4D79A

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with atp at 1.768 angstroem resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
243
Chain Sequence
b'VVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPGFGAATMVTATFGFVAVSHALKKMMAKAARQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
publication title The Crystal Structure and Small-Angle X-Ray Analysis of Csdl/Tcda Reveal a New tRNA Binding Motif in the Moeb/E1 Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 83
structure length 243
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d79A00
4J90A 1OC4A 1TI7A 2PKRA 2Q1TA 1NWHA 4OQYA 4RPHA 3OSUA 3W4JA 5A5FA 1HDZA 1H6DA 2HK8A 5B4VA 4ND3A 1PJSA 3ETGA 2UV8A 2ZB3A 1I2ZA 2AW5A 3MWEB 3INRA 1JKIA 4IS2A 4XIYA 4C7KA 4QTZA 1CF2O 1RM5A 2NNLD 5JMPA 3HE3A 2DPGA 4DMLA 3RFVA 1EUZA 3RVDA 2YJZA 1PQWA 1Z7EA 3ROKA 5EJ2A 2ZYGA 4IM7A 4TZTA 1RJWA 3K31A 4BO8A 4Q3DA 2OP0A 3GVCA 5C3MA 1PS9A 3KYBA 2Q99A 1Z82A 1EUDA 1HE4A 4J4TA 1A4UA 3WLEA 3WNQA 3CXRA 3GAFA 1L7EA 5KJ6A 3AJRA 1O5IA 1TT7A 3PWZA 2FR8A 2PK3A 3WFIA 1HE3A 4DIFA 4P22A 2EF1A 4WE3A 2X1HA 3WOHA 2EW8A 2YQ4A 4BS9A 1WZEA 3I1JA 3QP9A 4LSWA 2FR0A 3V1TC 1N2SA 3W4IA 2I9PA 1R0KA 2XPCA 3ROQA 1IE3A 4JBIA 2RHRA 1KC1A 4XB2A 1YJ8A 5GZ1A 2YZ7A 3ST7A 5EIOA 4JP2A 1BTOA 3PJFA 4QXMA 5F1KA 3UAGA 1GFSA 1E7WA 1M2WA 5DOVA 1DHRA 1IZ9A 3MJEA 2DTDA 1O94A 2X23A 4BNJA 3DFZA 3KRTA 4W99A 2IEBA 1T1RA 3VVCA 4PN3A 1C0IA 2B5VA 3IIEA 2HMVA 2D3TA 3VH4A 3ZNOA 4FB5A 2G0TA 7MDHA 2V6BA 2HCTA 1PU2A 4XGIA 5L7TA 2A9FA 4CMBA 3DB2A 2UYYA 5ENDA 1HRDA 4RF2A 4CM4A 4YJFA 2AG8A 2J3HA 4CJXA 4J6FA 3DBLA 3GUYA 1DIHA 5CDUA 1N9GB 4M55A 5HRUA 1BRMA 3JQGA 1H9AA 5IXYA 1ISGA 2AE1A 2X5OA 4L73A 1PJLA 4H16A 4CMEA 2FRDA 1FF9A 3KYDB 2W2KB 4G81A 3PJGA 1E1KA 3CMCO 1ONOA 1BDMA 2W8ZA 3X2EA 1E3LA 3JQFC 5CPFA 4DIOA 3B1JA 2PY6A 5G4KB 4YYZA 4D43A 2Y0CA 4AJNA 4JK3A 1V9LA 3DOOA 3TZCA 1ONPA 4OYRA 4BO6A 4N54A 2HU2A 3LC1O 1A7KA 1RKXA 4QX6A 2NVUA 4HKTA 1YBVA 2A35A 2GRAA 3HZZA 3DZFA 5AXCA 3MJSA 5BSGA 3AWDA 1NPDA 4XDYA 3DXFA 3Q1LA 4DYDA 3VZPA 3CMMA 1LDEA 2NM0A 2P9EA 1VM6A 3PIDA 5KVSA 3B1FA 3BTVA 4CM3A 3PWKA 2DUUA 1BWSA 3AUAA 3WBBA 4A10A 3BMQA 5CEEA 1D1TA 1R37A 1YQGA 4DC1A 2BGMA 3RWBA 5JFOA 3PTZA 2JHGA 2JD2A 2PGDA 1LRKA 1Y9AA 4DWVA 4HFMA 5COQA 4ALJA 2WMDA 1NTOA 2X0NA 4PG5A 2AQ8A 1GZ3A 1TVEA 3NEPX 4BO7A 4L9RA 4OHUA 5ES3A 2HUNA 4TVOA 4KWIA 4ND2A 4BO4A 1E6UA 3ETEA 2NVWA 1E0DA 1GUYA 1W6UA 2HJRA 4YJDA 2X8LA 2B36A 4AICA 2AEJA 1IPEA 3UH1A 4TWRA 1J0XO 5U9CA 1E6WA 3LF1A 5LDHA 2IE0A 4YVFA 2C54A 2UDPA 3KVOA 4KTVE 2ZB8A 1LNQA 4DQUA 4D46A 3ONEA 4J7XA 3GZNB 1BXZA 2B35A 3U09A 1IHXA 4RCVA 3BHJA 4RPLA 1M76A 2Q4BA 4RVFA 2NSDA 2Q2WA 2EW2A 3JQDA 4J91A 4LVUA 1E7SA 2C7GA 4D3FA 2O3QA 1ULUA 4WECA 3DZKA 4E21A 4GMGA 4OKNA 2EEZA 1F8GA 5F5NA 1ISFA 3WDSA 1WAMA 4EUFA 3ZU3A 4PRLA 3LT1A 2R00C 1LUAA 1X0XA 3ZHXA 4NFYA 3WTBA 3SC4A 3ZV3A 1D3AA 1DIGA 4FBGA 4B7XA 3RFTA 2YFQA 3JQAA 2C59A 1OZAA 1NFFA 3WLFA 1YB5A 2CF6A 1NVMB 4NHEA 3FD8A 3CSDA 1MP0A 3NKLA 1H94A 1XCBA 2VT3A 5AXBA 1E3WB 3ICPA 3R3SA 1VKNA 3AUUA 3WS7A 2AEFA 3M1LA 2HQ1A 3RC7A 3UGKA 3WYCA 5HWSA 3GDGA 1PSDA 4GLOA 5LDGA 4PRKA 2CY0A 4L0QA 2OZPA 1ZO8A 4YPOA 4FFOA 2C2YA 1LSOA 2GZ2A 4CLDA 3G49A 1J5PA 3R3JA 5H83A 3ROMA 4E5KA 2C82A 3GMDA 1Q7GA 4EZBA 4FFRA 2O2YA 4YWJA 1D4FA 1PX0A 3K2BA 3ZV4A 3FNGA 3GN1A 2X0RA 4D42A 4RJTA 2I65A 3OICA 3QRWA 3K9QO 1LLQA 4FJ1A 4XR4A 1UZMA 4J2HA 3OH8A 3H3FA 3MJVA 2OOSA 2TMGA 2PZLA 2X4GA 4CM8A 5F21A 1MLDA 2B4QA 3PRJA 3PPIA 1NBOA 1HSOA 3AI2A 3GMSA 4FC6A 1IOLA 4PCVA 4PVCA 2VT2A 5ILGA 3DMYA 2NU7A 4DMMA 1MC5A 1ENPA 4PLVA 4PG8A 4II2A 1EVYA 2Q1WA 3EDMA 5HS4A 1PJ3A 1GAEO 1H2BA 4UEOA 4LMRA 1HDXA 1X1EA 3HDYA 4DA9A 3JQBA 5A05A 5L53A 2VYVD 4XKJA 4IIUA 1KY5A 1P31A 2GN4A 2W2LA 1NASA 4EJMA 4O0LA 1DXYA 2O2SA 2JCXA 2QQ5A 3D5QA 3DO5A 2FPPA 3ZWOA 2W98A 1Z7BA 3NGLA 3TSCA 4J0FA 1N9GA 1YOVB 3PEFA 4Z9YA 1UZNA 1VPDA 3D3WA 3E1KA 4ZU3A 4PLGA 1R66A 3F3SA 4DUPA 4YCAA 3ZCXA 3KYDA 4DQXA 5BSEA 3DDNA 5KVCA 3H9QA 3NTOA 4FFMA 4RQUA 1RYDA 4GGPA 3QSGA 1N1GA 4I8XA 4HFNA 1E7YA 1LC0A 3C3XA 1EK5A 3HB4X 2ZTVA 3BA1A 2QZ9A 4JJFA 2HJSA 3PFWO 2AQKA 3GC6A 3PQEA 2EKPA 1GCOA 1Z75A 4R16A 1BVRA 3GDFA 2PWZA 4LCJA 1Y8QB 4CLOB 2H6EA 1DOHA 4R69A 3WGHA 1T26A 2CSUA 2QRJA 4OAQA 5IJZA 1X1TA 4ITUA 4IXTA 3E82A 3FNFA 3QE3A 5AOVA 5BNFA 1I3NA 4BKRA 1JLLA 3TZQA 3WIEA 1EVZA 1EK6A 1QKIA 3Q9NA 1EZ4A 1L7DA 1WP4A 4MIOA 2Q1UA 3IS3A 3V8BA 2BFAA 4OJNA 1R4MB 1JVSA 5DCWA 2FPIA 2P5UA 4CV0A 1YH3A 1B7GO 2EG9A 3EY4A 3RJ9A 5JSFA 4CMHA 3LLVA 2IEDA 1T1SA 3H9GA 1F14A 3GEDA 3NYWA 3D64A 3AUTA 4JROA 1EQ2A 3ANMA 4ALNA 3UN1A 3AU8A 2B5WA 4BNLA 3F4BA 4ZICA 5KOIA 1RM4A 3FR7A 3Q9UA 4CODB 1Q7CA 4PLWA 1T24A 2HMUA 1ZW1A 3O03A 4RVHA 3STHA 1B3RA 4GKVA 1XEAA 1K6JA 3QY9A 3OJFA 1OAAA 1C0PA 3ETDA 5TJ9A 2BD0A 4OOFA 2YUTA 1O0SA 4IMRA 2AG5A 3HQ4O 1P45A 4GX5A 4PVDA 4XYLA 8LDHA 1UXKA 1LEHA 4GL4A 3OP4A 8ADHA 1ZK4A 4XQCA 4IQ0A 2ZCVA 1T2AA 4WCFA 5JW6A 2O4UX 2WYVA 3GPIA 4E6PA 3ZZNA 4TRJA 1VJ0A 4OMUA 3RC2A 4CL3A 1C1XA 1Q7BA 2YDXA 1BW9A 4KOAA 1ISJA 3KSUA 4JP3A 1T2FA 3BTOA 4NBUA 3DZJA 3GZNA 3H8VA 3G1TA 3VZRA 3U3XA 4MINA 