4D7SA

Structure of the sthk carboxy-terminal region in complex with cgmp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords STHK_CNBD_CGMP
total genus 58
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7sA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7sA02
1G6NA 2Q1ZB 1QXJA 4UXAA 1ZVFA 4EWAA 1IPJA 3E5UA 3NJZA 1GQHA 2Z2SB 3OCPA 1YFXA 2EVXA 4X6RB 1I6XA 5HI0A 4XFFA 4B29A 1QXRA 4Q0UA 2V09A 3FX3A 4GULA 1GQGA 3H9AA 4HSLA 3CO2A 1ZZ8A 4J1WA 5FPZA 3DKWA 4FAHA 2UYAA 1O4TA 1EP0A 1RGSA 1LR5A 3D0JA 1YFYA 1CX4A 3CJXA 1NYWA 1CAVB 1V70A 4O9GA 2GH2A 4AQ2A 1CAWA 4KU7A 3ES1A 4D7SA 1XE8A 3IIAA 4LEJA 3E5QA 1O7FA 3RDIA 2WFPA 1DZTA 3EBRA 5AVPA 2CAUA 2ATFA 1PM7A 4XFIA 1L3JA 3SMHA 4EROA 2ZKLA 3ST7A 1ZREA 4MX3A 1U12A 3M70A 3U0ZA 1O3SA 2BNOA 2H6CA 4HMZA 5BY5A 4MH0E 4DINB 1VP6A 4D7TA 4PIXA 2XHKA 4L2NA 3E6CC 2VPVA 3H1YA 1WA4A 3FE5A 2BNMA 3USSA 4E2QA 4LA2A 1ZRCA 4Q0QA 2MHFA 3HT2A 1QY4A 3CF6E 4IERA 1UD1A 4LULA 4MUVA 2PQQA 4O9EA 1FXZA 1RTVA 4Q0SA 5FQ0B 3H7YA 4XFBA 1DGWA 3MPBA 4E2SA 4A2UA 2PFWA 4IEXA 5JSOA 2QNKA 4XEZA 2OYZA 3WW3A 1HW5A 4YSFA 1H1IA 3E5XA 3ZDSA 2UY9A 2H6BA 3VHRA 1ZZ9A 3N4MA 1JUHA 3FJSA 1IPKA 5D1IA 3DV8A 3EJKA 1O3QA 4BYYA 1UCXA 5CADA 1RUNA 2XKPA 3SXWA 2FQPA 4AQ6A 3H3ZA 5C8WA 2IXKA 4MGYE 2XL9A 4XF9A 4XETA 1ZRDA 5I8TA 1CAXA 1VR3A 2OZ6A 3H1WA 1PMIA 1UPIA 4BHPA 2PHLA 4LLOA 1J1LA 2C0ZA 2MPFA 2ETEA 1X8MA 3RPQA 4MZUA 4XFHA 2BYVE 1Q5OA 5BV6A 3NW4A 4Q0VA 2P17A 2QCSB 1Y9QA 3U10A 4IEZA 4JTOA 3BB6A 1QWRA 4E2GA 3LWCA 3QACA 1Q3EA 5EZWA 3PVBB 5I8SA 3BALA 4FAGA 5CVRA 4CYDA 5FCCA 3OD0A 1UIJA 2O1QA 4I02A 4MV2A 3HIFA 3CL1A 3EHKA 4R8HA 5FLIA 3L2HA 3GBFA 4LA3A 2QJVA 2I45A 5J48A 2IXJA 3LZZA 4F8AA 5JCTA 4WBBA 4HZFA 2XLAA 4L11A 4X6QB 5LEJA 4J1XA 2IXLA 5I93A 4JV4A 3KCCA 2D5FA 3NL1A 1WLTA 1ZZCA 1OI6A 4WVZA 1NZCA 2IXCA 2K0GA 3LA2A 1J3QA 4BIFA 1CAUA 3I59A 4Q29A 5FQ0A 3BU7A 1YWKA 4UBGA 3LA3A 5BUVA 3HT1A 2HJIA 1H1MA 2Q4SA 4MGIE 1VJ2A 1YFUA 2XGXA 3ES4A 3BPZA 2EAAA 4KL1A 3MZHA 4N9IA 4HVQA 1ZZBA 2OZJA 2GZWA 2Q0AA 4ZU4A 1OMIA 5BXXA 2N7GA 3RYRA 3SCFA 3PNAA 1XRUA 3DN7A 3KSCA 1EY2A 3KGZA 1YFWA 3OTFA 5FLHA 2O8QA 3GYDA 4EWEA 3ETQA 1CAXB 1X8EA 1ZZ6A 5E16A 4Z07A 2DCTA 2CAVA 4JTNA 4HSJA 4H7LA 2CGPA 5KHGA 3KGLA 4AVAA 4JVAA 3MDPA 4XFGA 2CV6A 3CEWA 5LRRA 1UW8A 1NE4A 4ONUA 4IEOA 3IWZA 4META 4AVBA 4I3PA 1ZZ7A 3H7JA 3B02A 3LOIA 2B9UA 4QGLA 3QOPA 3RZZA 3HQXA 5FPXA 4YYOA 2GC3A 1SEFA 1FT9A 3G7DA 1RC6A 2OPKA 1LKNA 3I59B 3JZVA 3U11A 4NVPA 2EA7A 3IBMA 3M3IA 4ZU7A 3FHIB 4EWDA 4KWKA 4QGMA 1J58A 4PIYA 3BCWA 2K9ZA 3SCHA 4XF3A 3ELNA 4XF4A 1I5ZA 4FBFA 3C3VA 3E6DA 4IEUA 4Q0PA 3DL3A 3RYPA 2H0VA 2KXLA 2BEOA 4PJYA 4LUMA 3FWEA 1LRHA 3S7EA 3I54A 3TNPB 3UKNA 1NXMA 3NSTA 5LEKA 1Y3TA 4AXOA 1X7NA 4MGKE 3S0MA 2ZCWA 5EFUA 1RUOA 1EYBA 2VQAA 2IXIA 4I2OA 4QM8A 1LB2A 3UKVA 4HN0A 1DGRA 2E9QA 2IC1A 3E6BA 2XLFA 3NKTA 2VECA 4LTAA 3PLQA 4HVOA 2ET1A 3D82A 4I0AA 3RYKA 1DZRA 1EPZA 5FLJA 1ZRFA 3IDCB 4YRDA 3EO6A 3FZ3A 4R52A 5K8SA 3SCGA 3WW1A 2BGCA 1SQ4A 3I7DA 4PIZA 3H3UA 1O5UA 5I8YA 4I09A 5C6CA 4IEWA 2MNGA 2WC2A 2PYTA 2B8MA 5I0SA 5KBFA 4FT8A 2XKOA 3E97A 5I91A 4AVCA 4KWJA 5E1RA 5KHHA 1TQ5A 5JSRA 2PAKA 2PTMA 5J7MA 4HVRA 3CLPA 1O3TA 1OFNA 4EV0A 2XL7A 2PAMA 2BNNA 4XFAA 1CGPA 3ROUA 1RL3A 3H1MA 4HLTA 4LUKA 4RD7A 5T3NA 4HBNA 2PA7A 2OA2A 3FFQA 2GC0A 4TLFA 3O14A 3WW2A 3MYXA 4Z82A 1ZNPA 3H50A 4XFCA 4XF1A 3KMHA 4QM9A 2XLGA 3LAGA 2Z69A 1WGPA 2D93A 2D40A 4I0BA 4K8FA 4QMAA 4HN1A 3IDBB 4ZU5A 4QX5A 2QDRA 5KHKA 1J3RA 1OD5A 5JSPA 4XF0A 2PHDA 3RNSA 4MGZE 2UYBA 1YUDA 4UBHA 4BH9A 2Q30A 2GC2A 3TNQA 4IEYA 4KWLA 2F4PA 1XE7A 1UIKA 2ET7A 2Y0OA 3EQEA 3ACLA 3UKTA 2GAUA 2IXHA 3S7IA 4IESA 5JAXA 5KHIA 4QGNA 3NVCA 2B5HA 2HKXA 5J3UA 1X82A 3SHRA 5I0RA 1CAVA 4OFGA 1YLLA 4IETA 4IEPA 1SFNA 1CAWB 1ZRRA 1O3RA 1FI2A 4YNIA 1J59A 4N9HA 3D0SA 4IEQA 5BPXA 5CU1A 3R6SA 1YHFA 1CAUB 1J3PA 4OLLA 2UY8A 1Q43A 1ZX5A 4IEVA 4QXKA 5FDBA 4WZCA 3LA7A 3WW4A 2QVSB 5I0UA 4YARA 5F1RA 2FMYA 2PAEA 5I0TA 3H8UA 5LRSA 1NE6A 1O5LA 3OF1A 4I01A 4P9GA 2D5HA 3OGJA 2GC1A 5JR7B 5KHJA 4KU8A 4ORFA 2GU9A 4F7ZA
chains in the Genus database with same CATH superfamily
3BTZA 1UN1A 4I9WA 1QJX2 1LULA 1GQGA 1QXPA 3NV3A 4O2BB 2Q8CA 5B1OA 2DYSC 3OW2U 2HVJC 1OVPA 5E89A 3O1MA 1QJFA 1QU0A 5FY9A 1UZ0A 3ZN1A 2YGMA 2ORZA 1JVMA 1NKDA 2JENA 1PGL2 4WFGA 4XFIA 3HKDB 3PHMA 3B7MA 1ULEA 4DQAA 5JCOA 5KR7A 1NQDA 2R9AA 1RMU3 2WWWA 2E51A 4AHWA 2GTSA 1T6GC 1WA4A 4YG0A 1FOD3 2UUAB 1AJKA 1Y9MA 3ZXLA 4YIPA 5LCWL 3BI3A 3A0KA 2DW4A 4Q0SA 4CUCA 2YYOA 2PFWA 1R082 2JB8A 2DV9A 4XEZA 1C28A 2OYZA 4NIAA 4GKKO 5EYYA 1JHJA 4ZIBA 4MLOA 5CKMA 4BK5A 2FQPA 3MV11 2ITCC 3WEZA 3WXPA 4JTAB 1AVMA 1R6KA 3RRDA 2P3IA 3L9JT 4FIPC 3AK3A 2A3QA 1DBNA 1RUE3 4LO5B 3RPQA 4I5SA 1TMF1 3GVMA 4GJZA 3SKJE 4NPLA 5FZMA 2Y48A 3EXAA 2ZA9A 4W65A 3S3WA 1UMZA 3A0RA 1BL8A 1NTKH 4LKEA 2OKXA 2OXBA 5I8SA 2A73B 1LOEA 2EXHA 3SEPA 2B5UA 1PO13 1IG0A 3SYCA 4X9QA 3J8F1 2RS51 4OHZA 2HYKA 2VNRA 2WABA 1Q56A 3SJBC 3ZM8A 4K8ZA 3TOJA 3VD5A 2IJHA 3CCJV 5LEJA 3MICA 4HZ3A 4FLUA 4ZZ8A 3TK1A 2CUGA 3T1MA 3JD3A 4EKWA 2FL4A 3E83A 3RQ0A 1TME2 2ILMA 3UKMA 1H1MA 