 5FQOA 3WRXA 4A92A 3EPKA 4RPJA 2FPIB 3A6FA 5DGIA 1F7VA 1FNCA 1L7EA 3RUIA 5JC1A 1XDUA 2WJ6A 3JQ8B 1VHTA 1XO1A 1SAYA 4K9OA 2ENUA 3I01A 4TKUA 1KI1A 3FYDA 3G59A 4MKGA 5GPBA 4C30A 4A5OA 1LF5A 2BIFA 3P4YA 1EFPA 4ZDKA 3LCJA 2XNDA 2GF2A 3KO8A 1VIYA 4D3ZA 1TO2E 4FPXA 3UB3A 2Q6OA 5L9AA 5JXJA 4IICA 5FFFA 4G0NA 5CHYA 3KYBA 1NNLA 4GOLD 1L5ZA 5JD5A 3OJWA 1NG9A 2PG3A 1AF7A 3DZHA 4XIFA 3UAOA 4BJ5A 4F4CA 2YZNA 1USIA 3ZLJA 3KT0A 4X8OA 4MDEA 4MS1B 4HNTA 5HIAA 4QA9A 3IUNA 1XJ0A 5CYFA 4HAWA 4PAWA 4EGSA 3TLGA 1VFNA 2QVLA 2ZAOA 3SAJA 3V4FA 2AQKA 1IUOA 2VTEA 3GMSA 3NQ41 4BQNA 4FW9A 1NQ5A 4LF9B 4MR8A 1DKPA 1NJ1A 2Q4RA 2YHAA 4ZPJA 1QS0A 3IA7A 5TMPA 2RHTA 1D1SA 4NCJA 2RK6A 3D43A 2VF2A 1FSPA 2UUCB 4KRGA 5JBIA 2R8XA 3L8GA 2PT6A 2FAXA 2ZUVA 5KMGA 5KWEA 1B74A 1E7QA 1DBRA 2OG2A 4LV6A 1G3IA 4QXAA 1VGVA 1Z18A 4HEA6 4J75A 4LY6A 5BUCA 3ND8A 1R3DA 3ILXA 3ZCPA 1N5KA 2DFNA 4PVDA 4QM7A 3O9VA 3FPBA 1EHCA 3CVOA 3DWIA 2QLLA 4IW3B 1F60A 2J5QA 2H1RA 3SBXA 1NW4A 2A35A 4W82A 3KOZA 1J90A 4C0WA 1Q7GA 2FW1A 4M1QA 1OREA 3RVDA 1ISPA 1MBZA 3PGKA 2PMKA 3R77A 4I6EA 4WKBA 5FKJA 1VXRA 4CLXA 5AR1A 4EECA 4YRAA 1L3BA 2GYYA 3N3BC 4Z7OB 1EE9A 4FZVA 1IQUA 1IH8A 1QCZA 2YHUA 5EWLB 1PUXA 4I9FA 1R12A 4M0UA 1JFFB 3U13A 3J7TA 2FMUA 1JIUA 1WX1A 4NJOA 5ALUA 5ALXA 1ODLA 3IP6A 3PD7A 2O0JA 4IV0A 2O8FA 3OIYA 3OICA 2O2IA 1H2HA 1O8BA 3MRXA 3Q7PA 5CT8A 2O52A 5F2OA 3C45A 1EK1A 1DAHA 1E5XA 1PWHA 1XLWA 4I8DA 4L3WA 5GV8A 4HD8A 4QDJA 1T8UA 2WUEA 1VIMA 5TXGA 4EQZA 4XVUA 3NV7A 2B5WA 1LPAB 8MHTA 1KY2A 1NYTA 3HXTA 4KI7A 3DDSA 3VPCA 1J9GA 4GYJA 2J6IA 2Q62A 1KAEA 4FUTA 4J3NA 4FFNA 1IK4A 1IFXA 3QXSA 4UAUA 1I6MA 5FA5A 3VR2D 3ZXXA 1WPXA 4KAAA 2Q46A 1DEAA 3AR6A 3ZBUA 3GRPA 1FFEA 1UBOS 3KEGA 3MD0A 2AF4C 4IUYA 2CL5A 1F8XA 5HHTA 1QC5A 1F3LA 3E23A 5IJXA 5TLSA 2FEKA 1I4EB 3CISA 1MC5A 3HBMA 4XWTA 1YOVB 3AF1A 3ELDA 3AY3A 4CU5A 3IIKA 1DRKA 1V0JA 1X9GA 2MU1A 3L04A 4MCHA 1MQ8B 4Q1VA 4A91A 5C18A 2GCIA 5E6SB 1U2RA 1CJUC 1C8LA 1WCYA 2JGDA 3DZKA 3GRZA 3LBYA 4P93A 1AGXA 3ZLVA 1JDNA 1LSOA 5CGQB 3UOAB 3DD5A 1N6HA 2QMYA 4G9EA 4P32A 4F9FA 3E9CA 3L0DA 2W9XA 3FWNA 4TWRA 4IQ8A 3V4OA 3I83A 1RRKA 2ZJ7A 4Q05A 4IEEA 5B4UA 2WU3A 4B33A 1DIBA 2PXXA 4PXSA 3MTBA 1G8FA 3QYFA 4N5HX 3UFXB 1SO8A 4YRDA 3ZD7A 2XIQA 4L6CA 1YQGA 1L7MA 1F2TB 1NXPA 1V1MB 3R74A 4B3HA 2IU6A 3EGXB 1H5QA 1MD9A 2CXTA 2JVKA 3FMIA 4FBMA 4M1YA 4NBLA 1ESEA 3EMBA 5DI9A 1DC4A 2YIMA 3O7WA 1I8TA 5AT1A 3VISA 3WSWA 1JHDA 2IH5A 2OFWA 2UUBB 2JBWA 3LWBA 4LZAA 2KWIA 4O0MA 4BO6A 1GEGA 1RCTE 3LUGA 5COQA 1YAHA 1BYUA 1P80A 1QHXA 5DM4A 3JZAA 4EKYA 3Q3EA 1JHPA 1HDEA 1RI2A 1YCFA 1U5BB 3CRNA 3ENZA 3GUVA 4KOEC 3UFBA 3CEPB 4QGGA 4DPMA 2UKDA 4DLTA 2D2IA 2OZLB 1Z82A 3PWSA 1TRKA 2VR1A 2FEOA 1NIPA 3DVSX 1KI2A 2VPQA 1CTQA 2FFQA 3IUYA 1PKEA 4H7DA 5TMDA 1PK8A 1Z5NA 2WMNB 3GDHA 4C0SA 4RU1A 1CUJA 3ROGA 3UUWA 3VMMA 4C43A 2COEA 2O50A 1LQ2A 1WW2A 4LJLA 4MVJE 3WA6A 3U4QA 2EW1A 1MRZA 4UBLA 5I8PA 2W2VA 2ZI5A 3N2ZB 4M0PA 3VO2A 2DUWA 5LLTA 3DR5A 3L40A 4GDFA 