4D79A

Crystal structure of e. coli trna n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with atp at 1.768 angstroem resolution
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
266
structure length
243
Chain Sequence
b'VVISDAWRQRFGGTARLYGEKALQLFADAHICVVGIGGVGSWAAEALARTGIGAITLIDMDDVCVTNTNRQIHALRDNVGLAKAEVMAERIRQINPECRVTVVDDFVTPDNVAQYMSVGYSYVIDAIDSVRPKAALIAYCRRNKIPLVTTGGAGGQIDPTQIQVTDLAKTIQDPLAAKLRERLKSDFGVVKNSKGKLGVDCVFSTEALVYPGFGAATMVTATFGFVAVSHALKKMMAKAARQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
publication title The Crystal Structure and Small-Angle X-Ray Analysis of Csdl/Tcda Reveal a New tRNA Binding Motif in the Moeb/E1 Superfamily.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 83
structure length 243
sequence length 266
chains with identical sequence B, C, D
ec nomenclature ec 6.1.-.-:
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4d79A00
3CKYA 3FI9A 1P31A 4K26A 4PG5A 3RD5A 3QWHA 2Y1EA 3ITDA 1NFFA 1PJBA 4WK6A 3UH1A 3FD8A 4J1NA 3WDSA 1DRWA 2W2LD 1JDJA 3B1KA 2DKNA 3U0BA 3RUDA 4J1QA 3OQBA 3I52A 4IZHA 1EK5A 1IE3A 3BMNA 4IS2A 3CPSA 3ZNOA 2Y1DA 1A7AA 4CMKA 1YB5A 3AUSA 2D8AA 4Z0TA 4D45A 4RVFA 2HAEA 1WZEA 1K6JA 1PJ3A 5F5NA 4GX0A 3ADOA 3E9QA 2BH9A 1L1FA 4NH4A 4Q39A 1I5RA 1Q7CA 1PZHA 3P19A 4BNMA 4DLBA 5EL0A 3PWSA 5T6BA 4XGIA 3D3EA 2GDZA 1A4IA 3HHPA 1ISJA 2RH8A 1E3IA 3GAZA 4ZJUA 1NHGA 5LDHA 3WSWA 2XOXA 4NBTA 4LN1A 2EF1A 3BA1A 3LK7A 4YAKA 2UVDA 2D0IA 2FSSA 2PZJA 1N9GB 2Y99A 3L4SO 3VH3A 5C37A 4PVDA 4R3NA 3U4HA 4KOAA 3H9UA 1NVMB 4J4TA 4ND3A 5C7IO 5CPBA 1EBFA 2BF7A 1EUDA 3LYLA 1I8TA 4FGWA 3VPSA 3TZQA 3RU9A 3OIFA 4WUVA 3UF0A 3E1KA 5DDIP 1RWBA 1YBAA 4YQZA 2IYOA 2HMUA 4FOOA 1UH5A 1F14A 1IZ0A 3JQDA 2Q2QA 1B26A 4GWGA 2GN4A 1OAAA 1P1IA 2P4HX 3E03A 1E7MA 3ZWPA 1E1LA 2GRAA 3L6DA 3GLQA 2PKRA 5G4KA 4BGEA 1UR5A 4EEXA 3IUPA 4E13A 5COQA 2Y1CA 3H5AA 3L6EA 3WJAA 5C7OO 2YYYA 3MTJA 3DB2A 3Q0EA 3UCXA 3FPCA 4H3VA 1ZSNA 3A06A 1FDTA 3GVIA 3I3OA 4NBRA 3S2EA 5U1PA 3NUGA 4TWRA 5CDTA 2DLDA 3C85A 4R01A 1SAYA 2OP0A 3SC6A 4YT4A 4YYZA 2JD2A 5CFZA 5KCZA 4CMGA 3KOUA 3WFJA 3LT2A 1E7YA 1Y9AA 2PNFA 1TI7A 1X13A 2ZJ1A 4JX8A 4B7XA 2PH3A 2G5CA 4DYDA 5IZ4A 1SB9A 4CM3A 2BKAA 3I23A 2NU8A 5CPFA 5JFOA 3HADA 1O95A 2GERA 1ZO8A 2W2KA 4R68A 4E5YA 3PI7A 4WNIA 4BO6A 1V0JA 3C7CB 2GZ3A 4R1TA 4ZVVA 1DJQA 5U4QA 2O7QA 3BTUA 2UAGA 4W82A 5KOIA 4PRKA 4D43A 5IDXA 1J5PA 1KETA 3PQEA 4GKVA 4M86A 2Q99A 5L7WA 3GN1A 3GFBA 1H6AA 1N7HA 4TRMA 1U3UA 1ZZEA 2DVMA 1B2LA 3H5NA 4RVSA 3B20A 5JO9A 4XX0A 4TRJA 3VH2A 4LRSB 5IJZA 5K6AA 4K1LA 2C0CA 1ENPA 3B70A 4OKIA 4RLHA 3RIHA 2J5KA 3FBTA 3RC9A 3ZWCA 3PP8A 3RVDA 3AOEA 3PHIA 1LSSA 4QO8A 3ZGYA 2IRWA 2VHWA 2YV2A 4ZQBA 2WWRA 3D0OA 4FFOA 3EGOA 3QV1A 1NWCA 4GAEA 4RF2A 3E9NA 2A9FA 3GR6A 2YY7A 2VNAA 2DTDA 1HDGO 4I5DA 4ALMA 4CR6A 1XYGA 3IDSA 4FR5A 1H94A 3PZBA 4YT5A 2VZ9A 2ZTLA 2PKQO 3CIFA 4JBHA 3JQFA 2DPHA 3A9WA 5JCJD 1T25A 2O4CA 1LA2A 1GUYA 4Q9NA 2NTNA 2G1UA 3GDFA 3OEYA 1GR0A 2CVZA 2EV9A 3PIDA 3VAZA 5FI3A 3OJOA 2VYVD 1UZMA 2JCYA 4CV2A 4R54A 2C82A 4MP8A 5ENVA 2GZ1A 3NDJA 2OBYA 4YJHA 3SXPA 3WGTA 4IGEA 3UCFA 4LGVA 4ZGWA 4G2NA 2O50A 2NV6A 2VHYA 3I4CA 1IOLA 4HUJA 1V9LA 1KIFA 3DZGA 3U9LA 2FR1A 2A35A 4IQGA 2VHZA 3GH3A 3DMTC 2VUUA 3OQ1A 4DGSA 4OYRA 4A2CA 3MZ0A 3QVSA 3ANMA 1GZ6A 3EDMA 4BL5A 4PLYA 1JQBA 1LDGA 1V3UA 3H8VA 1XWFA 4TZKA 2JJYA 3GUCA 4UUNA 4WCFB 2D3TA 4G5HA 1J0XO 2CNBA 3WBBA 1R15A 2FPPA 5CDSA 2Q49A 1C1DA 2GN6A 1YBMA 2IZZA 1U8XX 4RL6A 2P9CA 1VL0A 2AEJA 2BFOA 1P74A 2NU6A 4CQLB 4GH5A 4RO0A 4L73A 5A06A 3R0IA 4OOEA 1ONPA 5MGBA 1DC6A 4IXTA 3ETEA 3WWYA 3NGXA 4XRGA 5JS6A 4ZHSA 1DIRA 3L07A 4G81A 4IS3A 1WMBA 1Y9EA 4AVYA 4D0SA 1X7GA 4MKXA 4BNJA 1XEAA 2V6MA 1YDEA 2PD4A 4CM5A 3NJ4A 3ZW8A 3LF1A 3OHSX 5JDIC 1ARZA 4HNGA 5BNIA 1Q0LA 1MV8A 1SB8A 1ISFA 4UVHA 3ZN2A 5A04A 1K89A 3HE3A 4I5EA 4EUFA 4INAA 4J16A 2O7SA 2P9GA 3AUTA 3DBRB 1EVYA 2FHSA 1VLLA 3OECA 1I3KA 2BFPA 3KUXA 2Z1MA 4ZU3A 4XDZA 3WG9A 1SCUA 3I1JA 2VZ0A 3GGGA 2DFDA 4GWKA 2GASA 4AJIA 1JLLA 3WYBA 2HMTA 1H2BA 3ZV5A 4KUHA 1GU7A 2HJSA 1PS9A 1E1KA 4N54A 4QFCA 3T7EA 3W4JA 4YRAA 3EVTA 4TQGA 1RYEA 3ZWMA 4R3WA 1UZNA 2WTBA 5ENDA 2NU9A 1E3EA 2Q1UA 4RPKA 2JFGA 1JWAB 1I3NA 3WX0A 5A9SA 3JD1A 1D4FA 3PHHA 4MO2A 1LI4A 4E6PA 1M6WA 2Y05A 4F6LA 1HEUA 4Z9FA 2DTXA 4HX5A 3K31A 4C7JA 1KEVA 3M6IA 7ADHA 2C54A 1HDZA 3RFXA 4CPDA 1T2AA 2DBZA 3AM4A 4NQZA 1X15A 2O48X 2R00A 4HFJA 1GZ4A 4YAJA 3RASA 2GGSA 3KLPX 5F1KA 2BD0A 1N8KA 2O3JA 3I4FA 3KTDA 1QV7A 3WR5A 4YQYA 4BMVA 1DOHA 1G0OA 4MIOA 3ITKA 5AQ1A 1X1TA 1P0FA 4RV9A 3DQPA 3QW2A 5TLSA 4L0QA 2IXBA 1TA4A 3QLJA 3PJFA 4CLOB 2X0RA 4QQRA 2Q1WA 3U4DA 3LLVA 2X0IA 3WGYA 5CEEA 5AYVA 3DO5A 4IGFA 2ZTUA 3GZNB 3HDJA 1HDYA 1BW9B 4BNXA 1PJLA 5JAMA 1ZUD1 2FZWA 2YJZA 4XQGA 3V1TC 1E92A 1YQXA 4AL4A 5DP2A 5G2OA 3I9NA 5IFLA 4GMFA 5K0ZA 1V35A 4R9RA 2E37A 1GEEA 2HU2A 3GRPA 4DL9A 2D2IA 1KY5A 3AFMA 3ULKA 1ORRA 1F0YA 2NNLD 3BMCA 5EPOA 3RBVA 4FB5A 3H2ZA 2YQ5A 2A92A 1RPNA 4HFNA 2RH4A 4HKTA 1ZK3A 4FDAA 5F3RA 3MJTA 1JKFA 4WLVA 1OC4A 4CMBA 1O0SA 5EIOA 4IBOA 3M1AA 4DVJA 3GDOA 5CDUA 2JAHA 4A5OA 4BNYA 5TRTA 2RHCA 3RQSA 4DQXA 3L4BA 5TT1A 3JYLA 3GEGA 5GZ6A 