5LW9A 4IV3B 4RR3B 4MGIE 3LFIA 2Y33A 4E8DA 4LBOA 4X66B 3HKCA 3SH3A 1JZ2A 3ETEA 5B5EZ 1OMIA 5FMBA 1FJGO 1R1A3 1PO12 5A9GA 4DR1B 1EY2A 3ZPYA 3R05A 2RR13 3ETQA 2WQ4A 2H0BA 1ZZ6A 2VZSA 4MTOA 4JI3B 1W9TA 1V6JA 4UT5A 4CS2A 5KXBA 4RS5A 4XQWA 5LGNA 3BVCA 3OPZA 5APAA 3CMEV 5IDJA 2AZ5A 4I3PA 2X10A 4QGLA 3LNNA 5A3WA 1Y74A 2LW1A 3AXDA 5F3CA 4KG0A 4TUYA 1ASJ1 2ZIMA 3OUHA 5L19A 2W6IG 4JYYA 3ORJA 3JBG1 1KFXL 4IHJA 3BUCA 1M4WA 2PY5A 3B8MA 3Q8EA 5FBZA 3P3PA 5J2TA 4V1PA 5EV7A 3THPA 3WNNA 2OX0A 2SBAA 4PJYA 1H8TA 3G67A 2X05A 3S7EA 1R1ZA 2CH7B 2VZVA 4XUTA 2ZHLA 2YBSA 4XCAA 5BXZA 4HN0A 1LOBA 1WA8B 4GMP0 4U3JA 4AEDB 4FFIA 3KV6A 3TXSA 4R52A 1O59A 1EUUA 5JPNB 3K06A 5C3OA 2ZZJA 1RUC1 2YXSA 1VE0A 5I0SA 5KBFA 3SH5A 4B3SB 4KWJA 1O4ZA 1GP5A 2PAKA 4H33A 4HVRA 3PDQA 1PZ8A 1W6NB 1YIPA 3VQWA 3E22A 3WV6A 2PAMA 2BFUL 4RD7A 4LFBO 1HXS3 1US3A 1XMQO 1CPNA 1W3VA 3H50A 2HWD3 3J9SA 3OB8A 1ZBE2 2HR3A 1G1XB 2R1BA 1QEXA 2E33A 1OJHA 1FOD1 1I9RA 1KEXA 4K1YA 4FP2A 3RNSA 4GKJO 2Q30A 3VBRC 5IK7A 1F5FA 4B7KA 1GZWA 1SA0B 3P3NA 2ET7A 5A2QN 3DYOA 2KM2A 5BNNB 2XAHA 1OCCB 1HN0A 2Y69B 3JASB 4LR3A 4RO2A 2HKXA 4FTBA 2ZEXA 1CAVA 4R8CA 4LO6B 4Q4X1 2EINB 5LBCA 4S2HA 4NAOA 1URXA 4MTGA 1EZVH 4OLLA 2VR4A 1M56C 3KD4A 3K51A 4EFEA 1UQXA 2RMKB 3O1OA 4F83A 1S0BA 1KU9A 1PX3A 2VXRA 1RP3B 2JDNA 1S0DA 2ZNJA 2D3OW 2K2SA 1O91A 2FD8A 3J7NA 3WLUA 2PMWB 3FAVB 3NJZA 3O1UA 1RHI3 4QQOA 3F2ZA 4EZ4A 1SA0A 2AC1A 1RUC2 1BXHA 2YXYA 5GLTA 4JI6O 4KHPB 4JZ2A 3ILNA 4HXCA 1FNYA 5HFMA 1HV1A 2PF4E 3C7HA 4GIQA 1YFYA 3CJXA 3SPJA 4O4HB 2P5BA 3O5SA 3PVOA 2GH2A 1CAWA 1X9TA 3AP6A 3TXQA 3ES1A 3LQCA 1ODMA 1UU4A 3HR0A 2QGNA 3ZHSA 4GWIA 5ACA3 3I2HA 1ENSA 3ST7A 2ZPXA 3BRCA 3HR9A 4JGYA 4NTYA 4X1IA 3UQ8A 3FB5C 3RJ2X 1BCXA 1XMQB 3USSA 4LA2A 4NPRA 5C3SA 2PQQA 4O9EA 2QWNB 4Z2WA 3H7YA 1F8VA 1AR83 1DLBA 1OCRC 4K0KO 4UFZA 1ONAA 4FFGA 3JATB 2JIJA 4QX0A 2H6BA 2HFEC 5C8YA 5D1IA 3HVDA 2IXKA 1BKZA 1AI4A 1SQQH 3VN4A 4DMIA 4WM7B 4CCEA 3WF0A 3NV1A 2ETEA 3U1XA 1Q5OA 4Q4Y3 2PELA 2QCSB 4H2AA 5LY2A 4Q4V2 3U10A 2XPJA 1S0FA 4NXMB 4FLVA 2ZIOA 4R9DA 4Q6GA 5JVDB 3K4ZA 3BALA 3RZJA 3FLPA 4DB5A 5FXVA 2B9VA 4HK9A 1BEV3 5C4WC 3CCSV 3EHKA 5CBLA 5JJEB 1ZBA3 1Y7BA 4LA3A 4DV1O 1OKOA 2WT1A 3ZKUA 2WFF3 5JCTA 5EWSA 3HNMA 3WNMA 3AP4A 1M9NA 3BOPA 4M3CE 1WP7A 2IXCA 3ZYJB 5AG2A 5EBLC 3BU7A 1OQEA 3W7UA 4UBGA 2VQFO 1GICA 1YF2A 2YIBA 1VJ2A 2EIEA 3KT4A 2P34A 2JDHA 1HW7A 3BPZA 2JG8C 2WWJA 1LR1A 3CJIB 4C7UA 4RFRB 4ZU4A 4GKYA 1WD3A 2G19A 3KLSA 3RYRA 5B1AB 3PNAA 5FP7A 1Z2GA 2CDYA 1FX5A 1OV9A 3KSCA 3MHHC 3CEIA 4P9LA 2O8QA 3RYCA 1SLTA 4HONA 5JXHA 2WQZC 2XTAA 3AG2C 5DN2A 4LNUA 4XFGA 1RUC3 4LO8A 2VL4A 4W6WA 5FKBA 3VKNA 3IWZA 4GQ7A 4LBMA 2P4KA 2EAKA 1P4RA 4PDLA 2XBO1 1T6BX 4YW6A 5FYSA 4BQ1A 3GWKC 3N9NA 5FP3A 4C0BA 1HWYA 4K8RB 3QNEA 4UCSA 3BYWA 2HJDA 1YYNA 4WM8C 4RHV2 4HFSA 1IQDC 3WP3A 4R4XA 2ZCWA 3POJA 1RUOA 4A6SA 2ARBA 5FBJA 5E6HA 2W3JA 1GNHA 3FFZA 2XVGA 4UFIA 4ARXA 1SLCA 3PUHA 3SH4A 2DOSA 4BLIA 1EV13 4U7NA 2W0FC 4QPGA 2LGWA 5FMOS 4LP8A 4KXRA 5F5AA 1RPOA 3JU9A 5K8SA 5D5QA 3NKGA 1AJNA 3V56A 4ZOLB 4A42A 2A75A 2BGCA 5AFBA 2VULA 2EF6A 4D94A 5BNOA 5C3PA 4FPFA 4AVCA 4RQFA 2J1AA 4IV1B 1S1AA 2XL7A 4XURA 4CC6A 3SGIA 1RUJ3 1W90A 2LGQA 1KYOF 3CCEV 3AKRA 4P9WA 4N53C 4Y4YA 1JJ2U 3GALA 3O1VA 2RR12 1SZBA 3P32A 3KMHA 4IE6A 4M0HA 2XLGA 3LAGA 2JEUA 1Q81W 3PMSA 2ZDIA 3JD73 1Y4WA 3DECA 1WCKA 3J8F2 1WLCA 1YUDA 1COV2 5F5IA 3TNQA 1FAFA 4BK4A 4XIKA 4YVSB 4J41A 3OAAG 3ACLA 3VHNA 4MW8A 3VBUB 5IATA 2DCZA 3WF3A 4HPKA 2LW8A 3I5DA 3X2QC 1JJOA 1JCHA 4IETA 1FI2A 4P30A 3BAAA 3J26N 2WZR2 4Y26A 1B06A 2RCVA 3AYCA 5T54A 1EUTA 2P3JA 5I0TA 4P9GA 1J5EB 1O5LA 3MHZA 4CDWC 2BW8A 2JXAA 3Q4HA 1QXJA 2ZHMA 5FYHA 3SYOA 1V6IA 2XWJB 2WNVB 3JB8A 5FPLA 1CIYA 1B35B 3H9AA 3WINE 1RFYA 4FAHA 3DKWA 1XEQA 1YTFD 4L87A 1OQ1A 3N36A 5JOWA 4FXGB 3K75B 2RDRA 3UT0A 5J2UB 1S72V 2WLKA 1V55C 3U37A 4B1LA 5L9BA 3IKWA 4HKOA 3OOXA 4D7TA 2HWB3 2Q8OA 3VBSA 3H1YA 4N23A 4Q4Y2 5BYNA 2YPDA 2K1EA 3MI8A 2ZEYA 1SFYA 4XVHA 1U5YA 2ERFA 1RTVA 2W08A 1QNYA 4FO9A 5F2SA 4XUOA 1R3JC 5F7UA 2A7AA 3LUTB 1DK1A 2ZBJA 4EZHA 3ZXJA 2A6XA 1NR1A 4LLFA 1KBHA 4FPYA 3VHRA 3N4MA 1JUHA 5BR8O 2KG7A 1R6TA 1W0NA 1XNAA 5FFOC 4K21A 4LF5O 3H1WA 1E5RA 3OUIA 3WOGA 4CXXA 2Q1FA 3AP5A 1BMFG 4J10A 1IGOA 5DECA 2WBKA 2XJSA 3VD7A 2DQ3A 5FUIA 5JOYA 4LH6A 4CP9B 1FS0G 3DXRA 4LH7A 3T1YO 5FZOA 4JDOA 3VZNA 3RG0A 1CJPA 1AR81 2A3WA 1W8TA 1R3IC 1C4RA 2XLAA 4MS2A 4JV4A 2X8KA 3OM3B 1BVP1 3ASOB 1HRI1 4J6GA 2FMLA 3CD6V 4FMTA 4LKFA 2R9RB 1MZ6A 1RJ7A 1COWG 5LL6Y 2OUJA 4NRQA 4P14A 5CMUA 3VKFC 1H30A 2PHXA 2J1SA 2VOVA 5TSWA 2LRPA 4YZ1A 2Q0AA 3RN4A 3T4DA 1HDJA 1I5PA 4G3YC 2P5OA 5DAWA 4WBNA 3VHPA 3O9OA 2X7RB 1JZ3A 4YHHB 2HWF3 5J96B 5F5QA 3CJIC 2ZE8A 3CCUV 4YG3A 3JARB 1G9FA 1UW8A 3ZHQA 3IAYA 2JX9A 2FZ2A 3H7JA 2ZR2A 1HJGA 2D44A 3WG1A 3LSDA 1ULCA 5JH7A 1BYHA 1Y4MA 3JZVA 4U36A 3M3IA 1QJX3 4MSVA 1JYXA 2XR4A 2A06H 1OSGA 3DGEA 1V9U2 5FPAA 4DUWA 4OI1A 4AYUA 2EIJB 3UJOA 3RYPA 3CJHA 1H8EG 5AC93 2WR9A 1FATA 2KXLA 2GTAA 1KMIZ 5B1BB 4AGGA 5LA2A 4EN9B 4YFZA 2Y6KA 5KA6A 2VWJA 4R4ZA 2CNAA 2R49A 2E9QA 4LBQB 1PM4A 