4D7SA

Structure of the sthk carboxy-terminal region in complex with cgmp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
b'DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STHK_CNBD_CGMP
publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
total genus 58
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7sA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7sA02
2KXLA 5K8SA 1GQHA 1O7FA 4KU7A 2PA7A 2D40A 3H3UA 4B29A 4Q0QA 2FMYA 3IDBB 3RNSA 2XGXA 2XL7A 4WBBA 5KHKA 3IIAA 4P9GA 4YARA 3S7EA 4GULA 1IPJA 2GAUA 4OLLA 4AVBA 1LKNA 5J48A 4Z07A 4FAHA 4I02A 3BCWA 1XE8A 4I0BA 3HQXA 4PIYA 2QCSB 4A2UA 2BGCA 4L11A 4PJYA 2PAEA 4KWLA 4IEPA 1O3QA 5JR7B 4XFAA 4O9GA 5D1IA 1ZZ9A 5BY5A 4HLTA 1QXJA 2IXCA 3ES1A 4RD7A 1SFNA 4Q0PA 4XF0A 1ZRFA 5FQ0B 4N9HA 4O9EA 2EVXA 4IEWA 3CF6E 3TNPB 4QMAA 4BH9A 3IBMA 4H7LA 2F4PA 2Z69A 5FDBA 4E2QA 3HT2A 1CX4A 3E5XA 4JTOA 1CAXB 4HN1A 4HSJA 4HSLA 4I09A 3FFQA 2EAAA 1NZCA 3M70A 4QXKA 2PHLA 1LR5A 3ELNA 5KHHA 2Y0OA 2Z2SB 1OMIA 1WGPA 2BNMA 1SQ4A 2IXIA 4PIZA 1RUNA 4ORFA 3D0JA 1X8EA 1YFXA 4LTAA 2CAUA 1UIKA 1I6XA 1RGSA 1FT9A 4R8HA 5BXXA 1ZX5A 1UW8A 3H9AA 4IEUA 1O5UA 3JZVA 4JTNA 2E9QA 4D7SA 3NVCA 3B02A 3E6CC 5I91A 5KHIA 4OFGA 4KWKA 1UD1A 1CAVA 1YFUA 4Q0UA 1XRUA 4FAGA 3OTFA 4NVPA 3BB6A 4Q29A 1DGWA 4AVCA 1NE4A 2K0GA 5JCTA 4JVAA 2GH2A 2Q4SA 2PTMA 3SHRA 2B8MA 4LUKA 2Q1ZB 3ES4A 2XLGA 2D5HA 3IDCB 5I0TA 3HT1A 2IC1A 3WW1A 4IEQA 3NL1A 4YSFA 2PFWA 2K9ZA 3LA7A 4HMZA 3S0MA 1ZREA 1OFNA 5JAXA 3FHIB 4E2SA 5J3UA 5FCCA 3PVBB 1CAWA 5C8WA 2XL9A 3OD0A 3BU7A 3BPZA 4QGMA 2MNGA 1VR3A 2GC1A 5F1RA 3U11A 3CL1A 1WLTA 3H8UA 4IESA 1J3PA 1EY2A 1XE7A 3H3ZA 1RTVA 3EJKA 4FBFA 2PYTA 5I0RA 1O3TA 4XF9A 2I45A 4I3PA 4MGKE 3LOIA 3RYRA 4CYDA 5I0UA 2OPKA 4Z82A 5FLIA 3QACA 5C6CA 3DN7A 2PQQA 3KCCA 4MV2A 4HN0A 3H1WA 4J1WA 1J3RA 3G7DA 2BEOA 2VPVA 2GU9A 4ZU7A 2QNKA 3H7JA 3RZZA 3OF1A 3GBFA 3USSA 1UIJA 3SMHA 3S7IA 4QM8A 2VQAA 4AVAA 2CGPA 2C0ZA 5LEJA 2MPFA 5LRRA 1ZNPA 3LAGA 2XHKA 4MX3A 4XEZA 3NSTA 3I54A 1Y9QA 2OZJA 3E5QA 5T3NA 3KMHA 4IEYA 5FPXA 4F7ZA 5BPXA 3D82A 3E6BA 4BHPA 1ZRCA 4KU8A 4Q0VA 1O3RA 3NJZA 3FJSA 4META 1UPIA 1L3JA 1YHFA 3U0ZA 2ET1A 2XKPA 5CU1A 2ETEA 2PAMA 5BUVA 4MH0E 3UKVA 5KHGA 4MGIE 5EZWA 2Q30A 3I59A 3M3IA 2D93A 4XF1A 3SCGA 5CVRA 4QX5A 2ZCWA 4EWEA 1LB2A 1NYWA 4L2NA 4UBHA 4XFFA 2ET7A 3H1YA 1VP6A 1RC6A 2HJIA 5FLHA 4BYYA 3QOPA 3U10A 1ZZ6A 1Q43A 3D0SA 3KGZA 2H6BA 1VJ2A 1CGPA 3RDIA 4KWJA 5I8TA 4XF4A 3ST7A 2ATFA 2VECA 1J58A 1V70A 4LEJA 1GQGA 4UBGA 1J59A 1EYBA 1X7NA 1NXMA 2XKOA 1ZZ7A 1JUHA 1HW5A 5I8YA 3WW2A 2PHDA 5KBFA 1O4TA 3H50A 3EHKA 4DINB 2H6CA 3KSCA 5LEKA 2GC2A 4HVOA 1G6NA 1U12A 1O5LA 4XF3A 4IETA 2BNNA 4ZU4A 2PAKA 2BYVE 1Y3TA 3VHRA 3E97A 5E16A 5E1RA 1O3SA 5JSRA 2O8QA 4JV4A 2GZWA 3SXWA 4EWAA 3PLQA 4BIFA 1DZRA 1LRHA 4QGLA 1ZRDA 4MGZE 1RUOA 4AXOA 4X6QB 5I0SA 2XLAA 3DV8A 1YWKA 4YNIA 1CAWB 4QM9A 1PM7A 1SEFA 4LLOA 1ZZ8A 5FLJA 3SCFA 4ONUA 4LA3A 1X8MA 1Q5OA 1ZRRA 3RYPA 1CAUA 2UYBA 4I0AA 2QVSB 5J7MA 5HI0A 3EBRA 1DGRA 4HVQA 1OI6A 2QDRA 2FQPA 1EPZA 4I01A 5KHJA 2WC2A 4YRDA 4XFGA 3N4MA 1FXZA 4R52A 2ZKLA 2UY8A 3LWCA 3H7YA 3KGLA 4XFBA 1FI2A 3IWZA 1RL3A 3L2HA 4AQ6A 2HKXA 4ZU5A 4F8AA 1ZZCA 3FE5A 4XFHA 2QJVA 3LA3A 3FZ3A 3ROUA 4IEOA 3E6DA 3NKTA 5I93A 2H0VA 3GYDA 4K8FA 4PIXA 1QWRA 3RYKA 3EO6A 3MYXA 4UXAA 3DKWA 3ACLA 4EV0A 3SCHA 5BV6A 1QXRA 4EWDA 1ZVFA 1YFYA 5CADA 1DZTA 1J3QA 1YLLA 3I59B 4EROA 4AQ2A 5FQ0A 2GC3A 1TQ5A 3HIFA 3WW3A 3FX3A 2N7GA 2EA7A 2WFPA 3R6SA 2CV6A 2IXJA 4N9IA 1WA4A 1IPKA 2IXKA 1CAXA 1H1IA 2UY9A 4XFIA 3MDPA 5AVPA 1YUDA 3CEWA 2XLFA 4WZCA 5LRSA 1OD5A 4XFCA 4KL1A 4XETA 1CAVB 4E2GA 2OYZA 2IXHA 3ETQA 3LA2A 3ZDSA 3EQEA 1QY4A 4FT8A 4IEVA 4MUVA 5JSPA 4LUMA 3RPQA 3FWEA 3LZZA 3C3VA 4WVZA 4J1XA 3H1MA 2B5HA 4HZFA 4IEZA 1J1LA 3E5UA 1PMIA 2MHFA 2CAVA 2IXLA 4MZUA 2OZ6A 3CO2A 3CJXA 5EFUA 1UCXA 3DL3A 4LULA 3I7DA 3PNAA 5JSOA 2D5FA 2Q0AA 3BALA 1NE6A 4IERA 1ZZBA 2P17A 2DCTA 4HVRA 4I2OA 3MZHA 5FPZA 4D7TA 3WW4A 2BNOA 3OGJA 3MPBA 3UKNA 1H1MA 4TLFA 1Q3EA 2V09A 2OA2A 3TNQA 4Q0SA 1X82A 4IEXA 3OCPA 3UKTA 4LA2A 2UYAA 3NW4A 2B9UA 4QGNA 1I5ZA 1CAUB 4X6RB 1EP0A 1YFWA 4HBNA 4MGYE 2O1QA 5I8SA 4YYOA 2GC0A 3CLPA 3O14A
chains in the Genus database with same CATH superfamily