4BB5A 5DF1A 3O8QB 4YRBA 1NQOA 1E1NA 1GL3A 4IZHA 4IY1A 3TN7A 3EMKA 2WJPA 4U8GA 2FHSA 1WDMA 1X7HA 5TX7A 2J8ZA 3R6DA 3DTTA 1DRUA 3WGYA 4R41A 3U4CA 4NH4A 1KVQA 3PWSA 4LK3A 3AI3A 1U2DA 5TGDA 3A1NA 3ZWMA 2TMDA 3M6IA 5I8WA 3QQPA 1GADO 5KIAA 3L9WA 3I4FA 2QIOA 1YL5A 3ADOA 1B0AA 3GEGA 1LRLA 1XELA 4H15A 4Y6PA 1Q2XA 3HJAA 4RF5A 2FMUA 2VTEA 4CQMA 3LZ6A 4J9VA 1DFHA 1YO6A 5AQ1A 3KTDA 4IZIA 2EHDA 5K9ZA 2DBRA 2NACA 2PKQO 4X54A 4RZHA 4Y6SA 4XA8A 1PEDA 1JTVA 1DPGA 5B37A 1ZSYA 5BR7A 5IDXA 1ADFA 4PG7A 3WFJA 3RUEA 1K6XA 3ZWNA 3FNEA 3ZWVA 4NIMA 1GPJA 3U49A 3QWAA 3MOGA 1QYWA 1JDJA 4CMCA 2CDCA 1NFQA 3JYNA 3D7LA 3JTMA 3PDUA 4ZQFA 3I9MA 4HV4A 1B26A 4ZN6A 1KVUA 1WMAA 2GNAA 2VTDA 1KVRA 1P77A 3L0DA 2X9GA 4QUKA 3K73O 1AUPA 3GEMA 2O48X 3EUWA 3V1UA 1C1DA 4DREA 2VRCA 2GSDA 1A71A 3GFBA 1P1JA 3OIGA 3I52A 5A4DA 1LLDA 2Q3EA 3JQFA 3ZU2A 3U5TA 1WXDA 2I67A 3KEOA 3MOIA 4HXYA 3VVBA 2Y1GA 2BF7A 1TB4A 1SB9A 4I08A 2HO5A 2PD6A 3PHIA 4YRAA 2DU8A 3LYLA 3TZHA 3BIOA 4F3YA 1X7GA 1YJQA 2E6UX 1BDBA 4WEQA 3TRIA 4K6CA 3Q2IA 2J6IA 3FI9A 4BVAA 4YJFB 4CM4B 1S7CA 5EESA 3EVTA 3V5NA 1MC4A 1QV6A 2YFHA 1P9LA 1PL7A 1AE1A 2JFGA 2Y05A 3DBLB 3RUDA 1W4ZA 4UUMA 3JQGB 2RH4A 1P3DA 2NTNA 3G79A 2D5AA 5CG1A 5J23A 4YTEA 5AXDA 3Q0EA 1P1HA 1VL6A 3VH1A 4R5MA 3NDJA 1P1IA 4KQWA 4DPKA 1I8TA 2FWMX 4B3IA 2AQHA 3FHLA 4IJKA 5DCUA 1ISIA 1N7HA 4TRMA 3H5NA 4WUVA 4YB8A 1JAXA 3I9KA 2QRLA 3LVFO 4NJOA 4OL9A 4R1UA 1DC3A 3E9NA 5COAA 1M6HA 1M66A 2IRWA 5DZSA 1P1KA 1U28A 3PFFA 2I99A 1MUUA 2EP7A 3ZHZA 5ITVA 4MOWA 4BGIA 5MGBA 4D3DA 2EGGA 4Z6KA 3DQPA 2NQ8A 3UHAA 3G3EA 2GR9A 4FJ0A 1ZFNA 3JQBC 4I9UA 3K8ZA 1Y8RA 3FF4A 1JW9B 1SCUA 3M2PA 4W9NA 3TQHA 4M86A 4LISA 4OGWA 1Y8QA 4WLFA 2HRBA 1UUFA 4DL9A 5IG2A 2VWGA 4N5MA 1BGVA 3GQVA 4R3NA 1ZJYA 4NPCA 3PJEA 4MP6A 4EI2A 2LDXA 1BHSA 3I9OA 3HSKA 5B12A 3IC5A 1VRWA 5JLAA 3DBVO 3INGA 4J3FA 1VSUA 2EIHA 3AFMA 3ZW9A 2OBYA 4FPXA 1ONNA 4AJ4A 1K2WA 4ID9A 4WCDA 2G82A 1SNYA 3ZV6A 2Y1CA 3BXXA 3PYMA 3I9JA 4TQGA 3S2EA 4I5DA 4E12A 5FEUA 2X7HA 4NJMB 5A06A 3K6JA 5JC8A 4IJUA 3JD0A 2P9GA 1UP6A 1C0LA 1U4SA 1YBMA 4PLPA 5KJCA 1E3EA 3V2HA 4QSMA 4IQGA 4K26A 4WNIA 1EDOA 2DBZA 1GY8A 1J4AA 5DBGA 4CR6A 2BHLA 1GQ2A 2J3KA 4UEKA 1H6CA 4J7UA 5FWNA 3CH6A 3EZYA 2XXJA 1BXKA 2RIRA 5A04A 2DUWA 3C1AA 3E6AA 3VPGA 3ZWXA 1ZH8A 4BNMA 4TSKA 3DHYA 3IL2A 1EEHA 3M2TA 4R9RA 4FW8A 1H5QA 2WTBA 3FWNA 5IAAA 2OHXA 2HK9A 2PD4A 4XYBA 5EQDA 4OOEA 1PGPA 1VKOA 3L4BA 2X5JO 2X86A 4CM1A 3NAQA 5JYEA 4XZ3A 3PLRA 4JNKA 1UXIA 1Z74A 4ONEA 5IZ4A 1F8FA 1KBZA 5HTOA 2PGLA 4BNIA 1VL0A 3LT0A 3AFNA 1DAPA 3ADPA 2DFVA 3DAGA 1ZMOA 4YJHA 5EPOA 3QWHA 1KS9A 3HWRA 4FDAA 1GQYA 1MG0A 1XU9A 4CLRA 1OI7A 5T57A 5A02A 4DBVO 3HHPA 1U8XX 1KYQA 3LT4A 4IDEA 3JQAB 4WCFC 1RM3A 2IZZA 3NT5A 3S1LA 4PIVA 3RIHA 2WYUA 4L75A 1GU7A 1XA0A 2A94A 1EVIA 5A03A 4YEDA 4BO9A 2CMDA 4IDCA 2GCGA 4FJ2A 3JD3A 4XRGA 3U62A 4E5MA 3NUGA 4E33A 1WVGA 3DBRA 5EL0A 4AFNA 3GRKA 3Q6IA 1LU9A 2AA3A 2I66A 3AY3A 2VUUA 4P4LA 1MB4A 3GN2A 4KWHA 2CF5A 3AY7A 2ZK7A 3ENNA 1G1AA 3D1LA 4XX0A 2ZB4A 2DBVO 2PR2A 2FY8A 4URFA 3VKVA 3V2GA 1Q0LA 4P38A 4BMSA 1T4DA 2J3JA 3I5MA 4HP8A 1E7RA 3LC2O 2O7QA 5TNXA 3P2YA 1QP8A 1MA0A 4IJWA 4CM8B 1V3UA 1R0SA 5JAMA 1I2CA 1A9ZA 1AHIA 1SO8A 1U3WA 3ZHBA 3ANLA 4WJZA 2YQ5A 2WM3A 2HRZA 4B4WA 3WXBA 5BSHA 4BKUA 3ZNQA 4CM7A 1TEHA 2E49A 5JDCA 1BXGA 3GFGA 1DIAA 4ZJUA 3RBZA 2P91A 4H3VA 2XF8A 3H4VA 1PR3A 1E77A 4TMFA 2P68A 4XYMA 2BKAA 1XQ1A 2I3GA 4GGOA 3WBFA 1GCUA 1X14A 1P44A 1E5LA 1QG6A 1EQUA 2VWPA 1KIFA 3GNTA 4HY3A 1ZXLA 4TRNA 3S55A 4PLYA 4DXHA 5AXAA 3OA0A 3W8DA 3D3WB 1B15A 4LMPA 1B8UA 2EJWA 3BYZA 4BNFA 4XEHA 5U4QA 4WKGA 2F1KA 1EBUA 4AJPA 1VJ1A 4O1MA 2SCUA 1YXMA 1NQ5A 1UXGA 3GOHA 3WSVA 1HKUA 1PZFA 2WDZA 3HFGA 1T2EA 3PZRA 4Q3CA 5DP2A 2JCYA 1G0OA 1DFGA 3FWZA 1ZCJA 2V6FA 3OJ0A 3GGPA 2VNSA 4KUGA 4RDHA 2R6JA 2RBEA 3NGXA 4J0EA 4N18A 4FFNA 1TXGA 4ZRMA 3WSWA 3MJTA 2H5LA 4HADA 1OFGA 3DZGA 4YAKA 4FOSA 3H2SA 1ZK1A 1ML3A 2QG4A 5IXSA 4IMPA 1EFKA 3SJUA 2NQTA 4YA6A 4BO2A 1GZ4A 1UXHA 2AE2A 2JFHA 1PS8A 1WLYA 1Y5RA 5GZ3A 3IKTA 1R12A 3GR6A 5KJ1A 2YV3A 3W4KA 3DBHA 4RF3A 3VPFA 2QYSA 4BUCA 4AJ1A 1ZEJA 3JQ8B 1FDVA 3VTZA 3LDHA 1ZZEA 2WYWA 4GMFA 2Y66A 2AQIA 1PQUA 4GWKA 4NFSA 2G1UA 3P2OA 4PLFA 4FGWA 2Y1OA 4J43A 4EYEA 1XR3A 3OETA 3KLMX 4YR9A 3ASUA 2JD1A 3QVTA 4YAEA 3DWFA 5IFLA 4M8SA 2VYNA 1SZJG 2O4CA 3UF0A 1X15A 2E4AA 4NJMA 4PLHA 1E1LA 4GH5A 2CD9A 2Y68A 1GV1A 4W9NC 1VI2A 5ICMA 1WWKA 3S2GA 1H93A 1NVGA 3A4VA 5GY7A 4NBRA 5A1TA 1UAGA 3CEAA 4D44A 3SXPA 4OKIA 2PFGA 3PYXA 4QECA 4CM9A 1HT0A 3QVOA 3QVSA 1GPDG 1OBFO 3DAPA 4XDZA 5EN4A 4J1NA 3DHNA 4A27A 4WCFB 2QX7A 1HTBA 2NWQA 3OJOA 1K0UA 4J9UE 2YHUA 4B79A 4BO3A 4PZEA 2BFOA 3O26A 2FZEA 3ITDA 4FN4A 1C1XB 2BRUA 4E2WA 1BW9B 1CIVA 4MVJD 1VSVA 3B6ZA 5AVOA 3PP8A 3I9NA 3WMWA 4IXWA 1ZK2A 2CZCA 2AHRA 1ENZA 4L4RA 1U7HA 4B4UA 1ADGA 1U2GA 3DONA 4UVHA 2BFPA 1FJHA 1Y7TA 4CLHA 5U1PA 1E92A 2OFPA 3G17A 3GHYA 4DYVA 1NFRA 4QFCA 4AJJA 3HG7A 2V65A 4OM8A 1LDGA 1I10A 3FN4A 3MTJA 4N5NA 1D1SA 3EC7A 2D2IA 4WLNA 2ET6A 5F5LA 5G0WA 4CQMB 1KEWA 2ZB7A 3UFXA 2C5EA 2WSBA 3JSAA 4WPGA 5JY6A 5HBRA 1I3MA 3UXYA 4QT0A 3PK0A 3F5QA 4L76A 2ZKLA 