3GNEA 3LSEA 4Y20B 2PHUA 2A71A 5ISLA 1NI8A 1F7YA 3FZ3A 2X5IA 1F35A 3ZCCA 4M4PA 4G28B 4TV8A 1KS4A 4Y1XA 1A78A 1LHWA 2ZX1A 1VLNA 5B66Z 3R0RA 3ZHUA 2ZACA 1YJKA 3W7SA 4QQLA 4E4SA 3SR2C 1AL22 4I9QA 2R16A 1OFNA 1H38A 4FSJA 2CWMA 4DV2B 3AL6A 1AR93 3UESA 4LUKA 3CMGA 2QQWA 3IT8A 3ZFEB 3LFMA 4RL7A 1JPXA 3JBG3 3S5AA 4DXZA 4H14A 4P08A 3SYQA 3EB7A 1VMHA 2EULA 1Z7S1 2WAOA 4P02B 3U4SA 1MS4A 1N33O 2QDRA 4GT1A 1YITV 2QM4A 3ZVXA 2DFCA 2VU9A 3JD0A 1AYM1 2YY1A 1S2BA 5FLXN 3IIIA 4Q27A 1V9U1 3GCWA 2VNGA 2GSMB 1V00A 4O4IA 1ZBA1 3QCWA 4J11A 1DYKA 3A23A 1VF5B 3ZHTA 1DDLA 2ARXA 5IE9A 3U78A 4W4ZA 4D6TH 3E35A 3VBUC 3VBOA 4NXNO 3CQOA 4Q4W1 4P9XA 1ZBE3 4YARA 4CUBA 4IV3C 3OGJA 4CEYC 4J7ZA 2KD7A 1WLEA 3JSLA 5A33A 2XVLA 3VV1A 3BEHA 2Y38A 2RHPA 1R1A2 1YXWA 3WU2Z 4HSLA 3CO2A 4ARYA 2UWBA 1ZLZA 1GANA 2ORXA 1YI2V 3ZYPA 2GBOA 5A7PA 4LT5A 1TMF2 5K7PA 1WMEA 1O7FA 3A0NA 2I74A 1OQDA 1G9AA 4JYCA 1OF4A 2D3PA 2VMFA 3KV9A 3UK9A 1VRH3 1OURA 4DV4B 2HJFC 3ZFGB 1LESA 1JS9A 5FJKA 1OXCA 3VDDB 4LITA 4XUQA 5EIBC 3GCXA 5FY0A 3DYPA 2XAQA 4WVMB 3HQUA 4N90A 2HHHO 3LIHA 4NOTA 4NWVA 2WPDG 4RS5C 1REFA 3BKZA 4NHLA 2HWF1 1GMGA 1C5IA 1DGWA 5GTHZ 4IEXA 4FM1A 1LOAA 2JG9C 1JOBA 3ZMTA 1EN6A 3K5OA 1UNBA 2UY9A 3THTA 4AWDA 3FMGA 2P37A 4X8AA 3CHXA 3FJSA 2OCCC 4J9YB 2GSYA 4CCMA 3VBHC 1RUNA 2XL9A 1JMUB 1SCSA 5DABA 1HNWB 4BR6A 1UMIA 1NY72 4QPIB 4IT5A 4JHZA 1U0AA 2IZWA 3M3EA 3TN93 5K9YA 5KLVH 5GZCA 5BR8B 4DUVA 3SYAA 4L8JA 5EZWA 1SQGA 4JQTA 3C8XA 2ODMA 1JUIA 4TV9A 4UOJA 5CA6A 2UUCB 3ZYHA 1Q90D 2YXHA 2VQFB 2VS0A 3ZXKA 3KVAA 5CN0A 5F6KA 2YPJA 3MD0A 4JC1A 5CA3A 1VQPV 1Y76A 1VQOV 3U14A 2HLEA 1X36A 5LA0A 3LCPA 1MVEA 3WF1A 2HJIA 1C8M1 4S2GA 2HWC3 2XJTA 3N9OA 3N2GA 4WVVA 1DQ4A 3DN7A 2PYLA 2VUCA 1U5XA 1HR0O 4E4DX 5I0DA 5IUQA 3KQ4B 3WQ1A 1STMA 3ZN6A 1HB1A 4COYA 3CEWA 1HNWO 3KV5A 4QX3A 4KFMA 4JF3A 2HKOA 4JI2B 2W87A 4JKLA 4YZ3A 3CJIA 3ME2A 2Q1MA 1Q8QA 3HKCB 1ACCA 3UM7A 3TAYA 3K3NA 4HPKB 2JD4A 1QVGU 1Q6UA 3RT3C 5JCOC 4DV5O 3RYCB 1GOFA 4FM2A 4OQ9A 5T5JA 1VBE2 2JB4A 2ZGMA 4QHZA 5BNQA 3R4SA 4IEUA 3HPNA 1W8HA 1PMJX 3J7AU 2WAAA 2HWE1 2BEOA 1Z7S2 3K0DA 1JU3A 3NSTA 1ZAUA 1ND2C 5J2UA 2QKDA 1NJIW 2N05A 3IPVA 1XNCA 3E6BA 2XLFA 2WO1A 4ISRA 2X6BA 5B1BC 2WFF2 2VY0A 4JYAO 3EO6A 3C90A 5EYPA 4XJUA 5B2GB 2XG3A 1LHNA 1VBD2 2EJ7A 5I8YA 1N0NA 1YTFB 2YC2A 4LWSB 1EBOA 2Y64A 1MG1A 1DLLA 3R4DB 3E97A 1IHMA 1W04A 2FCUA 2ZMKA 5BNPB 1WA6X 5KHHA 5J7MA 5FXWA 4HL0A 3DCQA 2WAMA 4MXVA 4URAA 5FREA 2GHYA 2UUAO 3IGAC 4D6QA 3HKBA 1FAYA 1GYKA 5KUKA 4YZ2A 1GN2A 2D6KA 4LF7O 4PLOA 2LFSA 4PA6A 2WKKA 5JWPA 3LSQA 4Y5SA 4QPIA 1IKQA 1XDCA 4ZY9A 2PHDA 1AR82 5A7SA 3WP4A 4IEYA 3VDCA 1PM9A 3KHBA 3M99B 3WDWA 1OCZC 5JMOA 4FFFA 1V55B 4OFGA 5DDJ1 4CCCA 1ZRRA 4GB31 1TZOA 4Q2FA 1SBFA 5FNVA 3WHUA 4I50B 1VMFA 1QHDA 2UXBO 4YLZA 3FB8C 5EC2C 4NTXA 4LK7A 4JZGA 3A0HZ 3ON7A 1OUSA 5LBFA 4HOOA 2EJRA 4UXAA 1IDSA 1VAVA 1Z0HA 3M7AA 3QBQA 2WZR3 3AG1B 2DUPA 1W59A 3ABLC 1V6KA 1QCEA 3URFA 1H8HG 4KHPO 1HX6A 4HKLA 3USUA 1RHI2 4RWUA 5FY7A 5FYYA 4CDXA 4DUZO 3BA8A 4B4PA 4M3CA 1H2KA 2BV4A 3ZJZA 2TEPA 4WFBV 1CAVB 1FFXA 3IDAA 1UOGA 1DF5A 3STZC 4JDNA 1UJWB 3ZMZA 5IT9N 3RDIA 4GWMA 5D2AA 4MYEA 2ZXWC 1UMHA 4HETA 3ZO0B 3UO3A 1XHZA 1OH4A 2P6HA 4W6YA 1W8NA 1JZ6A 1KJRA 1LOGA 4AI8A 1NZ6A 1VP6A 2R0FA 4L2NA 5CBFA 3E6CC 4C1XA 1D2DA 4WCEV 3KWVA 5EJ3A 2HP8A 5LK5A 5C9AA 1ND3A 5IY5B 2YC4A 3E2EA 3GZAA 4NHYA 5IHRA 1HJFA 2RS33 4Q1PA 1PKXA 1R6NA 2I07B 3AZXA 1J95A 2Z4FA 2E76B 4JYBA 5EXOA 4F6EA 4AFBA 1Y6XA 1S5LZ 4PF1A 1ZZ9A 1AI7A 1HRV3 4BYYA 1ZUQA 2XJRA 5CEHA 4BW5A 1XJAA 3KM5A 4XF9A 3K3WA 2OZ6A 5KX5B 1OOPC 1GRJA 4QDQA 5FY8A 4UW4A 4EN7B 1CP9A 2QWPB 1PPJH 3POIA 4U3FH 1X8MA 4CU7A 1GQPA 3QH7A 1RUF1 2G38A 1JYIA 5BNOC 3NO8A 4IE0A 2ADQB 3DSQA 2FDGA 4C90A 3LWCA 4DUYO 3BA9A 3E8GA 4H7MA 2Q7EA 3A7QA 1RHI1 2OYQA 5K1PA 4AI9A 5KWRA 4YJ3B 3WFVA 3VBOC 1L0LH 2IXJA 1GN4A 3H8OA 2P67A 3RYFA 3OEAA 1S0IA 2D5FA 1COV3 5A7QA 5K1XA 3BN6A 5C3RA 4UCRA 3VKLA 4O4JA 3N9PA 4DUZB 4DV3B 2BGPA 1IBKO 5HFLA 1ULPA 2FMDA 1OUXA 1JMKC 2Z79A 2J1EA 4KL1A 4TWTA 4JI8O 1YRZA 3WQ7A 2OZJA 4RA0A 4D6RA 1VBB3 3M3QA 2BFUS 3PL0A 4NIIA 1CPMA 1XRUA 1GO3F 4DR2O 2CL2A 1NTZH 3SJCC 5L3CA 2VMHA 1BS3A 1OD3A 4Z07A 1QJU1 1ZA4A 5FP8A 1FYUA 2V1DA 4RGAA 5LRRA 4CP1A 4JGZC 5JQGA 5GLUA 2IM9A 1RVF3 4MHUA 4PI2A 4YWAA 5KC6A 3SC7X 3IZOA 3F95A 4BQWA 1WCQA 1HLCA 3PMEA 4NB5A 1H8VA 3MFCA 4CU9A 5A6ZA 3AYDA 1S0VA 3P6BA 1ENXA 2R072 1TNFA 1HNZO 4BQ4A 4H55A 4CCDA 4XMIA 1WW6A 2X5IC 4IE5A 1NVPD 3OTOO 1AR92 2ZX2A 3MHSC 5FPUA 1BK0A 2VTXA 2UU9O 1W3XA 4QXCA 2RJ2A 3ILFA 5CZKA 1DIWA 1U5IA 3UGGA 2DCYA 1LEDA 2OIEA 3UL2A 1KQSU 2D6NA 2QWRB 3E22B 4DRXB 1WCDJ 4NKGB 4W4LA 1PNGA 5IYZA 2HLDG 1VBC3 5A3PA 1WB7A 3D36A 2F4VO 4I0AA 2C5DA 4Y5TA 1RUH2 2BTVC 2P1BA 4OULA 5ANNA 4XE9A 4IEWA 4MT8A 3N3HA 5FYBA 5DQ0A 1JN2P 2FDJA 2PHWA 3CC2V 3GDBA 4XJ9A 2PTMA 1X33A 4EV0A 4JTCB 3ZS8C 3OGSA 1A34A 4MVTA 1RB8G 5LHHA 1XHXA 3AFKA 3LEMA 4OHXA 5CA0A 4DV7B 5J98B 3BY6A 1W2AX 1T5EA 2JEXA 1HB4A 1VB2A 4X8PA 2RJLA 3O65A 1IX9A 2WO2A 5LY1A 3DPRA 2OT5A 3NMBA 3CKHA 5DM6V 1S77D 2VUJA 5FYMA 2YSUB 4TOIA 2R071 2G1MA 3MUY1 4QGNA 