4MDHA 2HUNA 3OQ6A 5JDCA 3DBHA 2NM0A 4J1TA 4CV3A 1VL6A 1F8GA 1ZK0A 2HMWA 4I08A 3O9ZA 4DRYA 5DNAA 1NR7A 4AJEA 4GKBA 3OETA 3LU1A 5A05A 3FNGA 1EQ2A 4YR9A 1Y6JA 1X0XA 4Q3CA 4GLLA 4W99A 1E3SA 4UAGA 4B4WA 3SC4A 4UVEA 3B6ZA 1PJ2A 3K2EA 3D5TA 5EJ2A 3IKTA 1BHSA 4FC6A 3QWBA 3OH8A 4A7PA 4DQUA 1Y8QB 2JFHA 1NQAO 1S6YA 3HN7A 4RVDA 3MJSA 5G0TA 4DXHA 1E7SA 2X5OA 4KQXA 1CRWG 2X0JA 2C2XA 3AY3A 2B36A 1QKIA 2VYNA 4IJUA 4JXKA 1ZEMA 2A94A 1RKXA 4TKMA 2ZKLA 4TRRA 1WAMA 4NJMA 2HK9A 5A5FA 2CD9A 1ID1A 1KEPA 1JN0A 3ADPA 1LNQA 2B5WA 4U6QA 3OBBA 3PZRA 1UDAA 1W6UA 3V2GA 3D5QA 2X7HA 5KKAA 3S2IA 3OMLA 1C0PA 3WSVA 2NVUA 4XD2A 2O2YA 2QIOA 5TS3A 5IDWA 1BRMA 1E6EA 2IZ0A 1K3TA 4RPJA 1VC2A 2IZ1A 3BMQA 4J43A 2FPGA 4KTVE 3RUIA 2BFMA 4MKZA 4O1MA 4PLGA 1Y81A 4BGIA 3L0DA 1ZEJA 1DFHA 1DSSG 2HSDA 4CODB 4WASA 2GPTA 3IQDB 3JV7A 3C3XA 4CM7A 2CVQA 2P5YA 2PGLA 3CTMA 2X9NA 4Y8VA 2EGHA 2EGGA 2FOIA 3NTQA 4BMNA 1PX0A 2PK3A 2WDZA 3VZQA 3LC2O 1KOLA 1DHTA 4BO0A 1WDKA 1GV0A 3PJEA 3S2GA 5C7LO 2D59A 1U2GA 4XWYA 1DIAA 1R16A 4J7UA 3SJUA 2OUIA 3QSGA 3VPHA 1RYDA 3PQFA 4CMAA 2PA3A 4PG8A 2ZCVA 4D44A 3LQFA 4WLFA 4GLOA 3GHHA 4E3ZA 3COSA 1OMOA 1B3BA 4M87A 2O3TA 1IL0A 3AU8A 4N5LA 1H6BA 4J1SA 4CR8A 2G17A 2P9EA 1IY8A 3AM5A 5JO0A 2CFCA 2Q2WA 1L7DA 4CM4B 4MVJP 1YOVB 4CUZA 5C5IA 1PIWA 4IIVA 3AM3A 4MVJM 1T26A 1ZK1A 3TL3A 3VOSA 1SOWA 5HS4A 2VOEA 3V2UA 4LMPA 4WEOA 1SEVA 4DREA 4CMIA 2B69A 3K92A 3TZKA 3CMMA 2Y66A 3MTGA 3NX4A 2YDYA 5GMOA 3LC7O 1PWXA 3QP9A 3ROKA 1VKOA 2O3QA 3PYMA 3HNPA 1QYXA 3VKUA 4ROSA 3GVPA 1YWGO 4JP3A 5DT9A 4WE3A 4PIVA 4DC0A 2BELA 2UUOA 3WQRA 4OL9A 3T4EA 5A1TA 1HDCA 2QG4A 4IMRA 1DEHA 3CMCO 3H3FA 4FFMA 4KMSA 4F45A 1XR3A 2VZ8A 3ZHBA 4RJTA 2GSDA 2FWMX 1NAIA 4EZBA 4W9NC 3F5QA 4MVJF 3K96A 4KP7A 3ABIA 4FFRA 4J2OA 1X7HA 2NADA 3KYCB 1HF3A 3ONEA 4XKJA 3X2EA 4D0RA 4F3YA 4ZQHA 3RUCA 1BXZA 5JAZA 4OXYA 4IM7A 4Z9XA 4JJGA 5JLAA 4BNGA 3WB9A 4ALNA 1Z7EA 3JQGA 4IJVA 5KWEA 1J49A 1EFLA 3CINA 3RFTA 2WD7B 1D1SA 1Q0QA 3OICA 1O89A 3QE3A 1L7EA 2GN9A 2X9GA 2YHIB 4YAEA 3JQBC 4RORA 4CLXA 4U5QA 4NI5A 2W98A 4OOFA 3ZWBA 4PG6A 5KVVA 4EEZA 2PD3A 3HFGA 4YAGA 1V3VA 3OJFA 3PHLA 3FWNA 3GZNA 3RKUA 4XQEA 4B7UA 5JNLA 1ZMOA 2P5UA 4UUMA 4OJNA 5L4SA 1X7DA 3AY6A 1N92A 1QYDA 3K73O 4QXMA 1B3RA 4ZRMA 5EERA 4EJ0A 5I7FA 2OOSA 5JC1A 3IJRA 4CUKA 6ADHA 4XR4A 3JYPA 3JQAB 2J3IA 2P68A 2Y68A 4CV1A 5JYDA 1D1TA 4JROA 3WGZA 3ZWAA 4B3JA 2E82A 3FNFA 3KSZO 3ZH2A 3ZU4A 1QLJA 2Y93A 1Y1PA 4DYVA 3AJRA 5DP1A 3MEQA 5L9AA 1ZK4A 1ADGA 3DOOA 5DCYA 3IC5A 1XU7A 2EKQA 3PFWO 5TNXA 3KRTA 4BKRA 2VUSA 1NVGA 1JAXA 2CDAA 4AJNA 1TLTA 4KQWA 1QG6A 4MKRA 3GEDA 1P1JA 3WICA 2GZ2A 2PR2A 2Q2VA 4A27A 4AJ2A 5BNFA 5T8KC 1HE3A 1WPQA 1R4NB 3FHLA 4O6VA 1B7GO 1OC2A 3E18A 2DPGA 4BHTA 1C1XA 3CSDA 1LLDA 4JK3A 4O0LA 4DQVA 1G0NA 1GEGA 4KUEA 4BO2A 1SPXA 4Y6RA 3PTZA 5COBA 3JTMA 4HFMA 1NVTA 2GYYA 2ZYGA 4J3FA 3ZWNA 4TSKA 4WOKA 3GUYA 4II3A 4WKGA 3GZ4A 3DMYA 3GG9A 1NASA 1BXGB 4GI2A 1ULSA 2CMDA 4KWIA 4NPCA 4OSPA 4U6SA 3W4IA 1DRVA 2X23A 4IDCA 1VL8A 4IY1A 2OL4A 3DDNA 1IUKA 1X1EA 3NDIA 4OH1A 4QECA 3TZCA 4J4BA 1WWKA 3WBFA 4EBFA 1AGNA 4UUOA 3JQAD 5IZCA 3VVCA 1WW8A 4BKQA 4CLDA 2HK8A 1W73A 3MJEA 1PQUA 3UAGA 1KERA 2EHDA 5KTKA 2FSVA 2WYVA 3BTVA 1C3VA 1GCUA 5A9TA 2EWMA 1HDXA 2HCTA 5G0VA 2JAPA 4Z3DA 5CDYA 4BV8A 4R5HA 4YJFB 3HWRA 1GPJA 1UXHA 2BFAA 3GGPA 3S55A 1SMKA 1FK8A 1GFSA 1MGOA 2QZ9A 3PIIA 5I9MA 3E9MA 4ILKA 4IDEA 2ZCUA 1G1AA 1C14A 1ENYA 1JW9B 1JKJA 1KVUA 4I9NA 4X54A 5ILOA 1R4MB 3ICCA 4LRTB 3OIGA 8ADHA 3D7LA 4BNLA 4XJTA 4YTEA 3DOJA 4J9UE 3ZWWA 1BSVA 5CEFA 4WLOA 5IDQA 3HDHA 4MVJI 2AG8A 3KLMX 5BQFA 2G0TA 1EZ4A 4XGKA 2ZTVA 1FXSA 2X5KO 3I9JA 3TFQA 4H15A 3DZBA 1M67A 4XDYA 4ID9A 4GX1A 3PDJA 3NGLA 3AOGA 1ONOA 4D3SA 3UXYA 1DBVO 3W4KA 4M89A 4ZA2A 4FJ1A 3IKVA 4BUCA 2CDBA 3SX2A 1JTVA 1Q1NA 1TVEA 2GN8A 2X4GA 3Q11A 3GNSA 4U0KA 1DIHA 3HFSA 3MJVA 4A0SA 3DTYA 1QV6A 2VHXA 5AXCA 5F21A 4J91A 1HWYA 3VTFA 2E49A 4OQZA 3RUHA 1JA9A 4OO3A 3RROA 3JQ8B 4CQMB 3N74A 1YQDA 2NVWA 3KZVA 3ASVA 4DLLA 3OSUA 3ST7A 3F1KA 1U3TA 3DBLB 4P22A 3H7AA 1EUZA 2A4KA 4MOWA 3C1TA 2B4RO 1U7HA 4D7AA 1LSOA 4H7PA 1A72A 2AMFA 4RZIA 3UHAA 1IULA 3NYWA 3BHMA 2AEFA 3HDYA 3GT0A 5A3VA 5IXSA 1K6IA 4ZRNA 4BS9A 1NPYA 3JD0A 5GY7A 4ALKA 4MINA 1YDWA 4O63O 4UVGA 1U28A 2VT2A 3JQEA 5LDGA 1LLCA 2GLXA 3SLKA 3RJ9A 4IJKA 3PWZA 5CDGA 1WDLA 2CVOA 2C29D 3WNQA 3KEQA 3D4OA 4EJMA 1DFIA 1I2BA 1LRKA 4E5MA 2X22A 1LQUA 1Q0HA 5AXBA 2B37A 2V7PA 4W6ZA 1VSUA 4B4VA 2X8LA 5L3ZA 2JCVA 1U5CA 1E6WA 4RF4A 1NXQA 2VTDA 4W4TA 5JDIA 3H3JA 5K9ZA 1IZ9A 4DPLA 1YJQA 3TZ6A 3JQCA 5I9NA 2W2LA 3HB5X 3C24A 4K6CA 5DBFA 1VJ1A 1BMDA 3O8QB 1IB6A 3DBVO 3ROQA 4AJ4A 1YB1A 4BO9A 1H6DA 4CQMD 1E1NA 1KC1A 3JD2A 3BZUA 1K6XA 4FCCA 1EEHA 3P2YA 4BKUA 2EERA 3K8ZA 2BGMA 3TJRA 3GK3A 5JCXA 2P91A 2VOJA 4EGFA 3ZU5A 3V2HA 1GADO 4RF5A 1KVTA 2QRLA 1KC3A 2BRUA 3EY4A 3QVWA 2W90A 3OIDA 2Y1FA 5DF1A 2V6GA 2V6FA 3B1JA 1E3WB 1I10A 4CLRA 5I7SA 4U8GA 3DL2A 3WTCA 2QRKA 3U5TA 4RCVA 3ZHZA 3PFFA 4D46A 4EI2A 4RPHA 5JC8A 5CEJA 3STHA 3U09A 2HDHA 5CP8A 2UUPA 5JY1A 5TF4A 3AOEC 3PVZA 1V6AA 3EW7A 3I9KA 1F17A 4HNHA 1SOVA 3GMSA 2C2YA 5KJ1A 4Y98A 4JGBA 2AE2A 4L4RA 2HMSA 4O5OA 3QJ5A 4CM8B 4IDFA 