1FDUA 1KEVA 2O23A 2VZ9A 1R0LA 4CMIB 3L4BC 1DSSG 4CR7A 3WQRA 4Z3KA 1DAOA 4IQ8A 1IB6A 3MTGA 3UICA 4IDDA 5DBFA 3SEFA 3K5PA 4YBZA 3I9LA 2NLOA 1MV8A 4Y6RA 5KCZA 4O6VA 4XJSA 4YT5A 3GRPA 3Q2KA 4RLSA 3HN7A 3P19A 3WMXA 3GT0A 3S8MA 5IZCA 4E2XA 3D0OA 3JQ7A 3F46A 4BL5A 4MKXA 2AXQA 4WASA 2QYTA 5CDYA 3WTCA 3UCEA 4Z3DA 4CUKA 4I9NA 3K30A 4IIVA 3ZH2A 1C1DB 5JC1A 2DFDA 1DDOA 1EUCA 1C3VA 1E3JA 2CVOA 2WD7B 4IDBA 3HDQA 3JQEA 1XHLA 4RDIA 4WGGA 3OIDA 4ZRNA 5G0VA 4PZCA 4TKMA 4C7JA 5HS6A 3KBOA 3WIDA 4W82A 4WEOA 3W6ZA 3OECA 3OJEA 2JAPA 4AJHA 2JJYA 2GGSA 3WX0A 3EZLA 1NXQA 2FR1A 3HFSA 1K89A 1N1EA 4WK6A 3Q3CA 4AJIA 3K92A 1SOVA 3OA2A 3O4RA 1BG6A 3FTPA 4R1TA 3IJPA 2OP1A 1U1IA 3OFSA 2WD8A 4JXKA 4L8VA 1WDLA 1SEVA 4AJKA 2NADA 4II3A 3E03A 1B3BA 2VZ8A 3KLPX 1IHYA 3ZU4A 5JAIA 3TF5A 2CDAA 1OOEA 4KQXA 1U5AA 3CIFA 3K2EA 3TL3A 1LBEA 3ZWWA 3S2IA 3KM0A 2YHIA 3IQDB 2Q50A 3JQ9A 3F6YA 1CYDA 3V2UA 3A06A 3CUKA 3HDJA 4NK5A 4RVSA 3ENKA 1M67A 3OEWA 1NAIA 4Q3EA 3WJAA 3NJ4A 5JDCC 2CVQA 3JCZA 2FSVA 2C07A 1YGYA 2NU6A 1OC2A 3D4PA 3DHEA 2D4AA 5JO9A 1Y8RB 4UUOA 2DTEA 4IINA 4MIYA 3GK3A 2O3SA 2PV7A 1MG5A 2B83A 3ANNA 3E9MA 3VDQA 2A92A 4MO2A 4BKOA 1LQUA 1R4NB 4UUPA 2DKNA 4D3SA 1A72A 3U4IA 1R15A 2BELA 3C7DB 3R1IA 3BMCA 3JQCA 1NQAO 4DGSA 2BI8A 1I30A 1Z45A 1YL7A 2HMWA 5TRTA 1Q1NA 1QYDA 1FDSA 2EXXA 3IAHA 4F6LA 3JQ8A 5A5EA 4ZQBA 3BAZA 5JCJA 3N7UA 1MXHA 3WGOA 4J49A 2OL4A 2I3AA 1WPQA 2YV2A 4XQ9A 3U0BA 5JBIA 2Q1SA 3QJ5A 3RUCA 5JS6A 3MWDB 4Y98A 3FCOA 4Z0HO 3TFQA 3C85A 4E31A 5KVVA 1NAHA 5TJHA 5C5IA 4OXNA 1ORRA 5DNAA 4OXYA 3T4EA 3BHIA 3BMNA 2HMSA 2VWQA 4RF4A 4JN6B 1Y5MA 2VN8A 4GX0A 2HKIA 3TFOA 1GR0A 4JIGA 4C4OA 3AW9A 3SVTA 2O3RA 2QZZA 1HLPA 5T5QA 1ARZA 3EYWA 2G17A 2I5PO 1UJMA 2Z5LA 1N8KA 1W73A 2DC1A 5F1OA 4JGBA 2F00A 1ENYA 1UDCA 4DRYA 1GD1O 3WICA 2UAGA 3PQDA 1XLTA 1IZ0A 1PJTA 4FC7A 1HYEA 1DC4A 5BT9A 1LLCA 1I32A 5TQVA 3GH3A 5ENVA 4R3WA 1DO8A 2NU8A 3TOZA 1GEEA 5JDIC 1YB1A 2HDHA 5A3VA 2IYOA 1ULSA 4R01A 3UKOA 1U7TA 1E7MA 1BSVA 4AG3A 1VC2A 3FNHA 5F3RA 3JQ6A 4YJHB 3JYLA 1R6DA 3EVNA 4E2ZA 4QO8A 4E32A 2H1SA 1YONA 1UH5A 4CLRB 5L45A 3C8MA 1PWXA 3R0IA 2GZ3A 4GBJA 3DZBA 1NR1A 3O38A 1QLHA 1V6AA 4U0JA 3SJ7A 4BV8A 1X7DA 5BNTA 1V8BA 4MVJF 4B7CA 4D7AA 2PZKA 3VPHA 1Q0HA 4CMJA 5L4SA 4R1SA 2HSDA 1C14A 5A9TA 1HDOA 3CINA 3W1VA 3WG9A 1F0YA 2WE8A 6ADHA 1LLUA 4NBWA 1LXCA 3IMFA 4YT8A 5CDGA 5TF4A 3CZMA 3ONFA 2HLPA 3DBRB 3DZHA 3OEYA 3WGGA 4CMIA 1E5QA 4S3MA 5I9NA 3PGJA 3C24A 1XQ6A 3HB5X 1WNTA 4A0SA 3ICCA 4CUZA 1YDEA 4MDHA 4MKZA 1FDWA 3ZWPA 1IUKA 4B8ZA 4PLCA 2VHZA 3TPCA 2GN6A 4XD2A 2Y0EA 3GNQA 2VOEA 7ADHA 4E5NA 4TKLA 4WLVA 3VH2A 3ZDFA 4A03A 5JPIA 3VC7A 3DOJA 3I6QA 3MEQA 4DC0A 2P4QA 5A3JA 3FPCA 4NDNE 4RPKA 4ALMA 3JQAD 1QXSA 2FSSA 5JXWA 4RVUA 3VKUA 4UVEA 2D0IA 2DTXA 3KHUA 2NTVA 3DMTC 2WD7A 5MDHA 3IP1A 3WYEA 2J3IA 4D41A 4GQAA 1N5DA 3DTYA 1BXGB 4BNXA 4GLLA 5B4TA 1H6AA 4R54A 4CQLA 2QRKA 4G2NA 3KV3O 1P33A 1LA2A 4B3JA 3W6UA 4CM5A 1TLTA 4YAGA 5IDQA 4Y8VA 2X6TA 5DT9A 5KJEA 2LDBA 1C0KA 2BGLA 1Y1PA 3C7CB 5IZCC 3FRJA 4BHTA 4FFLA 1XG5A 3GGGA 3OF2A 5GZ6A 3WGTA 4BNUA 3BMOA 1N7GA 3INTA 4AVYA 4Y9DA 2X5KO 2C7VA 1GV0A 5K6AA 4ND4A 2E37A 4JCOA 1PZHA 1ZK0A 4UVGA 4NNJA 1HLDA 5FYDA 1R16A 1RM0A 1XGKA 3DR3A 4XR9A 1NVTA 5G0SA 4ALIA 4DPMA 5JNLA 1GZ6A 1PGQA 1ZK3A 3PHJA 4UEJA 2YV1A 3AM5A 4CV3A 3L6DA 3GAZA 2GERA 2GN8A 3C7AA 2JFFA 3PI7A 2CDBA 4BOYA 3ZU5A 3L6EA 4GSKA 3SC6A 4IS3A 4E0BA 1B14A 4QQRA 3QW2A 2IODA 2W2LD 4XQGA 4ND1A 1CRWG 1K3TA 3D4NA 3X2FA 1R4NA 3NRCA 1U3UA 4XWYA 5ICSA 3PZBA 3DBHB 5L9AA 1DC6A 2CUKA 3VZQA 2CFCA 3JQ9C 4Z0PA 2C0CA 4ILKA 4DTIA 2G5CA 4AJOA 4F45A 5K0ZA 1X13A 1QLJA 3F4LA 1PGNA 4FQ8A 1H6BA 1SMKA 2Y1DA 1LDMA 4YACA 1T25A 3ZN2A 4F6CA 1NNUA 4Q9NA 4YQZA 4LRSB 3MCVA 2PZMA 4EW6A 4R9SA 1U5CA 4E30A 3ONDA 4AJEA 2GF2A 4A5OA 5L3ZA 4FFPA 4RVGA 5L40A 4AJ2A 4RPGA 1I0ZA 2X0JA 3VHRA 5H82A 1JA9A 4CL8A 2PKQP 2ZTUA 2V6MA 4UUNA 2GYYA 4D79A 3RBVA 1XSEA 4RL6A 1O89A 5CHEA 3I3OA 4NFHA 5HA5A 2X0IA 4R68A 5T8KA 1EFLA 4CUJA 4XCVA 1UP7A 2IYPA 3LC7O 4XJTA 3WB9A 4HX5A 5I9MA 4Z0TA 4RZIA 1LSUA 1UAYA 1MGOA 4UULA 3PJDA 3KYCB 1F12A 3LF2A 1CERA 4R5HA 1A9YA 3H3JA 4KDFA 4FD3A 1B8VA 2PH3A 1G6KA 3F47A 5L7YA 3P7MA 3MJCA 4WOJA 4BIIA 2O50A 1PZEA 1HDYA 3EK2A 4GI2A 1YKFA 4BGEA 5KWEA 5KKAA 1E3SA 3NT4A 5ILOA 1W0CA 1HSZA 2POQX 3GPDG 1DJNA 5I9LA 3AK4A 3RBXA 3TZKA 2D59A 1S6YA 3G1UA 3KB6A 4YAIA 2ZQZA 3GY0A 3CZRA 1X0VA 2EGHA 3AY6A 4KP7A 3GDOA 2ZJ1A 1SBYA 3PIIA 5KVQA 5IDWA 4P4NA 1EE2A 1I2BA 1PWZA 2E82A 5KKCA 3TZ6A 1GYPA 2PD3A 2Y0DA 4LW8A 4XYGA 3NDIA 1QR6A 4EITA 1DB3A 1QORA 1CWUA 4R51A 4BNYA 3L9XA 3GNSA 4DLLA 3NDRA 1YDWA 4OIMA 4W7HA 3UVEA 4ESOA 1LX6A 2FPGA 2OUIA 4CM6A 4Z9XA 4NI5A 3RUHA 2ZTMA 3LQFA 4YT4A 3EGOA 1AXGA 3JQ7B 4NBTA 3GGOA 4AJLA 4M89A 1A7AA 3H6KA 2JL1A 1J49A 2VYVA 1HYGA 4ZD6A 3ZNPA 4WNCA 1EDZA 4N7RA 3CTMA 5TSDA 2J5RA 1LTHR 4CQMD 5C37A 4M49A 3ZNNA 2BI7A 3RAJA 3PGXA 3GG9A 1LSSA 3NTRA 4HUJA 5A9RA 5CDTA 1JU9A 5KNLA 4NK4A 1NHWA 4G65A 4WLOA 4EUHA 1ZBQA 1ID1A 4UREA 1MX3A 2JCVA 2EV9A 2W4QA 4B3HA 3JYQA 3JYPA 4CLXA 2IZ0A 3QA9A 4N5LA 2IXAA 1V35A 1ZJZA 1I3LA 2C2XA 4TRRA 4YXFA 2DVMA 3K96A 4KDEA 4E4YA 