4G27B 4CS4A 5JVDA 4IGOA 3FBMA 1LJ7A 1ZTEA 1HB3A 2Q73A 2YGLA 4JI2O 2RS12 1P8JA 2TUNA 3I8TA 3OEEG 2XBO2 4LIVA 3A22A 4QXKA 5ABJC 1BZKA 2WDBA 1S0GA 3WDVA 5LGTA 1UPGA 3ZEDA 4IGPA 5F1RA 1O9HA 1IQAA 3ACGA 5ERLA 3IM0A 4X1KA 1QJU2 5DUXA 1BMV1 5IYDO 5KHJA 2NMOA 4F7ZA 3NJYA 2Q1ZB 4ASUG 1OLMA 3ZFEC 1I6XA 1QJY2 1QXRA 4KBZA 3LSUA 2HWD1 4RN5A 4L9BA 1EP0A 3OUFA 1Q8IA 4BMBA 1Q8PA 2UXCO 2WA4A 1L1FA 1J5EO 1OA2A 1CIWA 2XAGA 2ZGRA 1N36O 3ZN6B 1P84F 4JRLA 4FFBB 2UXDO 3K57A 3QLQA 5JVVA 1V6LA 2WNVA 3SMHA 2ZKLA 5K0UC 1K5MA 5C8CA 4QKFA 1POQA 4LXLA 4RFT0 4WZFA 4PLNA 3AG3C 1Q8SA 5JIUA 1I1EA 4JGZA 2VPVA 3RYFB 1RUH3 2WJSA 2HWC2 5IT6A 1X9PA 2WNUB 4I0XA 4JI4O 1GKFA 2MHFA 4E4EA 1AYM2 2GDFA 1MMMA 2DE0X 4LF9B 3ZN5A 1M57C 1N34B 2ZABA 1MS8A 2ZKOA 2WLPA 5GLZA 3P30A 4O4LA 1TE1B 1E1RG 1ST8A 3POYA 3BODA 4AEDA 1IBLO 2D43A 4JGYB 4JI8B 4K9SA 3TWIA 2XKPA 5EZYA 1CAXA 1DG6A 4NXMO 1PMIA 4YGCA 3UYJA 5GONB 1Q7YW 3ENRA 4MZUA 4O65A 4C0HA 3JAKB 3HOBA 1TGOA 3IJ4A 1UKGA 2Q8DA 3ZMNA 1Y9QA 4GH4C 2OIGA 2BOBC 1H2LA 2NNUA 1IG3A 5FZGA 3JCUZ 2Y6FA 2FDFA 1SQVH 5TISZ 1OOPB 4BDVB 1BBT3 2D97A 1GM7A 3I2GA 2UXNA 3TEZA 4GALA 2FKXA 4DS0A 5FZIA 4DV7O 2BP6A 2WWUA 3FLRA 4MGSA 1GK9A 1QJEA 1HNZB 4TLGA 5DAXA 1PGW1 1W0OA 2VRZA 4GB33 5CG8A 4OUSA 1ZZCA 1MS3A 1WLWA 2J7MA 4FI9A 5B3SC 1J3QA 1OCRB 4JZRA 3VBOB 2YDEA 4EB6A 1GN6A 3K59A 4L92A 4DEQA 4JI0O 4YZ5A 3ASOC 3GZEA 2BERA 1YQ8A 3ZFFB 3T1LA 5FZLA 3KGZA 2F4VB 2JDUA 5FLHA 1K12A 4IL6Z 4FXKB 1IURA 5C9AC 1CAXB 5E16A 5A3UA 4X64B 5D8AB 5KHGA 1KITA 4RGGA 5FMCA 5A70A 4KGGA 2AACA 4YGDA 2YFZA 4I50A 4UF0A 3PURA 4AVBA 2VZRA 4CP0A 3KZ4C 2AHZA 5CA0B 2W5FA 4FCAA 1SLAA 4CDWA 2TNFA 1K97A 4NVPA 3B77A 3N2KA 2BBVA 4FK5C 1OA3A 3NNJA 2ZMLA 5FTTC 1VIWB 4PA4A 4PLMA 3EXUA 1H8TB 3V65A 1YXBA 3E6DA 5H2FZ 4LBQD 3T2TA 2JDYA 1AR4A 4QGPA 1H6YA 3RI9A 4XJWA 1VBA1 4RQPC 4QPGC 3FWEA 2D2CB 3AG7A 3RW0A 3UKNA 3A0BZ 4FLWA 5LEKA 1KKDA 2ZM6O 2ZMNA 2YC0A 3N9MA 4N7IA 3ZIAG 2W1UA 1SBDA 2VH9A 5JOXA 3NKTA 3CIHA 3QD6A 1SS3A 3B00A 1QR9A 3O1RA 2VCCA 2DQ0A 1S5HC 3NNFA 5L73A 3FYIB 1HP8A 1N34O 3AB0A 2J1VA 5B1NA 3HQRA 3PUSA 2BTOA 3T08A 1TME3 4QD2A 1V6NA 5JI9A 1K3EA 4LBKA 1XPWA 3PJQA 2GNMA 4HNAB 3S3XA 2JG9B 4UAPA 3CCMV 2PQSA 2WLLB 2HWF2 1AX1A 3WW2A 4XTPA 3MYXA 2QEXV 1ENRA 4Z82A 3I2JA 4CDUA 4UW5A 4MVUA 1FD9A 2D40A 4I0BA 1W6MB 4K8FA 1VQMV 1PVXA 5H9SA 1J3RA 3VBFA 4XF0A 4ET7A 2Y6JA 4N7UA 3I49A 2QBXA 4KWLA 4N43A 2VMCA 1AF9A 1GM9A 2A5ZA 3HD8B 1HV0A 3QO7A 3POGA 4LHNA 5FO8B 2Y0IA 5L3FA 3HMYA 4E9KA 3Q8AA 1UX6A 1AR62 1DQ0A 4CU8A 5A7WB 4B3MB 4A41A 1X59A 1CAWB 2J42A 3D0SA 2F6BA 4IEQA 5EPAA 2UY8A 3AVRA 1Q43A 4FOYA 4Y24A 3OGCC 1XBLA 3LOBA 4JCKA 3OR6C 1AUYA 2MEV2 4H3WA 4ORFA 3ZYIB 3N2GB 4COVA 3WP6A 1OLRA 5GKAC 3K04A 2XUMA 1GWMA 4Q0UA 1ZBE1 4GULA 3L71H 5KAFZ 1SLLA 2RS52 4IV1A 2X5IB 4FOQA 3FBYA 5C71A 1NYWA 3OBRA 2O8OA 1C5HA 4CH5A 1NY71 1VIBA 4A6OA 4KU7A 1PK6A 1W8OA 4COZA 4LEJA 2EIBA 4YVSC 4LFAO 4YW1A 1DZTA 1MS9A 4CRQA 4AVSA 1FPN1 2V4DA 1RUG1 3U0ZA 1O3SA 4LBLA 4HMZA 5DDJ3 4PV1B 2R6QA 1SBEA 5FK8A 3ML0A 1MS0A 5FWEA 2VGDA 2Q6AA 3S57A 4WFFA 1JBCA 3ZFGC 5LMUB 3H1LH 5FQ0B 5GALA 3BVOA 3CX5F 2C24A 4E2SA 5EJ1B 3EYPA 1QF3A 2Q5ZA 5IYCO 4C91A 1AR61 1B3QA 1LHUA 2D98A 4JI0B 1H1IA 2VW2A 2X6CA 3IMMA 5A32B 3UT5B 4FLYA 1QH7A 2CYFA 1G6UA 3BIEA 2OCHA 1WCSA 3VLBB 5C8WA 1YJWV 2VBDA 4X62O 5A3MA 1BBT1 1BQZA 1F23A 1S4CA 4XXPA 3D4KA 4IUGA 3K4AA 1DQ5A 2WFF1 3UGHA 3SLIA 1HQWA 2VG9A 4XJ8A 1QWRA 2ZGUA 4YZ4A 2ZXWB 1VF6A 1XYOA 1AP5A 3PTRB 3KB5A 2DVFA 4WFHA 1WMXA 2O1QA 4MV2A 3CL1A 4UCOA 2DYSB 4I3GA 1W6QB 2IFRA 2F93B 4IQPA 3GZTB 4A3XA 4BIOA 1FXKC 3QF7A 1OLME 4GD4A 4B4RA 1SQBH 4LBQA 1ULFA 3JD71 2DURA 3LA2A 4BIFA 4PELA 4Q29A 3ACIA 3HJRA 4DR2B 1F31A 3BHPA 5CKQA 1OCOC 1AYN3 2NN8A 1PL4A 1J83A 1PVC1 1YFUA 1UYXA 1GBGA 2JGDA 5BXXA 3CRAA 3WB1A 5A32A 3R66A 3RJRA 2R70A 3T4ZA 1BQPA 3JCIA 5FV3A 3TEYA 3OTFA 1N32B 2MEV1 2EX3A 2VCBA 3AK2A 5E79Z 3ALQA 1MNGA 4H7LA 2A70A 1R73A 2BE3A 5LA6B 1QJX1 4BA6A 2KG7B 4DYLA 2W92A 4JASA 4IEOA 1NKGA 3ZFFC 1DCSA 1KC8W 3RBZA 1A8MA 1EFRG 2WZR1 1IS3A 2PUSA 3JAKA 3POEA 3WF2A 1OZ0A 1LU1A 3MBWA 3F5WC 3H42B 1RSOA 1W0PA 5F2VO 3OPWA 1J58A 1SKVA 3VQVA 3SCHA 4AFMA 3ZXDA 4XF3A 4Q20A 1OBNA 4HG6B 4B7EA 3NNLA 2RQ6A 4YY3B 2GNDA 1RUJ2 4WFEA 4C8DA 1YQ6A 3T4VA 3AMQA 4IYIA 5F2WA 5LXTA 2YIAA 2XJUA 4OXSA 2DMXA 2YBPA 3O12A 3O0XA 1DGRA 5GLVA 1ENVA 3D82A 4DV0B 1DGRN 4RQEA 4BM8A 2JKXA 5FLJA 4K6BA 1QR8A 3V0AB 4DRVA 3VDDA 3SCGA 4RR3C 2ID4A 5C6CA 4I55A 1ENQA 2MNGA 2QTOA 5IVJA 2L6LA 1D7PM 2XKOA 4LE4A 2RS31 4KWUA 5E1RA 1ND3C 1WPBA 1VRH2 2V72A 4Y20A 1XOUA 5FYUA 4OUMA 1XE0A 3A21A 1RSOB 1KD7A 3O14A 5CYYA 1UL9A 1YO8A 4DXTA 1YI9A 2HEPA 4QPJA 3ZDVA 1QLNA 3K0GA 4HN1A 1RINA 4K7JA 2XONA 4LPLA 1RXFA 4FP3A 2ZT9B 1WJZA 1UOJA 1UIKA 2XOMA 3EQEA 4DV2O 3W7WA 4XJZA 3CJHB 1VP7A 5JAXA 2C1FA 1RUG3 1FXKA 4X8NA 2QZ2A 3VZOA 3E1F1 2D6LX 3GJBA 3VBSB 1WLDA 4LKDA 2ZJCA 1SPPA 5CU1A 3DUIA 3ZXGA 2ZGSA 4Q8LA 1MQTA 1QIQA 5EP9A 5LYJB 3MFAA 1ALYA 4WZCA 4YW4A 2VVFA 3EFFK 5LRSA 4DV3O 5JQGB 2B9ZA 1GNZA 5DN6G 1MOFA 1G6NA 3WUDA 3E5UA 3AMHA 1N4CA 5L7OC 1AYM3 3L73H 2NMNA 2AYHA 2YU1A 1RIRA 1RGSA 