1MS0A 2P90A 4R4ZA 2WS93 3E35A 4PDMA 1GRJA 5IFPA 3RVHA 2KKWA 4P9GA 2ZGNA 1H38A 3A0BZ 3NR7A 3AKPA 1GNHA 1OZ0A 3WDXA 4CUBA 3KT7A 1PP9H 4YW2A 4LF7O 3G6JB 1OXCA 3J8F1 1PZ8A 1AI5A 1K3EA 4UCTA 4E4ZA 3RRDA 5JR7B 1BMV1 3L71H 4O9GA 1FOD3 2LRPA 3ZHSA 4D3WA 4D6TH 3RMYA 3FLTA 4OI0A 1W59A 2VZOA 4C91A 3MV11 2UUCB 4BH9A 4OUMA 1S76D 4XZUG 4JTOA 1R73A 3WNPA 1OCCB 5H9QA 4IV1B 3M99B 2AHYA 5FZIA 5IVEA 3K08A 3CJIA 1VBC1 1V9U1 2RMKB 1EN4A 3I8TA 1I08A 4J80A 1JVMA 1WMXA 3POWA 1BMV2 1KD7A 1G6UA 2LO1A 3B2EE 2AGAA 2CY6A 2P6HA 1HNZO 2JICA 3Q4HB 4DR4O 4UFMA 1PNMA 3I4IA 3MICA 1UX7A 2ZGLA 1RXFA 3BTAA 3WW1A 5EXOA 1GZWA 3LA7A 2IW5A 1VBC2 2VW2A 2JD9A 4X1YB 4FPPA 5L9RA 4CP1A 3CCEV 2ZEZA 2YGMA 3U4XA 1MPXA 4A7KA 3JALB 1FFXB 5FV3A 4AEMA 2DYSB 1FXKA 5I0UA 3ZSKA 4Z82A 3MHZA 3E8GA 3H1WA 3ZFFA 3GXUA 4ZU7A 1CD3G 1YHQV 3FYIB 3O7OA 1XNRO 1VRBA 3D4KA 2NN4A 4AEKA 4FOYA 1ZRCA 1OH4A 1NQDA 3JCUZ 5IYZB 4TQDA 4QX3A 2P5OA 1A3KA 5HBAA 2C2AA 4IV3B 2AW9A 3SKJE 2BGPA 3ZSEA 1SA0B 3JD0A 5LCWL 2W1WA 1DDLA 5EJ3A 3BAAA 5FXWA 1I9RA 1ONAA 1QQP3 4V1PA 4YLZA 2Y0PA 4LEJA 4OI4A 2PHRA 4CU6A 4GALA 3GALA 1I5YA 2BOCC 4GQ7A 4N43A 3ZHUA 2D6KA 1GM7A 1U12A 4IETA 1SQXH 1F23A 4BIOA 5HFMA 4JDNA 2Q8OA 4FPFA 2J7MA 4AFDA 3WF4A 5E79Z 4CUGA 1PM7A 3HKCA 1SEFA 3UETA 1RMU3 1QQCA 5L3BA 2PELA 4YW3A 2G38A 2VU9A 1OHHG 3RWNA 3ETPA 3O1RA 3RQ0A 2QKSA 1AR82 2HLDG 4CCNA 5EYXA 1UY3A 3JBG1 1DLLA 1YIPA 1JMUB 1SLIA 4DR2O 4JV5O 1DG6A 3L2HA 1QIQA 2W1QA 1F35A 4KGQA 4JYCA 5GZCA 4BQ5A 2A71A 4MADA 2O0OA 2JX9A 3SPIA 3HNYM 2XWJB 3VBUA 4DV5B 1QWRA 1WP7A 5BNNB 3BTYA 5C8YB 4PBPA 3BKZA 3VBBA 1YDXA 4CDUA 2DQ3A 4TT3G 1TME3 4ASKA 1WLEA 2RDCA 4LBQD 1HRV1 1H8TC 2W52A 1HNZB 3HNBM 2EIEA 2UXCO 3N36A 4DR4B 3RZJA 4DXWA 4I7ZB 4AQ2A 3T1YB 1TQ5A 1W06A 2N7GA 3RYHA 3MFAA 1SZBA 3ICXA 3R05A 3F2ZA 1I5XA 3JBG2 4LO8A 4D69A 5D21A 3MO4A 2AR6A 1W28A 1CAVB 4LNUB 4Q4V1 4L87A 4KH9A 1XPWA 1QY4A 3LD8A 4IEVA 3RVZA 1PK6A 1CZSA 1HIXA 3H1MA 2JGUA 2J1TA 2CAVA 2OZ6A 4R50A 2GH8A 2JK5C 3IKWA 1Y66A 3L9DA 1HRV2 1VBA3 3MIFA 1ZZBA 3JASA 4I2OA 2XOKG 3IGAC 2FYUH 4LKSA 3W5NA 1HQWA 1ULPA 3NNLA 3HKEB 3FBYA 3UKTA 1OKQA 3DCQA 2GV9A 2O1QA 1ZWIC 4B4RA 1CVNA 2A79B 3OGCC 1VQ9V 2XB6C 4JQTA 3OGIB 3SYQA 3RNSA 3AKQA 2VZVA 2XGXA 2XHNA 2XL7A 4WBBA 5KHKA 5A9GA 3S7EA 1VE0A 2GAUA 5FZ6A 1LKNA 5KR7A 2ZGSA 4EN0A 2VTXA 1EV11 2RR13 3VD9A 1EZJA 2ZQMA 4AGGA 4EZ4A 2R9RB 4I4TB 3B5LB 4F83A 4ARYA 1AI6A 3H1KH 1SQPH 1LGNA 3KV9A 3CE2A 4XJWA 4D6RA 2Y38A 5GLVA 1I94O 1YXBA 2FTKA 2PHXA 3S30A 1AR71 3M70A 3BRCA 3AL6A 4QXKA 1UZWA 2JDNA 4XPVA 1MABG 1M90W 3THPA 3VHNA 2Y34A 4GX5A 5BY1A 3KV5A 5FXZA 1CIYA 1MSWD 4R8HA 3K06A 2V4VA 2WNUC 2JIJA 4CPBA 2EJ7A 4XABA 5FYTA 5CFCC 1OPMA 5C8CA 2ZEWA 1MS3A 1XRUA 1TVKA 3Q8CA 3TAYA 3E8BA 1G9CA 1NE4A 1PO22 1F15A 1EAH3 4LO5B 3SC7X 2BDRA 4IDZA 4JV5B 5FIXA 3F7YC 4AHWA 1D0HA 3OMNB 1NLRA 2UWBA 5H9RA 3IAPA 5F2WA 1DU3D 1W2TA 2AZ0A 4ISQA 3K51A 4DUWA 5K7PA 2MEV1 4JPRA 5E89A 5DXDA 1W9FA 5FZCA 2RN9A 2UXCB 3PVEA 4QQPA 5F5AA 5ITZA 5FKCA 4XMIA 3JSNA 3SJCC 5BNQA 1Y7BA 4BE3A 5LP6B 1J95A 5KC6A 1N3OA 2BQPA 1VMFA 3MBWA 1WBLA 5L3FA 4JI3O 3W7SA 4PLMA 1W0NA 1L7QA 3DXRB 4I0XA 1NT2B 4QPIB 2Y6KA 2YXHA 3MHHC 1F5JA 1IS5A 2FZ1A 4FPKA 4DEQA 2MEV2 4DY5A 3AZWA 5ACA1 3DTUB 2IZWA 2DWRA 2Q1MA 4NN0A 2XT9A 1ZBA2 1W8NA 3IJ4A 5DZGA 1UZVA 3O1SA 3H1JH 4MGIE 4A6SA 3LPFA 4K21A 3B3QE 1A32A 4GJYA 1NYWA 2IU0A 3SKVA 4J42A 4XFFA 4RUFA 5EJZB 1PKXA 3D3QA 3D0SA 2NMNA 3ZX7A 3RDIA 3ZCCA 5FY8A 3TGUH 1LNQA 4JGZB 4C1WA 3APBA 4XDJA 1NXMA 3I2OA 1HWYA 4YIPA 2LUWA 2GP3A 3M7MX 4UUJC 3WW2A 5KBFA 1JODA 4UF0B 1L7LA 1G6NA 1PIV1 2LTNA 1GOGA 4B1LA 4I0WB 2HWD1 3SXWA 4JTAB 3KB5A 4TWKA 3AMHA 4MGZE 5JXGA 4BCUA 2M7WA 3C90A 2UWCA 4PDRA 4RGKA 5F3CA 3UT0A 5FYCA 1JOPA 1N0JA 2BWCA 2DVAA 2XMLA 1ZRRA 3GZAA 4PD4F 1WPXA 1AYM2 5GONB 4U36A 4NJ4A 5FZOA 1GKFA 4IGPA 1I94B 1HR0O 4FIPC 3NKGA 4UW4A 5JWPA 4J7KA 2WC2A 2QZ3A 4FFHA 5FZ0A 2JEUA 4GT1A 3TXSA 3HKBA 3JYCA 4ZPIA 2VCBA 1VMGA 2FDKA 1G8MA 2Y33A 3OW2U 3LIGA 1COV3 3ROUA 3U1XA 4LHNA 4DR6O 4XJ9A 2BTVC 1QR9A 2E76B 1GOFA 4EV0A 4LBJA 3WEZA 3ABLC 1NVPD 1GTOA 2GDFA 3C8XA 1ASJ1 2VW1A 3VUOA 2KQXA 2GC3A 1WCQA 2YFUA 1GN2A 1H4HA 1JS9A 1UYPA 1W6PB 4AQTA 1AR4A 2R0HA 1XMOB 4Y22B 1VP7A 5C70A 1EPWA 5EV7A 4B8EA 4MUVA 1SQBH 1JHNA 5KA5A 1D4M1 3AG3C 2QQLA 3N9PA 2H8PC 3T0DA 4Y20A 5J9PC 4GD4A 1MZEA 3CMAV 1W6MB 3CO2A 4Z2AA 3HBZA 1WLWA 3LB9A 4U3JB 3WB2A 2Y6JA 1K7DA 4FLVA 4JI3B 4E4EA 3WW4A 1SACA 3O5SA 3CCSV 3HWJA 4O4LA 1RP3B 5IWAO 1AXKA 2EXJA 1K42A 2RJLA 1OQDA 4X64O 1CAUB 3ZVXA 4XDPA 2LW8A 4HBNA 2HBUA 2GN3A 5C93A 1AL22 1BBT3 3NNGA 1HW7A 2W9XA 3B77A 3ZYFA 2HR3A 4B29A 2DOSA 2Y69C 3IDBB 1WD4A 4IYIA 4NIGA 