1PL6A 4DPLA 4F46A 3CE6A 3G0OA 4YT2A 1NWCA 1LSJA 2WWRA 2Q4EA 1CEQA 1A27A 4IDAA 4J4BA 5T64A 1HWYA 1PGJA 5COBA 5BNIA 1E7QA 2P5YA 1NX6A 2C5AA 1N92A 2VZ0A 4LVCA 3ULKA 1TT5A 2YHIB 5JO0A 4TROA 3FTNA 3QVXA 1GDHA 4BQPA 2GUGA 3TNLA 3I6IA 3KXDA 3WJ7A 4Z9FA 3E9QA 1SOWA 4KUHA 4PLTA 1DJQA 2VRCD 1I33A 4DQVA 2J5QA 3V1YA 3IUPA 1Z73A 3D4OA 4GWGA 4DLAA 1O9BA 3LK7A 2VQ3A 4U0KA 4AL4A 4G5HA 3KSZO 2ZYDA 3IKVA 3RKUA 2D8AA 3VOSA 3JD1A 1U8FO 2X9NA 4HBGA 4RQTA 2B0JA 1NQTA 1YS4A 1XDWA 2XAAA 3EHEA 4U6SA 1V3VA 4ZQGA 3BZUA 5L4LA 2ZATA 3WGIA 3PHLA 1CQJA 3D3EA 2YYYA 3GVHA 3BMCB 3QHAA 4PG6A 4RVDA 3GVPA 1RPNA 3B70A 4TVBA 4EDFA 5K6AC 3H7AA 2GLXA 2ILTA 3HN2A 4ZA2A 2RCYA 4LCEA 1LRJA 2EWMA 5DBIA 2NVBA 4ZHSA 3QWFA 5TC4A 3IJRA 1KY4A 4HNHA 5TIIA 3ZWBA 1ADBA 3DEYX 2JKVA 1IY8A 1YQDA 2PLAA 2VHWA 3DZIA 4U7WA 4EUEA 1GEGA 4IJVA 3RC1A 5JDIA 3RKRA 1H9BA 4BNTA 1DIRA 5C7IO 1Y9EA 4BNVA 3N74A 3OM9A 3BMNB 4MKRA 2E48A 4H7PA 4BO1A 4E13A 2V6GA 1HZZA 1ISMA 4QEDA 5CEJA 3SX2A 3AOGA 3M1AA 2GDZA 4CV2A 2FOIA 4O59O 3RFXA 4HWKA 1BMDA 4JX8A 2FZWA 4PGFA 3IP3A 3VAZA 2UVDA 2DT5A 1H0KA 2VOJA 3FBTA 3MJ4A 4J4HA 4XGKA 3UCFA 1L1FA 4NG5A 1YE3A 4J1TA 4M87A 4W7IA 3RU9A 1CDOA 3KSDO 5ADHA 1NM5A 5I7VA 1HXHA 3TDKA 3VPXA 3L6OO 1ISHA 4YQYA 5JAZA 3SLGA 1DC5A 3IDSA 4TZKA 1SEPA 2G76A 2OXIA 3BTUA 3WWZA 1B16A 2Q49A 4NU5A 2ZQYA 3OQ1A 1SB8A 4K28A 5G0TA 4E3ZA 1LI4A 1OMOA 2O3JA 3E5MA 3KYCA 5IDYA 4B4VA 3AM3A 1ZNQO 3GHHA 3RUAA 2AEMA 3OHSX 1A5ZA 1CETA 1MFZA 1PJ2A 2BGKA 3H5AA 4YJGA 1QSGA 4PZDA 4NU6A 4YAJA 2D5CA 1M75A 5DOZA 1DRVA 5FF9A 3KEQA 4XGNA 2BFMA 1YBAA 4IBOA 1ZUD1 2D1YA 3GVXA 1O6ZA 3PDJA 4I9HA 5IF3A 2C20A 3PQFA 4UAGA 5T8KC 4Q3BA 3ON5A 3DMTA 1KVTA 3NJ8A 1CJCA 1WDKA 2GZ1A 9LDBA 6LDHA 3PYLA 4HNGA 4KZPA 1HZJA 1NYTA 3FSRA 1ENOA 4RO0A 2Y93A 2RHCA 3H9UA 1KERA 1E6EA 3U4HA 2V7PA 3FBGA 2VHXA 1J6UA 1Y81A 3AM4A 3KUXA 3D5TA 5CDSA 3GG2A 3RSHA 2PTGA 2QW8A 3OJLA 5CG2A 3RI3A 1JVBA 1O95A 2FN7A 2IXBA 4ROSA 3L77A 3ZI0A 3MZ0A 5DN9A 4L4XA 4RV9A 3RJ5A 4S1VA 4J16A 4M1QA 2VUSA 4J1SA 3HADA 1SAYA 3WQQA 2YW9A 1HL3A 1I3KA 1LDYA 3KZVA 4BNHA 5FI5A 2P4HX 3ABIA 5ER6A 2CNBA 3SBOA 4XYEA 1HETA 3RC9A 4UVDA 3HUDA 3OQ6A 2P9CA 4J1QA 5CEFA 4CQLB 3OQBA 3QIVA 5C7LO 2OMEA 1U9JA 3JYOA 3Q11A 5F1PA 1UDAA 1AGNA 2VNAA 3KO8A 1T4BA 4GAEA 4K9DA 4PG4A 2GASA 5B1YA 5DULA 3BTSA 5DP1A 5EINA 1YL6A 1DIBA 5A9SB 2Q46A 3H5RA 4GPD1 1YB4A 1NHGA 3BMOB 3ROPA 1VJTA 4PFJA 5L51A 1CQIA 2Y99A 1G0NA 3FPLA 2NTJA 1KC3A 1VE9A 3RD5A 5KTKA 3QWIA 5ER9A 2ZJ0A 4D0RA 1ZEMA 1UXJA 2W90A 4FIZA 3WGZA 3PLNA 4BQRA 1IULA 1JAYA 1Y6JA 4DVJA 1XYGA 5I7SA 3JD2A 5GMOA 1VLLA 5TT0A 1WZIA 3LLSA 1ZMTA 2B4RO 3WNVA 2EKQA 3RUIA 5HM8A 1GYRA 3U4DA 1PTJA 4WLUA 1WMBA 1PL8A 3DFUA 4L4SA 1JWAB 4BMNA 3HNPA 4FS3A 4RLHA 1DRWA 5I8ZA 2WEKA 2W2KA 3WYBA 2ZYAA 4MVJI 4FCCA 1JN0A 2BLLA 2JHFA 5THQA 3VH3A 4OH1A 3VDRA 4FR5A 4I5GA 2BMAA 1EBFA 1U4OA 5G4KA 4UVIA 3T4XA 3I83A 4BNKA 3P5SA 3F9IA 3ZHYA 1IL0A 1DHTA 2PZJA 2XOXA 5DDIP 3H9EO 3AOEA 3BHMA 1KOLA 1V3TA 4IGEA 2NUAA 5C7OO 1Z6ZA 3GZ4A 4J7CA 4E2YA 4DIBA 1YQXA 1FK8A 4D0SA 2OO5A 4EJ0A 1I5RA 4WLEA 5JE8A 4XRRA 3OIFA 4BO5A 4I1IA 1PJBA 4MVJH 4CMEC 1TA4A 2ZIZA 3E8XA 1F17A 1WW8A 4Q3NA 5CFZA 4P4GA 2RH8A 1UR5A 5L4NA 1FXSA 1HEUA 1HDCA 1PJQA 4RORA 3UW3A 1PJ4A 1A4IA 1ZVMA 5EQFA 5IN5A 4CR8A 3WQSB 4DLBA 3ZV5A 1BVUA 1IYZA 4M54A 3RU7A 3I4CA 2VRBA 3QVWA 3ZWCA 4ALLA 3GUCA 1JWBB 5JMWA 4BO0A 3FR8A 3L07A 4IDFA 5G4LA 2Q2VA 4XIJA 5KJFA 1PQPA 3B20A 1ZSVA 4GX2A 4MP3A 1EVJA 2OORA 4A26A 3ZW8A 1PJCA 3QV1A 2H63A 3VPSA 4PLZA 5LCXA 2R2GA 1PR9A 4BNGA 3NV9A 4JLWA 1E3IA 1HF3A 3U9LA 2HMTA 4KTTE 4L74A 1B2LA 1H2HA 1XKQA 2VYND 2XXBA 3F1LA 3NX4A 4FGSA 4IGFA 2NV6A 1M6WA 1K5HA 5JCXA 5I7FA 3C1OA 2GO1A 2WE7A 1JKFA 5CPBA 4YRDA 3ZGYA 3DOCA 4NMHA 1P74A 2Q45A 3LU1A 1YWGO 1RWBA 2Z1MA 1XU7A 2I6TA 4EJ6A 2Z95A 4CM9D 5AYVA 2DBQA 2J5KA 5L95A 3L4SO 4NR0A 3COSA 1LDBA 4OO3A 4Y67A 2HK7A 4BMVA 1QMGA 4EGFA 2Z1NA 3PVZA 1EMDA 1ZIDA 4W4TA 3SLKA 4A7PA 4BNWA 5CAEA 1D7OA 1HYHA 3PXXA 3CKYA 2CVZA 1QRRA 1GTMA 1T2CA 4EBFA 4I5EA 1NR7A 4IPTA 1NPYA 2P2SA 4DBZA 1UZLA 1PS0A 3OMLA 2GPTA 4HFJA 4OSOA 3RQSA 3W8EA 4ZVVA 3E48A 5T67A 2DAPA 1GYQA 3DC2A 2VUTA 4ND5A 3RCBA 1ZXBA 2HAEA 3LT2A 1JQBA 3E18A 1E3WA 3KOUA 2Y67A 3GLQA 5TLSA 1P1FA 5THKA 1HE2A 2B4TO 4CV1A 5FFFA 3O9ZA 3PHHA 1DLIA 3VZSA 5BSFA 2X22A 3S2FA 1HE5A 1EE9A 2VCYA 4BGVA 3WR5A 4GX1A 2I76A 1GUFA 5JAQA 1Q0QA 3AUSA 3E5RA 4U6QA 2B37A 4D45A 4CLEA 1PZGA 2VHYA 1ADCA 2C29D 2O3UA 3LSYA 1KEPA 4Q3AA 3TJRA 1YRLA 3WGQA 2PH5A 2O3TA 1ZKMA 2B69A 3NT2A 4NQZA 1RYEA 1HDGO 2JAHA 4MPDA 5A9SA 1K6IA 2ZCUA 4NZ9A 4RGBA 1DFIA 4MIEA 3ZWYA 5TT1A 2A4KA 2Q2QA 1XWFA 1TT5B 5FI3A 1P1RA 1U3VA 4XQEA 1F06A 1V0JA 3NTQA 3QLJA 1HDRA 4A73A 2OBNA 3AI1A 5G2OA 4JJGA 4ZQHA 3ITKA 3RUFA 1T2DA 3UUWA 3TL2A 2ZTLA 3W8FA 3I23A 3T7EA 3A28A 2YDYA 3DL2A 3JD4A 4ZQEA 1SC6A 2Y1FA 1FMCA 3F5SA 2IDZA 1KETA 3GVIA 4JBGA 4WOKA 4OSPA 1QYVA 1VL8A 1XIVA 1AHHA 1YOVA 2GD1O 1PGOA 3QWBA 2GN9A 1P0CA 3EW7A 2NU9A 4JBHA 4MJLA 1QYCA 2QHXA 2VWHA 2RAFA 3CPSA 4HFRA 1B8PA 1MXFA 5EMHA 4B7UA 4R4JA 4XB1A 3RROA 4RPJA 1LC3A 2BH9A 2DPHA 1NP3A 2EKLA 3IUSA 4W6ZA 5H81A 5TS3A 4LSMA 1I24A 2EERA 4Q39A 