2J07A 2RBEA 4O4HB 3R7FA 3P1JA 1PR3A 3ZU6A 3GVIA 3DLPX 5ITSA 4YH1A 1ZC4A 4NE7A 1YR2A 1V96A 4XCXA 3IELA 3GRRA 5DCUA 2BFDA 1G21E 4OBEA 4TUYB 1E0SA 4Y67A 2A78A 3KJIA 1BU8A 3WBJA 5CDYA 4RJTA 1ZISA 3EIWA 4FGZA 4XSVA 2FSIA 1GT91 3ZDCA 2OV8A 3EXIB 3GLRA 3KHSA 4PSCA 5K3EA 2HJWA 2Z58A 3B38A 3TJRA 1G5QA 1ZRMA 4Q1FA 4YAIA 3M9LA 1Q7BA 1K3UB 3PQ4A 4BDTA 3MWLA 2CK3A 1M2JA 2O3RA 3A04A 4HOYA 3ZZTA 3K0EA 5DIZA 3D9QX 4GE3A 4GM0A 3AV0B 4MDFA 1GSHA 2WWWA 3AKEA 1XDSA 1Z6QA 2ONZA 4N03A 5BWCA 5CBKA 2GEBA 3DPSA 2WJ3A 4Q7MB 1Z2NX 3KHUA 3JVEA 1SQFA 3B3FA 2J5RA 2ZXEA 3KHTA 1YS6A 3NHKA 3OY2A 4KPGA 5DNAA 2PZGA 3RFXA 2PXAA 2FPPA 2HPVA 4YV1A 2W2NA 3U4AA 4IEFB 4JJGA 4PX5A 2XMGA 4GKBA 1OZ0A 4FBGA 4P1ZA 2WSSD 2IOFK 4JJIA 3E7DA 5P21A 2GHQA 2AOWA 3IDFA 4PC1A 5TX7A 3VV2A 2A9VA 3OAAD 1VYTA 1ZXBA 2JLQA 3KWMA 3PIIA 2B7BA 3NUQA 1EP3B 3QW2A 4L57A 5EY5B 2OO7A 3IKLA 4ZC1A 2E4YA 5JH7F 4YJKA 5HF9A 1RZRA 1CJKC 2ZCVA 1Y1KE 3EXEA 5AW3A 2XDYA 3Q3GE 1U1CA 3DTTA 1MC1A 1WVGA 1JIXA 1QX3A 1RMTA 4K6OA 1PT8A 1UDXA 1V1RA 2W4IA 4S1TA 4V0NA 1GGFA 4OP1A 1CFZA 5KYUB 5FBRB 1N7GA 4HDAA 2BI4A 1II8A 2K4MA 2C4KA 2OR3A 2WP0A 3GZNB 3H0EA 3OIVA 4IIYA 4KQEA 4R81A 1N0VC 3GDFA 3L82B 4NZ9A 1MJHA 1U2ZA 1ZUIA 2G5GX 3QGMA 4M0EA 4HRYA 4BAGA 1SXJD 1SXJB 2I62A 3VU0A 3C5CA 3ZHSA 2WB2A 4YDQA 2MINB 4JLNA 2QN2A 3DUWA 4TMTA 1P5JA 3DWGA 2Q49A 1L2TA 4FMCB 4JB8A 1DAEA 4YQZA 1ADGA 1P6XA 1P4SA 3AEZA 3KV3O 1AV7A 3AU9A 4L3VA 3B36A 4BAUA 3V9PA 4U63A 2P69A 1SVWA 3A9RA 3DEAA 3HXKA 2GKSA 3BERA 3BF7A 1CPYA 1YRWA 2PCJA 2H7XA 4JWKA 5AJXA 4L28A 1Z2PX 1PW7A 3GA0A 5JPIA 2XXBA 4HVAA 3CZAA 1A5TA 1PJRA 1THTA 2X58A 1MH9A 4J4BA 2M2IA 2W6IA 2IWHA 4HZGA 4B82A 3P20A 1HDOA 5GOTA 3CSUA 5ALHA 4NICA 2Q4EA 4HGPA 2EW8A 3M6WA 3C6YA 3MTIA 3RDPA 4A03A 1X39A 2XUDA 5GJWC 2JFNA 4EWLA 4AJEA 5UKDA 2JK0A 4JLJA 4NULA 1CRQA 3RKSA 3TPZA 2Q5CA 5CM9C 1WMBA 4FR5A 1E1YA 1XEWX 3QX7A 4BECA 3BH0A 1G42A 2VZEA 2GT1A 3ZWYA 4A5SA 3QVUA 2FN9A 1DIGA 2NTNA 4ZVPA 5K0NA 3CUKA 2HEIA 5JCXA 3Q12A 4OK5A 4PLPA 4PCAA 5C7IO 2J41A 1Q74A 1DQZA 1NOIA 4HEJA 4KE7A 3WHPA 1XB2A 3N8DA 4UARA 3OZVA 1O6FA 3PX2A 4G26A 2V6JA 1EZZA 1E2KA 3DMNA 1WUTA 5H3HA 2ZRJA 2RCYA 4G23A 3OFSA 1BFDA 1FYXA 1NMSA 2QGFA 4LYFA 4M7OA 1UMBA 5EE5B 3PJEA 5EERA 5EWJA 3V42A 1NVTA 4DXDA 4Q4HB 1VBKA 5LQKA 3KJEA 2HPZA 2NP7A 5FWAA 2FMHA 2Y2UA 1BS2A 2Q1XA 4HAYA 1AF4A 4LJ9A 1S5PA 2NT4A 3BGSA 4BFWA 5HM6A 4LXIA 4L75A 2QQGA 2XYVA 3UBTA 3TZHA 2B2CA 1H2BA 1WOYA 1KKUA 1YHYA 1NN3A 2FY8A 3ONDA 1ORTA 2ZRGA 1EVQA 3NGMA 4F4JA 2BLLA 1JU3A 2VSFA 3K6JA 4IHJB 4YJ3B 3RRJA 2GLTA 1RM0A 3VYVA 3ZWCA 4DDVA 3IAS1 3I12A 4FYPA 1AU9A 1GAJA 1ECBA 4JT9A 4YK7A 1FTQA 2PU7A 3MJDA 3ZV7A 1NP6A 1Q7RA 1C5KA 2V0GA 3GLHA 5LZ8A 4ARAA 1Z3CA 1J49A 3M9WA 5CDFE 2ZT7A 2WSLA 2YJ5A 2M6RA 4PBSA 3FMOB 4KVGA 5B58T 3RJMA 3L7KA 4BEJA 2P77A 2OCLA 3R7SA 5JW6A 1S2NA 4YUAA 5IF9A 3R9KA 3LKBA 4ILEA 1K7EB 4US1R 3EIUA 3RRFA 5HK9A 2WG1A 2X6TA 3CWQA 1XZAA 1PTJA 4LNUA 3F5DA 4P54A 3TRJA 1FSFA 3TSOA 4J2HA 4G1VA 3NDPA 1CZHA 