1F8FA 2HK7A 4IDDA 1XCBA 2WSBA 1C0IA 2WM3A 3CH6A 5JPIA 1P77A 3UW3A 4TZTA 1DAPA 2AW5A 4PZDA 1PGJA 4UEJA 4ONEA 3H9EO 3P7MA 4EUEA 3JQFC 2WYUA 3DZIA 1HTBA 4E2YA 5LC1A 3QWFA 4PFJA 3W1VA 3NT2A 3EMKA 1T24A 5TJ9A 4LVCA 1WDMA 3DOCA 2DTEA 3AWDA 2NLOA 4NU6A 2I6TA 3WQQA 1XQ1A 3CE6A 1EVZA 4AFNA 4FFNA 4BNIA 3JQ7B 1H93A 3G1UA 4YCAA 2B83A 4HADA 3SLGA 1DO8A 3UUWA 3RBZA 1ADCA 1SBYA 3WLFA 3KV3O 5F5LA 3A28A 4NK4A 3TZHA 2Q3EA 1NAHA 4DIFA 4NK5A 3QWIA 2PGJA 2J3JA 2VQ3A 4P8RA 5L95A 1FF9A 5EMHA 4YJGB 3X2FA 1A5ZA 1NHWA 1R37A 3BYZA 1E7WA 3G79A 3PRJA 4KDFA 5CG2A 3SVTA 2BMAA 4LK3A 4DPKA 2YZ7A 3DHYA 4YB8A 3S8MA 1DFGA 1P9LA 2RCYA 4XYGA 3ENKA 1KY4A 4E21A 3H9GA 5G0WA 4BMSA 1E5LA 2PD6A 2VRCD 4JBGA 4JN6B 4CMEA 1N9GA 3INTA 1JVSA 5JXWA 2VTEA 1HYEA 1LC3A 2IXAA 2CDCA 4FSHA 5FYDA 3VZSA 1T2EA 2Q46A 3IOYA 4YEDA 4C4OA 5AOVA 2WMDA 1A7KA 3HZZA 3NRCA 5KKCA 4NMHA 1UXIA 2NTVA 3VC7A 1U5AA 3H2SA 1VPDA 2CF6A 1SEPA 2H1SA 1A9ZA 1ZIDA 5L53A 3QIVA 4OQYA 1ZCJA 3C7AA 2AEMA 1FMCA 1MFPA 2WD8A 3MCVA 3FCOA 1G6KA 3JQ9A 5L4NA 1U4SA 4R5MA 3KYDB 1UP7A 1EE9A 4MIEA 5L40A 1O8CA 4RF3A 4DC1A 5IG2A 3D3WB 4D3FA 2PZMA 5CHEA 1BGVA 1HLDA 1IHYA 3RC2A 1DPGA 1VJ0A 1DC5A 2CUKA 2O3RA 4RVHA 4XIJA 4EJ6A 4E5PA 1LUAA 2GF2A 2QRJA 2UYYA 3PGXA 3B1FA 1YL5A 1N5DA 4K28A 4FC7A 1EMDA 3Q3CA 1A71A 3AI3A 1GY8A 1GQYA 4D42A 2Y67A 4NDNE 5FI5A 3IS3A 4DMLA 3AY7A 1HLPA 5JCJA 2NWQA 2B4QA 2EIHA 1KVRA 1E5QA 3HDQA 2WE7A 4Y9DA 3HQ4O 1ISIA 4IXWA 1ZVMA 5BT9A 4CUJA 5F1OA 4KTTE 1NTOA 1RM0A 2AHRA 2VYVA 2QHXA 8LDHA 3RC1A 3LVFO 1XKQA 2YQ4A 4JNKA 1YO6A 1DDOA 1UP4A 3KEOA 1ONNA 4A03A 2FZEA 3CZRA 1LDNA 3FF4A 3JQ8A 4J6FA 3DZKA 1K2WA 5IAAA 4Y6PA 5T64A 4I8XA 4R69A 1K0UA 2J5QA 4YACA 1MX3A 4Y6SA 2R00C 2FN7A 4FPXA 4J2HA 2WJPA 3SJ7A 4QUKA 4D41A 1ZFNA 2B5VA 3H5RA 4UEOA 4FIZA 1WMAA 1R12A 1OZAA 4JJFA 4CR7A 1IPEA 4XGNA 2PKQP 4BKPA 4CMCA 2ZATA 3WGQA 2YW9A 4JBIA 4YXFA 3ASUA 3IAHA 4PZCA 3R3SA 4WCDA 4CMJA 3TQHA 1LLQA 3BMNB 5U9CA 1H9BA 1GQQA 1TEHA 3RU7A 3F6YA 4OSOA 4EW6A 4GX2A 2CF5A 1SO8A 1XIVA 4XRRA 3VHRA 2DUUA 1J4AA 4GVLA 4AG3A 1QYWA 4WEQA 2XAAA 4Z0HO 2W4QA 2GUGA 1Y8RB 4FN4A 4DBZA 4R9SA 5ER9A 1ADFA 3GAFA 4BB5A 4P4GA 4BVAA 3BAZA 3FNHA 1ADBA 2FR0A 1E3JA 3OA2A 1PQPA 3ROMA 5A5EA 3R3JA 4MVJD 1TXGA 3DHNA 3ZU2A 2I67A 2OFPA 1WZIA 4CLEA 1E3LA 3QY9A 3IMFA 2ZJ0A 4J4HA 4K6FA 4BKOA 1ZJYA 4E0BA 4E12A 4AICA 1M76A 3UOGA 3L4BC 3PQDA 4IUYA 4W7IA 4DWVA 2AQKA 1GD1O 2C20A 5JAQA 3GPDG 4K9DA 3WGGA 2C7GA 2X6TA 3PHGA 3ZNNA 4Z0PA 1ZSYA 4JCOA 3TNLA 1OOEA 1NBOA 3AFNA 4WCFA 4ZQGA 2H6EA 3RJ5A 1CEQA 1EVIA 2O23A 3O38A 3JYNA 3TRIA 1VRWA 1U8FO 3EUWA 1E6UA 3F46A 3P2OA 3WGIA 4GSLA 5JMPA 4GSKA 4MPDA 2B4TO 1QP8A 2QZZA 5L7TA 5G4KB 4GPD1 1VJTA 3Q1LA 3R1IA 4EUHA 1ZXLA 1OI7A 1Q7GA 3U3XA 4CQLA 1CWUA 4M8SA 4UVDA 5EQFA 3JQ6A 4C7KA 1GYQA 1P1HA 1QLHA 1UXJA 2VWPA 1YQGA 3EHEA 2YV3A 3Q2KA 1QYVA 1D3AA 2OGUA 2VCYA 1YGYA 2Y0CA 3ANNA 1GV1A 1LDBA 2EXXA 4E4YA 1KBZA 1M66A 1NQTA 3ENNA 1MLDA 3D4NA 4BO8A 3C1OA 2DQ4A 3E5MA 4CM9D 2O3SA 3PEFA 2JFFA 2PLAA 4BNTA 2R2GA 1A27A 2VT3A 3QVXA 4CM6A 4OKNA 1CJCA 4NNJA 3IP1A 3U49A 3CXRA 4NU5A 1T1SA 4BNHA 3NKLA 3WGHA 1KEWA 2QX7A 3KYBA 3DBRA 2GCGA 2W2KB 3N7UA 4ND4A 2V6BA 3RI3A 2C5AA 3WJ7A 5TIIA 4PGFA 2ZYAA 3Q6IA 4Q3BA 4XJSA 1T4BA 3JQBA 3ZW9A 1NPTO 4FS3A 4BO7A 1HYGA 1NWHA 4FQ8A 1B15A 1U2DA 2ILTA 3VDRA 1XU9A 2X5JO 3ZI0A 2G76A 4YA6A 4BO5A 4N18A 2C5EA 1PR3A 3F4BA 4J7XA 5KJCA 4F6CA 1NFRA 3EZYA 1DAOA 4BNZA 4DTIA 3GMDA 1UDCA 1RJWA 4U7WA 1O5IA 2NU7A 1ZXBA 1H0KA 1R0SA 5DOZA 2CSUA 4M49A 4RQUA 1BDBA 3WGOA 1ZH8A 2I76A 4LCJA 3I6QA 4PVCA 4FD3A 5DBGA 2NACA 4IDBA 3W8FA 3F5SA 3RC7A 3ZNQA 4S3MA 2P2SA 1MG0A 3BTOA 1ULUA 3KB6A 2YFHA 4D3DA 1AE1A 5J23A 3I83A 1PL6A 3HN2A 2I65A 1DC4A 4R1NA 2JD1A 5EN4A 4TROA 2I66A 3INGA 4YT2A 2I3AA 4IINA 1LU9A 2J6IA 2POQX 4I9UA 4JQCA 3MJCA 4XCVA 4BB6A 3EK2A 1H6CA 3GVHA 3DAFA 2DU8A 3MOIA 3WLEA 4E31A 1NX6A 5L7YA 3C1AA 2AQ8A 3AI2A 1BG6A 1XA0A 4MIYA 2H9IA 2Z5LA 1Q2XA 1YS4A 5JYEA 3IP3A 3GQVA 4CLOA 1P1KA 1R6DA 1TT5B 3AUUA 3DONA 5KJ6A 3PDUA 2D1YA 4YJHB 2HRZA 4KZPA 4OIMA 1BW9A 4J0EA 3NEPX 2J5RA 3DZHA 4PLWA 1HT0A 4CJXA 1CYDA 1HXHA 1YH3A 5I9LA 5JAIA 2ZB7A 4PLHA 1T2DA 3WIDA 1KEUA 3E6AA 4FFPA 3WMWA 2R6JA 1P33A 3PYLA 4GGOA 2Y1OA 2OMEA 2HMVA 3TOXA 3DFZA 1EBUA 3F4LA 1FDWA 3JD4A 4R51A 3RUEA 3L9WA 3BXXA 4P38A 3GA0A 1HSOA 3AW9A 5KVSA 1YL7A 1O6ZA 4MJLA 3FSRA 3MWDB 1C1DB 1N1GA 1PGNA 4YRDA 2VHVA 2VUTA 3O4RA 3ICPA 5ER6A 3ZV4A 3PYXA 2D5CA 5JY6A 2EP7A 2HLPA 1C0KA 3UCEA 4PCVA 4M1QA 2JHFA 4MVJH 1I33A 2EEZA 1NM5A 1WP4A 2PTGA 5B1YA 3VZPA 3PJGA 3SBOA 3WYCA 3JYQA 2AG5A 2E48A 2PFGA 5L4LA 3IL2A 1GUZA 4UREA 3HUDA 3NT5A 1UDBA 5AXAA 2X0NA 3G17A 4AJPA 5FWNA 1HDRA 2HJRA 5TT0A 1W0CA 2HRBA 4E2WA 3ON5A 9LDTA 1EDZA 4HXYA 4XYEA 3KO8A 4WECA 1HZJA 4QO7A 1R66A 4DIOA 3TDKA 4DA9A 1HE2A 5JMWA 1Y8QA 2J8ZA 3BMOB 3PK0A 2HKIA 4EYEA 1GYRA 5FF9A 1YL6A 1DXYA 2NQTA 3W8EA 1I36A 3VPGA 5KNLA 4B7CA 2H5LA 4A26A 3ZWOA 1LEHA 1WLYA 2PH5A 1CIVA 1RM3A 4R1UA 2IE0A 4BO1A 1ISGA 4H16A 3E8XA 1JWBB 1WVGA 5TSDA 5T5QA 5ICSA 1PZFA 1PR9A 3TWOA 2EKLA 4RPGA 1PGPA 1Y8RA 4CM9A 5B12A 2DM6A 4PLFA 2PY6A 5A9SB 3G0OA 3KETA 2ZQZA 1O94A 1M2WA 5I8WA 5CG1A 3ANLA 1U7TA 1EK6A 3UN1A 3UICA 5HRUA 5IDYA 4XEHA 