2C6SA 2VUJA 3PUSA 5FY0A 4DRXA 5LBFA 2WT2A 2XG3A 5CYYA 3VGIA 2EF6A 5EC2C 1UY1A 3EFFK 2P1BA 1N1YA 4L11A 4RS5C 2W5FA 4LHKA 1KKDA 4P9IA 1XHZA 4WCEV 2XNDG 3FD9A 3RI8A 1O8PA 5FQ0B 4WV8A 5C33A 3VBHC 1GU3A 3IM0A 4OUSA 4J7JA 1OQEA 2HWF1 4LWSB 5LYJA 5C9AA 3JD2A 3PJSK 1US3A 4PA4A 3AMNA 2D97A 3VBOC 2ZX1A 5LHHA 5KLVH 5EYYA 4D7YA 4ORFA 1YJ9V 1ZBE1 3N2GA 1AJNA 4WFHA 3VL8A 2SBAA 3BY6A 2VQTA 4AFAA 1AL0G 1F9KA 1HR0B 2OIEA 1UY0A 3PUQA 4JYBA 1Y76A 1G9FA 2A70A 3J7MA 3FB6C 1C8M3 2GP5A 5IJ9B 2Q4SA 2HHHO 5C5TA 4J11A 4B7EA 4BJ0A 2JXAA 5F3EA 4O61A 5IYCO 1ST8A 2PYLA 2B1IA 4UVAA 2LP7A 5ABJB 2W08A 1S0GA 4DR6B 1O91A 2ZA9A 1I1EA 2YICA 1QDOA 4TSFG 2ZINA 1Q7YW 3BPZA 4AAXA 1POV3 2CSGA 2YXYA 3DYOA 4I3PA 5F8PA 1FNYA 3RYRA 3MLLA 1SPPA 5CA6A 1LEDA 5JCOC 3W5MA 4X1IB 5GW7A 2VQUA 2VZRA 2JS5A 2EINB 1M4WA 1YRZA 2W1UA 1JYWA 1DYPA 5LW9A 4NYKA 1JYIA 1EFRG 2YI8A 4P2ZA 1H4GA 5CFDC 2YEVA 4GWJA 2WZR3 2CGPA 3ZMVA 1H8TA 1ZNPA 3LAGA 4MSWC 4JKMA 1YIFA 1R1A1 4YFZA 1MR5A 2C24A 4LKDA 4UCUA 4N23A 1LECA 4DMIA 4X66O 3OAAG 1YHFA 2QWRB 1YQ6A 4JZ2A 1SKVA 4JDMA 1GZ9A 5CU1A 4BR6A 5KUKA 3WP4A 4UVBA 1G9AA 2W6JG 2BCCH 4X64B 2Y26A 3E1F1 1D5AA 4KGGA 4AI2A 2LM3A 1OCZB 4EZHA 4LCUC 2A6YA 2XKOA 4XUPA 5A6YA 4JGYB 3APQA 1RUD3 4JI2B 1O59A 2BBAA 3H50A 3EHKA 3AK3A 3AP7A 2WFF1 1BZWA 1FFTB 3RZMA 2BNNA 1WB8A 1O3SA 1N34O 4OI1A 3QNEA 4OQ8A 3PLQA 4M3CB 1LRHA 4AYUA 3H1LH 1CAWB 1NH2B 4LLOA 2VZ1A 3LIHA 4ONUA 4QAWA 1LJ7A 1TUBB 3EYPA 2ZM6O 4I0AA 5LA9A 5IE9A 1S0DA 1W8FA 4I01A 1YO8A 4YRDA 2UUBO 1WD3A 1UPSA 1TVGA 2UY8A 4XFBA 2WFF2 1W8WA 1RL3A 2E74B 3NO8A 4KXRA 2JECA 4AQ6A 1NXD1 4K8RB 1YIJV 1GKBA 2H0VA 3OTOO 5DZEA 3WNXA 5FXXA 5IAXA 5K0UB 4XBLA 2B1GA 2VUAA 4BB3A 4F6EA 2LROA 2RE9A 3I59B 1RUJ3 1MS4A 3NWKA 2HHHB 2R063 1RUG1 5LB6A 3R6SA 1NR7A 5A32A 3LPGA 4WM7A 1HB2A 2AENA 1W2BU 3ZXGA 2IXHA 5CFCA 3ZS8C 2XPJA 1GLHA 2P3JA 2CDPA 4LUMA 4PI2A 3ZRSA 1VQOV 1NAEA 4J1XA 2B5HA 1AYN3 5CB7A 4KHPO 4JKLA 2DYRC 2PLV1 3DC5A 4AVTA 4GWMA 1FX5A 4B3NA 1OLQA 4P9XA 3NAPB 4ABMA 1UL9A 1W0PA 3C3SA 1PVC3 4ZXEA 3K5OA 3OGJA 3MIBA 2V09A 1BHAA 4Q4X1 4RR3C 3CWBH 3T4DA 4J6GA 1B04A 2R072 4JI6O 4LA2A 4O65A 4X65B 2BOBC 1EBOA 4NRPA 4FOWA 2IFRA 4LK6A 1VMJA 5GTHZ 2GC0A 1W6OB 2VJXA 4ZONA 1RB8G 2VMIA 2Z5WA 3OYWA 1NJIW 5C4WB 3GCWA 4XAAA 1QHDA 5FP3A 4G4FA 2PLV2 1M56C 4QPWA 2RDNA 3FFZA 1F51A 3BCWA 3V64A 2ENRA 4O2AA 3CMEV 1UU5A 4Q4X2 1D2SA 1V0AA 1IKQA 1B35B 2JGDB 3FBMA 4CS3A 1Q8IA 2QJ1A 1ZZ9A 4Y33A 2A6XA 3KT1A 4QHZA 3APOA 4NTXA 3NV2A 1MEC2 1US2A 1O9HA 3CF6E 4H7LA 2P4KA 2ZS6B 5GALA 2RS51 4DZGA 1N34B 1Y4MA 3O65A 4FFBB 2HWC1 3IDAA 3CCJV 3H8OA 3KZIZ 2E33A 4Z92B 4CCCA 2FCVA 2WKKA 4QX0A 3ILNA 3TN91 3ABKC 1I6XA 1KEXA 1JZ6A 5AC91 2A6WA 3H9AA 4IEUA 2J1AA 1OLME 2K9PA 2ZM6B 4D8MA 4CSWA 1N32O 4IYHA 4IGGA 1H0BA 3T1CA 4OFGA 1UD1A 3M3EA 3AP9A 5FPAA 3ON7A 3DGEA 4LBKA 1N1VA 1MOFA 1NY71 1OSGA 2X0LA 2RS52 4CDWB 2VVDA 2Q1ZB 3VDDC 2P3YA 4P5YA 4UCRA 2GTAA 3LSUA 2JWPA 2HWC2 4GWNA 3HT1A 5T5OA 1NLQA 1OF4A 1W9SA 4CC6A 2WSUA 4B3MO 2DVBA 1F4NA 2EIGA 4E4DX 5HFLA 3ZN0A 1FV2A 3OD0A 2IWGB 1DQ0A 1R3KC 5A3PA 2RNBA 1H2LA 2GMMA 2RM21 2K2SA 2UXBB 2GALA 2PHWA 4BISA 5FMBA 5GLWA 1N36O 4QU2A 1XB9A 1QJY3 2QKAA 1SCSA 1DIWA 4QXBA 2QNKA 4X9QA 1LOFC 1MVQA 1P4RA 5GLUA 1BEV1 4GAZA 1QJU1 3VD3A 1LOAA 3P3NA 5EP9A 1HNWO 2AHZA 4KHPB 4GXLA 4HKWA 4XEZA 4MGSA 1GBGA 1SDDB 1AR1B 4BHPA 4Q0VA 3I2HA 1VF6C 1XJAA 1Y4WA 1NBMG 2XKPA 3DEMA 2RM22 4EEQA 1DQ5A 1AR63 5BUVA 4LF5O 2AH2A 3SYCA 4MOAA 2QGNA 1JOBA 4XC9A 1RPRA 2XAJA 2H6BA 4K3UA 3AKRA 2NM1A 3IN9A 1BEV2 3ZEDA 1QJU2 4HZ3A 3PUIA 2RJKA 1XL6A 1ZZ7A 2XR4A 1JUHA 2NR5A 4X88A 2E7QA 2X5IC 3I3EA 1AI7A 3ZKUA 3EMRA 1E5IA 1UNBA 4RL7A 1D0GA 3AB0A 2WJSA 1Y3TA 1ZAUA 1ND2B 4NOTA 5FZDA 3CU7A 4JX0A 3TEWA 2RV9A 2BRTA 3TEYA 4BLIA 4F4LA 1DGRN 1FATA 1V6IA 3WDTA 1RUH1 4ZI7B 4QM9A 5AFBA 2ADQB 3M3QA 4IHJB 5KAIZ 2FKXA 1QKQA 3PDQA 5EYPA 1XQ8A 5FZMA 3Q8EA 4ISRA 4DXSA 4W50A 4H33A 2E63A 3ZFGA 3E8FA 3MIDA 4N90A 5KWRA 4GB33 2FB5A 1XYOA 1UYYA 2B4KA 4NHMA 2PHUA 4FXKB 4AG4A 1KKCA 2Q9LA 5B1BB 3AMMA 1C28A 1KITA 5GZDA 1IBMO 4PQ9A 4QQHA 3LA3A 1VAVA 4LT5A 2ZDIC 2YSUB 2YIAA 1N32B 2YMZA 1MQTA 5LHIA 2WLJA 1RUH2 4CDXB 4JKKA 3VBHA 2G1MA 1IG3A 3MUZ1 1IBKB 5DPNA 1XNAA 1JTZX 3VBOA 1NOVA 2X10A 1S0BA 1YJNV 3A2FA 3SDLA 5K1PA 1DLBA 2HEYF 2JG8A 1RVF3 4J25A 3HKDA 4CS2A 3C7FA 1ULDA 3FKSG 4B3MB 2B46X 4S2FA 3VKNA 3POBA 4FT8A 5F2VO 1IVSA 3PIGA 2RS32 4Y5TA 2BP6A 3CP1A 1R083 4CEYC 4MVMA 1ZA4A 3J7AU 1GN4A 2JG9A 