3E27A 1YNSA 1G8YA 7REQB 2WKRA 3SC3A 3LG2A 4S24A 2QLFA 1TECE 2QXYA 4FFVA 3N0XA 2VT7A 4Z8YA 1N57A 4YJHB 4X1IB 3QHAA 4I81A 4A10A 2ZEJA 4AO7A 1QRUA 2DY0A 1X77A 1NONA 2E18A 1KQ3A 3K2BA 2I4MA 3FSEA 3WMWA 1CR6A 1Y98A 1TAHA 5A5EA 2I7CA 3AUKA 1UBJS 4LVNA 1NQWA 4RF5A 4NRDA 4K81B 1YBFA 4BQPA 5AESA 1K6MA 2GGSA 3CUUA 2OFPA 1GL7A 1YC2A 3PDWA 2VTBA 4U2KA 2JEZA 4ZVOA 3PX3A 3VPBA 5HOQA 3LO5A 2FEXA 5I3CA 3OMLA 4D41A 4M6WA 1USGA 2WLTA 4B3SB 5FUYA 3VZPA 3F7TA 2WJAA 4A2WA 821PA 2C5AA 4ZAXA 1G2PA 1ZJZA 2DEUA 2QROA 4RTPA 2C3UA 4MQ4A 3A9WA 3A1EA 3K9LA 2HXSA 2C99A 2I8CA 4RSMA 3U7RA 1WJGA 2P9ZA 5KIAA 1NW5A 1TCUA 3ZD9A 4FHEA 2XEXA 2FK8A 5C7YA 5GTDA 1X7GA 5IDWA 2ZK7A 1KH1A 3F5QA 2JAOA 3PFHA 5F33A 5HFJA 5KB3A 3DWEX 3LC0A 1R4NA 2NZUG 3IKJA 3K3PA 3Q9SA 3ZTWA 1TTHA 4QC2A 3L4JA 1Y4UA 4NABA 1NUPA 2C4UA 4AZTA 4RA9B 1KJIA 5JQGF 3TE7A 1GA6A 5THQA 5JD4A 1SKYE 3ASYA 4Q7LA 3JSAA 3KZCA 1KEKA 4PF1A 3GH3A 1YSCA 5KEIA 2VN8A 2XB2A 3B8EA 3CUSA 3K0CA 1F4PA 1H0RA 3MS4A 3LQ2A 4NMHA 2VJAA 1YBVA 2ZBRA 1P1CA 1Q77A 3PQ7A 3EEOA 4OH7A 1KFEB 2AF3C 2WPDD 4RVFA 2EJWA 4K9NA 2BEJA 5JC8A 5JSHA 1C3OA 2P6UA 1EUDB 1Y63A 2HADA 5A71A 4LCBA 2JRLA 4JY7A 1DARA 3ELWA 4JZYA 4HEHA 4WKGA 3RUAA 3QNMA 4O2LA 4QZVA 4WZ6A 2VJNA 2PWBA 2PSSA 4UNIA 2VSOA 2QAGA 3NAQA 3PC2A 1MOQA 5I7FA 5JWRA 2IXFA 3LHIA 1PZGA 2R86A 1U8ZA 3I8XA 4M49A 1E4OA 2HU2A 4EEXA 5DBIA 2O06A 2V45A 1EJ0A 3L5OA 3U80A 5L95A 1MW8X 1UKEA 4KVFA 4WK2B 2FPKA 3TRFA 1BE0A 1SUSA 1ZWKA 5DCYA 2OFOA 3DOJA 5IVPA 4A27A 3Q41A 3AI7A 2X5JO 5EE3A 4ABTA 2R4TA 2Z2ZA 2QUBA 2G83A 4XSGA 1JW9B 5L3QB 3NB0A 4BLTA 4EI2A 3H5AA 4QU8A 4GKAA 3TGPA 3M5DA 5JYDA 2LE0A 3CZCA 1MDBA 1N2CE 1Y34E 2TMGA 5E9AA 3RAPR 3T5TA 4BLRA 4C76A 4ZEMA 1KTIA 4NJMA 1EM8A 2FRXA 3AESA 5K3SA 1SVMA 1B1CA 1EK5A 1SVOA 3HK2A 2CJPA 3DEFA 2YZ2A 4AZ0B 1OYOA 3KXLA 3DGEC 4QJ3A 2F8TA 3NATA 1XBTA 4CL8A 3O8OB 3CX7A 3CZ9A 2VS1A 5K5EA 4EQ6B 3HEAA 1OWNA 2QG4A 1YZNA 4JKIA 1V9LA 2CFOA 1H66A 4BGEA 1MF7A 2R65A 5IDQA 3O94A 2ORVA 4CUKA 2Y77A 4FWTA 4AWAA 3WFIA 4ZVVA 1O6GA 3PUKA 1E5QA 4MI3A 3V1YA 3WQRA 1FRZA 4F3CA 2I2DA 4UCXA 1RQXA 2YICA 2FPIA 4A2QA 8OHMA 4G4SP 1LK5A 2I78A 5FWDA 1QYXA 4A6DA 3S8EA 3AL2A 2QTGA 1OI7A 2C3PA 5HJ5A 5LPNA 3NUGA 1UC8A 1AQUA 3OT5A 3U3RA 3J81k 2FRDC 4RS3A 1FMFA 1A7KA 1M75A 5EMNA 1CY1A 5DLDA 5AWFC 2VUUA 2E82A 2SKEA 3G13A 2BMJA 2V97A 2C5FA 3K05A 1XTSA 3B6MA 1WSBA 5TGZA 3D0KA 3NDBB 1VLMA 3CGWA 3HB4X 4ENUA 5T57A 2WIGA 3VMFA 1H1DA 4NHEA 2OYSA 4J90A 1J7KA 4Y2HA 2WAMA 4G5YA 1I4OA 1F9EA 4KWCA 2CHVA 3Q98A 3NBYC 4GKVA 2JAUA 3CNBA 2BFMA 1CLUA 2Y67A 2M98A 3OHSX 1LPSA 4KN9S 1DG9A 3S99A 1AS0A 3DT6A 4M7PA 4N0PA 2OBXA 1W85B 4I5EA 3RJ9A 4MIYA 2RHDA 1Z2OX 1CP3A 1Y8RA 1ZK2A 1G2OA 2C2HA 3BX1A 1ZS9A 2P4HX 3GGGA 3KR9A 4L95C 3WK9A 1W88A 4NFYA 5DBHX 1QFYA 4FHZA 4QQRA 1QU3A 2VO1A 2P9CA 4M9UA 4PHTA 2H1LA 1U99A 3V4ZA 3WJ2A 5AI4A 1DTSA 3ML1A 3SZUA 1N2OA 3UN1A 5F5LA 3EYWA 1OWLA 2Z5LA 2QT0A 4LBYA 2RCNA 2HWYA 3BZBA 4EYOA 2E49A 2XF2A 3LUAA 1RJ9A 4PLYA 1EXWA 2QL9A 