4AJLA 3KBOA 1HRDA 1GZ3A 4II2A 2DUWA 2O4UX 1ISMA 3GNTA 4BO4A 4YWJA 5B4TA 2Q4EA 4WOJA 3RCBA 4R41A 2DBQA 1GDHA 1LSJA 4R1SA 1W8DA 1QR6A 5L51A 2X86A 4L76A 3TOZA 3GG2A 3K6JA 4NZ9A 1PJSA 2DFVA 4TVBA 1FJHA 1QORA 5TGDA 1W4ZA 2I3GA 4BO3A 1DIGA 5B4VA 2G82A 3H65A 4ZQEA 5IN5A 3PXXA 3F1LA 3GPIA 3RWBA 1LJ8A 4QT0A 4J0FA 4N5MA 1BVUA 2V65A 1T1RA 4GMGA 4XYMA 2EP5A 3H4VA 3N58A 1NFQA 3QWAA 4YJDA 5THKA 1QYCA 1LRLA 1PS8A 4UUPA 5A3JA 2D5AA 4FJ2A 5BSFA 3Q9NA 4B3IA 1P1FA 4ALIA 3BMCB 4CM4A 2JCXA 3LDHA 4LMRA 4PZEA 5TC4A 5ADHA 1YOVA 4PG4A 4ALLA 1B8PA 2AQIA 1PSDA 5HS6A 4PLPA 1UAYA 5ITWA 5IZCC 4CM1A 4XB1A 4QFDA 2ZB8A 3UKOA 2IYPA 2FPIA 4E2XA 3BIOA 1UUFA 4A10A 3G49A 3Q9UA 1OFGA 1ML3A 4WPGA 5KJEA 2SCUA 2Z1NA 5H83A 1R0LA 4FGSA 1D7OA 3DMTA 3GGOA 5L45A 3VPXA 3DBHB 4GQAA 4DUPA 3NT4A 3R6DA 1XLTA 5I7VA 3WYEA 2X9VA 3DZFA 3UGKA 4CLHA 5HWSA 2EJVA 2D4AA 2C07A 5JBIA 4I5FA 1UJMA 4I5GA 1I30A 1SC6A 3C8MA 3EC7A 2F00A 3GDGA 4G65A 4NFHA 2HO5A 4L8VA 1YRLA 3ZU3A 1CETA 1KVSA 2OO5A 3L6OO 3WWZA 4DBVO 4DLAA 5BSGA 3EYWA 4OXKA 3I9MA 3M1LA 1H9AA 1NPDA 4L9RA 2Z95A 4BV9A 5ES3A 3U62A 1ZMTA 5DCUA 4RDIA 2RAFA 5MDHA 1PZEA 1QMGA 1V8BA 3PJDA 1X14A 2F1KA 1P45A 2I99A 3DHEA 1XHLA 3K9QO 3FWZA 3KYCA 3QHAA 1T4DA 4L4SA 4KDEA 1DIBA 3ONFA 5A4DA 3IUSA 4Q3NA 3RKRA 4NJMB 1KVQA 3I5MA 4QX6A 2ZB3A 4BNKA 4IQ0A 3WNVA 2WD7A 1TB4A 1SNYA 2RBEA 2YUTA 4JIGA 1VSVA 2P4QA 4OGWA 4LSWA 2NVUB 4Z3KA 4LCEA 1Q7BA 2YHIA 3TFOA 1JKIA 3LC1O 4RGBA 4I9HA 3BMQB 1B16A 3WQSB 4P4NA 4TRNA 3VDQA 5BNTA 1TT5A 1AHHA 2EG9A 2BLLA 4JLWA 5A03A 1YONA 2FMUA 1PS0A 2FY8A 4HBGA 1M75A 4B4OA 1AHIA 1YE3A 4GVXA 2BI8A 3PLRA 2B0JA 1PL8A 4GX5A 3UFXA 4E33A 2ZYDA 4XA8A 5AXDA 5K6AC 1GPDG 3UVEA 1MA0A 2YHUA 3PGJA 4AJHA 4AJKA 4B8WA 3VVBA 2VWQA 3LF2A 3MJ4A 1XELA 3FNEA 4PLCA 4PLVA 3ZDFA 4WLEA 3O03A 3JQAA 1FDUA 1RM5A 2YDXA 1SZJG 1NR1A 4ND5A 5BR7A 3NJ8A 3FR7A 5KVQA 4OAQA 1PGQA 4R4JA 3CEAA 3HG7A 3V1YA 1NYTA 3M2PA 3F3SA 5T67A 5G4LA 4B79A 1BTOA 1LDMA 1A4UA 4E30A 3VKVA 3QRWA 1ZK2A 2BI7A 3BHIA 6LDHA 3ZHXA 1YJ8A 4IDGA 4U0JA 4URFA 2IODA 3OA0A 3OEWA 1M6HA 2VYND 3P5SA 3TL2A 3TPCA 1GTMA 1HZZA 1UXKA 1T2FA 1LLUA 3ROPA 3WOHA 4NR0A 2DC1A 3OF2A 1N2SA 3M2TA 4XYBA 1F06A 7MDHA 4YT8A 3U4IA 1B8UA 2VWGA 3JCZA 2IEDA 2RHRA 1VM6A 1FDVA 3JSAA 4WGGA 1R4NA 4ND1A 3TN7A 3ZNPA 1FDSA 1LQTA 1WXDA 3AI1A 2PZKA 1I01A 3O26A 1B0AA 4LW8A 4O59O 5F1PA 2X1HA 1MC4A 1PTJA 3NTRA 4QEDA 3DWFA 3WTBA 4YAIA 1QXSA 3U4CA 4J49A 2YFQA 4CMIB 1JAYA 5H81A 1BVRA 5TQVA 3JYOA 4BNNA 3VTZA 4QTZA 4M55A 3RBXA 5HTOA 4YRBA 3V5NA 3BMOA 1J6UA 1HE4A 3ONDA 5DBIA 4Q3AA 3ZHYA 2OXIA 3WFIA 1BXGA 1LX6A 3W6ZA 1CERA 1H2HA 1PEDA 1ZBQA 2FRDA 5HM8A 1N1EA 4YPOA 3HB4X 1HETA 1IYZA 3Q2IA 4BIIA 3DR3A 4IJWA 3OP4A 2HQ1A 1HL3A 2GO1A 3WXBA 3L9XA 1NQ5A 5IN4A 1CQJA 1O9BA 5DOVA 1Y7TA 3L77A 1DLJA 1MP0A 2LDBA 3F47A 3LT4A 3WIEA 4CV0A 4IIUA 1PQWA 4IDAA 5BSHA 2BGLA 4DPMA 2DAPA 3K5PA 3BTSA 1T2CA 4YJFA 1EFKA 1ENOA 3KHUA 3T7CA 5DCWA 2QYSA 3OJLA 2YV1A 4ESOA 3ZV3A 3RSHA 4FJ0A 1YBVA 2OP1A 2ZQYA 5KIAA 1I3LA 4XQCA 3S2FA 2WE8A 4PLZA 1U9JA 4HP8A 3JQGB 1KS9A 4IQ8A 5JSFA 3MOGA 3AUAA 4FBGA 1PGOA 1R4MA 3DXFA 1LXCA 2NSDA 1ISHA 2NQ8A 1ZKMA 3EZLA 4ITUA 1PJCA 1U3VA 2X58A 1LBEA 4DIBA 4GL4A 1VE9A 5TX7A 3WMXA 3H9JA 3IIEA 4Y67A 1XGKA 5LCXA 2Q4BA 4RLSA 1NQOA 4OHUA 1B8VA 3HJAA 5A9RA 1I24A 2AA3A 1AN9A 1XQ6A 4E2ZA 3TF5A 4L4XA 2JD0A 4RPLA 5HA5A 5ILGA 3F9IA 2C7VA 5JE8A 4NJOA 1JU9A 2NVBA 5COAA 2EKPA 1NP3A 1GYPA 4CL3A 4L75A 5G0SA 1YB4A 5I7EA 2EJWA 3DAGA 3K30A 4BGVA 4BQRA 2AQHA 3AU9A 1LDYA 4YDRA 1Z7BA 1DJNA 2XXJA 5B4UA 4B8ZA 1NNUA 4CQMA 3A4VA 1EE2A 1AXEA 4A73A 1QSGA 5FFFA 4CMEC 3GOHA 4PLTA 4WLUA 3DBLA 3I6IA 2Y0DA 1MXHA 4LSMA 4LVUA 3D64A 3WS7A 2XF8A 1I3MA 3E82A 4ZD6A 3NAQA 5GZ1A 2TMGA 2OHXA 3D4PA 3W6UA 1CQIA 2QYTA 4XIYA 2GD1O 5KJFA 4BNUA 3FTNA 2NTJA 4GBJA 4QSMA 1XG5A 5DZSA 1LC0A 2VNSA 4E5NA 3JQ9C 1PJTA 3PHJA 4L74A 1C1XB 4NFSA 1BDMA 1LSUA 2PGDA 4F46A 1U1IA 4IZIA 2B35A 1VI2A 1GAEO 3QVTA 4UVIA 4BQPA 1E7RA 3ETDA 5DN9A 4BNVA 4Z6KA 1EVJA 1Y5RA 2JHGA 3E5RA 4MP6A 4I1IA 4PG7A 4N5NA 4E5KA 3LT0A 4FW8A 4NHEA 1OBFO 1PZGA 4NG5A 3A1NA 1XDWA 1Z73A 3FBGA 3OJ0A 1U3WA 1E7QA 3DFUA 4Q3DA 2TMDA 2WYWA 5H82A 2GR9A 3FTPA 5T57A 3FPLA 1AUPA 4W7HA 3BHJA 2FP4A 3CZMA 5IXYA 2E6UX 4UEKA 2ET6A 3KM0A 2JKVA 3V1UA 1Z45A 3O8QA 4E32A 2PWZA 1AXGA 1MXFA 1P3DA 3GEMA 1MUUA 1ZJZA 1A9YA 1CDOA 1Z75A 3KSUA 3ZZNA 5JDCC 2O2SA 3V8BA 9LDBA 3E48A 1S7CA 3ZCXA 3KVOA 1MG5A 5AVOA 3LLSA 5THQA 4ZICA 4XR9A 1UZLA 2PV7A 4J9VA 1E3WA 2VWHA 2OORA 4JJIA 4LISA 2Y1GA 4FOSA 4AJ1A 4B3HA 4S1VA 4BOYA 1Z74A 4HY3A 5HBRA 4JP2A 1GUFA 3JD3A 3DAPA 3VH4A 1DRUA 4Q3EA 3CUKA 4W9NA 2Q1TA 2VRCA 2DBRA 3LZ6A 2Q50A 3DC2A 3RUAA 3AK4A 2XPCA 3ZWYA 5FEUA 2ZTMA 1EUCA 5EESA 2DT5A 4RQTA 1MB4A 2RIRA 4ZN6A 3GHYA 1QRRA 3GC6A 5TJHA 4NBWA 4CM8A 1GCOA 3G1TA 5CAEA 2Q1SA 2VRBA 3T4XA 4PRLA 4WNCA 4RZHA 4ND2A 4XB2A 2EW2A 2IEBA 2J3HA 3G3EA 3QA9A 1H5QA 4FFLA 4TKLA 4J7CA 1DB3A 4N7RA 1P44A 4B4UA 3QVOA 4XZ3A 4XYLA 1Z6ZA 4Z9YA 2AE1A 2ZIZA 3IJPA 2QQ5A 3NTOA 1MFZA 3I9OA 3I9LA 1C0LA 5DULA 2QW8A 4EDFA 3VZRA 1HSZA 1PU2A 4GGPA 3GFGA 2OBNA 2DBVO 2BHLA 4KWHA 3OFSA 1PWZA 1BWSA 3C7DB 2GNAA 3FRJA 3JQ7A 3D1LA 2C59A 5I8ZA 5EQDA 2ZK7A 3RUFA 1VKNA 