3WCSA 3C3TA 2D5FA 5IVBA 2D6MA 1SBFA 4ZS2A 4NAMA 5CIRA 1WPBA 5FZFA 3OGRA 1G4YB 3POJA 2FDFA 5FY5A 1HNWB 3B09A 3WR0A 4LNVA 4RSUA 3AMQA 1UYXA 4JHZA 4LF8O 2JRIA 4LBQA 3T1LA 2R0FA 1FPN2 4PF5A 3RYIA 2NLJC 1K5JA 3ZMNA 3VBSA 4LF5B 5IDJA 3GHMA 2RG4A 1F5FA 1OHFA 2B45X 2QM8A 4AVBA 4NHLA 3ASOC 1YZBA 2VOWA 1VLNA 5CBGA 5A3WA 1NA1C 4PIYA 4YVSA 1GM8A 3BHPA 1YYNA 4FFKA 4LBLA 4FPGA 3USUA 4LP8A 4SLIA 5E6HA 4FPJA 4O4IA 2GNTA 1UZ0A 3ES1A 3ACHA 3VN4A 1GM9A 3OMAB 3E86A 2VZ3A 4N9HA 4BQXA 2VQEO 4Q2FA 3QBQA 4U3FH 2EAKA 3IBMA 4W6YA 2ZR3A 1GN6A 1JR9A 1ULEA 1S55A 1NZCA 4YJ3A 1SC5B 5KHHA 3K9SA 1W8ZA 2X29A 4K0KO 2G9FA 1V6JA 3D0JA 2NZ9A 5BXXA 1PNGA 2BU9A 1H6XA 3GDBA 4YJ2A 5H6QA 2E9QA 2IH3C 4QX1A 4N53C 3OBRA 1ULGA 4JZRA 3N9LA 3KQRA 4Q29A 5C3SA 1O8SA 2FMLA 5FR3A 1CPYA 2P5BA 4FOVA 4DXRA 2PTMA 1AR92 2CE4A 4OPAA 1DF0A 4QE9A 1XNTA 2WNOA 2IC1A 2WNVC 1V54C 3TK1A 3JQWA 4YW5A 1SDWA 2DVFA 5LA0A 1IXMA 4BPZA 2JD4A 1HB1A 3CXCU 2MNGA 2KA3A 2ZMLA 4AVSA 3HKBB 3K79A 2OIIA 3I5DA 5D8AC 4ZOLA 3HQUA 3ZXJA 1ZSPA 1JFFB 1VBC3 1STMA 5C6CA 2PQQA 2RS12 4FLZA 1J3RA 4B4QA 1AX2A 3ZSJA 2GU9A 3RZZA 3IC9A 4INDA 4Y3OA 4TV9A 4LKFA 3ZN6A 2C0ZA 3WNMA 3PUHA 4CUAA 2XHKA 3C7EA 1BQPA 4UV8A 5D2AA 1FS0G 3FB8C 3ZLIA 1NCQC 2V1DA 4HPKA 4AI3A 5B1OA 1ND3C 3T1HO 3DPRC 5IT9N 5IAVA 1POV0 2ETEA 1PL4A 3OEAA 2D3RA 1IKPA 4CEWB 2SLIA 4Q1RA 4ZHQA 1QLEB 1UO9A 5L36A 1GUIA 1XOUA 4K1ZA 5ANNA 2Q68A 2W0FC 1Q8QA 4LE3A 1W8TA 3QOPA 1NZ6A 4IW3A 4CUCA 3VBFB 3MW4A 3FYEB 3ZFEA 5IK5A 5HXVA 1E1QG 3LEGA 4LBNA 4HVOA 3SYAA 4O4HA 1JYXA 4QT6A 5KXEA 2X53S 4JV4A 4CU7A 2LW1A 4XDOA 1XYNA 3O0XA 4X6QB 5AFEA 5JH7A 4TUYA 5F5QA 5BXZA 1XBLA 2OQ6A 1QHTA 1V6NA 4LR3A 2DFBA 2VQEB 5B3SB 1Q5OA 1KQSU 1WA8B 2Y6LA 2QVSB 5FO8B 5CA0A 1E57A 4BQ4A 3THDA 1LHNA 4GKYA 4LQRA 4KBZA 1WBFA 4FPCA 4K0KB 4KWUA 3I3DA 5L7OA 2VXRA 2DF7A 4DR3O 3VZKA 4FP2A 4EN8B 4CH6A 4NXMO 5DDJ2 2XVGA 3GVMA 5F39A 3RI9A 4PIXA 1AR83 3MYXA 4TZDA 1W05A 4PDVA 3WP6A 4Z8BA 3SCHA 3JARB 1X9PA 4QKBA 5FZ4A 3B8MA 2QQPA 2CTWA 1SS3A 1RUE1 1W8UA 4KP4A 1VBB1 2WFPA 2F4VO 4B3RO 3AC0A 4OQ9A 2ZCEA 1YUDA 2YPJA 5LRSA 4UAPA 3G80A 5JMOA 1LUWA 3T30A 5F9TA 3C3VA 1V55C 2F4LA 3BOWA 1NQJA 4P9JA 2XDVA 5GLZA 1CWPA 5LA6A 2UU8A 3CJHB 2NYYA 2ZNIA 3SYPA 3JBG3 2V4DA 3I7DA 3QH6A 3BALA 1R3LC 1S77D 5T5JA 1UMZA 4HVRA 1RUE2 2Q5ZA 1GP6A 4WVMB 3UKNA 4RUEA 5FP8A 5FZ1A 2DVGA 2XUMA 3UV9A 5DMYA 2W39A 1KJLA 2D6LX 4N7IA 2XQXA 1LOGA 4TV8A 3I3QA 5T5LA 3RWRD 1HRV3 5CNAA 4RN5A 3JD73 3ZXFA 1ULOA 3T1HB 4C7UA 3H3UA 3GM8A 1VB4A 4A42A 4UVCA 2J1VA 4AI0A 1IPJA 1FNZA 4AEDB 4LBOA 4W6XA 3BA8A 3NJXA 3VZMA 3T4HB 5FYIA 1JU4A 5FYZA 3UO3A 4DR1O 4TTGA 5GLTA 5IYYA 2WLLA 1S2KA 4IEPA 4JI1B 5TSWA 1O3QA 2R1DA 1VF6A 4K8XA 3ZSMA 2GHYA 1OJHA 1N33O 1R3IC 4O9EA 2WS91 2E51A 1XEQA 5LXTA 3UT5B 4E2QA 1VQ6V 4A3XA 5LA1A 3E5XA 3K5MA 4HSJA 5FK7A 3LCPA 2GSYA 2EXKA 1HXS2 1WP8A 4O4JB 3E2EA 1LGCA 2XJVA 2E3CA 5DUXA 1J5EO 3RN4A 4L92A 2JE7A 1XNCA 2QTOA 2HEVF 3VKOA 2QKDA 3JAMN 2LFSA 3TXQA 3I2FA 1S0IA 4GKXA 4TWTA 4JTNA 4K7JA 2A3QA 1FOD1 4FFIA 4JI7O 1OCCC 2ZE8A 3K04A 2E5LO 3CJIC 4H3WA 2AZ2A 1HNXB 4CZSA 1AI4A 3SQOA 4E4SA 3L2YA 2ZTNA 1HP8A 3AG1B 5DAXA 1WA6X 4NXMB 4Y4YA 1JZ8A 4QQ2A 4BZ4A 2CWSA 4LUKA 1UXZA 4DUXA 4XIOA 4IXLA 2WN3A 4I3GA 1KD1W 3WFVA 4LO7A 2P37A 1PMHX 4R7CA 5FZAA 1BSMA 2ES3A 4KMQA 4M4PA 1PO23 4YW1A 5GZGA 1GICA 4IE0A 2JENA 1XILA 3EXAA 3EHBB 3JAKA 2WPDG 3AYCA 4FBFA 2TUNA 3ATGA 2F4VB 2WNEA 2QWPB 3F95A 3HAGA 4B3RB 3PVNA 4NE9A 4DV1O 4OULA 2OPKA 3QACA 2ZDIA 3ZDVA 1W6NB 1LHUA 1DYKA 2HEWF 3H01A 1FXKC 3KV6A 3N9OA 1GSLA 1MS8A 1DK1A 3VKLA 1K45A 3LF7A 2HJFC 5KMGA 4CCJA 3ZFFC 5T3NA 3OUFA 3ZMUA 3UCSC 1G86A 2ZX2A 4L0PA 3AEIA 5IJRA 5LZ6A 1I0HA 4DV6B 1BXHA 2WNUB 1RHI1 2VOVA 2FMDA 3K48A 1Y43B 4MH0E 2NMOA 3RYCA 2CH7A 4XF1A 2Q7HA 5CVRA 2R7EB 4FJCC 1ACCA 4DV4B 2MEV3 4UBHA 1W2UA 2QQNA 4CEYA 2VZSA 1OOPB 3WV6A 2GNDA 1ZBA3 1H2NA 2VCCA 3G6BA 2Y60A 1F8VA 1SG3A 1J59A 3OR7C 3VZLA 1NCRB 1VQLV 5FO7B 2OS2A 4V2WA 2WLIB 4H2AA 1RHI2 4MXWB 1V6LA 3C7GA 4HKOA 5CBLA 3VBRB 2IU3A 5JZGA 4BXSV 2QEXV 4DR1B 5T54A 2DFCA 2P67A 5A7OA 3KG2A 3OEEG 2UXNA 3K75B 2BTQB 1N33B 1QQP1 4DR5B 1S5JA 1JPXA 2CL2A 1U5YA 1IURA 3N7LA 2DUOA 3AG2C 1I3HA 1Z7S2 1KFUL 4LR4A 3M7AA 3LSQA 1U5IA 3N4MA 1K4CC 1DQ1A 4HXCA 1DF4A 1RFYA 2LS6A 2HKXA 1D2QA 1OD3A 3DKQA 4PI0A 3ZR5A 1AYM3 1UZZA 4X62O 2NPIA 2W1SA 4JI7B 3RGBA 2VMCA 2RDSA 5FYYA 2E5LB 3N2KB 3PL0A 4UFKA 5JOZA 2AACA 1QQP2 4Q1PA 3WOGA 1YEWA 3VBUC 4IE5A 4MSVA 1HKDA 4O7XA 