4CLOB 4BVEA 5D1NA 3O92A 2VRWA 2WQ7A 3GFGA 4DLSA 3EW9A 1Y4AE 4J6FA 3OOJA 4W1QA 4L6IA 4OKNA 1TCBA 4PPYA 2R3SA 5KTTA 5CPBA 3L46A 1NJ5A 5F1PA 4G4GA 4Z6KA 4NYIQ 2RI6A 5J2TF 5JQGA 3O4VA 4EY5A 2J0VA 2H1SA 5FBHA 1DO0A 1HR0B 1M34E 1O0SA 1NBAA 2Q5LA 1RS0A 5EJ8A 4X85A 4FEAA 1RXYA 1YIAA 3DOFA 3OQHA 4RFVA 5TPZA 1C3EA 4J1SA 3T3NA 1PUIA 3IDOA 3QIAA 4CKZA 5TJ9A 4QYIA 4LKRA 1ZOPA 2ISCA 4FSDA 3D8UA 1PJZA 1RQLA 4UEJA 5HMLA 3V4SA 5BR8B 4CPDA 2X8WA 2ZRNA 1H1LB 1QFSA 1CC1S 3ABQB 3C3AA 3Q2OA 2V59A 4H7FA 1SXIA 2ZIWB 4Q02A 3OLWA 4GNRA 4LBZA 3IPYA 1UJNA 2GCGA 3C8HA 5LA6B 2BFFB 4N82A 5FF9A 4UEQA 1WXGA 3Q88A 4K9DA 5FJIA 1OCEA 4WBNB 3SQWA 4MRVA 5BRAA 1N8SA 4BGVA 4MB0A 3WFJA 1Z47A 1X0VA 3GJ3A 2Y9MB 1UPXA 3KSDO 1QG4A 4D81A 2C3OA 4ZVKA 2VJDA 1CY2A 2JAQA 4Z2AA 5K01A 1PDWA 3H8SA 2BFEA 1IWBB 1YIDA 3FCEA 5ER9A 2A0WA 3EH1A 1F2DA 2PTGA 2W6OA 5CRIA 5I45A 4FQ5A 5MFZA 2CHEA 3LVBA 3LX6A 1PZXA 1FFCA 3WZMA 1DZIA 3V55A 3ZWOA 4FI3C 2PMWB 1PT9A 1W34A 2GASA 1BS1A 3OJOA 1IEWA 1ZCFA 1KOJA 2CXQA 3FE2A 2XI4A 3LXMA 4IXWA 4R2KA 2KJQA 5CH3A 1O0CA 1DEKA 4OXYA 1TC1A 4I99A 2I76A 3DNPA 3MSCA 1H2FA 1J8DA 3FPJA 3MYRA 5CR9A 2R4QA 5EJIA 3RLFA 4X24A 2ZYUX 4L0MA 5HVNA 1YRAA 3WLEA 3KCQA 3CN9A 1NX9A 4LY0A 2ZB2A 5AW6A 1ZOOA 3AJRA 3UY4A 3EPLA 1YB4A 2YDXA 1DKQA 1KIMA 4N1AA 2BHRA 3CVWA 4I50B 4L08A 2V7PA 3QBTA 4TXHA 2XCLA 4ZQIA 4G8BA 2PVPA 2IJGX 5AVJA 5AM2A 4DV7B 5DISB 2OK7A 3B8HA 3DLTA 4XB2A 3LZCA 1Q50A 3G79A 1RYFA 3H17A 3L8CA 3J81A 2HNAA 2VZ8A 2BUCA 4B3RB 2UZ3A 3CNHA 4MUGA 3HQ4O 1ZCBA 1W59A 2BPOA 1KEPA 3QBEA 1E2NA 3NT2A 1U5BA 3VTAA 3VR6H 5KX5B 4CIAA 3PXUA 1TF2A 1Y1LA 1X8LA 2HJRA 3LCRA 2OZLA 3N1UA 3NH6A 3P9XA 5JNTA 3UUEA 5BWBA 2H31A 4YRNA 1EGMB 1N33B 2XCIA 1TJ5A 1EVYA 1HL7A 1Q1AA 3WL5A 1NR1A 4OFWA 3Q15C 2DPGA 1ZY2A 4H3SA 4Q4AB 1KERA 4DCOA 2X14A 3MMXA 2M6SA 4PHHA 1ML3A 1X3SA 2G7MC 5TJHA 3UPUA 5I01A 2VP5A 3H11B 1MPXA 4ZJPA 1UFOA 3JQFA 4BTEA 4JBXA 4FOSA 2ACKA 5BNWA 2C8LA 1HL3A 2UYGA 1FS5A 3FVRA 1MJNA 5DP1A 5CVCA 1JDSA 1ZZEA 1XLTA 1E2MA 5EHQA 3P0FA 4CF6A 8ATCA 2AJTA 4YJ2F 2O8BA 4AF6A 4GRDA 4D0GA 1WCIB 3T0IA 3ZWVA 1T9AA 1M5UA 1ORWA 3S70A 2PZFA 1ECFA 4ESOA 3ONFA 3MTEA 4A8JA 4CMCA 4UPVA 4D0RA 2YY6A 3NT5A 4GI3A 4BWGA 3QYJA 1TK3A 2OHJA 1VKNA 3A26A 3E1GA 1PGQA 4FEYA 3PXGA 4DLNA 1U63A 2B5OA 1SULA 3CZ4A 3VAAA 3ER9A 2KMLA 4EG4A 5MN4A 2OA0A 2H0RA 5HQTA 3DE1X 1EBFA 4OOEA 1U1IA 1G41A 3JPWA 4OLHA 3M4NA 2B4TO 2R5NA 2AUMA 4EJSB 5TQ2B 5J2TA 3KVVA 3EH2A 1N2SA 2FJPA 3LX4A 2HOQA 2B1QA 3KVYA 4KTTE 3BWDD 4MP8A 4MVJF 5THXA 6REQB 2O3SA 1G291 5L7WA 3HSSA 3MSXA 4BHTA 2R60A 1X7DA 2HBRA 1AKWA 2RHJA 2X40A 1FDIA 1FVOA 3L7BA 4OAPA 4QQ8A 1Q84A 1F5NA 1ORRA 2NZVG 3C3MA 3C3JA 2FHPA 2DULA 3QTBA 4LMBA 3TUJC 3VPXA 4DVGA 4RPGA 3IQIX 2WSSA 5JDIC 2OUIA 3KPJA 1SEVA 4JJKA 2GH1A 1ZD8A 4PGMA 3WV5A 3T52A 1BN6A 1IUKA 3PGLA 4G9BA 3T3PB 2RD2A 1XZPA 3VYWA 4E5DA 3NNDA 4DG9A 3ORRA 2VK2A 1SGWA 1J33A 1FMCA 1UWKA 3BBPA 4ZO4A 3ZXSA 3IQZA 3AT1A 1C80A 3DBHB 1F5SA 1R0SA 1SH7A 3Q0IA 1JMKC 2ZJAA 