4GVXA 5LC1A 3OBBA 2DM6A 1PIWA 1SPXA 5ITWA 1P0FA 4EEZA 2FP4A 3UOGA 2DLDA 3KETA 4K6FA 3EAGA 4IDGA 4A2CA 4E5PA 1UDBA 2PA3A 4GKBA 2Y1EA 2UUOA 4MVJG 4BKQA 2NVUB 4GVLA 5DCYA 5BQFA 5JY1A 4O5OA 4BKPA 1I01A 1AXEA 4CLOA 5L7WA 4FSHA 3T7CA 1O8CA 5JYDA 4O63O 4BV9A 4OQZA 4JQCA 4BNNA 3C1TA 2UUPA 3H65A 1U3TA 3ZWAA 2IZ1A 1KEUA 4OXKA 1DEHA 2O7SA 3WWYA 3A9WA 1D8AA 3AU9A 1YVEI 3TOXA 4CMKA 1R4MA 3BMQB 1KVSA 1NPTO 4MVJA 4J2OA 3A14A 1AN9A 3DAFA 4GSLA 2EP5A 4QFDA 4K1LA 1JKJA 3H9JA 1QYXA 4INAA 3VTFA 3GF4A 4CPDA 3TWOA 4BNZA 1QV7A 5EERA 4KMSA 4NBVA 1E1MA 3H2ZA 4MVJM 3B1KA 4MP8A 4MVJP 1DLJA 3AOEC 5CP8A 4IUYA 5I7EA 1LDNA 5JCJD 5B4UA 4ZGWA 1LQTA 2JD0A 4I5FA 2VHVA 4BGUA 2H9IA 3IOYA 4LGVA 1W8DA 2R00A 3HDHA 4CMAA 4CMGA 2X9VA 1LJ8A 1GQQA 2PGJA 5G0UA 4YJGB 9LDTA 2X58A 4B4OA 4YDRA 2EJVA 1MFPA 3F1KA 2OGUA 2AMFA 1ZSNA 4LRTB 4QO7A 5T6BA 4BB6A 1I36A 3ORFA 4U5QA 4LN1A 2YY7A 4JJIA 4P8RA 4R1NA 3ASVA 3O8QA 3JV7A 2PNFA 4E5YA 1UP4A 3N58A 3UCXA 3GA0A 3PHGA 1IPFA 2DQ4A 4FOOA 4B8WA 4MVJE 1DBVO 4KUEA 5IN4A 3RASA 4EEXA 4ALKA 1GUZA 1FDTA
chains in the Genus database with same CATH superfamily
3GJ4A 1OC4A 4HYQA 4OQYA 1KYIA 4F4JA 4UW9A 5A5FA 1RJ9A 2QL7A 1ZCAA 4LAFA 2UZ4A 3HZHA 5B4VA 1R2QA 5LXTF 3QI2A 2R2AA 1A8HA 2ZB3A 3C3KA 2NYUA 3ISTA 1II8B 3V8MA 3PXEA 4RMGA 4QTZA 3GP3A 4QASA 2MTBA 2NNLD 3CGGA 4GP6A 1ZUWA 2DPGA 5JZMA 2IS1A 2G4CA 3KHTA 1AUVA 3RT1A 2JLXA 3EHDA 4LZOA 4U39A 1FFWA 1F4LA 3N07A 5CTJA 1U31A 5K0ZA 3CR8A 3JZAA 4F84A 1U9CA 2AVNA 4XW2A 2OP0A 3GVCA 2C96A 1DI0A 2ZUBA 1GJRA 3VU9B 3BFKA 1KYYA 3N5CA 4G0NA 1UQRA 4KJXA 4F85A 5KO2A 1SCQA 3WNQA 4KPGA 3NU1A 3GAFA 4MUIA 3FOBA 3X3HA 5JNWA 2GCPA 5LKRA 1G1MA 3E22B 1NW4A 1FUKA 1YZKA 1VP9A 2J0UA 3AR9A 1NRXA 3GRVA 4M37A 5DNDA 3WFIA 3WO0A 3N9IA 3TR5A 2EF1A 1E9VA 2V5UA 2XMGA 4WE3A 5IHPA 2YQ4A 1JIJA 3T7IA 4BS9A 1WZEA 1UMKA 3QP9A 5AKXA 2FR0A 5AKGA 3V1TC 4Q05A 1N2SA 2AC7A 3L7YA 5AKHA 5A4JA 3W7BA 3PX3A 3CEMA 4NZNA 4PV7A 4WWHA 3WLOA 1FSGA 4RHUA 2C5HA 2W6CX 1KK2A 3IH5A 4N0MA 3UJ6A 5GZ1A 3ST7A 1NR5A 4IHQA 4ID3A 2QPLA 1VMDA 4NULA 2ZUVA 1GFSA 3LXRA 5ARCA 2QRHA 3E84A 5LA6B 2QD4A 1MJFA 2K2WA 2Q6LA 1XQ9A 5KOJA 3B82A 3ENWA 2DTDA 3IV9A 2C58A 2X23A 3DFZA 4KMRA 5FQOA 2GEVA 2NU7B 3VVCA 2EWWA 4QXAA 2HPHA 1M54A 2FQXA 2XW6A 1S3GA 3IIEA 3LUJA 3FY4A 3L8FA 2J07A 4KQMA 5F64A 4E4RA 2LR0A 1FYFA 7MDHA 2V6BA 2GH1A 1ZWKA 3GARA 3HBAA 2AXEA 4TVKA 3AVXA 4PEVA 2BEJA 2A9FA 1QVWA 2CJWA 3PC3A 5F51A 2XOEA 4CMBA 3A0RB 2FFAA 2YIVX 1XUOA 4PX5A 4J6FA 4P53A 4GPTA 4NSNA 3GUYA 3LP8A 1JR6A 1WW3A 1M74A 5HRUA 5TQ2A 1WY7A 1JFVA 2I6GA 5F98A 4X20B 1PJLA 1XD9A 2N1BA 4H16A 3ZCPA 1Q1GA 5DLYA 4CMEA 2JFXA 2FRDA 3WMFA 2VQFB 3OM1A 3Q9LA 4CF4A 1YA6A 1ORHA 3NH9A 2O05A 2QAGA 4IUDS 4KMOA 4Y1RA 3U7QB 2OYCA 3NC1C 2GHQA 4M9CA 4QEZA 5FFNA 3VJRA 2F2TA 4ABYA 5CNMA 4DIOA 3UJ8A 1N33B 3DW1X 3AP3A 1SXGA 3FNIA 4DCPA 1TQ8A 1DZ3A 4X1KB 5KZMB 4K0KB 3BAFA 2BE7A 3UJPA 4DBLC 3WB0A 1IJEA 4BMYA 4EMTA 5FR1A 4DT1A 2PGAA 4BO6A 4X8LA 5GIOE 4M1WA 3CBGA 1A7KA 3K6RA 3WDKA 1H0RA 1OWOA 1E9RA 1Q91A 1ECBA 2YCBA 1QIFA 3EVDA 4HKTA 5HF9A 2A35A 1VKHA 5F52A 2NUAB 1CLEA 1UBGA 3OPXA 1RXUA 4KO8A 5HCNA 4KFCA 1CZRA 3WKAA 3Q1LA 4OBEA 4U9HS 1B74A 3N0XA 4TTPA 1JI3A 3CMMA 4A6XA 1RRMA 4QLOA 3O8OB 1E32A 3AXSA 3PIDA 2YJTD 4B3GA 3PWKA 1IHUA 4IDNA 4RHYA 4OUDA 4AZSA 3D6FA 4E7PA 4BWGA 4C0LA 4N4AA 3D1VA 1R37A 3NWPA 4PGMA 5CEEA 2C7QA 4K40A 3WL4A 1CY1A 2GM4A 2C5FA 1R3UA 3RFCA 3H0KA 4JBNA 5C1OA 3IJEB 1LRKA 3NHBA 1KJQA 1EK2A 3PXUA 2QGNA 4NRDA 4UC0A 4K7JA 5CFLA 4ALJA 4I4CA 1KO8A 5CYOA 1P0IA 3THOA 3UYLA 4X8HA 4IIJA 3GMIA 3NEPX 2R1TA 1SVMA 3CIOA 4A8TA 3HXLA 4TVOA 5FD8A 1UMDA 3L7DA 2A6PA 2F3SA 1R50A 2GMWA 2ZR7A 3E9YA 3TLBA 4BO4A 4ZCTA 5ALVA 5CGZA 3V4PB 4YJDA 2RGNA 4JQSA 1OYOA 4MYUA 3NAZA 3PFCA 3H2YA 4FHCA 1ATZA 5DHPA 5EXSA 1IPEA 4TWRA 4HUQA 3UUFA 1KI8A 3TRFA 3CWZA 5DHRA 3O82A 3JTEA 3QPUA 3P0IA 4EM6A 3CEHA 4MHSA 3TINA 2Q3BA 4PX2A 4A2WA 1V26A 1NJ8A 3K09A 4ETNA 3O74A 4DQUA 4G0WA 2CL7X 5LZ7A 4ZTUB 3O94A 3KYIB 1FQKA 4MV4A 3GMTA 4KN5A 3EE6A 3OZVA 1IHXA 2RAVA 5DXFA 3BHJA 3REGA 1A5SB 4R1MA 4RPLA 2FMTA 1E1RA 2JC3A 2BBTA 3K8YA 3DPUA 4RVFA 4X9XA 1BU5A 1L7QA 1TF5A 1NJ6A 3H1BA 2AMYA 4CEJA 1CVLA 2P5SA 3DS8A 1PV1A 2H1OA 4TS4A 4BBJA 3U1VA 3DE7X 4YQFA 1ETHA 2C1XA 2O3QA 4WECA 2NUBA 4E21A 4YV7A 2J48A 2Z5FA 3EUAA 3WK8A 3WLRA 5K8LA 3EGVA 1V1MB 3PEWA 2Q8PA 4PRLA 1UWCA 1CUUA 2QL6A 2XTJA 1GZUA 2YXPX 4MQ4A 4NFYA 3E05A 1OTXA 5KQSA 3FB1A 2V74B 1RAHA 4LRWA 3SC4A 4R0NA 2WU0A 3JQAA 1O57A 1TKCA 4C0SA 1C3EA 1NFFA 2IT1A 2OTCA 2XNDA 3P9NA 4MZXA 2FPXA 1ZVVA 1L3BA 1FDIA 3L2OB 3M6VA 4FI3C 3WYGA 1MP0A 3N8NA 2ERCA 5KSPA 5TB5A 2C4WA 2GPJA 2IWRA 1GTZA 4B43A 4WBNA 1S0UA 2A78A 2JHAA 4MRNA 3M1LA 2JBWA 3I42A 1PSDA 5KAPA 3UWKA 3IOEA 1T5HX 2CY0A 3E9DA 1QS0B 3G0GA 5EIEA 1MX9A 1J5PA 1PEAA 1QNFA 5H83A 2QU7A 3QTTA 1V5IA 4GO1A 2UYGA 1Q2UA 1Q7GA 2HNAA 2W6JA 3HBFA 2O2YA 4MKHA 1BE6A 1D4FA 4FR0A 5HK8A 1Q21A 3ZV4A 3FNGA 4F3CA 3GLSA 3BZWA 4IYJA 4KDRA 3FOWA 1M0TA 4IL5A 4LXXA 4PPNA 5EMNA 1OZ0A 3EXIB 2YFYA 1J24A 2VXYA 2EJCA 1VI5A 1QVRA 3I0ZA 3DMNA 3R8XA 5A7GA 1MLDA 3ET5A 2CMKA 2GK6A 4ZVUA 1CUGA 3PPIA 3GMSA 4G86A 4OXXA 1NP7A 