1KS4A 2RVAA 3RJRA 1NS1A 5BNNC 3JD3A 2CV6A 1CAXA 1H1IA 2JDHA 5T52A 1QJX2 1JOYA 2J1UA 3AVRA 3ETQA 5J2TB 4DUZB 1XBFA 3ZHQA 1R64A 1WMDA 3PJQA 2VZUA 3P32A 3LZZA 4OZOA 3QO5A 4Q4W1 4YW4A 4LE4A 4IEZA 1E5SA 1W2NA 3BOPA 1HV1A 2MHFA 1OURA 4RQPA 1GP5A 2EIDA 2YXSA 1PGSA 3DL3A 1A8MA 1PMJX 4DV1B 1PK6C 3A22A 2VG9A 4J10A 2DCTA 5JQGA 2ZZQA 2WNVA 2BV4A 4LK7A 2OUJA 4LFCO 1ZL8B 4JASA 4Q0SA 1XOYA 2B42B 4EYUA 3NW4A 4EB6B 3A0NA 5DUWA 3ZXEA 1H9WA 2ADEA 5I8SA 4FXGB 3K57A 4O2BB 1RM1C 5D8AA 5DAQA 4KNCA 4P08A 2RMU2 4Q4W2 2PF4E 1BS3A 4QB2A 4K3AA 3ABLB 5JI9A 1TNFA 4I0BA 2Z42A 1AL23 3CDZB 2F93B 4FI9A 1NCQA 3AK0A 4QDSA 5D1IA 1ND3A 2ZXQA 4HLTA 2IXCA 3GBWA 5FUPA 4FPLA 4U7OA 5FAXA 2GUZB 3RYFB 3ZRWA 4QMAA 2X6CA 1NH2D 2NQYA 1CX4A 5FY7A 4HN1A 1DHKB 2E32A 1ZX3A 3QO7A 2Z2SB 2WWWA 4M0HA 2RR11 2FDGA 2YBKA 4G27B 1YFXA 3PU8A 1PO12 3MDSA 2ZKNA 2YC0A 5FWEA 5IFTA 4DFSA 1O5UA 2VNGA 4WBNA 3WG1A 2P34A 3AFKA 3KT4A 1ENXA 5A1FA 5JDBA 2OX0A 1JMKC 1H6YA 3H1HH 1OPOA 2PQSA 2HWE3 3LDRA 4DV0O 2Y69B 3ZYBA 1KMIZ 3ES4A 3R4SA 1Z5WA 3PMSA 5BYNA 3IMMA 4OHZA 5T55A 3S5AA 2DCKA 3B69A 3AP4A 3FLRA 4I50A 3FUOA 1S0VA 4NHKA 4P9OA 4RGAA 2HJDA 4WFAV 5FRAA 4RS5B 3OUJA 3ORJA 1MZ5A 1XE7A 4C90A 1AILA 3JATB 1MS1A 3WDWA 4UCSA 2HFEC 1O6UA 1SLBA 3RWKX 1ODMA 4J1WA 3G7DA 1JYVA 1VRH3 5IJ0B 3MIEA 1QJZA 3OF1A 4JRLA 3NNMA 5LP6C 4AQSA 2WO7A 4QM8A 5A3TA 2MPFA 4FP3A 1LUVA 5J2UB 4IL7A 1Y9QA 5JVDB 3DSQA 1IX9A 5GZEA 5BPXA 3D82A 2BERA 1PGW1 1M57B 5FY1A 4C1XA 1KB9F 4LXLA 4FO9A 3W7TA 1YTFB 1QMJA 4QPIC 1WCUA 1VEWA 4MVZA 3CCLV 5M0TA 4X1KA 4FLUA 4LFCB 4XQ4A 4QPGB 3I55V 1BCXA 1FJGB 5GTIZ 1WW6A 5IVJA 1WCKA 3T1MA 3POFA 2JKBA 3H1YA 1V6OA 1RC6A 5ANQA 5FLHA 4JI4B 4IE6A 3U10A 3SNMA 5A7QA 2VY0A 3CPWU 1CGPA 3HN1A 2VMDA 2EILB 4HNAB 1NZIA 4LPLA 5CB4B 5LASA 5JXHA 1RSOB 5KAFZ 3OR6C 1Q8PA 1HW5A 1B6QA 5I8YA 4JI0O 2LQTA 1JZ4A 2DTYA 2OW4A 2R70A 1PGW2 3DF0A 2YC4A 1KGYA 5L3EA 5LWBA 3D36A 5CA3A 1L8DA 5CG9A 4ZU4A 5F7UA 4JGZC 5JSRA 2O8QA 4G3YC 1WLDA 4BIZA 2OWOA 4EWAA 2WAMA 3ILRA 4HYOA 1AB3A 4LOSA 2ITCC 2IM9A 4DIQA 3WNKA 4JI8O 4HG6B 1U0AA 2YPDA 3O1MA 2QM4A 2P4EA 4LA3A 3AYDA 5B4NA 3SEEA 4ZXKA 3BN6A 4K40A 5H9PA 5BNOB 5JJEB 5CFDB 3V65A 5FNVB 4COYA 3JB4C 2KSDA 1VAKA 2DBIA 3MF6A 4AK3A 1FAFA 1W03A 2A6VA 3QVNA 3R4DB 4BOWA 5FPUA 3D8CA 5DM6V 2OCCC 2W91A 5FPOA 3E6DA 3NKTA 5I93A 4OGQB 2W95A 2BOIA 3WQ7A 2ZHMA 5B2GB 4JC1A 3J7LA 3B4SA 5BNPB 3SR2C 4FM1A 1URXA 3ZYIB 3D3AA 4EWDA 2VE1A 2WFF3 4WFBV 1YF2A 4ZKTB 1CPMA 2V72A 1QH7A 2E7TA 4DV0B 5L73A 1DTOA 3ACFA 4IT5A 3WG2A 1VQNV 1OVPA 3AG7A 4PDWB 3AXDA 3HOBA 3S6PA 2E75B 2XLFA 2H3OA 2OYZA 4IV1A 1BE3H 2R9AA 1VARA 2VOTA 1KP3A 2ARCA 3J8F2 3CX5F 2X6BA 1DGWX 1PMIA 2DWDC 4DV5O 4MZUA 4I5SA 4PT6A 3UM7A 2P6CA 3WNLA 1QCEA 4YM3A 2VAUA 1NE6A 2YZ4A 4YGEA 3CXHF 2N05A 4A41A 1Q3EA 3V0AB 2LJ2A 3T1YO 2OXBA 2IJIA 4D6QA 2B9UA 4QGNA 1GV9A 3NNFA 4LHLA 4DV2B 3O14A 5LGTA 4WM8B 1MZFA 1V9U2 1G8WA 3CHXA 4IIJB 1FYUA 2PA7A 2D40A 4XTMA 4X1YA 4GMP1 2VZPA 1YXWA 2NP0A 3SPCA 2R073 5FTTC 1K4DC 4Z07A 2Y6HA 4I02A 3JALA 1FFXA 1A34A 1QLNA 1GN3A 4MVQA 3BUCA 5KC5A 2E31A 3V0BB 1RUF1 4A2UA 4FTSA 4FLYA 2PLV3 4UB6Z 4JI0B 4JHTA 4CCEA 1BBT1 4XDQA 3A0HZ 4N8MA 2IH1C 2V5DA 2EVXA 2ZD9A 2HWB1 2CDYA 4QXHA 4Q4X3 4GIQA 1G7YA 2CHHA 4HSLA 1KU9A 4HANA 4P00B 5IYZA 2DYRB 5LK7B 3LDKA 5FZHA 2Y0OA 1X36A 3THTA 1OMIA 1S2BA 2Z4FA 4JI8B 3CNAA 1MEC3 2PI5A 5A7SA 4IV3A 4NIHA 1RUF2 3OG2A 4AFCA 5C9AC 3B9CA 2ADDA 1Z78A 2D3SA 1SA0A 4RR3B 4ARXA 1APNA 4Q20A 3AYEA 2O57A 2HEPA 4LH7A 5I91A 3RZHA 1YFUA 4AR2A 3HMYA 1IQDC 1I5PA 1BBT2 1FD9A 5LMUO 2HWB2 3AG4B 3OY8B 2YC2A 3O12A 2C4XA 2UXDO 2YV8A 1MS9A 1T6BX 1LESA 1Q90D 2UXXA 3VQXA 2D98A 2ZOEB 3IPVB 3FN9A 2DDUA 1C5IA 3ZX6A 1UU4A 3A8TA 4QDQA 1AXZA 4QGMA 4CPBD 1AJQA 1TGOA 3EJKA 5I0RA 5ABJC 2HWC3 5LOVB 3X2QB 2VQFB 2I07B 4HN0A 3ZBHA 1JW6A 4DS0A 3SJBC 2K46A 2EBOA 1YSCA 1XMQB 2ITDC 1QR8A 2ZX0A 2VRZA 1S4CA 1W6QB 4WF9V 4X20B 1XNBA 3JXSA 1QJFA 4FFGA 4AOCA 5FO9B 3E6BA 5C5UA 2EINC 5BNNA 3AL5A 5C8YA 1B3QA 3U0ZA 3ZRVA 5IY5C 5KX5B 4CTEA 3ABZA 1H2MA 3M3IA 4UFLA 2VCAA 3NJVA 1SZTA 4CXXA 2YDEA 1ENQA 5FUNA 1D7PM 1UKGA 3LSDA 3ZHVA 2VL4A 3VDDB 2WZR1 4LNUA 4UBGA 4I9QA 2RM23 3ZKYA 2C1FA 2PHDA 2YUEA 1W04A 5JVVA 4Y1VA 1AJOA 1LHVA 5APAA 1QNYA 4MW3A 4B3SO 4NTYA 1W99A 3AZXA 4JGYC 4RAIA 2GMEA 5IYDO 3WF2A 3B01A 2A3XA 5B1AB 4D94A 3HKEA 1PV0A 3N9QA 4AW7A 4GCZA 1WW7A 2OTLV 5F2SA 1LNSA 4D6SA 1PM4A 1C3HA 4CU9A 4Q4V2 3T2QA 2L35A 4RFRB 4X8AA 4BK5A 2OKXA 4DUYO 1M4UA 