2QAJA 3G17A 3PHHA 1CZRA 3IOBA 5TY0A 3I32A 4LZWA 4BYMA 3MTGA 4H17A 4KODA 1HZZA 3JWPA 2XMDA 3PR1A 1EXDA 5JEEA 3NYWA 3OMXA 1SXJA 4FR2A 1TA4A 2NYUA 3DOEA 4HWGA 3U48A 2CUTA 3UKOA 4CLEA 5LDHA 5CD1A 3HWWA 2VUTA 3FPLA 5CA1F 1QANA 1BGWA 2AKYA 4XVHA 2HNKA 4DA4A 1HX7A 1FDOA 2B82A 2BKLA 2CMGA 2OC9A 5E4YA 4CTOA 4A16A 3SG0A 4JLPA 5BSFA 3OPMA 3Q1KA 4P80A 4AU1A 2GF9A 3OF3A 3DOIA 3R6DA 1TGVA 2R8OA 3LUPA 2FF5A 3EZFA 2WP8J 1S2IA 3HR4A 2I4IA 3F8TA 3ZQKA 4OQZA 1XF9A 1HTBA 3CBGA 1FYWA 1WL8A 1PHRA 3C7TA 3IMCA 3QWIA 1NY6A 1SR8A 3GCGA 2REQA 4NV3A 4PRKA 2WY2D 3WLNA 1E4EB 2JL1A 3CT6A 4AKTA 2VKTA 1Z4QA 5KJFA 4MWZA 5DB4A 1R6UA 3AM1A 5H4GA 2PMCA 1QQTA 1PNTA 1J25A 1KYXA 4IJUA 1BWPA 2O5VA 4OAOA 4Q00A 3RIMA 3LL4A 3RWMB 1GQRA 3ZCVA 4EFLA 3A9VA 2GYVA 5CT4A 4AKSA 4UBMA 4EG5A 1F0PA 4BJ6A 1RPTA 1NBHA 1C7QA 3QW4B 1AKYA 4HZUA 4S04A 3EVTA 4XJTA 4ZU1X 5HDBB 4MUXA 5JAIA 3CUWA 1LBQA 2FZ5A 1QORA 2HA6A 4JEIA 3KQVA 5IT9A 5F9FA 2OE2A 3CW2A 3LZ6A 4FU0A 3SYLA 2CNWD 1FLNA 4YRLA 1HDCA 1ZJJA 1BDBA 4JN6B 4LC1A 4QDUA 3ZI0A 2O14A 2QTVA 3AXTA 2I3BA 4AM8A 4P98A 2G6TA 5JSZB 5I7VA 2WHPB 1HMYA 3JR3A 5DK4A 4JUDX 3ZK8A 5CAEA 5F4BA 3I09A 4JX9A 3H2BA 2BI7A 3GRUA 2JI4A 3MJFA 4D26A 2XGGA 1B43A 4TMKA 2FLWA 2A1IA 1XZJA 5AMXA 1PZEA 3RS0A 4C04A 3MT9A 3KQQA 3GCWA 1SCDA 1JQDA 2PGOA 4YJ2A 2IPMA 4BV3A 3X1MA 2C88A 3PNKA 4TL8A 1RBZA 3H8JA 3KQLA 2GYUA 1K97A 3WOHA 2XXAA 3WYEA 4KUEA 4Q39A 1CVRA 1GYQA 3KYIB 4GOJA 2I67A 4O2BF 4MR9B 4ER7A 3D3NA 4BATA 1XKXA 4LYHA 3KT6A 1M2OA 1QK5A 1BGVA 4M8KA 1K63A 2QPAA 1SNYA 2C1EA 4D8YA 5DNUA 4OPMA 4J0EA 1EP2B 1CUGA 1J42A 4MR7B 1OLXB 1DO8A 2XVYA 4F9EA 4URFA 1G9TA 1FP7A 1PL6A 2FPWA 3FFTA 4HFJA 5AM4A 2EQAA 1DWQA 4BNZA 2IUSA 4RHTA 3ZDRA 4ER6A 4LC9A 4C4YA 2C8VA 1JEDA 2HTEA 1QP4A 2VF4X 3KELA 4MVJA 3ZCSA 3P4UA 2FXVA 4HTFB 4UASA 6YASA 1ZIPA 3COPA 3AB8A 4RDXA 3O91A 2VHTA 1K5DA 3DE0X 3V3TA 1ABFA 1Q0QA 3DAFA 4HATA 3C1OA 4N12A 1NUTA 4O4LB 3UJ3X 5LOVF 3AFOA 1ZK4A 7REQA 4M9RA 2V03A 1OOEA 1U2DC 3N5KA 5I7EA 3E8MA 1UKCA 4G85A 2YJ4A 5C31A 2PL5A 4CKBB 2J45A 4DQDA 5CEJA 5C52B 1GTZA 4X1IA 2I1QA 2FN7A 3C3WA 2FJUA 4EA7A 1GPLA 2QJFA 2AFHB 2O8NA 4R9VA 1OFVA 4DNPA 4W5OA 1FNSA 2IZ5A 4Q47A 4Y1EA 1Y9JA 1L7XA 1M83A 2ADFA 2N42A 1GUYA 1YVRA 2AHOA 5CMLA 5DOVA 2IXAA 2QLBA 4GP9A 3KS9A 3UK7A 5KQPA 1Z0KA 2GLUA 4RF3A 3I58A 3MNFA 3IP7A 5ESWA 3MJEA 1DKUA 2NX2A 1QRSA 4B8ZA 4BJHB 3CF4A 1L5SA 4OB7A 4PPQA 5HM8A 2KB0A 5ADVA 2DHQA 1NVXQ 5L6MB 2BM0A 3FDIA 3AFIA 3IHLA 3SFTA 3T9BA 3DEYX 2C96A 4ZA2A 4ATNA 5J1SB 5HQ3B 1IHXA 5CA1A 4QWMA 3DOUA 3CX6A 3GLUA 1XQ1A 1DTWB 3I4LA 1RD4A 2H18A 1LS6A 4NAHA 5DHFA 3UVEA 3SY8A 2FN3A 4BMPB 4Z49A 1IM8A 1E3EA 2P0AA 1FXUA 3FSGA 3N2GB 5B1YA 2CZCA 1WEHA 1DBIA 1YL6A 3DWFA 2CEAA 2OSBA 3NX4A 5EHXA 3K4QA 2HMTA 2PCLA 4FYJA 4INJA 3G5TA 4Y2YA 4EK9A 3I1JA 3RU9A 5A7HA 3KKPA 3L9XA 4QBFA 3BWYA 3AINA 3QXHA 1EWRA 4K03A 1TLFA 3GFRA 1ZVMA 3F1KA 4Z9YA 4LOIA 4HT3B 1C30A 1ONOA 1DWOA 1A4IA 1FNDA 1K86A 1AKNA 5IVHA 3WBBA 3GIDA 3WIOA 2I3ZA 2EZ8A 3HRIA 1MAVA 