2QE7A 4EBBA 3T9CA 1CUIA 1UL1X 4QG7A 4LBZA 5ILGA 3TW0A 4DXAA 4IJMA 4NYJR 5HMLA 5IC5A 3T3EA 4N0PA 4G2TA 1AH2A 3KK0A 2VUIB 4W5TA 2P4UA 4X71A 3ROGA 4E1AA 4KYIB 4CI0B 2B0CA 1LPNA 4UEOA 1I4WA 1Z7GA 2ZRKA 3KOZA 1UFKA 2H5EA 2W2NA 4LMRA 3S99A 3ZUGA 4DA9A 3BGVA 5A05A 1JEDA 4DJAA 4XKJA 1I13A 1KY5A 3HCRA 1PG5A 1PR6A 3JAKA 1FSPA 1MIOB 4I3FA 1CRPA 1L4KA 4FNGA 3KXIA 4NEGA 1REQB 1MJGM 2BZGA 2EDAA 3CJRA 5EUCA 1F2UB 5K6RA 3ZWOA 1KYZA 3UOAB 2VP0A 1XRNA 2CCGA 4JT9A 4KQHA 2PEZA 1QBKC 4Z9YA 4OUKX 3VR5A 1UZNA 1VPDA 3E1KA 4BP8A 1AX9A 2C4NA 2YASA 1JJ7A 4PLGA 4GZ3A 2XB4A 2NU9B 5TEVA 4BDSA 1TC1A 4DUPA 2EFYA 2NZVG 2R4QA 4F2GA 5IM4A 2XQKA 5IJ0A 1T2VA 3X1WA 4YUAA 1PO7A 3DDNA 5BSEA 5JIBA 5KVCA 2XXAB 2D1TA 4LDZA 3FJYA 4FFMA 2AMLA 1IK4A 2PRZA 2H54A 4YCBA 1K5PA 3HGTA 5EGNA 4O4LA 1N1GA 1E99A 4FKMA 5DSTA 4NENA 2FP4B 4HDOB 3TXAA 5CA0B 3GFQA 5FNZA 1YTUA 4JJFA 1KDTA 4EY7A 3B6JA 1XX6A 3C8UA 4R16A 2GARA 3UWDA 1YT5A 1T0UA 4M0PA 2C2WA 1QK3A 1BCSB 4PCLA 1A96A 1QGOA 1CF9A 2JLCA 1U80A 3I1IA 3PE4A 5CA1B 4MDEA 4CEIB 2FNAA 3GAAA 2QRJA 721PA 3N39C 5IJZA 4AQYB 5DM60 2QQFA 3E82A 3OPNA 3FNFA 4B40A 5KPDA 3KLNA 5BNFA 1I3NA 1Y6RA 1GPMA 5DK4A 3THYA 1Q7TA 1EK6A 2C3PA 2HLDA 2W8BA 3Q3VA 1WP4A 4MIOA 5KEIA 1E0SA 2FRDC 1HK7A 4MQBA 4BVAA 4M1SA 2AN1A 4ON9A 1R4MB 2JF0A 2HCJB 2IXFA 2BFFB 2QAGC 4XAQA 3VYUB 1QH8A 4C5AA 4CV0A 1B7GO 3SM9A 1WABA 1GL7A 2QOEA 3G89A 4CMHA 3CZ5A 3KDAA 5JHGB 2IEDA 1N6IA 2VUHB 1DE0A 3GEDA 3JR3A 3NG1A 3AUTA 3R5JA 4ENWA 3A9RA 1V7CA 2D2XA 3ANMA 1YS7A 3URMA 3HKEA 2BGJA 5E7MA 1J9ZA 1M8KA 2O59A 3F4BA 3I61A 2IUFA 5I4CA 1XMOB 3FR7A 1ADJA 1Q7CA 1B0ZA 3JWPA 5IC6A 5D2CA 1ZW1A 1VJCA 2GM3A 3STHA 4C0AC 2HZ7A 1DAMA 1OAAA 3HWSA 1MKYA 2E4ZA 2JFPA 2PU5A 5EEHA 3SX4A 1CFJA 4OOFA 4B31A 3Q7RA 3EPLA 4IMRA 3MLAA 2G9UA 4ND8A 4PVDA 2HT6A 2NAFA 5M7EA 2FWIA 2FX3A 5CU7A 1R6VA 2W2OA 1UXKA 2J59A 5CJPA 1QRDA 4RQBA 3CB4A 2RGUA 4IQ0A 3D7KA 5KDLA 1XNGA 1UK9A 2LZ0A 2O4UX 2EF0A 2P6OA 5EXPA 3K1ZA 4IVPA 5C4GB 5D01A 1FRFS 4M0MA 1X7XB 3UGTA 5NLLA 1QU3A 1Z3CA 4GZLA 2MYUA 4MI1A 1X87A 4GI3A 4OMUA 4ZT4A 5CB4F 4X62B 4OAPA 5ARDA 2D4HA 5EKDA 4DABA 1BW9A 4B0OA 2COUA 3D2LA 5EJ5A 2ZW9A 1T2FA 5D1HA 2NN3C 4NBUA 3GZNA 1PFUA 2CNKA 4BB5A 4P1ZA 4RY9A 4UQPA 2ZP1A 2AX3A 3HGQA 5LLTA 1FRVA 1KBOA 3O8QB 4QSHA 1GL3A 5KTTA 4MW5A 4IY1A 5AO9A 5KNCA 3EMKA 3S2YA 2FHSA 1C9JA 1WDMA 1X7HA 5F2KA 1HV8A 2J8ZA 4A6DA 1ZM2A 2WF8A 3M6MD 3WGYA 2EZ4A 3EEOA 1C4KA 1RRVA 4S1TA 1WF3A 1KVQA 3KOXA 3U4CA 3LXUX 5FAXA 1OIWA 2RGNC 1U2DA 4WY2A 2H18A 1X1CA 3RAFC 2BR3A 2TMDA 4I0WB 1XYYA 3M6IA 1GZVA 2ZJ4A 3EJWA 4F4DA 4JEUA 5DYGA 4OI1A 3I4FA 2QIOA 2XWSA 3U7GA 1G18A 1TTHA 3RNLA 1A9RA 4HF7A 2VPQA 2WA1A 1EYZA 2Q0XA 3FSEA 4BMPB 1JQ3A 1V9CA 2CLCX 3K15A 2WVJA 4RMNA 1YO6A 4Q4HB 3LBFA 5D5QA 3AKCA 2IOHA 1KPIA 4PC1A 3WHIA 3IT3A 3AVOA 5AQ1A 2I34A 2O5VA 1BROA 2X13A 3K09C 4W5WA 3KQKA 2I0FA 3ESQA 3L7IA 1U11A 3GJQA 1GXSB 2YHAA 1RP1A 2AH5A 1XTBA 2JGMA 2NACA 2QX8A 3E9CA 3S1AA 2JJ2A 4RZHA 1TM2A 2MU1A 3PE3A 3DTVB 1LBSA 2J46A 1DPGA 4N7BA 3I28A 4NEQA 2BGGA 4JUCA 1A77A 1X42A 4PG7A 3QX7A 2XCIA 5EI5A 4D9IA 2BFBA 3LCRA 1LS6A 2FZKA 4HQFA 2O2HA 3CTPA 5EFOA 1KDPA 2X15A 2IXDA 3FSGA 1AHNA 1OA1A 3HXPA 3BIXA 3R6WA 4NCKA 4AUNA 3OTOB 3JTMA 4UTVA 5M3BA 3I9MA 3V42A 5D6NA 1KYXA 1ZIXA 1B26A 1VYUA 1KVUA 1MPTA 4B73A 2GNAA 3IBFA 4ANFA 3OFJA 2WYHA 3SYMA 3SBXA 3VNQA 3ZI4A 3KZNA 4UASA 3L0DA 3EVZA 3NO4A 5EXEA 4DG9A 4PYJA 3GEMA 2O48X 3L82B 3EUWA 3GJZA 4OX9Y 4C1NA 2VRCA 1JA0A 3SF8A 3OIGA 4HAZA 1Y4DE 1XKLA 3E9ZA 1IOWA 1DO2A 2IYSA 2Q3EA 3JQFA 4HX2A 3ZU2A 1WXDA 5IYZA 4HXYA 3TI7A 1I7PA 1Z7WA 1JG6A 3B6MA 5LMCA 3LPMA 4QTXA 3VR2D 2HO5A 1SC4A 3PXCX 1W25A 3QK7A 4L8LA 1T8UA 1WE2A 3LYLA 4BYGA 1YJQA 2E6UX 2OXCA 1NVVR 3ZXUB 2J6IA 3FI9A 4JMLA 4Y2UA 2YNMA 4ZT3A 5CT5A 3QITA 5EESA 1U3DA 3EVTA 3P0HA 4GOOD 1QV6A 3U31A 3O90A 4N3NA 2WJIA 1P9LA 1PL7A 1NW7A 1AZSC 2QD3A 2YVUA 5IKEA 1IB0A 2AI2A 1PR4A 4BVFA 2Y4NA 3JQGB 5EJ8A 2C99A 3OI7A 4YTEA 5F4ZA 5AXDA 1V16A 3ILHA 1C3XA 1E18A 4JB3A 3ZHQA 5DX0A 2VT6A 1NJSA 2ZETA 1LJLA 1QZXA 3BX1A 2GZHA 1I8TA 3T0IA 3ESDA 3FHLA 4IJKA 5IP5A 4TRMA 1EKXA 4K9OA 3OM0A 2IU6A 3CNLA 1EHYA 3IBGA 4YB8A 4OL9A 2BJVA 1W35A 3EZ7A 4MWBA 2GESA 3RTGA 3T8YA 1M6HA 2W2XA 1E4YA 1M66A 5DZSA 1DRKA 1P4HA 4M36A 4FGZA 3PFFA 5G40A 2GKOA 2I99A 4F04A 2EP7A 4PN7A 1KIAA 3NHWA 5AUNB 3HPRA 2NW6A 5ITVA 5AKIA 2BSAA 3T35A 1TYZA 3C3WA 2NQ8A 3UHAA 4V1CI 2GR9A 4TQAA 4FJ0A 3K8ZA 1BMQA 5GM2A 1JW9B 3TQHA 1OY1A 5T4HA 4TV9A 3THRA 5IG2A 1W5BA 4GOKA 4DL9A 3KEFA 2OKCA 4R3NA 1ZJYA 2PIDA 1OLUB 1SXJB 3P52A 3CSSA 4P33A 1SHZA 4HGYA 4AZ0B 1RQLA 2I62A 1BHSA 1P6XA 2I6UA 3IC5A 4KI7A 1XHEA 1IATA 2A5LA 3JQQA 5EEGA 1YC2A 2P2CA 3AFMA 4PE5B 3KKKA 2QR2A 4V0RA 3V4RA 1QPGA 1K2WA 3M5WA 4AJ4A 4H0CA 1L8QA 1BD4A 1IQRA 1RFLA 3R3UA 4CTOA 4HJRA 3C2QA 1O4WA 2QDKA 3BHNA 5D86A 3BXXA 2ZBUA 1E6CA 1WO8A 3MCUA 5LVAA 2A30A 1R9MA 5BUCA 4NCBA 1NBIA 3K2IA 4Y0NA 5HF5A 1GTL1 2XT9A 2R1ZA 1W59A 4UATA 4NJMB 1Y4UA 2FWBA 4J0GA 2NUTA 4WKBA 3PKIA 4OQQA 3JD0A 4Q3LA 5K2MA 7ABPA 5HTKA 1UP6A 1YZGA 1UF9A 3QKSB 1U4SA 4H27A 5FPTA 4P35A 1QRAA 2B9EA 3R6TA 4UD2A 1SKMA 2JAQA 2Q5IA 2XSZA 4QSMA 3QLUA 2PSSA 