2BOJA 1RM1B 3D0JA 1O4YA 5KXEA 3I56V 1UXXX 2QQOA 3VBBA 2ZINA 5DZGA 3NR7A 1COV1 1GV9A 4K35A 3HAGA 4AQ2A 2JDMA 1A32A 3GBGA 4Q4X3 1W05A 4CS3A 3E5QA 1QLEC 2K46A 2W2IA 2BU9A 3GHMA 3TJTA 5BY1A 2ZE6A 1GLHA 3JQWA 2OW4A 1ZWIC 1ZREA 4CXYA 4XHBA 4TN7A 4K8XA 3ZMOA 3TEWA 1VBA2 4MADA 1W6QA 3BIWE 1IS5A 2ZHKA 4P9IA 3CCRV 2VOWA 4OHYA 3N2KB 2EIDA 5LK7B 2BNMA 3W9AA 1JI6A 1OCCC 2YI9A 4QNHB 4P2ZA 2C2AA 1NXD1 3JAMN 4HAMA 2WLLA 5E88A 1VAMA 4DO0A 4FPLA 5CG9A 5JZGB 4JHTA 3KKYA 5C3QA 4LF4B 3PTYA 2ITDC 2ETNA 4MTXA 4JI6B 4Y1VA 2R32A 1R1BA 3MF6A 3TN91 3H3ZA 5EK0A 2RDSA 4CH3A 4GMP3 4MGYE 2QWQB 1VQNV 1XSQA 5A1LA 3ZN4A 2VW0A 1XMOO 3VL9A 1ZM1A 3UT5A 1VRH1 5CISA 3J7MA 5CFCA 2BYVE 1HN1A 4NRPA 4FOVA 3I97A 4A44A 1YHQV 1MPXA 3T0DA 2RVAA 4FAGA 2FCTA 3OD0A 1RM1C 4DOUA 5FUNA 5JMCA 1H6XA 3ABMB 2KKWA 1UOBA 4PQQA 4OYUA 3SKVA 4S2DA 5J48A 2ADEA 4X1KB 4HANA 1M90W 4P9YA 1JOPA 2B46X 2QQVA 4GZ9A 4YJ3A 4RQPB 5HCBA 4EN6B 5EBMC 4BQYA 2VZOA 5IYYA 2DVAA 3JSNA 2UXBB 2YI8A 2YB7A 5FYCA 3FB7C 1H9PA 1D4VB 2WIIB 2EILB 3L74H 2WYFA 2N7GA 2BUKA 3HBKA 2CTPA 3WR0A 4FPPA 1W03A 2E5LB 5FZ7A 2OUHA 2AH2A 2CGPA 3SEEA 4YGBA 5DG2A 1EAH2 1AX0A 1IXMA 5KUMA 4LF8B 3B02A 3LOIA 2DCJA 3ZXFA 3C7EA 1NTMH 4D0QA 5FPXA 3AMNA 2A6YA 2QM7A 3HN1A 5JJNB 4UYBA 5FMDA 3VZMA 4QHOA 5C8CB 1VQ9V 1THZA 4PIYA 2DUOA 3RS6A 1JODA 1NS1A 3C7GA 2ADDA 3OFNG 3LKJA 1I5ZA 4FBFA 3C3VA 2RS13 5HXVA 4O2AA 2K9PA 5DEDA 4WFAV 4UW6A 1LNQA 4MVRA 1D0GA 1Y3TA 3I3DA 2EBOA 2HEVF 5CB7A 1DQ2A 3AEIA 3OBAA 2H8PC 3UKVA 1Q8OA 2KB1A 3STLC 4ZHQB 3H0OA 3WHTA 3C7OA 5IJ9A 4IHJB 4G2KA 4K1ZA 1SCRA 3WDXA 2E26A 3ZMSA 4YPJA 3LDKA 2R073 1SQ4A 3I7DA 5ANQA 4PJ0Z 4CEWA 2XASA 1S55A 2JG9A 5LYJA 4NUBA 2WZPP 1PK6B 2XB6C 4TQDA 2BJSA 4PA9A 5I91A 5JSRA 2B1GA 2XXZA 4DV4O 5F3IA 1XC6A 5LOVA 3G80A 1EN5A 2HEWF 2WSSG 5ACA1 4AI2A 4KH9A 4G4FA 3J8F3 4UCUA 3ZRVA 4AGVA 1NBMG 2PYJA 4XF1A 4OGQB 1CX1A 4LE3A 3I55V 4QM9A 1K4DC 2Z69A 2WUHA 5KHKA 4RR3A 1OD5A 3E8HA 4AQSA 4MGZE 1E5HA 4COWA 1I94O 1G86A 2XVKA 1OC1A 1XE7A 1GFF2 5FPOA 4EEQA 5LMNB 1S0EA 2UU8A 3WDYA 4K3UA 4DR5O 3M4FA 1DQ6A 1XQ8A 5BPXA 2D3RA 2WNOA 1G7YA 4NRMA 5FXZA 3I3EA 2VO5A 1WD4A 4I4TB 3OG2A 5J1XA 3CZUA 5FZCA 5C5UA 4OI0A 4MVZA 3V0BA 4PDWC 1YI7A 3OF1A 1L8DA 2BCCH 3MLKA 3E86A 2GU9A 4NIHA 3RVZA 3RWNA 2JE7A 3BCCH 4DR3O 1AR91 4L0PA 5BNOB 5L3BA 5IYBO 4NMIA 3AJYA 4EN0A 4B29A 5DMYA 5LP6A 2YIBD 3KF5A 5JPMB 1ZZ8A 4CDUB 1POV1 5LP6C 2PI5A 3DF0A 4M3CF 4M01A 2Z5UA 1AR72 2PXJA 3MLJA 2DDUA 3PJYA 1W39A 2X09A 3EHBB 1VBB2 4NROA 2BVBA 3CSXA 2ENRA 2TBVA 3V64A 4N53B 4AGRA 5AVPA 1POV3 1JFFB 5IAVA 4FFHA 1L3JA 1S76D 2QQNA 5IW0A 5HPOA 2H6CA 4ASKA 4D6SA 2PLV2 3MW2A 2IWGB 1Q8VA 1N1SA 5A1AA 4GLXA 1AHSA 1ZRCA 5CBHA 1FXKB 1K5MC 2OPWA 2E7TA 2JECA 4GX5A 3UGFA 4YFWA 4GWJA 2QE7G 4PI0A 2XQRA 5JR2A 2QTSA 1WWYA 3HWJA 3ETGA 1LHOA 3ASIA 3OD4A 3JALB 4JGZB 2NN4A 3CPWU 3KZIZ 2J1RA 3IAQA 1K92A 2QQJA 4AQ6A 4PF5A 2OS2A 4PHZA 1XREA 1DGSA 2FBEA 3KQRA 1Y9GA 4Y1UA 4FVVA 3ZFEA 5FZDA 4XC9A 1KGYA 4M0NA 2QQIA 3NW4A 1JX9A 5CFDC 2VQ0A 1K9MW 4EYUA 3I3BA 1JZ8A 2W47A 4LMFA 5FZAA 1LTEA 5H9QA 4F3JA 1QDOA 3N7KA 4CYDA 2F1MA 4CEWC 1TAEA 1XNRB 4XUPA 3L2HA 3B01A 3KHCA 4GH4B 4INDA 1JOYA 4X6QB 2BOIA 1SETA 3KCCA 3NL1A 1GOHA 3L70H 5LMUO 2J22A 4AQYO 2WLHA 3AK0A 3H1KH 1A6CA 2Z42A 3LA3A 3I3MA 1TVKB 1WBFA 5L9RA 2E53A 1HIXA 2IH3C 2QE3A 4BW9A 1K34A 3K77A 3SDLA 1V0AA 3OY8B 1GMMA 5B3SB 5L7OB 1DGLA 3AYAA 3TCUA 1MR5A 4EFBA 2ES3A 3BTAA 3UCSC 5A80A 2ARAA 1Y67A 5DUVA 2JG8B 3ATGA 2CV6A 3T0BA 1GKBA 5CNAA 2VZ1A 2C4XA 3ZSJA 4GX0A 2JD9A 3OY8A 3RVYA 2WN3A 4Z1VA 4CVUA 4Y22B 1KFUL 3CC7V 2X6AA 4BMEA 2OTLV 4U7OA 3IBMA 4NN0A 5KXDA 2BZDA 2FCVA 1PGL1 1VBD3 4UI9L 3A2FA 3D36C 4DV1B 2RMU1 4U2AA 3WCRA 2DYRB 1XNKA 1JHNA 4O7XA 4CEWB 4AW7A 4UB6Z 3WQBA 2IFWA 4AXOA 4MGKE 3RYIB 3S0MA 3RWKX 2PHTA 1H1AA 4BB3A 1F15A 4C1WA 2IXIA 4IIJA 1OLQA 2V5DA 3LEIA 2HBTA 5IAXA 3PVNA 2PI4A 4PBOA 3RVHA 4XJAA 3V0BB 5CFCB 4LHLA 1H9WA 4LFCB 1P7GA 4UUJC 1FFTB 1AXKA 1LEMA 3I2OA 1OF3A 5GJ6A 1GSLA 4FT8A 1MEC3 4LBEC 2IVJA 5DUWA 3VOUA 2B1IA 1K7DA 5DAQA 3MW4A 4IE4A 2R72A 2R063 2JICA 2YS8A 3CLPA 1I7FA 3CRRA 4DXWA 4O61A 3RWRD 1NH2D 2UUBB 2RDNA 2E7AA 3VGIA 1UYZA 4ASLA 3C2UA 2Y0PA 2QKCA 2YMZA 2BBAA 4QMAA 5HCFA 1NU1H 2WN2A 4ZKTB 4RHV1 2GDSA 5FY1A 4URTA 2BRTA 1B6QA 5J36A 2VD7A 4B3NA 3X29B 3B09A 3APOA 1NCRA 3VDBA 4B3MO 4FFKA 5LB6A 1RVF2 1ASJ2 1QLEB 1JYCA 1W8WA 4PBPA 4UCVA 2EZOA 4Z92B 5D21A 1K45A 1AZDA 3W5NA 4OVEA 5IVVA 1NCQA 5HV0A 4JTDB 4O4HA 1CD3G 1SLIA 4JV5O 2Y8KA 4ZXEA 4XILA 4RQPA 2QQLA 4AR2A 3AKPA 1RMU1 2LALA 1IPSA 4YG6A 5IVEA 2OIIA 3JXSA 2F4LA 2D5HA 4JI1O 3OR7C 2GN7A 4B08A 4DW1A 2GC1A 3WZ1A 4KU8A 5FMOL 4R9AA 5GONA 4UFKA 5T50A 1W8UA 4PDWB 1EAH1 3JD2A 3HPLC 3LDCA 5L7OA 4FVMA 3DC5A 1SRYA 3KT7A 4X65O 2VZQA 1LCLA 1XL4A 4LJHA 1MEC1 1W9SA 1CWPA 3Q4HB 3VBRB 4A45A 4ZHQA 4D7SA 5A1FA 2H3OA 3EBRA 5LXTB 5BNNC 5A7NA 4GA9A 4WM7A 3K5NA 3L9DA 4Y5Z0 1URFA 4BIZA 4BQ2A 4LOTA 1U12A 3WNPA 2BNOA 5BY5A 2CTWA 2YU2A 4MH0E 1JZ7A 2Z3YA 3T2QA 1I5XA 3RZKA 1HKDA 1GR3A 4JGSA 1F4MA 2JDZA 2W52A 3RYHB 1QY4A 4TQFA 2W1WA 3VUOA 4LBJA 2WINB 4ATEA 1U97A 2G9FA 2WZ8A 2V5YA 4UW3A 2QNKA 