1Y5MA 1PJQA 1PL7A 1N7GA 4ZQFA 1I0ZA 5KVCA 3DEYX 3RAJA 4RVUA 4NIMA 3EAGA 3ZWVA 1F12A 3GY0A 3ZWXA 4YJGA 2W8ZA 2BGKA 4MVJE 4HFRA 3LT1A 4NBUA 4TMFA 1XSEA 5G0UA 1V3TA 3GF4A 5BSEA 1B14A 4J90A 4WCFC 2H63A 3PWKA 5B37A 4BGUA 5ITVA 4KUGA 3GN2A 2E4AA 1DHRA 1EQUA 1P1RA 1UXGA 3HSKA 4RVGA 5EINA 4DMMA 4EITA 5IF3A 4CL8A 1E0DA 1E77A 1MC5A 3H9QA 4YBZA 3RFVA 4ALJA 1DLIA 3GVXA 2EW8A 2PZLA 1U4OA 1PJ4A 2Y0EA 3PPIA 1CF2O 2I9PA 3H6KA 1LRJA 3PLNA 1D8AA 2JL1A 1TT7A 2FR8A 5GZ3A 4RDHA 3ETGA 1E1MA 4YVFA 4IMPA 2O3UA 1KYQA 2CY0A 4TVOA 4AJJA 1IPFA 2Q45A 5C3MA 1GL3A 4PN3A 5T8KA 1YXMA 5ICMA 3INRA 1WNTA 3KYDA 3TSCA 4IPTA 2OZPA 3D3WA 3EVNA 4AJOA 3NDRA 4WLNA 3ORFA 3W8DA 3A14A 3OM9A 1GQ2A 3GNQA 3DZJA 4BNFA 3GVCA 3DTTA 2UV8A 3ZV6A 1R0KA 1ZSVA 3QQPA 4P4LA 4MVJG 2AXQA 2J3KA 3GRKA 3VPFA 1YVEI 1HE5A 1UAGA 4R16A 1JVBA 3KSDO 1IHXA 1ZNQO 4OXNA 1Z82A 2CZCA 1I2CA 1HKUA 3MWEB 3OJEA 4NBVA 3FR8A 4NFYA 1HYHA 4CMHA 2WEKA 1ZW1A 4OM8A 4CLRB 2UDPA 4UULA 3NV9A 1LTHR 1I2ZA 1DC3A 1LDEA 4MVJA 5JW6A 1I32A 4MP3A 1K5HA 4HWKA 2I5PO 3LSYA 1UP6A 4OMUA 4HV4A 4WJZA 2LDXA 4XQ9A 2ZB4A 2VN8A 1X0VA 1ENZA 1BXKA 1RM4A 3K2BA 2IDZA 4BNWA 5A02A 1YKFA 1HDOA 4D79A 3FN4A 1EDOA 3SEFA 3VH1A 3KXDA 2XXBA 1P0CA 2NUAA 4M54A 3S1LA
chains in the Genus database with same CATH superfamily
4KPGA 3BMXA 2WFZA 2G6BA 3CKYA 3FI9A 1P31A 3HLTA 4HAIA 1GNLA 1GPUA 2Y1EA 3EB9A 1PJBA 4WK6A 4AKSA 4TLCA 4H7DA 1FNCA 4JYCA 3FCYA 1DRWA 2A9QA 3NI2A 3PT5A 3CQ9A 4FM9A 4WSOA 3OKFA 2DKNA 3H2JA 4IZHA 1IE3A 3BMNA 3HEBA 4IS2A 3E7FA 2V98A 2X42A 2Y1DA 4Q4DA 4BC1A 3ZI7A 3BDAA 4RKEA 1D6NA 4MUJA 4F2WA 1OA1A 5AJYA 1GAXA 5AKEA 1XXLA 1KORA 1Z0JA 2PTHA 3ADKA 3G8CA 4RVFA 3VV3A 4JI4B 1W19A 1WZEA 4QULA 5H3CA 4YRGA 5TPWB 2JLZA 1BGXT 4MRRA 4UBMA 4DIEA 5AW4A 1XE3A 2BH9A 4X45A 1D5WA 2D7CA 1Q7CA 3UTDA 1GPKA 2VK1A 4U2CA 2IPMA 5EL0A 3MD9A 2ZT5A 2OKGA 1S8AA 2UUCB 4L4YA 3R75A 3TYXA 2GDZA 2E18A 1HQYE 5H3LA 4ZV4A 3KTOA 2CSXA 1FBNA 2XNCA 3OZBA 5IASA 1NHGA 4JYZA 1NQWA 4G0ZA 3WSWA 5HPYB 1CY2A 2AYZA 2B8TA 4LN1A 2NO6A 4P3NA 3DHWC 1LBIA 5DSXA 3LK7A 1QONA 1OYYA 2PZJA 4B9EA 2Y99A 3VH3A 3OKPA 4NDAA 4EUKA 3KZKA 2Z6QA 3VAYA 3T3EA 2BCGY 5FWYA 3ZDEA 4MUXA 4MRMB 5LQDA 1NVMB 4BVBA 5EUCA 1PG5A 3EH1A 3EWAA 4X93A 5GM2A 5AOAA 3PQ2A 4EAAA 5C7IO 1EBFA 5ARBA 1EYZA 4YR7A 3LYLA 5KYVA 5IUJC 1PR2A 2EX0A 4NAUA 3VPSA 2XBUA 5HJ5A 5JJ5A 1RAAA 2F3SA 2ZRMA 4MZXA 5CM2Z 3UF0A 3FUXA 4AXBA 3VNBA 2XKJE 4FCWA 3V7YA 1RWBA 1MDFA 2JB9A 2X0FA 1RMYA 4HG2A 3NPAA 1IXSB 4UBLA 1O96B 3HP7A 4KQIA 2GN4A 1KHHA 5C18A 3E03A 3T3DA 1E7MA 2PZFA 2QMOA 1GGEA 5EI5A 2C5HA 2WAMA 1M2GA 1XNQB 4UFOA 1UR5A 5KYUA 1XAGA 5CLLA 5A0TA 1FMTA 1YR3A 5COQA 5C7OO 3IDQA 2YYYA 3GL9A 3DB2A 1GITA 1US8A 3UCXA 4EHDA 3KC2A 3DR5A 4H3VA 3A06A 5GADl 2XNKA 1X8XA 1G2QA 3VDMA 5K03A 4HDQB 2D2XA 3BKWA 4JSTA 5CDTA 1AQJA 5E1OA 1GTJ1 3PKJA 3C85A 2PT7A 2EX1A 2AG0A 4CEJA 2FK7A 4YT4A 5D87A 4XUDA 2JD2A 3QA3E 1LPPA 5EE0A 2QGFA 2WKWA 4DCGA 2DJ5A 4JVNA 2F62A 2QI9F 3BN3A 3KOUA 5TXGA 2XT9A 5KWSA 1JQLB 1NF9A 4HN2A 1BHQ1 5LZ7A 2ZJ1A 4FHGA 3STTA 1Y6GA 4DYDA 4AZVA 2PVPA 3UANA 4F2GA 3I23A 1A9QA 2NTEA 2OQIA 1KH2A 3ZE8A 1GNVA 3C7CB 4B4DA 1QVVA 1DJQA 4IILA 2ZIXA 4PRKA 2HTFA 3RF7A 4F3KA 5IDXA 1J5PA 1TA9A 4H08A 4RMHA 4WUTA 5DISB 1NBAA 1M8JA 3SY8A 4IOMA 1K5GA 1X8JA 3GFBA 4ZXFA 4A16A 1Y3FE 2OA0A 4JXXA 4XLTA 1N7HA 4K9KA 2Y1WA 4OA8A 2P2ZA 3H5IA 4XX0A 2W83A 4TRJA 3STUA 2JLXA 1XQYA 3L8ZA 5MHTA 2P2GA 1HL7A 2GPBA 1WP9A 3UY4A 4Q1VA 2DEUA 3AXSA 4B3TB 3ZWCA 3RVDA 3TQTA 1R8JA 1FFGA 2W6JA 4M7OA 2K7FA 3CY6A 3WL8A 2PM8A 2B6HA 3W5AA 2JFWA 3HNOA 3DE3X 4LOIA 5DCLA 2M1ZA 5DYNA 1QP4A 4ZQBA 3U6BA 4J03A 2C4UA 2GM4A 1ZICA 1KMIY 3EGOA 1NWCA 4RF2A 4EGSA 1NQVA 2WFLA 2K87A 3AJDA 2A9JA 2FRXA 4GMHA 1FY2A 1UJ4A 3EXFA 4I5DA 4OH7A 3O21A 4ALMA 1QTIA 1X86B 3QUQA 4C0HA 4CR6A 1BHJA 4FR5A 2BSQA 1BC5A 1H94A 1NVEA 3PZBA 1PKEA 1T8WA 2ZTLA 4ON9A 1OFUA 2PKQO 4IYRA 3LS2A 1QP0A 3GLHB 1FUKA 4YREA 4B8YA 1GWNA 3AUFA 3H5OA 1QGAA 2CBZA 3W9YA 2HJVA 2HF7A 5AM2A 2F3RA 1R5BA 3EBLA 1GUYA 1N9KA 2NTNA 3GLTA 3HKBB 4IJ5A 1GR0A 2CVZA 2EV9A 3NBQA 4H17A 2IYQA 1Z29A 3V1KA 2VYVD 3AFIA 4Q1CA 4JC8A 2JCYA 2C84A 1GZHB 2VPPA 4B87A 3H0EA 3A6LA 3NDJA 4JITA 3MAGA 1V5WA 2YJTD 3A6PC 3AVTA 1ND6A 3RG2A 4G2NA 4JKOA 1BU5A 2O50A 4HQRA 1MX5A 3FMGA 1Y82A 2QLMA 3BWYA 2FR1A 3U9LA 1Q0ZA 4KQEA 1ORWA 5JBQA 2A35A 2VAXA 3C6MA 3NHPA 3PFBA 5FI0B 2PL9A 1HY3A 3HJBA 4XFKA 5FTJA 2VUUA 4DGSA 4OYRA 4YUWA 3BGVA 5BVGA 3EC2A 4BV3A 2CK3D 3MZ0A 1SUWA 5IJ9B 1GZ6A 1QQ6A 1FVFA 2OO3A 3FNRA 2H7YA 4WV3A 3H8VA 3TSYA 4TZKA 2JJYA 3T9DA 4IUCS 5KTTA 2D3TA 2IIBA 3RVJA 4H60A 3H84A 2N75A 3LCJA 5SY4A 2GEJA 3H17A 4E4RA 1CEYA 1UEXC 3KWLA 4FWTA 2GJ4A 4BLRA 3I6YA 3BK1A 1C1DA 3MWDA 4OB6A 3TIVA 1KI3A 1LW6E 3AFOA 1IDOA 1YBMA 4RBNA 1A04A 1HYBA 2P9CA 1AKNA 3NAZA 3GA5A 4I1SA 3LKDA 2JLBA 4IGIA 3R8FA 2JBAB 3JR7A 1XC7A 4WN9B 5A06A 5JWOA 3SZ3A 1NMYA 3DEIA 3A3PA 4H3KB 1DC6A 2C77A 4DXAA 5J4HA 4PAQA 1RJ9B 2VJMB 1B0ZA 5JS6A 3HDVA 4IS3A 4G81A 3UJHA 2EARA 1ULTA 4INJA 1T9GS 4BNJA 1YDEA 3OO1A 4CM5A 3O31A 3WMRA 1P8AA 5AHWA 3PS9A 5JDIC 1OX5A 2R9VA 1C3EA 4OBEA 3RYFB 1EESA 1Q0LA 5A3RA 3H18A 3D7RA 4Y2XA 3VI3B 1SB8A 4JYMA 5LZ8A 4ZVKA 3SIWA 3DT6A 2GJ9A 4I5EA 