1Y9MA 3BPSA 1THZA 3LEMA 1OA4A 2DU1A 4ASUG 5DECA 1ENRA 4QPYA 4XFGA 3VD4A 4FVMA 4P02B 1S5LZ 4B7KA 3KGLA 4RO2A 3IWZA 4URTA 3GJBA 2Y48A 4FQZA 3BGAA 3FZ3A 5EQUA 5L9VA 1XHXA 5FJHA 1NUKA 4I4TA 2BGOA 4JCKA 2XTAA 5LMUB 4UXNA 3UNPA 3INAA 1LOEA 1J3QA 4Z1VA 2JVDA 5FFOC 2UXDB 3IAYA 3RFRA 4ITCA 2AXTZ 2WABA 2EIBA 4PLOA 3CCUV 2Q67A 2DBNA 2WRAA 2X5IB 2UY9A 1W9TA 3LDDA 4OHXA 4E2GA 1JBCA 1EV12 4ATEA 4YZ1A 5DEDA 4WM7C 3VLBB 3HR9A 5JMCA 2Q69A 1UCXA 3E22B 5H9CA 2Q0AA 2HP8A 4LF6B 3OBAA 4MGQA 1JQ0A 4NPRA 3S5QA 4TLFA 5A33A 2V7QG 3LE0A 2RS33 3D6EA 4UFJA 1KECA 3TNQA 3E89A 4URAA 5KXCA 1GYKA 1VBE1 1AVMA 2CDOA 4A4AA 1AR72 1JI6A 3JAKB 1I5ZA 1IHMA 4MGYE 4QQLA 4FAGA 1XMOO 5K8SA 5FPRA 3WUDA 1Y9GA 1UQXA 1EUUA 2FL4A 2XJRA 1L1FA 3B00A 2QWNB 4QKDA 1GMGA 3N7MA 4XW3A 3KD4A 1IS4A 1PVC1 2ZEYA 2Z5UA 1X59A 5LP6A 4GKJB 1FPN3 4OHWA 1AUYA 4Y24A 1BHBA 4LFAB 2BGCA 2DU0A 2GSMB 1VBE2 3A0KA 3Q8AA 5L3DA 2QM7A 4LF4B 3DXRA 2XONA 4QPIA 4GH4B 2EIJC 2W68A 3WY6A 3E8HA 1AHSA 4BAYA 4NHXA 2QKCA 4R6ZA 3CKHA 5C3PA 1B35C 4XHXA 1QF3A 5BR8B 3K0DA 2XJTA 4BU2A 4B3SB 3H0OA 5A3LA 2EIKB 3I2GA 1VQKV 1IZ3A 1QGLA 5EWSA 4UW3A 1SZXA 1PVC2 4DW0A 2IXIA 2JB4A 4J41A 4R9DA 3VD7A 3UGFA 4Y1ZA 1FMD1 3ALQA 2DYCA 2Z0AA 2VULA 4P9YA 3STZC 4DUYB 1R093 4CCOA 4P5HA 3T3YA 2F17A 3JD1A 3SISA 4JGZA 2CYFA 2VVEA 2F95B 1LOBA 3BODA 4PA9A 1W8HA 5ACA2 2K1EA 4LJHA 3ZXKA 2IBZH 4UF0A 2YFZA 1D4VB 1Z2GA 3SGIA 1B09A 4XJ8A 1GANA 5FZ3A 4YVWB 5F5CA 4COVA 2WAAA 3ASOB 2K9ZA 4HMZA 3FHIB 1FMD2 4CDWC 1HLCA 3WP5A 1NA1B 3P30A 3BABA 1AR93 4CP9B 5EZYB 5IHRA 2PYTA 1K97A 4YZ3A 5GONA 3OOXA 4E4HA 4JQRA 3G67A 1S1AA 3ZYGA 1YNAA 1OC1A 4RHV3 1BGYH 3POGA 1PIV2 3AP6A 4G9SB 4W4ZA 2YG0A 3ECQA 1UIJA 2HWD2 3WDVA 3S7IA 1WLCA 3T0AA 1LTEA 5LBCA 2KM2A 2F23A 4MX3A 5JOXA 3LEKA 2Q7GA 1SMVA 3TETA 1OBNA 1RJ8A 1E5HA 3D3IA 4Q4Y3 5DG2A 2WLMA 2RS13 1JZ2A 2F1MA 1OCOC 4RA0A 3HB3B 1U97A 4N53B 5A7WB 2BE3A 2VBDA 4AI1A 2AYHA 1D2DA 1K5MB 1PNFA 2BW8A 1GNZA 1K34A 1FV3A 4L99A 2B5UA 1NTZH 1QJY1 3K77A 2JJ2G 4MTOA 1XNDA 3JU9A 1W6PA 1Q43A 3H9VA 2W87A 5LK5A 4Y22A 4ZZ8A 1QOSA 2KG7B 1GQGA 1EYBA 1BL8A 3K0GA 1DF5A 1WZXA 4W4LA 3J80N 4UV9A 4ZBMA 5CA1B 3MIHA 4BK4A 1C57A 4DINB 4LC1A 1MZ6A 1NI8A 5LEKA 1SFYA 3DC6A 1W6MA 1QXPA 4CH3A 4P30A 3VHRA 4U3JA 3L75H 1AR61 1ASJ2 1XU1A 3S3WA 2XUEA 3LDBA 1VPHA 4A44A 5SV8A 1HRI3 3CRAA 5SV5A 3M3OA 5EK0A 1ZRDA 1JJOA 4XMAA 3J7NA 2RJ2A 1QJY2 1P49A 2YU2A 1ND2C 1YI9A 1S0CA 3UGGA 1XNKA 4CDQB 1CAUA 2DTWA 4ZKIA 3PURA 1D4M2 2ZIMA 4QKNA 2ILMA 1VF5B 2Z3YA 1OA2A 4MGTA 3WQ1A 4JI2O 1FI2A 1N3QA 2Y64A 3FL7A 5CAZA 2PI4A 3DPRB 1AR62 2DUQA 2VMGA 1ZZCA 1MVEA 4OHVA 3ZFGC 2V73A 3CS5A 4UYBA 4LFBB 3ZO0B 3VHPA 4GX2A 3RYKA 5DG1A 2WWSA 2PY5A 5FWJA 3ZSLA 2JJ1G 4NIIA 2WT1A 2E7AA 3WX5A 1XUQA 3WHUA 5EJ1B 2X7RB 1MQTC 5DDJ3 3P3PA 5FQ0A 2WO2A 4NIDA 4F6RB 3CQOA 4CDXC 2IXJA 3ASIA 1M93A 4W6WA 1UPGA 4LWSA 4A5UB 3MDPA 5AVPA 1YQ2A 3CEWA 1OD5A 1RUI1 3A7QA 3RSJA 1AX0A 2WLPA 3FHAA 3C7HA 3H8XA 1SESA 2JG8C 3UGHA 2QTSA 2ZE7A 2G4IA 1VQMV 4OCTA 1V00A 4WFFA 3CC4V 3NXSA 3IZOA 4IUGA 2UUAO 3WG7C 2WINB 5G05L 1TE1B 2D7FA 5FMCA 3PJYA 1IS6A 3OT7A 4P9WA 2JG9C 4OUEA 1U5XA 4LIVA 2HWF2 3ACGA 5IJ9A 3GZEA 1EUTA 5FYHA 1RUI2 1KC8W 1EP0A 4RYDA 1DGLA 2IVIB 5ABJA 5JOWA 1VQ7V 1R081 1RUE3 2DV9A 1ZBE2 4CP0A 1VBD3 2JDZA 4Q0QA 2VBBA 1GQPA 2ZX3A 2WA4A 5J37A 3KZ4C 4DW1A 3U75A 5IVYA 2XAQA 1J83A 2WWJA 5J48A 2VTFA 4Z1MG 3O0VA 4LBMA 2FHRA 3VBSC 3FAVB 3N9MA 3R0RA 2TBVA 4UT5A 4X1IA 2I2SA 1GO3F 5BY5A 1KUQA 2ZJCA 3JAWB 1ZRFA 3CD6V 4X65O 1CP9A 5DN6G 1VB2A 5GZFA 4PF1A 4YVSC 1XU2A 4BM8A 4AHZA 5L3GA 1R082 2QQIA 3TNPB 5FMDA 4L9BA 2F4PA 2Z69A 1P84F 1V55B 2UWAA 1Z0HA 2VVFA 2WBKA 5CMUA 3FFQA 3PVOA 4I55B 3GF6A 4NKGB 1WGPA 1REEA 1KBHA 5CKMA 1OVSA 2BSKB 4LO4B 5JPMB 1Q81W 4ZS3A 4AAPA 4ICGA 5BMVB 3MV01 5JOYA 4KWKA 4Q0UA 1JZ5A 2YS8A 1K8AW 1HXS3 3BB6A 1TEIA 2K0GA 1R1A2 4JGYA 4NRQA 2QA4V 5LL6Y 2C9KA 4H0LB 3VV1A 4XUNA 2Y6GA 2XJUA 4LF9O 2MW2B 4Q26A 1RYYA 1BK0A 2ZAAA 5T50A 5EHDA 2FBEA 4IEQA 4YSFA 3OSDA 1SQFA 4I30A 2PFWA 2YIBA 2ZE6A 1UWWA 4M3CA 3MPPG 4XURA 2Z79A 5J3UA 1CAWA 2LGQA 2WWUA 4MYEA 5A80A 3T2TA 3QF7A 3JCIA 1J3PA 3IMNA 1W0KG 1TUBA 3NV4A 1O3TA 2Q8CA 2IVJA 5FLXN 4CVUA 5C3QA 4F3JA 3PTRB 3CCQV 2Y8KA 3ZYRA 2YUAA 1L0NH 3EB7A 3IDEA 5J98B 1VQPV 3BVCA 4FSJA 1XSRA 3VQYA 1VQ4V 3E5QA 5DAVA 4XTPA 3AYAA 4KU8A 1O3RA 5K0UA 4PLNA 2UUAB 1CR7A 3MEPA 2ET1A 3A23A 4R9AA 3ZJZA 5A6ZA 2D43A 2Q5TA 1J84A 3I59A 2DJVA 3CJIB 4PV1B 4HONA 3B9IA 2ZGMA 