4DR1O 5A3NA 3WW3A 1NAEA 4H0LB 1DF0A 2P7TC 3EJKA 1O3QA 5CA1B 3SXWA 5FZ8A 1H2SB 4B3RO 3EMRA 2FTKA 4J7KA 1VR3A 2A7WA 2PHLA 2VUDA 4GWNA 4LLOA 1SG3A 2C6SA 2DCKA 5AC92 2EIKB 1HR0B 5JIAA 4TXWA 1W6MA 4ATFA 1J1TA 5FZHA 1UY0A 2HWB1 4AFDA 3CRQA 4E2GA 2W9XA 4JI5B 2P06A 2P6JA 5FIXA 1Q3EA 5IVYA 1R3KC 2RR11 4ES8A 1NCRC 2ZGOA 4PCRA 3ABKC 3PU3A 3ZBHA 3WQ0A 1QQP1 1AX2A 3CU7A 3GBFA 3FLTA 4JYAB 1UWWA 3HN3A 2ZEWA 3ZMVA 2XJPA 4J1XA 2IXLA 2CU5A 3T2MA 1UY2A 1MABG 3MIEA 5L9VA 1WLTA 1OI6A 4DV6O 1LHVA 5A6YA 2XBO3 1OVSA 3ZMUA 5FRAA 4JKKA 4N21A 2YV8A 2JJ1G 2VQTA 3ES4A 3MZHA 2C9AA 1JZ5A 2GZWA 4CEYA 2AHYA 4OX9O 3AG4B 4KBBA 3JD4A 1W2UA 2DYCA 3QO8A 2Y34A 2JDKA 5FZ1A 1UYPA 3CXCU 4A4AA 2DCTA 4XACA 4NO4A 5FAXA 2JJ6A 5JXGA 3KT1A 4XDPA 5BMVB 2A3YA 1GZCA 2B9UA 1M5IA 4B3TB 4TT3G 3NAPC 4RUFA 1HRI3 3ACFA 3OMNB 4UB8Z 1AJOA 1BEV1 3JD1A 1ORQC 4QIWF 3USUB 4DIQA 1TEIA 4BXSV 1GUIA 5FP4A 3FAVA 2ZX4A 2K9ZA 1YIFA 2WLJA 3P5BA 4CC5A 4DV0O 4DR6O 1R092 1N0JA 4NE9A 3ABKB 4DXRA 4LIUA 1F9KA 1WW4A 2XAFA 5KA5A 1FOD2 3ABTA 4YM2A 4XCBA 4MXWA 3LE0A 4CXWA 4YW3A 1BHBA 4LC1A 1WCUA 5K0UA 1C1LA 4LTAA 2E75B 1T2XA 4K40A 1KS5A 4KUMA 4E4HA 3WG7B 1ZRFA 3GBWA 3AP9A 1WA8A 2QTWB 3CXHF 1ND3B 4EE2A 2EXIA 3DPRC 1V9U3 2EIMB 4I09A 5A33B 3MIFA 3K79A 2IJKA 1K3IA 1Z5VA 2PYTA 1FXHA 1AR5A 3J4UH 1XNBA 3M1HA 1UZZA 2GP5A 5EIBD 4LFCO 2HWC1 4LWSA 1Z7S3 3RZGA 4QKBA 2HWE3 5DUUA 4P9OA 4QE9A 4TLFA 2QQPA 2RS53 5C4WA 4XFCA 2WNUA 1B35C 4NHMA 5HCHA 1G4YB 3E8BA 4M3CB 1G8WA 2E32A 1JH5A 4OZOA 1NQTA 2BVVA 2VOXA 4P00B 2DWEC 3D3AA 2RM22 3SJQC 1BHGA 1LGNA 4XZUG 3VDAA 3W20A 1UAIA 1AB3A 1AROP 1V54C 2O0OA 2YROA 1PO21 1SESA 2EXKA 4XMAA 3LDEA 5J3UA 4DZGA 1VBE3 1ULGA 3ABMC 1SFNA 4FPHA 4ZBMA 2WSUA 4MTFA 5HBAA 4S2FA 1PIV3 3IPVB 1Y43B 1CAUB 2KR2A 3CDZB 3PIJA 2ZGQA 2A3XA 3LB9A 1K5MB 2ZEZA 1L7LA 4CA9A 1V9PA 1W6PB 4W50A 1YJ9V 5IFTA 1OFSA 4DUYB 1NE6A 4AHZA 1FYJA 2VXJA 1W9FA 4AFAA 2ZOEB 1D4M3 4B3TO 2IJIA 1GQHA 1Z5WA 2AZ2A 3OCPA 1VBC2 4X6RB 2DVDA 4FLZA 4QDSA 2V09A 5D8AA 3B93A 4H44B 5J2TB 2RV9A 4BWOA 5FPZA 1AR63 1PNKA 4CCKA 2UYAA 1LR5A 2DYRC 3HB3B 3D3QA 3OUSA 1KP3A 1KDKA 2D6OX 3D3IA 4BQ5A 1I94B 2WFPA 4OX9B 1H4HA 2AZ0A 1R091 4TZDA 3POBA 3IAPA 3M8AA 5GW7A 1IS4A 3LPGA 5JI7A 4Q4W3 5CBGA 4PIXA 4DY5A 1QQP2 3SPHA 2RS32 4D3WA 3BTXA 5HCAA 4TSFG 3IDEA 1PV0A 4DV6B 4KG8A 1DGWX 3WCSA 4LULA 1JFFA 2PLV3 1XU1A 4LFAB 1VQ5V 4A2UA 1KP2A 1KECA 2VMEA 4K3AA 1KD1W 3ZDSA 2QQKA 2A1XA 1GNYA 3MLLA 1IPKA 1HQNA 4RS5B 5GZFA 2CHHA 5AFEA 3W5MA 2ZNIA 4WVWA 1VEWA 3RZMA 3M3OA 5I8TA 2VM9A 3L75H 2C0ZA 3AKTA 3H01A 3CYOA 3WNKA 5FWJA 1WMFA 4XFHA 5JUVA 4NHKA 4Y1ZA 3N9QA 1WB8A 1BVVA 3GHNA 2ARCA 1D2QA 2NP0A 2BTQB 1UF2C 4OZXA 2ATKC 3WNXA 4IDZA 3VZLA 1QKQA 1W0JG 4YIOA 3IN9A 3AZWA 4Y4RA 5FCCA 1NZIA 3RMXA 3SPGA 4GJYA 4P9JA 1YDXA 4J7JA 3BPSA 1UX7A 1CZVA 1AR73 3LEKA 2ZE5A 1YJLA 2YBKA 2VMGA 1RUI1 5GZGA 3LZZA 4WBBA 4HZFA 2JDPA 5I93A 1RVF1 3ZFFA 2DU1A 4WVZA 2F66C 1VAKA 1YWKA 4B3RB 2YUEA 4ZS3A 3HT1A 2WLNA 4XZPA 1US2A 3OTOB 2XGXA 3AXEA 4PDWA 2UU9B 5IYZB 1CXZB 4FQZA 4FPKA 1AL21 1W0KG 1GAXA 2IU0A 1YQ5A 4K0KB 4B4QA 4JTNA 2JIZG 3KG2A 3ZXEA 5KC5A 1QQP3 3MDPA 5FZ6A 4BQ3A 2JDIG 1M4UA 2M6YA 4ONUA 1ZL8B 1IKPA 2PHFA 3B9IA 1EV11 1S5JA 2EALA 5FP9A 1R3LC 3RZHA 2A79B 1REDA 1YVWA 1MS5A 2Y6GA 4H13B 2LM3A 1YJNV 4OQ8A 4F4LA 2VZ3A 3J80N 1LNSA 4XF4A 5H6RA 4HK8A 4XUNA 5H9RA 3MW3A 4RHV3 5FOBB 4N53A 2JKBA 1AL23 1O6UA 5CIRA 1X50A 2Q8VA 3MV01 2AGAA 2VTXJ 1PVC3 3ETDA 2NYYA 1O8PA 1AR71 5FUPA 3LIGA 3KVBA 3ZYFA 5FPVA 2VECA 3TGUH 4ZI7B 4GKJB 3WG2A 2V4VA 1D4M1 1DZRA 4TSVA 4BZ4A 4D7YA 3BOWA 3FKSG 2J1TA 5EJZB 2YG0A 4CDQB 3WB0A 4AAXA 1QJY1 2W46A 4BLJA 3JCZA 2Z0AA 3WVJA 2D6PA 1DF4A 1PNFA 2CSGA 3V0AA 5L3EA 1R083 2R1DA 1FKAO 5FZ3A 3OT7A 3VBFB 1CVNA 4QHBA 2ZGNA 1RL3A 4HLTA 4IGQA 1XXNA 4RGKA 3FFQA 2RM23 2R7EB 4QQPA 1QOTA 2Q8EA 1Y76B 1CEZA 2ZGPA 5T5LA 5A7WA 1AXZA 4W6XA 5BNPA 3X2QB 2R043 2DF7A 5LZ6A 3LDRA 5JSPA 4V2VA 1MSWD 3T3YA 1GZ9A 2NZ9A 2N74A 1SQFA 2BSKB 1PP9H 4UVCA 4LORA 1JYVA 2Y0OA 4HKWA 1LODA 1H2MA 4FLTA 2IXHA 3AG4C 1C8NA 5I0RA 3QO5A 5CFCC 2LUWA 2OQ6A 1E1QG 1J59A 4D8MA 1ND2A 4JPRA 1V6OA 4B3SO 1KJLA 1XQNA 1GWKA 1J3PA 1K8AW 5JXJA 3O0WA 4J80A 1LUVA 2WNVC 3U07A 5FDBA 3LA7A 4GYCB 1NH2B 4I01A 1OCOB 1D4M2 4JI4B 4HYOA 3M8LA 1BSMA 1IPJA 3AZZA 5FO9B 5IJ9B 3JAWA 1VB4A 3APBA 1E57A 4J1WA 4X20A 1FPN3 2QZ3A 1W8FA 1NVPB 4JX0A 1C57A 3PUIA 1XBFA 1NR7A 2BOCC 3B8NA 2RJKA 1LOFC 1KQRA 5FYZA 2CTRA 3THDA 1V70A 2HBUA 4JAUA 2WT0A 2SLIA 1QBZA 1L0NH 3B69A 4XAAA 1N1VA 1AR1B 4LNUB 2ADPA 3C3SA 5ABJA 3WX5A 2CH7A 1GWLA 4EROA 4LF9O 1YNAA 3JB4C 3OMIB 2XHKA 1NQJA 4AHYA 3ZRWA 4XQDA 3ZSEA 1RUI2 5FPRA 1PGSA 4NR1A 1JQ0A 2ZS6B 4IERA 4I4TA 1RUD1 3RYIA 1FXZA 3AMPA 3CCLV 5KAIZ 1UXZA 2CAZC 5BNPC 1LGBA 4UXNA 4FPOB 4EQVA 4Q4X2 1KRIA 1HW5A 3I2FA 2IVIB 3T1YB 2WT2A 4BE3A 5CADA 4Q4V3 3VKMA 2A6WA 4N43B 1PO11 2UWAA 3MIHA 5FZKA 4FZ0A 1UPIA 4Z8BA 4DR5B 4LO4B 1JTZX 4XDQA 1MZFA 5T52A 4Q0VA 4R9CA 4IEZA 4JTOA 1YSCA 3T2OA 4KGQA 4BXFA 2JE8A 4DR7B 2XHBA 4RYDA 1CONA 1F2NA 1UIJA 3HKDA 4I02A 1DZQA 4R8HA 3M7MX 1S2KA 1AJQA 2XNDG 2ZCEA 3S30A 5H5NA 5F37A 4L11A 4QQHA 5HV4A 3AZVA 