4EUFA 3TEMA 5KTPA 1IMOA 1I1OA 3MQ4A 2B2CA 2RJ3A 1EVYA 2GD2A 2ZRJA 4JCCA 2FHSA 4FS8A 5JHGB 3H1AA 3L93A 2A14A 3KSBC 2GJKA 2QTGA 3F7TA 4RV4A 1LS1A 3OOHA 5GOTA 5AO9A 2RE8A 1J22A 1MU0A 3ZV5A 2H4ZA 3GQBB 3SOZA 1GU7A 2HJSA 3KCNA 1PS9A 5E9JA 4YCSA 4BATA 2IFTA 2P6PA 4HAYA 4YRAA 1P80A 5HHTA 3KEGA 4KYTA 1YR1A 2NZXA 2R1ZA 4KRGA 1UZNA 1L1QA 3KP1A 2CJXA 4XASA 3UJPA 1I3NA 2WZQA 3CEJA 2ZI4A 3AMVA 3OZRA 3U17A 1Z7WA 1J99A 3NHAA 2WJ6A 4HEJA 3WX0A 4BB0A 3JD1A 1D4FA 1N6OA 2GAIA 2M1XA 1PR4A 4MO2A 4PSDA 4UAVA 1M6WA 2P40A 4QXAA 4IO1A 4E6PA 4FOTA 1A9XB 2L0XA 3LBIA 3OIYA 2JLUA 3UPDA 2FE4A 2VJAA 1HEUA 1H0HA 4Z9FA 2DTXA 3I01M 4AZ3A 3PNMA 3K31A 2B9VA 2D3WA 4BAUA 1E5VA 1PV2A 4DJTA 2X8AA 4TKVA 2G7ZA 3M6IA 4UBIA 5JSYA 3FRHA 3TD2A 1ZHFA 3T7IA 4CPDA 3KPVA 3ZDZB 1M72A 3PX2A 1Q50A 1QRUA 2WAYA 3RSFA 1X15A 4HFJA 2R00A 4YAJA 3DDSA 1NRXA 3OCJA 1HZZC 2GGSA 3MM4A 5D5PA 4Z51A 2F9FA 3KLPX 4ARSA 4H4DA 3KTDA 3I4FA 2WHPA 3SZUA 1DOHA 1G0OA 1NLUA 3ERCA 3ITKA 2VYCA 3O82A 4BFUA 5TLSA 3I0NA 4L0QA 4C01A 4EMBA 5KSWB 3EAQA 1UT8A 1VG0B 4IWNA 3G2PA 2FPSA 4XUCA 4OFBA 5DGIA 3OLZA 2ZTUA 2ZCJA 2QD3A 2YNMA 4QHYA 1PTJC 5FBZA 5CJ2A 1EQAA 1BW9B 1HDYA 1PJLA 1U65A 4MB6A 1ZUD1 4GPEA 4Z4QA 2BSAA 5F2EA 3KX2A 3MXOA 5SYAA 4V0KA 5CM9C 1YQXA 4ZAGA 2ODAA 4S35A 4X3OA 5DP2A 5G2OA 1BMQA 2MDTA 3WKEA 4LOKA 1PDWA 3IOBA 2FUG1 1CHDA 1XROA 2VH5R 4GMFA 1V35A 2QENA 4F71A 1DQYA 1FPQA 5FO0A 3JWIA 3GRPA 2MU1A 3KAKA 2GK3A 1KY5A 3ULKA 4JD5A 1EDDA 5AH0A 3I42A 5FPHA 3BMCA 1BN6A 4MR9B 4LMAA 3VGJA 1P72A 2J67A 2YQ5A 2A92A 4K40A 2ZRQA 3NV7A 4I9FA 3BUSA 4PSCA 5D01A 5GONB 4FDAA 4K9LA 4PR3A 2OHFA 3U3DA 1OC4A 5EMJA 3RODA 4CKEB 1C8LA 5BV0A 1UDXA 5EIOA 3WLNA 3A6EA 3H9BA 3R20A 5EWMA 2XECA 3FOEC 1JE0A 2RHCA 4LRUA 2QMQA 2QM0A 3R8XA 1P2DA 3GEGA 3SR0A 3ZGOA 3T1VA 4GZMA 1XWIA 1HLFA 3B36A 3OQ6A 1JBKA 1K7EB 4Q1FA 2CEKA 5E6UB 1VL6A 4LQLA 1J90A 1F8GA 3EZ7A 2G3YA 5DYGA 3RGGA 3U40A 2F6RA 5EE1A 5JOQA 1NR7A 2ZAOA 3O7WA 3N2NA 4RYDA 5EWLB 3SS7X 1GG9A 1CNFA 4QXRA 2X0DA 3UT0A 1OLSB 1J21A 4GKJB 1E0JA 2I3DA 3SE7A 1HT2E 1PK9A 4NECA 4F38A 4DCOA 1R4AA 4J29A 2H4XA 3QNUA 4ZGBA 1W94A 1GZVA 3B6ZA 2LIVA 3G2QA 1N6NA 4GZ6A 3K2EA 5LU8A 2QQ0A 1PCXA 4FC6A 2YINC 5JD4A 5K0CA 5KU1A 1Y8QB 2D0DA 5CXQA 1K7XB 4YV7A 1CFJA 2REOA 5G0TA 1EP3B 5AI6A 4DMCA 1V5IA 2FU5C 1P5RA 4EDHA 1SC9A 4DXHA 3LY9A 3PT9A 3QPDA 1E7SA 5BOSB 5FQOA 1SHUX 1Z5NA 4MUIA 2WUDA 1DRKA 1RPTA 1V41E 3NLLA 3AUXA 4O4IF 5BSTA 4JXKA 2EJBA 4FMDF 2YIVX 3F7OA 1ZEMA 1R6UA 2JFZA 3HYTA 3OE5A 3GRZA 2PDAA 3IQWA 2A5LA 4MV0A 1OX4A 3W2FA 3WFZA 4NJMA 4HB0A 2OZLA 1Y6QA 2GBCA 1JEJA 1ID1A 1AOXA 3TVDA 4GD3Q 2E2WA 4ZK2A 1Q95A 1F7UA 3A10A 3OBBA 4ZVRA 3S2ZA 4UEQA 2HRRA 2X7HA 5IC4A 2GQ0A 2ZREA 3OMLA 3P9RA 2VDLB 2QUKA 2NVUA 4XD2A 5IDWA 3MCUA 2RBKA 1C5KA 3QEMB 3BERA 1K3TA 3GFOA 3GBSA 5GVSA 4M99A 4FLMA 2QZJA 5BSRA 3TE7A 2BFMA 3H5WA 4FBMA 2DHCA 1NMQA 4TTJA 1LWNA 3ZIAA 1W36B 4MITA 3FLMA 1J0DA 3HFRA 4B6EA 2GPTA 3JV7A 4NV1A 1GSOA 2QNBA 2PLNA 2JLAA 3HVKA 4AC9A 4CM7A 4L6IA 3X1DA 5LYJB 3UXEA 2BFNA 5ISMA 1EI9A 2X9NA 2EGHA 3BGOS 2FOIA 3FIJA 1GL7A 2IELA 4KI7A 5D5QA 3S5JA 2WDZA 1FL9A 1PT9A 4V0SA 1Q1ZA 2QTMA 3LC2O 2JAXA 3RW9A 3PC7A 3VYTB 4JJ6A 5DNYB 5JASA 1GV0A 2BMEA 1RWWA 3PUYA 4GNKA 5C7LO 1U2GA 2AYXA 4MKFA 1VLVA 2DHDA 2HRDA 3B5IA 3PNOA 4KLAA 5E3HA 3WBJA 5TIIA 1DTSA 1R16A 2O2GA 4AB1A 3A9VA 3QE9Y 2JG3A 5EZQA 3VPHA 3R7FA 5BRNA 4PG8A 3DO8A 4NYMQ 3L8EA 2B1GA 4KFTA 4E2FA 2KW5A 3P8ZA 5JD5A 5HQ3A 2XUGA 2VBIA 1W47A 3GHHA 5KNCD 2NPIA 2B4AA 1OMOA 2WWTA 1B3BA 2KX7A 4RGYA 1AKRA 2YXPX 3L05A 4FYIA 5FJJA 3ESAA 1BKDR 1ZD2P 3V8NA 3T35A 4ZAZA 1NQUA 3W6NA 1VHWA 2G17A 4YAFA 2RHGB 3M6WA 3P9XA 4LHSA 5JO0A 2HN9A 4UDOA 4PE5B 3UMFA 4DDTA 4TS3A 1N5LA 3CNOA 3ROEA 3F5MA 1AJEA 3MGBA 3RC3A 1E20A 4OMFG 4CUZA 1GDDA 3P9SA 3D8NA 3KKPA 4QHSA 1XALA 5C5IA 3ZVKA 1IQPA 4IFTA 4NCBA 4G84A 1HQDA 4IIVA 4V0ME 3RKSA 1T26A 3TL3A 5ECWA 1GPLA 2HA7A 5HS4A 4I55F 4BZZA 3TXAA 3AW8A 4BVAA 3AHGA 4Z2AA 1DBIA 3DDCA 4CMIA 3LVBA 4YNBA 1S2LA 2JCBA 2OCBA 1IRIA 2Y66A 4CDRA 3VZCA 2XGSA 4UU8A 3K6RA 721PA 2YDYA 1HT3A 3AC0A 1PWXA 1YBFA 3K0FB 3NTUA 3QP9A 4S1TA 1JB9A 1VKOA 1WXXA 4I50B 3QEJA 1RI5A 5DI3A 1PJRA 2I4IA 2J87A 4JA0A 3W2EA 4ARVA 4EJFA 2E21A 5KWIA 1KAEA 2HHLA 3G5MA 1CW2B 3D8HA 2F3QA 3I53A 2IX9A 3VKUA 3VR3D 1T6YA 4QYWA 4QEZA 2ESRA 3HACA 4A2WA 4G5YA 4WE3A 3TTUA 3RR2A 3FPBA 1XXHB 4P83A 2V8BA 4F5WA 2QG4A 4Y9RA 3W9UA 5UKDA 1FZTA 2OORC 1YI1A 2QR3A 2FTKE 3H3FA 1QS0A 2I6QA 4F45A 1WJGA 2VZ8A 1YVPA 4H7JA 2GSDA 4JL5A 1M2OA 2RB5A 5K0TA 3MWYW 5AI4A 3S70A 2V59A 2W6ID 1IG3A 4H7FA 3KQKA 4KP7A 4QGSA 3HVRA 3QFTA 1X7XB 4YCCA 3KLOA 4DQLA 4FFRA 1Y1RA 5B7NA 3R9XB 3KZMA 3ONEA 4XKJA 3NH9A 3TKAA 2AFVA 3PRHA 1EP1B 4ZQHA 5EMLA 2QRMA 3EUAA 3VDXA 3TDMA 5GIPE 4ZO6A 1BXZA 4OXYA 2OLEA 1FSSA 4AKTA 4IM7A 1Q3TA 1RQRA 5JLAA 5E0OA 4BNGA 1IN8A 2JZCA 3MPUA 4ZMBA 2OVBA 3F5DA 3JPWA 4NNOA 1BCRA 3FNQA 2HHJA 4JDPA 2FMTA 4D9BA 1IRXA 1EJ0A 1DVRA 6AT1A 4ZI7A 1T6ZA 4A2PA 1CRZA 5IC6A 2NW6A 1L0BA 3OICA 1I7PA 4ZQIA 1TAHA 1ZGBA 2BFWA 3M6LA 4RORA 4DV4B 2IKQA 3F9RA 5TMEA 3TD9A 2W98A 4OOFA 2CV2A 4EG7A 4PG6A 4V0MA 3V32A 2PD3A 3HFGA 3KK0A 3B60A 5KVVA 4TT3A 1FTQA 5BN5A 1QGED 1P0IA 1E63A 2JLSA 3PHLA 