2A5GA 4XFDA 2OB1A 2C2GA 1OXMA 3NBUA 4U39A 5ICFA 4ZI7F 3OQ1A 3PEFA 1AUXA 3NFRA 2VF5X 3PT5A 2WF7A 3ORFA 4YMTA 4LGVA 1Y1TA 4Y7CA 2Y0BA 5EXXA 5CJPA 3MMPA 3AIMA 1KYIA 3LQQA 1CRPA 2JS7A 4FHCA 5G0TA 1L7DA 3HO1A 5KSPA 4C4PA 1M9NA 3N53A 1ZWLA 1H0HA 2P3QA 3DBLB 1LQTA 3G8BA 3NCHA 4MA5A 3GN2A 4O1IA 1WZUA 3PBKA 1JT9A 4J16A 4TX1A 1G4AE 1KU6A 1O6CA 3MWKA 4X65B 4FYIA 4JSTA 1KJZA 1TGYA 2VUSA 4LHYA 4OSOA 4UVIA 3D8HA 4UTRA 1VBFA 1F48A 2ALJA 5CX1A 2H5IA 1XMXA 3PQCA 2ZJOA 3ZE9A 5A1TA 4E5SA 4PANA 4GOND 4Z53A 1A5SB 3STWA 3W4JA 1EP1B 3LWNA 2Q0XA 1FYVA 1UIRA 3AOGA 3M6VA 2ID8A 3P27A 3QPBA 3N2EA 5JNWA 4WXEA 4R7GA 3OEWA 5LQSA 2P2NA 2WU4A 3NEPX 5B6PA 2YXBA 2EV9A 2CNDA 1T3HA 4OQYA 1CSEE 3PLRA 1B8PA 2OGTA 2AI2A 1QMPA 3KYDB 3COWA 2HHCA 1GPKA 1OHHD 2QX6A 3BMCB 3HR8A 3SE0A 5CG2A 3B5JA 1H8ED 2K7ZA 4JBIA 4AO8A 1P0PA 3I9FA 1VMEA 3QOWA 4H7KA 1LH0A 3OZ7A 3ADOA 4XIGS 4C2BA 4IUDS 1Y3IA 1DX4A 4UE6A 5LQCA 4GX5A 4FDUA 1A8HA 3JATB 1JLLB 1B0UA 1SU4A 2IU3A 1M6WA 3LPCA 1WQ1R 4NYJR 1UINA 1Z15A 3FWYA 5FTKA 5IBRA 3WYBA 1UXKA 1A9RA 4PSVA 4RLFA 5ECGC 4R9NA 3T7AA 4E3ZA 2X41A 2O4CA 2YRWA 2GBPA 4QO7A 1MO3A 1VKRA 2Y1XA 3IE0A 5C32A 4JOBA 3THRA 3ECAA 1L5LA 4ZYVA 4R84A 5ULLA 3U3ZA 1UJBA 3BTSA 1QH1B 5G4LA 3TX2A 5BSVA 1L5VA 2II6A 3ESRA 1E2IA 2ET6A 2VDUE 2ZITA 3Q6NA 5IJZA 4QFMA 2IPLA 1TAGA 4NPCA 5H3LA 4XYEA 5JZSA 2VDWA 2PMBA 2CSXA 3PPXA 1SBIA 2V7GA 1NRXA 2JJ2D 2A1TR 3KR1A 3RSFA 1N5MA 1Q6ZA 4WLUA 4CR6A 5KYWA 4D44A 4EF5A 1HTTA 5GOZA 5FPTA 3OM8A 4EBBA 2BLNA 2GVZC 1Z2AA 2ZJ3A 4MP3A 4ZCTA 3GGJA 4LJKA 5C5DA 3IAM1 4CM6A 2H57A 4WTOA 5SZJA 1L9KA 2YR0A 1S2OA 1GNTA 3HCFA 2R1ZA 5JT1A 1H2WA 4Y30A 3OQNA 1NL3A 2JHCA 1QWOA 5BN5A 1CQWA 1L4FA 1ZD5A 3H5LA 3LHDA 3I34X 2O1XA 3N07A 4RC9A 5TQ0B 4FN5A 3IVAA 1XQ9A 1KI7A 3MC1A 4GX0A 4XXHA 1JIJA 3AKDA 1FNMA 1LPMA 1WDLA 3MJCA 2ZSUA 3LNCA 4RQUA 3HKCB 1OUMA 2O5CA 4DC0A 1HGXA 1QTRA 3T4EA 5JTUA 1MV8A 1XMJA 1D0VA 2QXUA 4IKPA 1HYBA 1KPHA 4KQ9A 4X1KB 2HGZA 2NVUB 4BNJA 2YWGA 4UDNA 1VZ2A 5CFLA 1YRBA 2CZGA 1JR3D 5EIOA 2XPCA 4K0KB 4LOJA 2W00A 5E3HA 3GOQA 2IYLD 2EHJA 5A02A 2VPPA 3H2HA 4LW8A 5AJTA 1BHJA 3LXRA 5DNDA 3OD1A 1BJTA 1TVEA 5AVZA 3J80A 1QVAA 3QI2A 1NU6A 4AYXA 3QOYA 4DG8A 4D8TA 6ADHA 1JFTA 4Y3UA 1ZSNA 3HVKA 3AM3A 1MG5A 1N2XA 4ZEOA 4C05A 3OQOA 3BFJA 3CNOA 5KHLB 1N3IA 4WKNA 4ZVMA 1RHJA 4U0JA 4ZI7A 2ZJ5A 2CE7A 4Y6SA 3U31A 3LP8A 1YV9A 2DTEA 4ZRNA 4AZWA 4TYNA 5HQJA 2GN4A 1K88A 3K8QA 1FXSA 1V6AA 4LRSB 4JV5B 1NVAA 2WQ6A 3MWGA 5A3SA 4R8SA 4IFBA 1N0HA 1Y7PA 3HYSA 3NRBA 3W9BA 2C03A 5LA6A 2BFFA 3T1VA 2ZIEA 3CRRA 4I19A 4WBNA 1MNQA 2AFIE 3QVTA 5CA0B 2Y1EA 4MQUA 4FMDB 4L7VA 4PM4A 2AEFA 3GCZA 1GGEA 4W7SA 5U1PA 1B23P 4GMFA 2E55A 5KQMA 5JAMA 2JFVA 4FSHA 5CXUA 3WKAA 1P2VA 2O2YA 5K51A 3GLIB 3PQ8A 4XM1A 2P5TB 5TV2A 4BN4A 3LYAA 1YZ3A 3HABA 1EFHA 2QQEA 1BEEA 2QV0A 4DLKA 4TZ0A 5J2UB 3MB5A 4ROTA 1P91A 2VH5R 3CVJA 4LHSA 2FZCA 1U98A 2J6CA 2X5XA 5F7OA 1PRYA 1TM3E 3TR0A 1N9GB 1R3UA 5ITZB 2IS4A 3H6KA 1QDEA 1UH5A 3K92A 4MVJI 4QAQA 5HK8A 