4YJ2B 3G4SV 1NZCA 1IVSA 5K0UB 5FY5A 4DNYA 4AG4A 1QGLA 4AFCA 4ZONA 1KKCA 2NM1A 3F7YC 1MS1A 1G9DA 4GB32 1SC5B 1NX9A 2OCCB 5BZBA 4UFMA 3ABLB 3ICXA 1IOAA 4QB1A 4CPBA 3SCFA 1JYWA 5IJ0B 4NAMA 1VBA3 1JYNA 1BBT2 2JS3A 3ZIWA 3G6BA 1X8EA 2CAVA 2ARHA 5JZGA 3KGLA 2LROA 3OBTA 1IXBA 2UXCB 2EIMC 1QOOA 3WUCA 1CZSA 1NE4A 3SITA 1ZZ7A 4ICGA 4OPAA 3O7OA 4N8MA 4OUEA 4I7ZB 2ZX0A 4O4LB 1WBLA 2VOTA 4AILC 3DEMA 1SEFA 4ES9A 2B45X 1BQ0A 1FXVA 4DPNA 1RC6A 4D69A 2HVKC 5IWAO 2KA3A 1CJDA 4EJRA 1HDKA 1MACA 4GX1A 3ELNA 1TUBA 3CRCA 1DTOA 1UYYA 1HRV2 4YJ2A 2PHRA 2H0VA 3VBUA 1HQLA 1CQ9A 1ODNA 2Z5WA 2F43G 1K33A 2VNOA 4TUYB 5DAVA 3RFRA 2F23A 1PZ9A 4QM8A 1GOGA 3CS5A 2WS93 1A3KA 2IC1A 2E6VA 2DBNA 1NUKA 2W6JG 3AKQA 1L7RA 4HVOA 3MIDA 3K5LA 3RYKA 4ZZ5A 1UFIA 3VDDC 5IK8A 1Q86W 1QDCA 5KXCA 3HKBB 3GXUA 2Y6HA 4QB6A 2OT7A 2VOKA 5CB4B 2ZM6B 3T2PA 3FHAA 2OTJV 5IVFA 2VVEA 4XOGA 2QQMA 5F3GA 2BNNA 1PMHX 4KQ7A 2QFEA 5D8AC 4COUA 4XDJA 2JWPA 3H1MA 4PDVA 2OA2A 2I2SA 4DEVA 1OOPA 1S0JA 2GC0A 1LUWA 1SDDB 5FKCA 4QQ2A 2DU0A 3PIGA 4XBQA 1DP0A 2XQXA 1U96A 4RSUA 3IDBB 1MZ5A 1ZX3A 4DR4O 1BLZA 2FZ1A 1Y66A 2UYBA 2GC2A 3MEPA 1SZTA 1W2BU 3TB0A 3NNMA 5C5TA 4GKXA 1GP6A 1NCRB 5FO7B 4YVWB 4CP2A 3LDDA 3DXRB 3I2KA 4FQ4A 4JI1B 2PGGA 4QPGB 1FMD1 4U3JB 5A3OA 3CB2A 3N7MA 1XMOB 1B09A 1O3RA 3H1JH 1BZWA 2CDPA 3ABZA 2O14A 1SQPH 3GZUC 4DR6B 2FB5A 4PDMA 3CBNA 2Q7HA 3FYEB 2Y4UA 3LD8A 4IEVA 5KMGA 4X20B 4A7ZA 2B7YA 1BCCH 3WW4A 4CP9A 1GN3A 1HNXO 1EAH3 2VC9A 1VQLV 1RUF2 1SFPA 3QVNA 2YUAA 1TA8A 3Q9OA 3ZFGA 1U5ZA 4Q5OA 5HI0A 3K03A 4CDXC 2VBBA 3ABUA 1PHMA 1RUE2 2DTYA 3R4UA 1NA1A 2DWRA 5FYIA 2YZ4A 1AVBA 4JAAA 3THOA 3PN1A 4Q8KA 3ZSLA 2R041 1N1YA 1FMD3 3KS7A 1XUQA 3IIAA 2QJ1A 4BOWA 1V54B 1S2EA 3VB9A 4YVSA 3CWBH 2HWE2 2RN9A 5FZEA 2A0LA 1ASJ3 2MK3A 3SQOA 5JH7B 2G9ZA 2JDAA 1MZEA 5FYTA 1JU4A 1E79G 3B3QE 4QE7A 4E2QA 1Q6IA 4O2BA 4Q0QA 1RITA 2AW9A 3C3TA 4YVWC 1DLCA 3DKQA 2ZD9A 3HKEA 3KV4A 5CKNA 1ND2B 4DK1A 3L72H 4QU1A 3IMNA 4WBNB 1FMD2 3B9CA 4QPIC 3UO2A 5H6QA 4YSFA 3E5XA 3SPCA 3G6EV 4AL9A 4XTMA 4OI4A 1GM8A 2OWOA 4MVSA 3H8XA 1SQXH 1XNTA 5GM0A 1W2NA 3AM2A 1PL0A 4P9PA 2ZHNA 1ZRDA 4UVAA 2EXJA 5C8YB 4I55B 4O2AB 4BHPA 1IBMO 1W9YA 1AYN1 3MIGA 4CDWB 3RZLA 1N47A 5LASA 4Y3OA 3H1HH 3ZPOA 3MDSA 2JVDA 2DVGA 2X0LA 2OQ7A 3LGRA 5L3DA 2XMLA 2MEV3 1UY1A 3E8FA 3QACA 2DBIA 4N43C 5ITZA 3PVBB 5CVRA 3WB2A 4XAEA 3DGTA 2LP7A 1D2SA 1M1KW 4L8QA 2Q67A 1BEV2 3CE2A 1JZ4A 3CZJA 1DFQA 1RUF3 1K73W 2P6CA 2YICA 3MUZ1 1K42A 1XYNA 4TWKA 5ACA2 2XH6A 2V7QG 4MVQA 1UZWA 1QNWA 3D6EA 1CAUA 3I59A 2J1UA 2RG4A 2Q4SA 3PU8A 4XPVA 2QA4V 1QQCA 1XNRO 4I0XB 5EC1C 3E89A 3T1HO 5EHDA 4CCNA 2RS11 1VQ8V 1W9WA 2VAUA 4CTEA 3MGUA 3LDBA 3MO4A 1LOFA 3CP1A 3JASA 2YHJA 4GX2A 1D5NA 1K5JA 1PO22 3FUOA 4MSWC 1VBD1 5C33A 5J09A 1NT0A 1MVQA 4OHVA 1N3PA 1TVGA 4META 3IFXA 1PNMA 1E5IA 5FPBA 1K5SA 1R1A1 3ZX7A 3ZXAC 2NLRA 3CMAV 4CBCA 2R042 2FHRA 3VBFC 3G7DA 4O4IB 1EPWA 1LKNA 3I59B 3U11A 4XXAA 4QKDA 4YHHO 1JA8A 1N36B 3O0VA 5DAPA 4Y22A 2VW1A 3LF7A 3BCWA 2UXDB 4LO7A 4LF6B 4UV9A 4CDUC 1RUG2 5L36A 3K46A 4DY3A 1US6A 3S6PA 3JUUA 3DC6A 1NCQB 4YW2A 3OGGA 3LSSA 1LRHA 3ZR5A 3OEHG 4QXBA 3VBSC 4X88A 4NYKA 5C93A 3TN92 3OYWB 3IC7A 4ZKIA 4FM0A 2VQAA 4I2OA 3ZSMA 4AOCA 1TNRA 3ZHRA 3T0AA 2ET1A 4YXWG 1QNMA 3SPIA 5DZEA 1EN4A 4Q4V1 5EIYB 4OPHA 3CC4V 1HRI2 4XABA 1I5YA 3AJZA 1SERA 5FNVB 3MAQA 2P22C 1G9BA 1QVFU 5IVCA 2HYXA 3OYWA 2PLV1 3I4IA 5KMGB 2ZAAA 1K4CC 4JQRA 1YCIA 2OVUA 4AVTA 4IE7A 4F6RA 4ZI7A 3WF4A 1GP4A 3T1CA 4IYHA 3GJAA 1FV3A 5T3NA 4GMP1 3ZHVA 1G9CA 4CU6A 4BWAA 1RUE1 3ZYRA 2H94A 1CN1A 3GWOA 1VF7A 1JOJA 3C7FA 2W1SA 2ZE7A 3HNBM 4AAPA 4QXHA 4NJ4A 5CFDB 2FYUH 4BAYA 2KSDA 4GKKB 3U4XA 2ZGTA 3SISA 1MQTB 2GUZA 2ZKNA 5FXXA 3CRMA 1O9GA 1KDMA 5FY4A 5JOZA 4HT1T 3L2YA 2NR5A 3UKTA 3ZRXA 1UU5A 4IESA 3BABA 1VRBA 3OSDA 4BPZA 4NHXA 4YM0A 2GALA 1NCQC 2AEZA 1BJQA 3K9SA 4E2LA 4W8JA 4JAVA 1JR9A 2X53S 5BNNA 2P3YA 3OBZA 3UV9A 3FB6C 1EM1A 3J7LA 2ZDIC 1DYOA 1OT5A 3AL5A 2E74B 4BJ0A 1ZX5A 1XNDA 4AI1A 1M57B 4DR7O 2Q5TA 4AEDC 2PAEA 1XB9A 4I30A 4UWDA 1ZL8A 4X1YA 4JI7O 1XSRA 3VL8A 1WP8A 2QDOA 4DV5B 4OMCA 4J25A 5LWBA 3IB3A 1FV2A 2EVXA 5SV5A 1OA4A 3WDUA 2DJVA 3JYCA 4AVVA 5F5CA 3ZR6A 3FN9A 1CX4A 2P3KA 1MA1A 2ZR3A 2QWOB 1AYN2 2UXXA 2VMDA 4XW3A 4CDXB 4IV3A 4RAIA 1XE8A 4X1IB 3N27A 1NG0A 1PD3A 2CAUA 2ATFA 2GUZB 4YW5A 3RMYA 4FLXA 5IY5C 4MX3A 4LQRA 4TV8B 1W99A 4DINB 3OGVA 4LOSA 2RDQA 4RUEA 4MVMA 2RMU3 4WM8A 1XNQB 3GGLA 3MPPG 3AC0A 2VE1A 5FZ4A 4BQXA 3HT2A 5A3LA 1DHKB 3CF6E 1AI6A 5ABJB 2DN9A 2VVDA 3VQXA 1HB2A 1NOVA 1W8ZA 3FD9A 4QX7A 1P7BA 3GF6A 3NXSA 2EINC 1YQCA 5JSOA 3OEBA 2ZGKA 3TRSB 1AJPA 1F51A 3NJXA 3VZJA 1XU2A 2LFRA 5LATA 1PIV1 4XETA 3LEGA 3THCA 4ZHNA 4Q4W2 1QJY3 4AF9A 3T4HB 5BV6A 1JXNA 3N9LA 3AG2B 1VBB1 5C8CC 3AK1A 2ZGLA 2BPA2 5A6XA 4AEMA 2R30A 1S0CA 3BB6A 2PZSA 4IGGA 1EV12 3WT3A 3ZYBA 1Q6HA 2YFUA 1RPRA 2QM8A 5EZYB 3HIFA 3NV2A 1F4NA 2JG8A 5LBEA 1CPYA 4IL7A 4Y33A 1V6MA 3DXTA 3T1HB 2QJVA 4DUXA 3KCXA 4LF8O 3HBZA 2GMMA 4QPKA 1SF9A 2VZUA 4FPGA 2GV9A 4XBFA 2C26A 2K0GA 3TYJA 1APNA 2BSKA 4TV9B 3VZKA 2CWSA 5DDJ2 3DPRB 2VQEB 5FJHA 3BGAA 4O4JB 