3FWNA 1ECFA 3GZNA 3QIAA 1RSZA 1SU7A 1QTNA 2VL7A 3SAJA 4B7UA 4C6SA 3O93A 2CT8A 2P4UA 4OJNA 2H65A 1YS6A 1T0UA 3AY6A 4PHFA 2JATA 4QXMA 4G0QA 4UBKA 4M36A 2Q6KA 3GUZA 5EERA 3X43A 4EF5A 1WNFA 5I7FA 2DG2A 3L2OB 5H0IA 2DF8A 4QBIA 2XZLA 2PXHA 1CR6A 4A91A 1HMPA 2EL9A 4NTZA 1QRAA 1Z5GA 2WSSD 1ORDA 2PLFA 3CR7A 4FNOA 3TLCA 4C08A 5I45A 2J3IA 2Y68A 4JI3B 4GEGA 4JROA 3P71T 2AXNA 4LHXA 3U4AA 4J0KA 3V8EA 4EPYA 3SEAA 1UK6A 2AX4A 4IR7A 4DCPA 3FNFA 1UC5B 1FTWA 2IEIA 3B51X 3Q7SA 2FWRA 1ADYA 2ATCA 4LGYA 2OBFA 4HX9A 3VYWA 2WTXA 3JALB 3EQ8A 3QTLA 4EKDA 3NHKA 3O4VA 5JATA 5DI9A 3VV2A 4DUGD 1W46A 5AKLA 2BFCB 3MEQA 3SFZA 4GYJA 2QY6A 1ZK4A 1HM5A 3DOOA 3ZJ5A 4BWFB 1GQOA 3LBYA 1O6CA 4HAUA 3P5BA 1RKUA 2EKQA 1YTUA 4LNAA 4TQUS 3KRTA 2RD2A 4AJNA 1T43A 4EO4A 1J07A 1P1JA 4H1TA 4H6PA 4URWR 4UZFA 2NXWA 2Q2VA 2W5UA 5BNFA 1CHNA 2F90A 3DJFA 1Z6QA 1CLEA 2PWYA 1HE3A 4V3BA 3WP1B 4N5IX 2IKSA 2CLLB 2FUG6 1R0YA 3FHLA 1OC2A 1N2CE 4P84A 1P3JA 1LS6A 2H57A 3O8DA 1LLDA 3UYKA 4FMBB 1G0NA 4KUEA 4BO2A 3HP4A 4Y6RA 5IT0A 4QUHA 5COBA 4QA9A 3TKYA 4JQYA 2GYYA 1IQ0A 3UAOA 3H11A 4W5WA 5FUXA 3ZDBA 2GKGA 2I4LA 4WOKA 1LBQA 4NEHB 2YVQA 4L95C 2GEVA 3DMYA 3GG9A 1J0EA 5CCEA 1BXGB 4GI2A 3NCHA 4RIGA 4HD8A 1RWMA 3W4IA 1ZXXA 5KNCH 4IDCA 4NBNA 1ST3A 1PSZA 4NCHA 1IUKA 1X1EA 3IYLW 4S12A 3TZCA 3UT5A 3ZZMA 3ZHVA 3T3HA 2BR4A 1ZU4A 2H5IA 5EE3A 2ZULA 4UUOA 5LXTF 3QG1A 4MLPA 5E7JA 5B3JC 5AI9A 4G86A 4KE6A 4IO0A 3CEHA 4BLPA 1SOMA 2H17A 4TTAA 3R23A 2HK8A 3C45A 1UKCA 4J0QA 1W73A 3MJEA 1PQUA 5KHOC 3UAGA 3W06A 2R8BA 1CQJB 1KERA 2ORED 2O8EB 4P36A 2G5TA 3T61A 2BKVA 1ADJA 2GNPA 2EWMA 2GAFA 3VNUA 4B2LA 4BV8A 1QFSA 1M0TA 1FLAA 2RGNC 2J1LA 3B53X 4B85A 2X5XA 2WQ6A 1UXHA 3S55A 2PEZA 1BWRA 3BHNA 3E7WA 1CUZA 1L7AA 3OX3A 2FEAA 2XT0A 2B21A 2XX3A 3VNQA 5ESXA 5EHIA 1YS1X 5I9MA 1EJBA 1P9WA 4ILKA 5IHPA 2XZPA 1OTYA 1TIKA 3OE7A 1JW9B 2HYDA 4CDNA 4IGKA 3ABZA 2P5TB 1KVUA 3RVOA 4I9NA 5FUVA 4X54A 5JEEA 4UHEA 4X20B 3ZVMA 4POOA 1NUHA 3OIGA 1P81A 4Y2VA 5D7BA 2ODEA 4BNLA 4RA6A 2FLWA 3CFYA 1E9RA 2NZJA 3DOJA 1OFHA 2GH1A 4PM4A 4YTEA 1BSVA 5HF9A 2VQFB 2J3QA 1YV9A 4J0CA 4DA6A 3EZXA 3LQRA 2CBGA 3SJBA 2DWPA 2G0TA 3DEFA 4XGKA 4B0OA 4EA9A 5LKRA 4LGCA 1N2CA 3R6WA 3EFOB 1POWA 1NXSA 1A98A 1JTEA 1UOPA 4XDYA 4FYPA 2GZSA 2FVXA 4EQ6A 1CRLA 1GNRA 1M1YE 3ITNA 4ID9A 3PDJA 2W6IA 1ONOA 3UXYA 1CP2A 1XQWA 3OY2A 2EWVA 4K6MA 5CTAA 4RK6A 3WHLA 1XDBA 4M89A 1YR7A 5JTUA 2H1WA 1QFXA 1TMYA 1Z5OA 4ZYWA 1X9HA 1X92A 5I8PA 3S2YA 4BP9A 5TGZA 5BN3A 4FOLA 3GNSA 2D5IA 3W6OA 4RSHA 4A0SA 3GFSA 3L0OA 3RS2A 2Q6OA 5F73A 1L5MA 4WBSA 2FW9A 2J3LA 2VHXA 2NSLA 2DY1A 3TW6A 1E6LA 3MINA 2R4QA 4Q4HB 5BO5A 1M33A 2E49A 4OQZA 1JA9A 1V8FA 2CUTA 2NYRA 3ICOA 1EFVB 3M89A 1E2FA 4NYMR 3N74A 1YQDA 3L92A 3EUFA 2MSLA 4CQMB 4X60A 3IQIX 3OSUA 1TZJA 3ST7A 3HKCB 3NTLA 1K6EA 3Q40A 3SKYA 4O29A 1E1RD 3VSDA 1C4OA 2QTNA 2HBYA 2ZSFA 2O2IA 1C30B 2XLBA 7ABPA 1QCZA 1BE8A 1U7HA 2VSNA 3K7EA 3VKFA 2WV7A 3L7BA 3AV3A 2V3CC 2ECQA 3QYFA 1LSOA 2GFQA 3L8YA 2R7AA 1W4RA 4KI0A 2AMFA 3HWSA 1CQIB 3ZTTA 1YQQA 1TK3A 1WXQA 1ZX1A 4BYMA 2C2WA 3TSWA 4D9IA 2AEFA 1GU1A 1KMNA 3LRTA 3NAMA 4TT8A 4D9KA 1ZJ6A 4L1KA 4ZRNA 2F1OA 4BS9A 2ZSIA 5F2KA 3KQUA 3JD0A 3NMUF 3ID6C 4UVGA 1KKUA 2XRFA 3PQ6A 1DDGA 2JFYA 4GDMA 4OQ4A 5J9FA 2W9XA 4X90A 1WXEA 1KDRA 3N7AA 2HSJA 4BUJA 2AN5A 4U9HS 3NIDB 1P4JA 1Z0IA 2C78A 4LE0A 1LV7A 1LI5A 1CDDA 1V5EA 5CDGA 2Z9CA 2YY6A 2CVOA 3IALA 1KZHA 4PAMA 4UM8B 2PVSA 1F20A 4EJMA 1JAZA 2ZXEA 1DFIA 2WVAA 2O8DA 4LRWA 4WAUA 1LQUA 4PYJA 3I5UA 4GF5A 3EXHA 1M7HA 3A11A 4JOCA 2QD5A 1M1YA 1F48A 4GR5A 4K9SA 3HABA 3AIMA 2XA2A 4LZJA 2JCVA 5BWCA 2VTDA 4Y2QA 1OCEA 4W4TA 4XWWA 4EW3A 2AJBA 3UUGA 4AN4A 4JUAA 4N0DA 3TFWA 1TYZA 2W2LA 2P62A 1Y7HA 2V6IA 1G55A 3C24A 3L7NA 4MTCA 5DBFA 3V4VB 3O8QB 4AJ4A 1HK7A 2RK3A 2DWCA 5AW7A 4U7DA 4C4AA 2J09A 4G56A 3JD2A 3BZUA 3ZJUA 4KXXA 3JY6A 5DWDA 3R0JA 5H4GA 4BKUA 3K8ZA 2DSTA 1P91A 5HKBA 2YH2A 2BZ1A 3U80A 1XLTC 1JFFB 2P91A 5ICGA 3N3BC 4MLZA 3W2HA 4EGFA 1GADO 2QL5A 4KQ9A 1JQDA 2QRLA 1JHZA 1P29A 3HY3A 5HFNA 2C1EA 2NP7A 4PSKA 4JL8A 3THWA 4YI5A 3ZDCA 3EY4A 1W44A 3A25A 1H69A 2PMEA 1ZM7A 2PBZA 5FLEX 4UNSA 1L8XA 3GARA 1NU6A 3PXAA 3WL7A 1MPXA 2Z2ZA 1BRTA 3ZHZA 3LQYA 4G85A 1XMOB 3DEAA 3L3BA 5IKOA 3STVA 2ZXUA 4R40A 1MB9A 2HWYA 5CP8A 1SM4A 4BGDA 1N4DA 3I62A 1YE8A 5TF4A 2H06A 1V6AA 4TYPA 2O1SA 4XX1A 1BDIA 2QN2A 1F17A 3QX9A 5CCBA 4HNHA 3NIGB 5EE5B 3IQFA 3FW1A 3GMSA 5BN4A 1RWXA 1HNZB 3NATA 2WJGA 2PR7A 4L4RA 2HMSA 2ZUFA 2IU3A 3BAFA 4Z4GA 1T5SA 3BXZA 2WSMA 3D4BA 5C1PA 1F8FA 2HK7A 1XCBA 3ER6A 2QW0X 1C0IA 3CH6A 1SQ0A 1BE1A 4N01A 3QI7A 2BGIA 5H8WA 1PVOA 5SZJA 2ZZMA 1JHVA 2W2NA 5AJTA 2AW5A 3FLBA 5DX8A 1DAGA 5CNIA 3UW3A 2RGYA 3S81A 1PGJA 4UEJA 2PQ0A 4YRZA 1PWYE 1RXSA 3IPCA 4EB3A 1KJIA 5MN6A 2Y1LA 3FOAA 2VVTA 3KQWA 4AS3A 4E2YA 2KHZA 3QWFA 4PFJA 3W1VA 2QRQA 2GESA 2J46A 3EMKA 5BRAA 4FZVA 1L7BA 4JVMA 3H7IA 5TJ9A 2NSJA 3G5LA 4LVCA 4YJ2F 4R2HA 1NUPA 5EJ6A 1W88B 1Y33E 3BZWA 1E6MA 3JQRA 2QIPA 2VHEA 1R0BA 1Y8CA 4FQ5A 1Q7TA 3DOIA 2FW8A 4AIIA 3CEMA 3L7IA 2AWNA 3JQ7B 3TEJA 4YCAA 4DCMA 3F4KA 1U8EA 4US1R 2A5FA 3RBZA 2ISQA 3BD6A 3PE6A 4U2KA 2W6OA 3A28A 5TPWA 2WWVD 3SG0A 4CHTA 2XCTB 5IUKC 1QFMA 