4O4JF 2X0NA 2CLOB 1EVIA 1PU2A 2GK6A 3F3YA 4G01B 3U44B 1DXYA 3A9UA 3NIDB 4NE9A 4L16A 1M5RA 5AM3A 3BJEA 2BF7A 3PTAA 4L9SA 4RHEA 1SEPA 2V9CA 4P92A 1LPOA 2GR9A 2O0MA 2C4WA 4YDSA 1N8TA 4F5WA 3T5AA 1FRQA 2PS3A 4N65A 4P81A 4HDKA 3B85A 4ENVA 4MKRA 3U3JA 2ILVA 3I8SA 2I4NA 3IAS6 3L49A 4MW4A 1KDVA 4YRPA 3S55A 5HDQA 2A8YA 2PSDA 4HDMB 3SKVA 1BH6A 5ICCA 2PJRA 5CYGA 4Q1AA 4CM3A 3D0RA 4H4DA 4X7MA 2IXGA 4JJ6A 4RZQA 6PFKA 1G2IA 1SIUA 2WUVA 3PQ6A 2H1CA 4Y6OA 1BVRA 3C85A 4MKHA 5EESA 3DKVA 3AG5A 3RHTA 5LMZA 1S2DA 1XN1A 3GN1A 1UC9A 3AZQA 3I64A 3PCXA 1XX6A 3OZBA 3Q10A 3CEAA 3C43A 2GK7A 5JBQA 4E33A 3ANYB 4BRZA 3D5TA 3A3OA 1L1QA 2C20A 2QNRA 1XCGB 2EEZA 4Q4AA 4X6XA 5E7QA 1L5GB 3NHAA 3H1FA 1U9JA 1XHEA 3TKYA 3WGMA 3SM9A 1LGYA 1QVZA 3G2QA 4HXYA 3EEIA 4U2BA 5G0WA 4DIFA 1R1DA 3H11A 1HLPA 3R8CA 1QV9A 3WMRA 5BY2A 1G7SA 2NU8A 3D7SA 3I04M 4D3YA 3RM3A 1THGA 2F8SA 2ACWA 2JAWA 2Q8NA 3BILA 4LDZA 4BQQA 3W5BA 1WCIA 4F38A 1CK4A 1VL2A 5KYYA 1VSTA 1FEZA 5EQJB 1ECPA 2JLRA 3OHMA 2IHTA 2XV1A 4BFYA 1QFZA 3EVAA 2EG9A 4HN9A 3EF0A 4OXQA 1W5AA 2AZ4A 4MRSA 4XB6B 4RENA 3RS8A 3BA1A 3LT5A 4IJ6A 3TZ6A 3W5CA 4C6HA 4FFSA 1YH3A 2ZUWA 2ATIA 3HVIA 1L1EA 1A1SA 3DL2A 4LHXA 1WRBA 4M9QA 3SF8B 4F71A 1T3ZA 3MILA 1HFJA 3P9ZA 2JFBA 5BSKA 1K0FA 1SHKA 4MJXA 4C0BA 4F04A 2ZCUA 5KSWB 1MAUA 3AUSA 1R6VA 5DXFA 2GNPA 3FTDA 4KQWA 2R25B 2YY5A 3L4BC 5C8XA 1C9KA 2Y1DA 1IMOA 1E99A 5J4KA 3LKZA 4JJEA 4DDHA 5A6SA 1R4AA 2D1SA 2EKDA 2HMWA 3VU3A 3Q7EA 3ETHA 2V1UA 3E82A 2J46A 1SXHA 1D1QA 1RQ2A 1SKBA 1YJ5A 2YFHA 2G8LA 3ZKWB 1SBCA 1XPOA 2ZSFA 1W9HA 3SC4A 4NK5A 1AH2A 2AC4A 5FWXA 1WB9A 1NHWA 3QLJA 2F3SA 4AJKA 3QLVC 4C7VA 3E61A 1GRNA 1C9YA 1L7NA 2BEWB 3S3TA 1JQKA 3W0LB 5F4ZA 2XWSA 2YXPX 2I2WA 1Z5OA 3INGA 3AIIA 1M7BA 1JQ3A 1YI1A 2IK8A 2YUTA 1EI9A 2Q3JA 4MVYA 4Q1BA 3TMYA 1JR2A 3OE1A 3VZDA 4AQDA 2BI8A 2NYVA 4UAGA 5FV4A 3ZZNA 1YZTA 5FBLB 2BGLA 4TTVA 421PA 1E4YA 2VIIA 1HDGO 1S8NA 3R2JA 5H82A 1GZUA 1H9AA 2GI4A 1NVFA 3AR5A 2PZMA 2VHEA 2YKGA 4EHDA 2DPMA 5ED0A 4C1BA 2OFFA 2O57A 1NVDA 2B35A 3O73A 4Z9XA 2Q5IA 1JSCA 1YO6A 4IMRA 3WWZA 4MVJG 4O29A 2CVFA 1Z5UA 4O4JA 3RREA 3T5CA 4EW1A 2O59A 1MO2A 4KXXA 1T3SA 1EVLA 1W4ZA 1ZNZA 2GBIA 2JFPA 4MB6A 3JW8A 2TS1A 2XYGA 3RBVA 1KI6B 1I0IA 1E9AA 5C8DA 2ETXA 1SBTA 2D5IA 4UATA 4LV5B 2QTHA 4OQXA 1P9NA 1JVSA 1EBUA 2J6BA 1VL5A 1FP4A 1FBTA 2C4VA 2GDJA 4IJQA 4U0KA 1FDWA 4NU5A 4CIWA 1A27A 1INLA 1PJQA 3ICOA 4Y8VA 4QUGA 5JLJA 3IBGA 4PC2A 4BCDA 4IJMA 1MABB 3ZYZA 3ZDXB 2Z8XA 3NHBA 3CUVA 4U7PB 1ECJA 1RIFA 2A5FA 4MUKA 1PFGA 1NN0A 4C6SA 1DMRA 3PC7A 1NXXA 2QTLA 3L6OO 3PXXA 2PFSA 2D2EA 4ZJYA 4ACBA 2XYHA 5FTNA 3W3AH 4YO7A 4DDUA 5BT8A 1H22A 3MG9A 2BEUA 3ROQA 2ECKA 4J49A 4EF4A 3RYIB 1KO4A 4LZPA 4PHCA 3CF4G 3TAXA 1XI2A 4DADA 5LYJF 1F4LA 2HEGA 1TD1A 2CNWA 1W4AA 3KSRA 1ZHFA 2GAOA 3QVXA 3T35A 1TPZA 1YFKA 4BTLA 3ME5A 4LXXA 3CX4A 5K0TA 2NO6A 1W76A 2CLCX 1JYSA 3R0IA 4M9ZA 4HDNB 3RJ5A 2EW2A 4B73A 2EAUA 2CE2X 4GXNA 1TYZA 2YBEA 4IXDA 3OLVA 4K2HA 2WHPA 4RD4A 1JFVA 