4CH6A 4YM1A 4XQ4A 4JGYC 2Y6LA 4K20A 1TUEB 4UF0B 2W95A 4N9IA 4HVQA 3RYHA 1UKRA 2AGSA 1ZRIA 1NA1B 3IC9A 1CR7A 4DXSA 5LA6A 4PA7A 1YFWA 1RUD2 4YVWA 1KB9F 3W7TA 1X4TA 3GYDA 4R9BA 1B35A 4MO3M 4AVAA 4JVAA 2E63A 3VKOA 4IXLA 4JRAA 4YW7A 4LHKA 2XT9A 2LJ2A 1IBKB 3QOPA 2F95B 5GLWA 4ISQA 1XYPA 3G71V 2QDNA 1LENA 1VQ6V 1FT9A 5GZDA 1RMU2 2BWCA 4LNVA 1AP6A 1H4GA 1UY4A 1LOCA 4UV8A 5L3GA 2P90A 4EWDA 4KWKA 2YXLA 1R081 2CGOA 4Q0PA 4AQTA 3ZRWB 2AXTZ 2EZPA 3H8RA 3PUQA 5LBBA 3SYPA 3ZRSA 1QMJA 4FPCA 5C70A 3R65A 1X7NA 3MIBA 2G4IA 4XDKA 5T5PA 1SPPB 2VJXA 1OHHG 3I2DA 4DRRA 1UO9A 1IBMB 1OKQA 1FNZA 1Z78A 3VHOA 1EPZA 4BISA 2AR6A 2C9KA 4YRDA 3WD5A 1BGYH 5E1AC 4GZRB 2DWDC 2WNUC 3WW1A 2JIGA 3H3UA 3T30A 1K5QA 2Q0OC 3K2OA 4UFLA 4TYSA 1F5JA 2WC2A 2B8MA 5CFDA 4A7YA 3JATA 4FZ1A 3NAPB 4X1YB 3O1PA 5G04L 1QHTA 4CCJA 4A7KA 2P4VA 1A8DA 2WWSA 3H3LA 2PA7A 5G05L 3AVSA 2O57A 3PJSK 1TME1 3AX4A 2VCMA 2V4AA 5FL7G 1OPOA 1WGPA 2D93A 1N8RW 2VBPA 3W58A 2WQ8A 4NPMA 1W6PA 4OCTA 2UURA 4QAWA 3ACHA 5IJRA 1DYPA 1YIJV 5DPNA 4AEJA 3OGRA 4X64O 2QQUA 3QG5A 3WG7C 3SHRA 4BIUA 1N1TA 4IEPA 3VBRA 3H1IH 2WL1A 3R6SA 4Z2AA 2VZPA 5F39A 1QU7A 1PVC2 4LF4O 2AEYA 5FZBA 1CESA 1IBLB 5LHGA 4OMDA 2QVSB 3TEXA 5A6QA 3W21A 2FMYA 4Q26A 1XI1A 2V73A 1KUQA 4LFBB 5F32A 2NQYA 3NAPA 5JR7B 4XDOA 2DUQA 3AP7A 1OH3A 1ZVFA 4MGTA 4LF5B 2W1QA 4XFFA 4PDRA 2JGUA 4E27A 1JYTA 5B4NA 3OGIB 3ZLIA 2VCAA 1O4TA 1GH6A 3JAWB 1OPMA 1RXGA 3VD9A 5SV8A 2E5LO 3K3OA 3AFGA 2Y26A 5H9CA 5GZEA 4JDMA 2VQUA 3AG3B 3KF3A 2WLQA 5A3TA 2CE4A 2CK3G 1XOYA 2BQPA 4G9SB 5H9PA 3JD72 3O1TA 1PM7A 1N3QA 4CE8A 2BGOA 3J81N 2YEVB 3VD3A 5LOVB 4X66O 1YZBA 1L7QA 4XHXA 2Q4PA 4ZOLA 3ZN0A 3W7XA 2DFBA 4AZZA 1WKYA 2JK5C 1H8TC 3FC0A 4XIOA 4QB2A 3AMMA 3WY6A 3I2IA 4B1MA 1UD1A 1JW6A 2WS92 1R64A 1TVKA 3Q8CA 4WM7C 5M0TA 2L35A 3OPTA 4MW3A 1WN7A 3ASNC 2VQEO 1XNQO 3DV8A 2FDKA 1UCXA 1BE3H 2A6VA 5FR3A 4CH4A 4NIDA 4DFSA 1GZWB 3D8CA 2W68A 4PT6A 4OI2A 4QWNA 1J1LA 1KXGA 2Q68A 3PVEA 1UZYA 4GXLA 3DXUA 4DR3B 2D7FA 1RUI3 1ZBA2 4MVOA 2W0XA 2N04A 2W91A 5FK7A 2WYSA 2Q9LA 5T5OA 4AHXA 3TBDA 2ZXQA 4DRXA 4L97A 1D0HA 2QKAA 3ILRA 2M7WA 3A8TA 5FLIA 4FTSA 1WUVA 4FPEA 2WA3A 2AREA 3K58A 4YM3A 4I0WB 3M3CA 3DTUB 2BDRA 1BK1A 4GH4A 3K08A 2ZQMA 3NRUA 1VQ4V 5FOJB 2HEYF 5LHIA 4PD4F 2CTQA 1NT2B 1WZXA 2KQXA 4JI7B 1HRV1 3Q8FA 1FPN2 3P1IA 4R6ZA 5FQ0A 2BTQA 4ABMA 2R0HA 5D5PA 4CEYB 1QJZA 1SHWB 4NXNB 3UNPA 2VNVA 4LR4A 2ZTNA 1BHAA 4XYXA 4FPJA 1PO23 2UWCA 3WSOA 1ZZBA 1IS6A 1LU2A 1MEC2 5IFPA 2AENA 5DG1A 1VQ7V 4QJFB 2LW7A 2GP3A 4EWEA 5KX5A 2IUWA 3APQA 2WLIB 1BMV2 5J37A 2VMIA 5DXDA 3LPFA 1YC61 2NPIA 1WNSA 1W6OA 4CZZA 3DYMA 4XDLA 3Q8BA 5E8AA 3B5LB 1G8MA 3HQXA 2G9GA 3UJQA 4JI3O 5C7GA 2XWBB 2GNBA 5IK5A 2OPKA 4YY3O 2EA7A 4ZU7A 3FHQA 1NLRA 3FHIB 3SJAC 2WNEA 2EIGA 2L9LA 2HG5C 2GMPA 3DL3A 4NWWA 2WRAA 2JGDB 3ZSKA 1VBC1 5FZFA 2W39A 4GCZA 4LUMA 5IK4A 5J9PC 3I54A 5CA1A 3BTYA 5EFUA 2CTVA 5JXIA 4KI5M 1LAJA 1I0HA 4QKNA 2CDOA 2LTNA 1W2OA 5AC91 2Y69C 4WM8B 2LQTA 5F8PA 1W6NA 4CCLA 2E3CA 2XAJA 3WNLA 2AUYA 1RUD3 1VPHA 4QPYA 2FDIA 4PIZA 1ZSPA 1O5UA 3ECQA 3HEIA 1F4AA 3OMAB 4OHWA 1M93A 2WLMA 2BWAA 2XJQA 1TUBB 1YEWA 3PUAA 3AYEA 2WO7A 1PIV2 1TQ5A 4FTEA 1GTOA 1O3TA 3OUJA 3QTCA 4BU2A 4XFAA 5C4WB 1CGPA 2B42B 4JKMA 1ULOA 4TTGA 4XBLA 2GMEA 4J9ZB 4LF6O 2LS6A 5EQUA 1QJU3 5JDBA 2UUCO 2R9IA 1C8M2 4CPBD 1Y74B 3UETA 2IJJA 5AVAA 3EVKA 4WF9V 2IU3A 4ZU5A 4QX5A 4SLIA 1PX4A 4QX2A 2RNBA 1HXS2 3ITQA 4LKSA 3N35A 4BH9A 4SBVA 2WZEA 1C3HA 2WSVA 3S5QA 4R50A 3LNMB 4W4KA 1QH6A 4M4RA 5KHIA 2EIJC 1NA1C 4LCUC 1PZ7A 1YLLA 5LBQA 1VALA 1AL0G 1S3JA 5IVBA 4NIGA 4YNIA 4N9HA 3ZIXA 4CDQC 1H0BA 3JARA 1Q82W 4A5UB 2QR4A 4P5YA 3VBHA 2JS5A 4QX1A 4M00A 4AK3A 5JLVA 5I0UA 1DQ1A 4CUGA 2QUOA 1AXYA 2WS91 1VBE1 5CAZA 2Q7GA 1N3OA 3AKSA 3B2EE 3SNMA 4PQ9A 1EZJA 1PNLA 3M2MA 2YEVA 4EWAA 2HWB2 2JEMA 3K9AA 2Z2SB 4J42A 2LO1A 1YFXA 2GNTA 3FX3A 3H9VA 3VBHB 5GTIZ 4QDRA 1XL6A 1RYYA 4XBNA 3RGBA 5EYPB 4KNCA 2F17A 2ZX3A 4O9GA 5LA1A 4AHCA 1MQTC 1J84A 2DTWA 2RMU2 3F7VC 3CCVV 2P2KA 5LP6B 1RUJ1 1FPOA 4Y1YA 3ZKYA 1GU3A 3M70A 5F3EA 2VTFA 2CGNA 1P49A 2VZTA 4E4ZA 3U75A 1ROPA 3FE5A 5LMNO 4WV8A 2X29A 1NLQA 3AZYA 3A4UA 5FZOB 3NV4A 4MUVA 5IJ0A 4AEKA 1LGCA 3MPBA 4XFBA 4CCOA 5C9AB 1ZA7A 2QKSA 1TMF3 3K48A 3VQYA 2R061 1E5SA 2EILC 2QSAA 4X65B 1C1FA 2RM21 4FJCC 3G6JB 3ZX6A 5B1AC 4JI5O 3QH6A 5FZ9A 3W59A 2JRIA 2DVBA 3J7HA 2MPFA 1OHFA 1UU6A 3RSJA 1B04A 4X62B 2P17A 5LA9A 2MW2B 3WP5A 2HHHB 2A6ZA 1W6OB 4LBNA 4BCUA 1UOFA 2XDVA 1RUH1 2IH1C 4LHSA 1WMDA 1N33B 1CZTA 3CCQV 1OCZB 1XILA 2HWD2 1RJ8A 4CZSA 3MF9A 3HKEB 1HXS1 1SLBA 1W06A 2I45A 3TETA 4Q4Y1 4JV5B 4F8AA 3K5MA 1UY3A 3B40A 2WLIA 4EN8B 4YGEA 4AI3A 4QPWA 4UFHA 3BFRA 4KP4A 3F5TA 1AILA 1UZVA 5BUVA 5F9TA 2YIDA 4MXWB 3POSA 1MSDA 3T09A 3OE7G 1YQ2A 5IWFA 5JZGC 2EAAA 4R7CA 3B4SA 3AG1C 3INAA 3ETPA 1WAZA 2JJ2G 4AE2A 5A7OA 3JQXA 4GAZA 4L99A 1VMGA 4X89A 1VF6C 4HSJA 2XHNA 4LK6A 2B4KA 4GUNA 1F4HA 2Q69A 3POFA 2RDCA 3O1SA 2R062 1O8SA 1FFXB 4AI0A 3RZZA 2D6MA 4YYOA 2GC3A 3OJBA 2PN5A 2CY6A 3KCYA 5LGUA 4FFBA 5EBWC 2VUAA 4QT6A 2EIKC 1SDWA 3POWA 4UCTA 3GB7C 1QOSA 4QGMA 1SZXA 2A9HA