1NDUA 1NAHA 3QXXA 3TZHA 4DIFA 3MIIA 4RSRA 4UTOA 4S1PA 3EODA 1B41A 1D0IA 1EVEA 1AF7A 4M1YA 4URYR 3SJAA 4YYEA 4UEWA 2OB2A 3BYZA 1G8PA 1IUPA 2VJNA 3PRJA 3DF9A 4PYIA 2NT4A 3Q3IA 4QUJA 2FMXA 2YZ7A 4RL4A 1GQRA 1ZQ9A 4URVR 2YIMA 4ZYVA 2CFTA 1NW9B 3OPVA 3ENKA 1E2QA 4A1FA 1DC7A 5SY9A 2IYWA 2ZUDA 5G0WA 1E5LA 2YXEA 2VRCD 3GIDA 3UATA 1SXIA 2Q9CA 3QM1A 5JXWA 4C4TA 4FSHA 4B3CA 4Z3OA 1MW8X 2PU7A 2AC2A 2IVFA 4MNTA 5FYDA 3CC8A 4KWEA 2WMDA 1A7KA 2X8JB 2ECKA 2PIAA 1GZDA 2WT4A 2X4DA 3BEOA 1FW8A 1XVLA 1K98A 1M74A 2IITA 4KVAA 4NMHA 1U5AA 4ODIA 3H2SA 4ZZ3A 1KZGB 2VP3A 2PT6A 2CF6A 2C3PA 4QOGA 4GPIB 4KR6A 1XJCA 1QUEA 5CLHA 3VU3A 1RADA 4DQKA 2ZTSA 1VXOA 2FE1A 2FSPA 4YCJA 2F2TA 3FHCB 4OQYA 5H9WA 3T9CA 1J00A 2ZZKA 1SC3A 4OJYA 5HJ2A 3CG0A 3COZA 4MCIA 5L4NA 3JQ9A 4DADA 3NOVA 3H5LA 1U4SA 4JL6A 4R5MA 3NIWA 1O96A 1GSIA 1UP7A 2YHAA 3K16A 3L8HA 2FDRA 3FMIA 3S44A 3TTVA 4DC1A 5L40A 5IG2A 1GAQA 4GBED 5CIWA 4DRZA 2N3ZA 4X8OA 3L04A 3KT0A 4JB0A 5CHEA 1QDUA 2O7NA 3V8PA 1HYQA 1YQWA 2FW0A 4RVHA 4E5PA 4NOMA 3W79A 3C41J 4OI4A 3VZBA 1OZGA 4F7DA 3PGXA 2J9RA 3Q9SA 5FKJA 1MHPA 1RKVA 1XRPA 3HU5A 4UU7A 1YL5A 2JIBA 1GDTA 4B44A 1U1FA 3AZPA 4JJ8A 4FC7A 3Q3CA 3GLHE 1GY8A 1RPZA 3UPTA 2Y67A 4BY9E 1SBQA 4JFAA 3H05A 5AK5A 5K0NA 1BU8A 1XLWA 4KQ6A 5K3DA 3S27A 2GXUA 4HNAB 4J0JA 9GPBA 1Y4UA 1GNTA 2FPOA 5JCJA 3S1SA 3IT2A 1X77A 3GAAA 1KVRA 5HQTA 3F71A 1U8UA 2PL1A 3FHOA 4L5YA 1N6IA 2QJFA 2X19A 1ZVMA 3RYIB 1KZYC 3EIHA 3EVBA 4YP0A 1CDZA 3E53A 5F1OA 3DV2A 1FYWA 4LC1A 2QHXA 1RE1A 4DIDA 1CS4C 1XFDA 1Z5UA 2LE0A 3LVFO 3U7IA 2CNLA 2RHDA 3K6SB 4DCTA 3KEOA 1NVXQ 4LX8A 4A03A 2FZEA 4CTOA 1ILEA 2GEFA 1JVNA 1LDNA 2XOEA 5FR2A 2CXPA 4JOQA 2W70A 3NGMA 4W1PA 4J6FA 3IBCA 3U3MA 3NHJA 1NW6A 4Y6PA 3PXEA 2R6R1 4FE7A 4IHKA 3L6BA 1Z08A 3DB1A 1WIWA 4KH0A 4XQ0A 1E2EA 2NQ2C 2R00C 1XCJA 3AONB 1KF0A 4FPXA 1G291 3EXG1 3ZYCA 4QUKA 1M2KA 5KTMA 1KPGA 4UEOA 2VYQA 1NUAA 3NEAA 4FIZA 4ZC8A 3PFCA 1ZISA 4H0FA 3WDMA 2AOUA 3NBYC 2HTEA 2KI5A 2YMMA 2WP8J 1O5TA 3WGQA 5B58T 4YXFA 2HEIA 3IAHA 1P6XA 4PZCA 4CMJA 3JWJA 4DLYA 1SRQA 2VQDA 4EW6A 2FQ1A 2FSHA 1VHDA 4GX2A 4JR1A 3TS1A 5JI3E 1SQ5A 5JPDA 1V7ZA 2YNMC 1A96A 3MLAA 1JDPA 1OLOA 2OAGA 2XMQA 2B98A 1H2ZA 1X1RA 2Q2OA 1JEDA 3BGDA 1J4AA 3E9EA 4N5HX 3TBKA 5B1EA 1NN0A 3BBPA 1JBEA 2QORA 4AG3A 1YCFA 2HA5A 4BLVA 1QYWA 4DCSA 3QE4A 2QQFA 4YV2A 1J8MF 5M04A 3NNNA 1KIMA 2YL2A 3HK2A 2O6LA 3AP1A 3M6UA 3OHPA 4UNIA 3ND9A 4YPFA 2CC2A 3FCXA 4P4GA 3GLHA 3OTWA 2GEUA 4BB5A 4EMUA 3ZG6A 1E3JA 4BX3A 1E60A 1H2FA 1X1SA 2BGRA 5A5EA 2HJ9A 2CFSA 5ERYA 3ZOZA 4MQ6A 1K8ZB 2MSNA 3HKBA 2I67A 3MHTA 4ZI5A 5LIPA 2OCDA 4CLEA 4N3AA 1MR3F 4AMUA 1R10A 2GN2A 1LV8A 2ZG6A 1IEVA 2AUTA 2JAWA 3LHSA 1QF6A 1K86A 2Z2JA 4Q7KA 1M76A 2H2HA 4PN7A 3RWOA 3UOGA 4L28A 1D2RA 1KJWA 2CZGA 1S3GA 2F1RA 3PQDA 1T1IA 2AQKA 4OPMA 4RE6A 4MSUA 3ZHQA 4W5RA 2C7PA 3FDIA 4IQ4A 3U7QB 4F06A 2GZMA 3IILA 1P6UA 3ZVLA 3ILXA 4PEVA 3RIEA 4LPSA 3B6EA 4R9VA 4A23A 2RKOA 4ZZ1A 1E8DA 3Q15C 5IJ9A 4Z0PA 4OM7A 3REOA 2KYRA 521PA 1OOEA 2R65A 3AEKA 3IHTA 2CVPA 4KEAA 3K15A 2HQBA 4OUDB 1H85A 1VMEA 1ZNXA 3NHYA 3O38A 4L7QA 3MCWA 5GIOE 3I12A 1E2LA 1VRWA 3F46A 3WGIA 1T8YA 5ADWA 1EFRA 2FFRA 2DE0X 3JAKB 5JMPA 1Q3KA 3HYRA 1Z83A 3P0RA 3VGPA 4BDTA 5HKOA 3DTVD 3BVPA 4UJ5A 5G4KB 1VGVA 1ZU5A 1XT6A 4GPD1 1MW9X 3VR1A 3Q1LA 3TLBA 3TTWA 1D2AA 2ZE5A 3IFSA 4EUHA 4UHBA 1GCGA 3IE2A 2R85A 2XUPA 4BIMA 2ZQ5A 1Q7GA 4S1OA 5NULA 1JG4A 1PFGA 3ZKAA 1F8XA 3R9KA 3IUQA 2JBAA 4WN9A 2JIDA 2IUEA 4C7KA 1P1HA 1QLHA 3TI9A 1YQGA 2YWXA 1JSRA 2QAJA 1QYVA 1D3AA 2OGUA 1RJ9A 2VJMA 5E7IA 1NNLA 1VJ5A 2BGJA 2BOVA 2A1TS 2EXXA 2JGMA 3CF2A 1KBZA 1M66A 3ENNA 3ITEA 3Q98A 4YS6A 3EASA 4BO8A 3C1OA 2UVPB 3NBXX 1Y63A 2MHCA 4BNTA 1XZLA 2PSJA 3KJFA 1Z2AA 2HJGA 3Q7QA 3WC4A 4ADSG 1T6BY 1CJCA 4ZVOA 1VG9B 3VU1A 3PXDA 3U49A 5KYYB 2G77B 4NU5A 4QYIB 5H59A 1WG8A 2HNAA 2VNJA 3DMRA 4BNHA 1VDMA 2NTYC 3AVOA 3NKLA 4BQSA 1KEWA 3KYBA 3PPVA 1YI8A 4W9RA 3OQMA 1ID8A 1E4OA 2EEPA 2V6BA 5T3YA 1IATA 4OP1A 1THMA 1NW4A 2W2VA 4L5IA 4UKDA 3RVMA 1CD5A 3FHTA 3JQBA 2FLKA 4EFDA 5DHQA 5HW0A 1J2UA 4BVFA 1ZOOA 3IAUA 4FS3A 4W7IA 3ZYZA 3IRVA 3GQBA 3IBTA 5K9ZA 1O2DA 3ONVA 5KTSA 2AW3A 4BO5A 4C43A 3C87A 3LQKA 1VBFA 2ICAA 2EZTA 4ABTA 3I04M 4IDNA 2O52A 4J7XA 2PSDA 1NFRA 4F6CA 3ZS9A 1OI4A 3WYFA 3GMDA 1WTCA 5FL7D 5ALPA 1QGDA 2VXCA 1UJ5A 3KUUA 4CI0B 3GLFB 1H0KA 4HLUA 2Q3CA 4CCSA 3AV0B 2WHRA 1QKKA 4XOIA 4Q47A 3CRVA 3FZGA 2XUQA 3I6QA 1ZQ1A 3KDAA 5F9MA 2IY8A 3OOYA 3KQHA 4GXNA 2YX1A 1U2GC 4WKNA 3WHKA 5LWQA 3FYSA 4UQPA 2FUCA 3DPSA 4S3MA 4DSTA 5EHXA 5JQGB 2VPQA 1MG0A 1A9XA 3BFXA 3QVUA 1S2OA 1NL3A 4EY3A 2YFHA 3BJZA 4HK4A 1Z6AA 4DCJA 3CH5A 3L8GA 3THOA 1SJ9A 4R1NA 1IDN1 2AT1A 3IHKA 1QFJA 3L06A 4K87A 1SCKA 3I1IA 4KE9A 1MIHA 3R24A 1ZN2A 2I3AA 4JH0A 2J6IA 2POQX 5EIAA 4C5BA 5LP6F 1GNSA 3MJCA 3SC2A 4JLOA 4QL3A 1G7TA 1O6GA 1YRAA 2QAGA 2VHCA 3MERA 3DAFA 3ZHSA 4LECA 2VYFA 1XTJA 2AR9A 1B8OA 2VSXA 5FD8A 3FOZA 1E2KA 3GD7A 5L7YA 5ALVA 4H77A 5CB6A 1LVUA 1XA0A 4EB6B 4MIYA 4NMWA 1YKGA 2GN0A 1KOFA 3O75A 4RU1A 1BDHA 3GQVA 4WY8A 2JI8A 1R6DA 1O95D 2RI0A 3HO6A 4BE9A 3AUUA 4C0AC 5K3SA 4L51A 2QF7A 3DLIA 1JHQA 2HRZA 4KN6A 4KZPA 3SX0A 1BW9A 3ZGVA 4G1CA 4DR2B