2IGTA 3EVFA 4M21A 3E1KA 2R6HA 3QX3A 4CEHA 2BEVA 2R6ZA 5A9SA 3DB2A 4P7BA 3HLKA 4RTLA 2IHUA 1YCHA 2WJWA 1J22A 3P9IA 2JW5A 4MHTA 1WMEA 4H1UA 5IK2D 3RFCA 2E4XA 2IYPA 4MHSA 3CTPA 3QV1A 4RD2A 5DMHA 4ETWA 5LR6A 1UBKS 3RAJA 3UPTA 3GH1A 4FD2A 2PSJA 1YZFA 4P6VF 5EIWA 1KVTA 3KB1A 5EUMA 2GJAA 5DW3A 3COJA 4GEGA 5CFOA 6ABPA 4EP1A 2IBMA 4QRDA 4E11A 2W37A 3NTQA 2WQZA 1YB2A 3KQNA 1RWNA 2YN2A 3K5PA 4EB6B 2Z1DA 1E6EA 1X87A 5CM2Z 1WG8A 1MAHA 2W6JD 4LNAA 3U17A 3GEGA 3VHQA 4AJOA 2PJUA 2J9XB 3RFVA 2YVKA 4NECA 3K9NA 4AKEA 2D5CA 1A04A 4OHRA 2VPWA 1LBHA 2VDNB 1U7XA 4KLCA 2FPOA 3PWKA 4R1MA 4HTFA 1TM1E 3HUUA 3SYKA 3DFFA 1ZVJA 2QQ5A 2YWXA 4DNFA 4KPEC 2QGNA 1LPPA 2QXTA 3FOCA 3HCBA 3ZHRA 4CMIA 1J99A 3NM5A 5A3JA 1U5CA 3L7NA 5DN9A 4BVHA 4D9BA 1JAZA 1I3KA 1XXLA 2FLVA 3WZ2A 1APBA 1FP6A 1K2WA 2K2QB 4ZVRA 3R75A 4PTLA 3WTBA 1ELOA 5IS2A 3KVNA 1VDMA 2BUBA 3CU5A 4FXPA 4QD3A 4YRTA 1BXKA 1G18A 2EU8A 2VTVA 3QTTA 1S01A 2PSFA 3MT8A 3N2YA 2GUGA 4UMVA 1XD8A 3T7EA 2XTMA 3OCZA 1U6JA 4GM4A 3SQXA 4G07A 4KVZA 2DXIA 2CT8A 1OX5A 4ARBA 3UQZA 3BZWA 4NG5A 4FOLA 1D7OA 3VUFA 1T25A 4LZJA 3UMJA 3DF7A 2M6LA 1CEXA 3OPYB 1TU4A 1R18A 2AE1A 4WZAB 4A0SA 1U9IC 1Q16A 2JCXA 2AXPA 4D7AA 3H3JA 3R3ZA 1XMVA 2I8AA 2J3JA 3RYHB 4ZV7A 1E60A 4KSYA 3URKA 5KVSA 2PGXA 3ADCA 1P7PA 4Q34A 1YZUA 2WDPA 1TZBA 5D85A 4UXHA 4CDNA 4CRWB 2PXCA 4EELA 2PVCA 4AKIA 4OFBA 1DTWA 1COZA 3Q40A 5FIUA 2NXJA 5ALJA 2AMLA 5GONB 3AFMA 3SMVA 2BFNA 2BDEA 4Y0AA 5E4FA 2KS6A 3WGOA 5JS8A 1Z17A 1DX6A 2OZPA 2IDJA 4ENWA 4X3OA 2DZDA 1NR5A 1BXGB 2EGGA 2VRBA 4L0CA 1U8CB 2FETA 3N05A 3O9MA 4GE0A 4ZT3A 3SPXA 1X1QA 4TT3D 4OP3A 2QGZA 3MRTA 4WI1A 1WQ3A 4YQFA 4BB9A 5C8YB 4MJLA 2Q5HA 4KAXA 1X7XB 3C5EA 4RJ2A 5HRUA 5ARDA 5CCXA 1P7YA 3AM4A 4OMDA 1WLYA 3MXOA 4ND8B 2RHLA 4G5OA 1HQKA 1JG1A 1GKYA 1ULZA 1VIVA 2G82A 2XUJA 4MB2A 5J4HA 2H2GA 3CUTA 5BSHA 5BV1A 2ZRDA 2N9UA 2V7QA 1GKKA 3FBTA 1BSVA 4YP0A 3X1DA 1AKUA 3CCBA 1PS0A 4KE9A 4WCFB 3SLKA 5JRZA 1E3QA 2OCGA 1K3TA 3D7NA 3QY0A 2FWBA 4P38A 5FI0B 4AN1A 1QQ6A 2LRHA 1MB9A 3A1CA 2BFWA 2FOXA 3NJ8A 4C3ZA 4LE2A 4MGZR 5GY7A 1T2EA 1LB1B 4K9SA 4RVDA 5CH8A 3EQ7A 4FNGA 4P4SB 5LYJA 3QI7A 2BFCB 1TYBE 4LOKA 1MENA 2AB0A 4ZOQI 3MLAA 3M5PA 2VZ9A 4LQCA 3KJHA 3P52A 3PD1A 4HQ0A 1HM5A 1Z0DA 2F8MA 4YRJA 3MCAA 1AZSC 1D1PA 1HV8A 2BKEA 2OXRA 3EWAA 3I2KA 1M74A 2J0EA 3LPNA 3OZRA 2H8GA 4UAJA 5EL0A 1UM8A 1X8JA 4RV4A 3QUBA 4OSEA 2YZ7A 2I22A 4XWYA 3WAJA 3BJZA 1OW3B 1XJCA 4TMWA 4TQGA 1VM6A 1TIBA 4AMYA 2A5LA 2QEQA 2DSNA 4S2UA 4WKPA 1JSLA 1DG3A 4R41A 2GBCA 1JJAA 9LDBA 5G02A 1OKKD 5HYVA 3CPEA 1MA3A 1ONBA 4JHLA 4WUTA 2FFHA 4B2LA 5CVEA 1RTKA 5KINB 1OWPA 2VXYA 2MSLA 2Q6VA 4JC4A 3KZVA 1RPZA 1GPWB 2NSDA 3FY4A 3HU3A 3L0CA 1OHHA 3R6TA 2D7DA 1U80A 1C7ZA 3BSYA 1IJKA 3DE2X 3EAFA 3Q9LA 2CNLA 4LJSA 5DSTA 3UK6A 1H8EA 2QRVA 4A26A 5LN1A 1F7UA 2Q2VA 3KBBA 3DPIA 3HCCA 3IVGA 1J23A 5D1HA 3TN7A 2GLXA 4ARVA 3HUEA 4Z3KA 2GFIA 4FS8A 2WB4A 1MQSA 2ON6A 4QJIA 2J3HA 1MNAA 1JLLA 2OB2A 4JR0A 4QDTA 1P5FA 3T3MB 1JKXA 4ETNA