3KVBA 2UU9O 2ET7A 2UXBO 3TWIA 3UJOA 1CPNA 4XYXA 2XAFA 3PUAA 4KWJA 5I8TA 2QTWB 2VECA 3CZUA 4CEWC 4FM2A 3T0BA 2BFUS 1QLEC 1C1LA 2XJPA 4I9WA 4AQYO 4FPHA 4DOUA 1PX3A 3K3OA 1LHOA 2A7WA 3ZOIA 5IK8A 3A21A 5I0DA 2GC2A 1H2SB 3WDYA 1SF9A 3OD4A 3VBFC 3ZFEC 3NAPA 2RDQA 1GP4A 1WWYA 2VXJA 1WCSA 1GZWB 4YZ4A 1RUG2 4QX7A 3NMBA 1OA3A 3M3CA 4DV3B 2EX3A 3MW3A 4KG0A 3AM2A 2QWOB 1SBEA 1YITV 1WN7A 2BJSA 2VUDA 1RHI3 5ISLA 2UYBA 3BFRA 4IL6Z 4FVVA 1O4YA 1S0EA 1FXKB 1W6OA 1OI6A 2Y4TA 4MT8A 2FQPA 5DUUA 3ZFFB 1FXZA 5C4WA 3H7YA 1JH5A 4XCBA 5B3SC 1LAJA 5FPVA 1CIWA 1OKOA 4YY3B 2E26A 2R9IA 1XE0A 3CBNA 3SPJA 3BU0A 1Z7S3 1E1RG 5L7OC 4BQ1A 1B35A 3ACLA 2JGDA 3ZR6A 2HYXA 5FBJA 3ME2A 3CYOA 3CCRV 2AC1A 1YLLA 2I74A 4J9ZB 4C0HA 3LSSA 1WW5A 3ABMC 4LF9B 5FZLA 1AP6A 2BFUL 4GX0A 5FOJB 4RGGA 3ZRXA 1XNQO 1XREA 4HK8A 3DECA 4V2VA 4YGCA 3CMGA 4FFBA 2H0BA 3EQEA 2VMHA 3AMPA 2QQKA 4N43B 1AR81 4S2DA 4M0NA 4NXNO 4ZHNA 1MMMA 3A0RA 1SBDA 3P1IA 4XXPA 1IG0A 3AFGA 4FQ4A 1G9BA 1QJX3 4DK1A 1W90A 4LF7B 1IBKO 2WZEA 3AG2B 2OA2A 3ZXLA 3HKCB 1X82A 3W7WA 1S72V 4PJ0Z 4CDWA 4FTEA 4DV7O 1YTFD 4EN6B 1DQ4A 4UW5A 5F3GA 4X6RB 3RZGA 5BZBA 2FD8A 2DCJA 2WO1A 3TN92 2PZSA 4Y1UA 1YJKA 3KS7A 4KU7A 5AC92 1LR1A 1M5IA 3IC7A 3ETGA 3H1IH 3H8RA 4OMCA 4N21A 5J96B 2PUSA 1W9YA 2EZPA 4DXTA 2Q8VA 1KXGA 2UU9B 3ACIA 1PZ7A 3NV3A 3VBUB 3OM3B 1BZKA 1NY72 3OBTA 1SQQH 1WJZA 2X6AA 2RMU3 4Q4W3 3K4ZA 4CDUB 4XFAA 1S3JA 4MVRA 1WMEA 4AEDC 4AQYB 1OFSA 3OUSA 4RD7A 3JD71 1W3XA 4JI5O 4P9PA 2DMXA 3RYHB 4IEWA 4PA3A 3I3MA 1QBZA 2ERFA 4NROA 4JZGA 4AHYA 1OCRB 2HG5C 4CP2A 3NQHA 2F66C 4YW7A 3ELNA 3UQ8A 4UI9L 1BLZA 1PK6B 1UOJA 1EN5A 4LTAA 1UOFA 4E27A 1TMF1 1K12A 3JZVA 3GBGA 4CXWA 3SH3A 4OMDA 1P7GA 3CCMV 3ZN4A 3WINE 3JASB 1RUC1 3JD72 1NTKH 2CTVA 5CN0A 2V4AA 2W92A 1RM1B 1PO13 2B8MA 4G2KA 1XNRB 3AXEA 4HETA 4K6BA 5F37A 1XI1A 1M9NA 4UW6A 2CUGA 3HR0A 4QGPA 1WW4A 1ND2A 5FUIA 3I3BA 4UCOA 2G19A 2X05A 4P14A 1QNMA 3AG1C 1ZREA 1C1FA 1TMF2 4ZI7A 4DUVA 4IHJA 2JEXA 5J09A 4H14A 1QDCA 2QE7G 3CL1A 3THOA 2XAHA 4DK0A 5B5EZ 2HKOA 2VS0A 3SLIA 2VTXJ 1RUC2 5FZEA 1GNYA 2W47A 3CRRA 2AEYA 1XNQB 2YROA 2OYQA 1K5SA 2DCZA 3I2JA 3KCCA 4MV2A 3ASNC 3BVOA 1E5RA 2AUYA 1GFF2 3OGGA 3ZMTA 4IE7A 3USSA 5CISA 4Q8LA 5H6RA 4YHHO 1PNKA 5LEJA 4NXNB 4BLJA 3I54A 1PO21 1R6KA 3KKYA 3KMHA 2RQ6A 5FL7G 4CCKA 3WHTA 2O8OA 3NJZA 2WLKA 4CDXA 2LW7A 1EZVH 2OT5A 1I7FA 3UKVA 5EZWA 1C5HA 2JIGA 5A1AA 3JUUA 2HVKC 4DV7B 3NJYA 4Y26A 3K4AA 3AJZA 2R32A 5C8CB 2CNAA 4XF4A 3ZXAC 2XBO1 4GKKO 2ATFA 3CEIA 1J58A 1TVKB 3WP3A 2ADPA 3SH5A 5IVFA 3MGUA 3AKTA 1GZTA 3BEHA 1JOJA 5A33B 4DR2B 5ERLA 4H13B 2CGOA 1OOPC 1BVVA 2CU5A 4QPKA 4RWUA 4HAMA 2PAKA 4XIKA 2VMEA 1JUIA 1NCRC 4XBFA 2A75A 3O1TA 3MD0A 4QPJA 1DZRA 2A73B 1RUOA 2QDNA 5I0SA 4UWDA 1WMFA 1LOCA 2HVJC 1WAZA 4JI5B 3SCFA 1ZBA1 5ITZB 5JZGC 4FOQA 3VBRC 2XBO2 1X8MA 4FLTA 1G1XB 3CRQA 1Q6UA 2WAOA 5HI0A 2OUHA 3TEXA 4G28B 4HVQA 1UOGA 2IJHA 2QDRA 1TG7A 5CG8A 2RJZA 2ZXWB 5FY4A 1NTMH 3AKSA 3LWCA 4I0XB 1W3VA 1M1KW 3OBZA 3ZPOA 3MFCA 3FE5A 3L73H 4GZRB 1H1AA 2BOJA 3GYDA 4K8FA 4NWWA 1CZTA 1Q82W 4CXYA 2EIMB 3JD4A 2ZIOA 5BV6A 3LQCA 2Q1FA 5F5IA 2F6BA 4MXVA 3TCUA 5LBBA 1OV9A 1SLAA 1UF2C 1BJQA 2AZ5A 1Q8SA 5A3UA 4AL9A 4TYSA 2WN2A 3VKMA 2R041 4NB5A 5E1AC 4NPLA 1H2GA 4E8DA 5CBHA 3LA2A 4Y5SA 3UO2A 5FJKA 1AYM1 3RPQA 1MNGA 4HZFA 1J1LA 1UN1A 4WZFA 5E8AA 2IXLA 2YY1A 2ZGUA 3GWKC 5JSOA 3I2IA 2W6IG 1NKGA 2QZ2A 3MZHA 3DYMA 4YWAA 2KB1A 4RQPC 3CIHA 5F6KA 3J8F3 4YHHB 1P7BA 2R042 3ENRA 3WNNA 4ET7A 2L6LA 4PA6A 3W7XA 2BBVA 1SERA 2E53A 5FZOB 5FZKA 3ETEA 4MVUA 2OCCB 1A6CA 1GQHA 3QTCA 5FOBB 4KG8A 4NR1A 3OGVA 2Y6FA 3I2KA 2BPA2 2ZAHA 3THCA 1Q86W 4PBOA 4XJZA 2ZNJA 3CSXA 4W65A 5IK4A 4QDRA 1SFPA 1BVP1 1V9U3 2WSVA 1PX4A 1JFFA 4GKKB 3QD6A 1QEXA 4DXZA 4DRRA 3CZJA 5HCHA 3ZM8A 1K5QA 1PL0A 3R65A 3B8NA 4BIUA 4AWDA 4R4XA 3HQRA 3UK9A 5EIYB 4K20A 5K4LA 1NKDA 3K4DA 3LDCA 3M8LA 1PGL1 2W3JA 1AL21 4CEWA 1X8EA 5EIBD 2CAUA 4R9BA 1AJKA 4Y20B 4DR7O 1DFQA 1CZVA 2ZGOA 2D44A 4GMP3 3V56A 4BMBA 1XL4A 1QOOA 2WIIB 5KHIA 1YQCA 3VBFA 4JI1O 2BWAA 3OTFA 5JIUA 3LKJA 3Q8BA 1TAEA 3IIIA 3BIWE 5LY2A 1QH6A 2YHJA 4O4LB 5FYMA 1RUF3 1AR5A 3SHRA 4JTDB 4BW9A 1HB4A 2XLGA 3O1PA 1Y6XA 4W4KA 3VL9A 1PGL2 3LUTB 4M4RA 3B93A 1K73W 1OUSA 4CCLA 1W2AX 4MW8A 1TA8A 1OFNA 2HWB3 4QKFA 4B1MA 5FCCA 2ARBA 3BU7A 1FAYA 2GC1A 2DVDA 4DRXB 3H3ZA 4YG3A 4ATFA 1WA8A 1X33A 4CA9A 3EVKA 3W58A 2JE8A 2GNMA 5FREA 1AXYA 5LBEA 1HNXO 5FLIA 2HWE1 4MO3M 4K35A 1R6TA 