5K5EA 4K26A 4CCYB 2DBZA 1JB9A 4B6PA 4D81A 4A23A 4DB4A 4ZAXA 3QLEA 4YDHB 3PC2A 4R0VA 1SU7A 1H6CA 1E4OA 4ETIA 1YCHA 3FKSD 4ZFNA 4AMVA 1YKSA 3IVGA 3L8HA 3W9UA 5K3OA 2XXJA 1BXKA 4KK3A 1IC6A 3C1AA 5HKOA 3ZWXA 1XQXA 3HU2A 3DHYA 1NDUA 1EEHA 3M2TA 4DM3A 4R9RA 4BXOB 1CX9B 1H5QA 2WTBA 4G36A 4NQRA 4AZTA 2XZOA 1YQQA 2HK9A 2PD4A 1NN5A 2BMDA 3HCEA 1XZMA 3TNYA 5KOYA 1SUPA 5HE9A 3STWA 4CF3A 1QCYA 1NF2A 2VHTA 2O7VA 3QMWA 3FHJA 5T3UA 4QWMA 3ZQKA 4CM1A 3R9KA 1G17A 4PSVA 1G55A 5TY0A 1MC8A 5LNK1 1V71A 3B7PA 2VJOA 2JLVA 1ZINA 6NULA 4ECEA 5FV7A 1KBZA 4Y6GB 3G85A 1MQAA 3ND8A 4P84A 4JLDA 4BNIA 4C08A 3DAGA 3V7UA 3ADPA 4X7RA 3AWIA 3SYTA 1PVOA 2A9OA 1ZMOA 3QWHA 3HY4A 4PXSA 2R97A 1KIMA 2HDOA 4F6RB 2F6RA 1ZM3A 1T3HA 1OX5A 2XYPA 3MRTA 1OI7A 3NHJA 5FPHA 3H11A 3FLBA 2PXAA 2REBA 3ZLBA 1H3EA 1H2ZA 3BJRA 2I87A 4NWIA 2YJ4A 4UCQA 1FNBA 3FGNA 4MR8B 4TN5A 3DEHA 3LWZA 1BHO1 3AZOA 3DNMA 4A91A 1RVDA 3E5HA 3L1HA 2OYRA 1AA9A 1Z9BA 3TLYA 5B7NA 1J20A 3MUNA 3FNBA 5DTRA 2QE6A 3P20A 5CNJA 2W6PA 3L0PA 2GPBA 1YBFA 3JD3A 4FJ2A 4G07A 3FKJA 4V2IA 1VHJA 4L1KA 1Q1EA 4E5MA 4DDVA 1T5OA 3PGA1 5DHQA 4R1QA 3DBRA 4II7A 4EL0A 5KTRA 3DGEC 3R8CA 1GU0A 3GRKA 3AM1A 5C5DA 4D99A 1VKRA 2IHYA 3AY3A 1L4NA 3UMMA 4RANA 4MEJA 1N2OA 2ZK7A 4I36A 5K3FA 3WLLA 5KYKA 1TZBA 3G7SA 3O8CA 3D1LA 4OK6A 4JXZA 1GSOA 1TAHA 2D1FA 1I2AA 1DWQA 2FY8A 4LYJA 1Q0LA 3VKVA 1U2DC 3A70A 3D7NA 1V1JA 4P38A 3ONNA 4UXJA 4DEXA 4K9PA 1KEZA 1OXXK 3EUEA 4I9FA 1T4DA 1LPOA 4JLAA 4KXMA 2LIVA 4BMSA 3P9RA 4HP8A 1NYQA 3DDOA 1YULA 1QP8A 2I03A 4IH9A 3WNCA 4DCOA 2COEA 1C7QA 4FX2A 4BTLA 4F5ZA 1KK1A 2CL5A 1A9ZA 5B30A 1SO8A 2VTBA 3C15C 5A4AA 5AJUA 2J08A 2WM3A 1DKUA 4KBFA 3HBJA 4N39A 5GWXA 4Q15A 3ZNQA 1V48A 2FZ5A 2IW1A 3TJZA 1TEHA 3PNVA 3QV2A 4F2HA 1ZU4A 4UCWA 1P80A 2E2WA 3GH1A 4RV4A 4HD8A 2ZRLA 2P91A 4N5DA 4F21A 1G7RA 4F2WA 4TX1A 1PR3A 1T6BY 5KQRA 4DLTA 4ZO8A 4S1PA 5BWNA 2G4LA 2P68A 5HCUA 1XQ1A 3CLUC 2VNHA 3IO5A 1DIOB 2J9FA 3KOOA 1X14A 1LI5A 3N3AC 3DUWA 1SN7A 1OXMA 1QG6A 2FPPB 2XDQB 4HN4B 1VGRA 2QLLA 2JIMA 4RIHA 4DM4A 5I3CA 4ZJYA 4G85A 3QU9A 4KREA 2IYQA 2DEUA 4DXHA 3OA0A 4CIYA 1U0BB 4NYIR 2NXNA 2W2QA 3KQVA 3C6YA 2DMRA 3IIMA 5U4QA 4O4JA 4WKGA 5FUVA 1XMQB 1UBSB 1G8YA 4OHZA 2X8WA 4HDMB 3D6UA 4JA0A 4O1MA 2SCUA 1L5KA 1YXMA 1NQ5A 1YRBA 1XC7A 2KX7A 3D8BA 3F7NA 3PNKA 1SZCA 3HFGA 3IQFA 4YIKA 3OY2A 2J6BA 1N1MA 3PZRA 4DS3A 1QGUA 3SJAA 4MRRA 2PQ0A 2JGDA 2RIPA 2WWXA 1FNCA 2X8AA 3BVPA 5K4HA 4ROTA 2HLNA 4LJ6A 3WJ2A 4AZ3A 1ZCJA 3GGPA 1XJ0A 4KUGA 3M5CA 4MMXB 2B92A 2RBEA 3BXPA 4N18A 3UMJA 1QIDA 4FFNA 4A36A 5KSZA 3FBWA 1X7ZB 5L3QB 3ZW7A 2BFCA 2IA5A 4HADA 2ES4A 2FZLA 2GN2A 4XLZA 4HATA 5AIAA 2OZVA 3OQJA 4PNPA 5DNWA 5LMNB 4LF4B 2YNMC 2EC5A 3H2SA 1P7WA 3K5WA 1IEWA 1KJZA 4KQFA 4L6IA 1RWVA 5FUBA 5KU7A 2YZ2A 5KX5B 1UOPA 1T0PA 2VJCA 1PS8A 1JLLB 4G97A 3T7KA 2DR2A 5E7QA 2JGLA 2JIDA 1UBCA 3IVCA 2YV3A 1N2CE 1XEWY 1K66A 1DS6A 4ODIA 1JDUA 4BUCA 5KBYA 3SS7X 2FPIB 2BEUA 2YWCA 3INNA 1FDVA 2Z5GA 3JQ8B 5AFSA 1BE1A 2WB4A 4HWSA 5LA6F 2R8OA 2Y66A 3C6ZA 4BKMA 1PYGA 1PQUA 2AYXA 2Y8EA 4HAXA 1QRUA 4Z4GA 4Q03A 2IBMA 3T95A 3AUFA 4QFMA 2DXIA 3KVVA 4YAEA 3QVTA 5SY4A 4QU8A 3C8HA 4ACBA 1XZFA 4C78A 5IFLA 1EGHA 2VYNA 3A1FA 1WJGA 3HR8A 3KR2A 2O4CA 4A0FA 5IJ9B 3UF0A 4W5HA 4PLHA 4FUQA 2W5UA 4GMXA 1G4AE 3AHHA 5AICA 4V1CA 5HGXA 4PF1A 1Z6GA 3CY6A 1MZPA 4ZHQA 3O93A 1II0A 4IH4A 5ICMA 1F8YA 3S2GA 1OW3B 1CDEA 1H93A 1MOPA 3RYCA 4F38A 4WZAA 5GY7A 3T9EA 3KG2A 4AKIA 4D44A 4Y9UA 3SXPA 4OKIA 2PFGA 1XEXB 1NF9A 1GQFA 1KAMA 4FU0A 2GILA 4YAOA 3B36A 5HOEA 2ATIA 4REMA 4H1WA 2R6FA 2CLLB 1CT9A 1U3GA 2VG8A 1HT0A 3DZDA 1GPDG 2A3RA 4A27A 5B6JA 1JR2A 3PE6A 4DR6B 3NV7A 2NAPA 2YZGA 4J9UE 3RABA 5H3HA 3RWMB 1NU8A 4HDSB 1H2RS 1AO0A 4B79A 2CBGA 2QM3A 5TVKA 3WC4A 2Q9AA 2XMZA 4XSHA 2FZEA 3Q85A 3ZQJA 1CUVA 1CG6A 1P2TA 3KQQA 2GRJA 2ZJ5A 3MYYA 4MUJA 2BRUA 4Q4AA 5D5HA 1E64A 3U26A 4C0HA 3LQKA 3TTTA 4DZZA 3UHPA 3T5AA 5B53A 4U4AA 1VSVA 2FP3A 1MF7A 3I9NA 3JXEA 3PP8A 3WMWA 3CLVA 4I6GA 1ORDA 3OT4A 3KVNA 1BEZA 1GGNA 4JKIA 4KIGA 2QGFA 3BICA 1U7HA 3G2QA 3ESAA 3HBLA 1KH2A 2PCLA 3K0FB 3TLAA 1XNJA 4P0TA 3JRNA 1E58A 9MHTA 1TZKA 1E92A 3EQ2A 1C80A 2OFPA 3QLUC 2P6PA 4WOCA 5TPWA 5D7NA 4DYVA 5ED0A 1W36C 1JHAA 4WFIA 4YUVA 4OK3A 4CBVA 4MZDA 4D26A 4KHZA 3IQWA 4ZK6A 4ZMSA 3SMQA 1NXSA 1ZBDA 1ZLYA 4LHYA 4N5NA 1I6KA 2CGEA 5DVZA 4JBLA 1D1SA 4NV0A 1KE2A 5BUSA 2AJDA 4BE4A 5LN1A 3RRBA 2ZULA 3KSRA 4I55A 4W8OA 4WPGA 2ASEA 4BUJA 4C4AA 1K92A 5JY6A 4HGPA 5HBRA 2CB0A 1I3MA 4KO3S 1W46A 2LRHA 5EP2A 3UXYA 5A6SA 4QT0A 2EFDB 3Q3IA 4FYPA 1F7UA 1V7QA 2ZE6A 2ZYHA 3F5QA 4UPDA 4X6YA 5GQSA 2JLZA 5JNSA 1FZTA 3CVWA 1JRLA 5DN6A 3H42B 1DXHA 3U44A 2P9JA 4Z3KA 3OCUA 4X1IA 2DY0A 3GCDA 4IQ8A 4BNDA 2C04A 4ESEA 1XVVA 1SCIA 3UICA 4TYNA 3WWOA 4BVHA 3K5PA 4FWBA 3I9LA 3GLVA 3NASA 1GUDA 3OOWA 1Y3FE 2BI4A 4FK8A 4Y6RA 4AP5A 5KCZA 1N57A 2XBMA 4YT5A 3MHTA 3AJDA 1EB8A 4I1YA 4RLSA 1S9HA 3WMXA 1B6RA 3S8MA 5I48A 3O2QB 3D0OA 2I71A 5IVDA 5BOSA 3F46A 4FGKA 4MWDA 1T9DA 4FZRA 3A3NA 4KIWA 4MKXA 4XSVA 5HK9A 1RKVA 5DYYA 4WASA 4PZUA 1RWMA 5H16A 3TVYA 3W2TA 3WTCA 5BW6B 5CDFA 3JAMA 1K08A 4EGQA 3ZH2A 4IIVA 5ECWA 4Z54A 2DFDA 1E2EA 1SUDA 4MW4A 4HH1A 1EUCA 1VLVA 2QUZA 1JQAA 1Y1TA 1JE1A 3IKMB 4P7KA 4EK9A 4QOJA 5EJGA 3OIDA 4ZRNA 5ICGA 4PZCA 1RABA 1J5EB 3WIDA 1V9SA 4LHSA 4EGJA 1Q22A 1JHOA 4WA7A 1SPBS 4O8ZA 4C88A 2JJYA 2QUBA 1CFZA 1QIKA 4INOA 4IP0A 5IVHA 1SKYE 3ILYA 3KZKA 3Q3CA 4AJIA 1ODFA 1SOVA 4CKEB 4R1TA 5AH0A 3ZK7A 1GKYA 4BAZA 1F6DA 4IRUB 4JXKA 1A1SA 1USIA 1WDLA 2C78A 2IZ5A 3LIPA 1X8KA 2GAOA 3EA4A 5T4EA 3M5PA 4II3A 1TF2A 3E03A 2RK4A 5JAIA 1AMNA 1UCFA 4K9QA 4L8YA 3AQ4A 4D4GA 1RLJA 3OWHA 5AUOB 1LK7A 5CCXA 1U0RA 2WWVD 3ZWWA 3COWA 3LWDA 1GA1A 2NOAA 1SUEA 2YHIA 4TWIA 3JQ9A 1NSFA 3EZ6A 3F6YA 3V2UA 2AFHE 3A06A 4TKVB 4NK5A 3ENKA 1MQ8B 3U7FB 3B1XA 3EGIA 5DGTA 1M67A 5HFJA 3BGSA 3DVSX 5CMLA 3S81A 3MG9A 3MYRA 2CVQA 3GWZA 4FFWA 1QRTA 1Y7LA 2JRCA 2OILA 3CWCA 5B6IA 4C76A 4JP8A 3D4PA 4RE6A 1ORTA 2C7PA 2D4AA 2BISA 2O8VA 3E7DA 4PYMA 5DHAA 5C51B 4QDUA 5MN5A 1XWIA 2ZUTA 6YASA 4FYJA 1Y8RB 1V1RB 2TYSB 1V8FA 2E1RA 2XQVA 2DTEA 3NDBB 2PV7A 1MG5A 3ANNA 3FW1A 3P9KA 2P3LA 3RRYA 1DGQA 2CMHA 4QJ3A 4Q3OA 3F7TA 3OE4A 3UB3A 2FZCA 3CLRC 3AF3A 1NE7A 3O4GA 2GAFA 4W1PA 5JQGB 5HPYB 2QA5A 1WBBA 5CB8A 2I6FA 4AKGA 2Q5HA 3HCDA 2X42A 4B6JA 5F7JA 1QOPB 1FDSA 1UODA 2EXXA 3E70C 3I01A 3L0CA 2ZSFA 4DJEC 2XR1A 2ZEJA 4FYMA 3WGOA 2AZ4A 2V9PA 2VF2A 1VA4A 2I3AA 2R87A 2X5XA 3IP9A 3KKEA 4QOFA 4QYWA 4XQ9A 3U0BA 3FTEA 1CB0A 3JQRA 3G1WA 1K86A 1VTKA 2JIZA 4LBVA 4QL3A 2EX1A 2XUAA 4QHTA 1GITA 4Y98A 2E4UA 4MQ6A 4RU1A 2OENG 3NHUA 4GMKA 1B6SA 3FKQA 1FP6A 1ORRA 4A2PA 3FUWA 4Q9DA 1EIWA 5EIWA 4OXYA 1IXSB 2R62A 2VWQA 1C1HA 2CLDX 1Y5MA 3WNZA 1SXQA 1QVZA 3A9SA 2O8CA 4JSRA 1DAIA 4LVNA 4EB6B 3TFOA 5I9IA 1GR0A 3WGVA 2AKEA 4AZVA 3NBUA 1LD3A 2AWOA 3UAVA 3W5HA 1EJ0A 4BMZA 2HLHA 3A6DA 1CUSA 2HBQA 1HLPA 5ETJA 1B6TA 3ZD9A 4HAOA 5T5QA 3CJTA 2QENA 1K75A 1R4AA 1T0BA 2W0MA 1N5OX 2EFGA 2RG1A 3HUEA 1JHPA 3W6NA 1YR7A 4JGBA 2ZCJA 3UTCA 1UDCA 3MAJA 4CLRA 4S0ZA 4EATA 2WG2A 5BWCA 4LYEA 1TUIA 1PFWA 1P9OA 1VE3A 3MT0A 5D3QA 2GETA 1USUA 1YIOA 4HZGA 4MXDA 3WY9A 3B1YA 5CA0F 5DHFA 2ZBPA 5TQVA 5ENVA 2GNPA 1B41A 2PLRA 1DO8A 1X8LA 5ALMA 5FWYA 1K4MA 3EWAA 3RM3A 1NUSA 3TOZA 1Q0TA 3LX6A 1GEEA 3AHGA 1J2YA 2DCMA 3AEUA 4N0EA 3L1KA 4PYNA 1RCUA 2GLTA 3UKOA 3G0CA 3S8EA 1E7MA 1JS1X 3MMSA 5CA1F 1BSVA 4OBWA 4AG3A 3HSYA 5F3RA 3JQ6A 4FE7A 4G8JA 1GDDA 1C1YA 1SCBA 3B12A 3JYLA 3W34A 3DDWA 4S05A 3QEMB 3UZUA 5F2NA 2G9ZA 3EXHC 4BFTA 1U7DA 4GBJA 2C9OA 2B25A 1FNSA 1NR1A 1CRQA 2PYZA 3WRWA 3OSZA 1KH1A 1V6AA 1M3SA 4U0JA 3ER9A 1X7DA 3AP1A 3FDZA 4XPIA 5F35A 2ZSDA 1P2UA 4D7AA 2PZKA 2EOAA 1Q0HA 4I8DA 5LYYA 3OPYB 5I9BA 5L4SA 1SU4A 4LFBB 4UHEA 1W48A 1HDOA 2IPMA 3PUIA 3WG9A 2BRUC 1US8B 3GDHA 3U9SA 4C0JA 1YMQA 3KFXA 4NBWA 1LXCA 2VQ6A 1BWQA 2ZDQA 3A1DA 2XYQA 3GJ0A 3IMFA 4HEA6 5CVVA 1I80A 3FCUB 5CDGA 1I2MA 3ER8A 4WESB 3ONFA 4Y30A 4EW3A 3P2IA 4H3HB 3OEYA 4CMIA 4CYMA 1E5QA 1N6PA 1ZGJA 4MUFA 1AB6A 4P3OA 4L72A 4FDLA 3HLTA 4UBJA 2WIJA 3B3QA 3C24A 3GFSA 3PGJA 1XQ6A 3T3MB 1HKHA 1WNTA 3AGQA 3K70B 1E9EA 1YUMA 3NQ41 3VBEA 5B57C 5JH7A 4WACA 5P21A 4OHOA 4FX5A 3SQWA 2Y76A 3OQIA 3ZWPA 1M2NA 4B4KA 3K35A 2GN6A 3UK1A 2AKYA 2B4YA 1QG2A 1ZG3A 5F12A 1ZGBA 2CXOA 3OZ7A 3W2EA 7ADHA 3C70A 4D3ZA 1DKOA 3SOZA 2X5NA 4MRPA 4N8SA 3TQQA 5JATA 1ZVKA 3RLFA 1BJRE 1MH9A 3KKMA 1OH8A 2HJWA 3VC7A 1N1DA 5FOUA 4FBMA 3S7TA 1YFKA 3VKFA 2QSZA 1D6NA 4PQRA 3I6QA 4K2HA 2P4QA 2BEVA 3FPCA 4GXQA 4NDNE 4RPKA 5CURA 3ZDQA 2I9KA 4GRDA 3I6ZA 4RVUA 3PUWA 5BQXA 4UVEA 3DLTA 2DTXA 4R3UC 4UBOA 3BE5A 3BXHA 3PA6A 3FYUB 3ZVMA 3WYEA 4D41A 3WQBA 1RHQA 3BWVA 2CLOB 2JKYA 4LOHA 1DKQA 2HMAA 3R4VA 3SKYA 1RXCA 3K1JA 3A0UA 2ETXA 4B3JA 2FSPA 3OOJA 1XVLA 4A0GA 3SIRA 3RK4A 2YV4A 5IDQA 2IK8A 1S1MA 3CCFA 4I1PA 1AKQA 4P32A 1Y1PA 3FRJA 3HYNA 3RG8A 1JIXA 3A05A 1Z63A 4TLLB 3W04A 4O3MA 2DB3A 2Y9MB 3OF2A 1TMOA 2DSNA 5PNTA 3BMOA 4RXMA 1YCFA 1N7GA 1XVIA 2RK6A 5AHOA 4ND4A 2FK8A 3AEKB 1JDNA 3BSYA 4J0QA 3MMNA 4X1OA 3VR4H 1MHTA 4KRFA 2PSDA 1ZK0A 1CP2A 4PR3A 3C7KA 3R6GA 3KUCA 3H8WA 3DEIA 5HNKA 3O95A 5MFZA 5F9FA 1RI1A 1GRRA 3G68A 4ZREA 3SHTA 3T0GA 1F4VA 3ZZ1A 3T5PA 2IV7A 4AUKA 4WKNA 3RU3A 3PHJA 4UEJA 1JWLA 2PT6A 4V39A 2JI7A 4F1WA 3PUJA 3EZ2A 1DCFA 2HPAA 5AI8A 4FGJA 2GERA 2OM2A 4F4UA 4ZEMA 3UWOA 2GN8A 1H1DA 1E2KA 2JFFA 2W2VA 4PYLA 4DIUA 1XDSA 3NTLA 3KAQA 3F71A 5JT1A 1JIIA 1J39A 4FLMA 1P29A 4F9EA 1FQOA 4PYRA 1N6OA 5JS7A 4E0BA 1V43A 1EVEA 4BX3A 3U7EB 2IODA 1OBOA 4XQGA 1CRWG 1E9AA 2QMUA 4QYMA 4TTQA 4IVQA 3NRCA 2R1VA 4IHKA 3X2FA 4CG2A 4ER6A 5KYUB 2R7KA 3ISVA 3VV2A 4EQ6A 3E61A 3ETHA 2RD2A 1YR9A 2Q4DA 2YYAA 3DULA 3Q1KA 2JI8A 3LGAA 4FIDA 1JG4A 2MINA 3OCXA 3P0EA 3GLGB 2J4DA 2ERYA 1FFDA 2OGTA 2Z30A 3JQ9C 3FDIA 4YV1A 4Z7QB 4MRMB 1QE5A 1JR3E 4AJOA 1JEOA 2UZ1B 3DMRA 1EG7A 2F1JA 4AN0A 4F45A 4R71A 4I50A 5K0NA 4REOA 5JD6A 4DRZA 1WUHS 1H6BA 2KPOA 2V1UA 3DFIA 2A9PA 2DWOA 3G5TA 1M6EX 2Y1DA 4F71A 3WLAA 3OFND 4BAGA 1LDMA 5KTPA 1YJAA 1T25A 1MOQA 4DBLE 1JJVA 1NNUA 4M8IA 4YQZA 1FRZA 4D56A 1IN1A 2JBAA 5LB2A 2YL2A 1EM8A 3S4YA 3L8ZA 1AHPA 1Q11A 1ZWLA 4E30A 5K20A 5BXYA 1FNNA 4AJEA 1OFVA 1M0SA 1VGQA 1W88A 2OM6A 1W2GA 2IU4A 3L7OA 4FFPA 5L3ZA 4AMYA 5DMHA 3I72A 5HJ5A 4G56A 4D8TA 5K8VA 3N3BC 2ANBA 1XVAA