4NO4A 1LU1A 1IXBA 4CRQA 1N8RW 2HH9A 4UFIA 1KP2A 1ZUQA 3SMHA 3URFA 2KD7A 4AVAA 3IT8A 4NRMA 2CAZC 5LRRA 4HKLA 1YJWV 5LHGA 1TNRA 4A3ZA 5LA2A 5LYJB 4GYCB 3FJSA 5C9AB 1PM9A 4CCDA 4DEVA 1N3PA 2WR9A 4Q8KA 3JARA 2IJKA 3STLC 2Q30A 5KA6A 3SCGA 1O9GA 4EWEA 3KV4A 2ZGRA 5LY1A 3N2GB 3WF3A 2HWE2 1M57C 1VP6A 4YW6A 5H9SA 2PN5A 1VRH1 1OLRA 1MA1A 2R49A 3KHBA 3RJ2X 3IB3A 2X09A 1DGSA 2CK3G 1Q8VA 4QPGC 3U4SA 1Y76B 5FXVA 5IW0A 2R16A 4RQFA 3RS6A 4BQWA 1ROPA 4HFSA 1UAIA 2XOMA 3M2MA 1VIWB 4XBQA 4X8NA 3KSCA 3CJHA 2EILC 4XF3A 3TEZA 4JDOA 5FZGA 3O1VA 3JSLA 4LLFA 1PZ9A 3SJQC 5F6LB 1KJRA 4DV6O 1WNSA 1VQ8V 1VBB2 3UL2A 1H8VA 4WVMA 1GOHA 3D36C 4TQFA 3DV8A 4R8CA 2P7TC 1VRH2 1Y74A 4DV4O 4LITA 1QVFU 1URFA 3O0WA 1HN1A 1SPPB 2DW4A 1EPZA 4PELA 2XWBB 3BIEA 5A6QA 1VALA 4YM2A 3POSA 3RVYA 2C5DA 3I97A 2YEVB 4ZU5A 4AEDA 5BNOC 2DE0X 4Q4V3 4XFHA 4DR7B 5IY5B 1H8TB 4XUTA 2GNBA 2A0LA 4MTXA 1CJDA 1JU3A 4L8QA 1W39A 1AJPA 2XXZA 1UOBA 3J26N 2ZT9B 5IVVA 1YFYA 4QU1A 1CQ9A 4YGDA 5IWAB 4DR5O 2D2CB 5FZ8A 5BNPC 3WCRA 3UT5A 2EJRA 1H8EG 2QR4A 3ZDSA 4OX9O 4O4JA 2B39A 1V6MA 3AK2A 5DQ0A 5D5PA 4PDWC 4CE8A 4NUBA 2VBPA 3QCWA 2WT0A 3BTZA 2BTOA 3RG0A 4IV1C 3OFNG 1RIRA 5A7NA 2B9VA 5LGUA 2WS92 1EV13 2BNOA 1XDCA 4CS4A 1FXVA 3FLPA 3CCVV 3AZVA 4XJUA 5DUVA 5EC1C 2EZOA 1UJWB 2XQRA 4YYOA 3N3HA 1BMFG 2WDBA 4DUZO 3F5TA 1O7FA 1QNWA 1GWLA 2C9AA 2ORXA 2QWQB 3LOBA 1FOD2 2JB8A 2QQJA 2R1BA 3T4ZA 5JJJB 1AR73 4FAHA 2ZEXA 1A78A 4WM8C 4MVSA 1XE8A 3MLJA 2W46A 3KM5A 2ZGKA 4S2HA 3HQXA 4MTFA 3KCXA 4XXAA 2ZE5A 1IS3A 1W6NA 2Q6AA 2QSAA 3CRMA 4COUA 4LBEC 4XDLA 5C71A 4QHOA 2DYSC 1HJGA 2VZTA 4XQDA 4BQ2A 5A32B 3J81N 4E9KA 3HT2A 4WM7B 1BT8A 2R071 4JGSA 1OQ1A 1VBE3 3WF0A 2WNUA 2EAAA 5CFCB 3PU3A 2PHLA 2R72A 3BI3A 2VC9A 4R9CA 1SQVH 4HK9A 1UIKA 1ZX5A 1UW8A 3OMIB 1T5EA 2WUHA 3LNMB 5F32A 3BTXA 3B02A 1OOPA 3E6CC 5JXJA 5JPNB 3ZMOA 4IV3C 1DGWA 3WU2Z 2JDUA 1NCRA 3N7KA 3GB7C 3MF9A 5JCTA 2GH2A 3MUY1 3K03A 2WLIA 2D5HA 5CZKA 4BMEA 5FK8A 1BCCH 2W0XA 4MXWA 5LBQA 4XAEA 3VBRA 3RZKA 2TNFA 1WKYA 1MEC1 3AG4C 3OYWB 4M01A 4XDKA 1YQ5A 3WXPA 3S0MA 4X66B 3T09A 3HJRA 2JDKA 5ACA3 2XL9A 1UXXX 1XSQA 1VR3A 4MHRA 2BTQA 2B9ZA 2HYKA 3H8UA 4IESA 1IDSA 1EY2A 1L0LH 3K58A 3RZLA 4LIUA 5IYBO 4GA9A 4XF9A 2I45A 2EIJB 4O2AB 4H7MA 2QQMA 5FP9A 1YQ8A 4W8JA 4EN7B 1GR3A 1FMD3 4BDVB 2JDYA 3T4VA 3FX7A 4DY3A 4OX9B 1XYPA 2WA3A 3GBFA 1NLSA 4HOOA 5JIAA 1GWMA 1YI7A 3WSOA 3X2QC 4QNHB 2P22C 2OZJA 2ARHA 5H2FZ 4QIWF 1RMU1 2J1RA 2ORZA 4B4PA 4XHBA 3N2KA 4DRVA 1PIV3 3UYJA 1MG1A 5IUQA 4QJFB 3ZYJB 2JDPA 4U7NA 4C8DA 2HWD3 2GMPA 5J36A 2ZCWA 2VNOA 4CZZA 2HJIA 2N74A 3WQ0A 2ZR2A 1ZZ6A 3F5WC 3KF3A 2D6PA 1V70A 1LGBA 1W0JG 4M00A 5FKBA 5J2TA 2UUBB 3B40A 2ODMA 1JYCA 5L19A 4TLGA 2RCVA 1RMU2 3NRUA 4Y5Z0 4MS2A 3VOUA 1TME1 3VKFC 2ZZJA 3VQWA 1GWKA 5JLVA 3F7VC 1ORQC 3OTOB 3R4UA 3ETDA 4AXOA 2XLAA 3OPZA 1ZL8A 3X29B 1H9PA 1FJGO 3VDCA 1K9MW 5FLJA 2WZPP 5B66Z 1QJEA 4EB6A 4GUNA 4S2GA 5CEHA 4JI4O 2XJQA 3WB1A 4CH4A 1ASJ3 3EBRA 2WQ8A 3ZIWA 1DGRA 1JHJA 2KR2A 4XACA 3EXUA 4O2BA 5B1AC 4PCRA 1UMHA 1TME2 4XJAA 1OF3A 2WO3A 1R6NA 1VBA1 1OCOB 5FY9A 1GK9A 1J1TA 2OTJV 2G9ZA 4PHZA 1F31A 2QJVA 5EIBC 3SITA 1D4M3 2LALA 1KDMA 3EO6A 1GZCA 3T2OA 5IT6A 1IQAA 1H8HG 5FYVA 4JYYA 4H44B 1DZTA 4ASLA 4ZY9A 3ILFA 2YI9A 2FDJA 2F43G 2GUZA 3FX3A 2JE9A 2H94A 4FPYA 4JI6B 3RYFA 1LHWA 3AG3B 1RINA 4XE9A 2Q4PA 4N9IA 1WA4A 3OPTA 3JCZA 2E6VA 3WLUA 5JXIA 4DO2A 1VBA2 1AVBA 4YPJA 1U96A 4UCVA 2A6ZA 2VMFA 4M3CF 3K5LA 4TOIA 4COWA 3FWEA 3POIA 4WVZA 1RITA 1T6GC 4Q5OA 2VUCA 4X89A 3CJXA 1CEZA 3FHQA 2XVKA 1QU7A 4IERA 4AE2A 5FPZA 2ID4A 3AX4A 3T2MA 1UYZA 5FYUA 2NNUA 4BQ3A 5EYPB 4IEXA 1RJ7A 3I49A 3KHCA 5EBMC 4EE2A 3BA9A 2RR12 5A3OA 2KXLA 4KI5M 4FLWA 3ZFGB 1REDA 1U5ZA 3ABUA 1DCSA 2HWF3 3IIAA 3J7HA 4RS5A 5JR2A 5HPOA 2JEMA 3JATA 1RUI3 2ZX4A 3POEA 1EAH1 4WVVA 2P06A 1MQTB 2RS31 2QCSB 4AHXA 1ZBE3 3VBHB 3OE7G 2VM9A 2XJSA 4KWLA 4AI9A 2WYFA 5CKQA 4EJRA 5EBLC 5IJ0A 4NPMA 4C0BA 1QXJA 5FZ7A 4Q0PA 2WL1A 3VBOB 3S57A 4COZA 3W7UA 4JRAA 3DUIA 2ZKOA 5J2UA 4DV2O 1XXNA 2FCUA 5JVDA 2VW0A 1UFIA 1HDKA 1TZOA 4E8CA 2JG8B 3M1HA 3HKDB 4WFGA 1W2OA 1SLCA 3J4UH 4I09A 2EULA 4GH4C 2A5ZA 2PXJA 1VIBA 2Q8DA 4K8ZA 4RFT0 1FPN1 1IBLO 1S0FA 4QPGA 4LH6A 1EAH2 4OXSA 3WG7B 1RGSA 5GKAC 5K9YA 2EIKC 2JG9B 2QQUA 2RHPA 3NVCA 4YZ5A 4IE4A 1BKZA 4HNAA 3FB7C 1N36B 4DPNA 5CB4A 1YC61 1RSOA 4K9SA 3GCXA 4JVAA 4MVOA 1MACA 5FPBA 2VZQA 3IDCB 1LEMA 2WZ8A 2VOKA 4LBQB 3O1OA 4UFHA 2D3PA 4Q27A 4YFWA 3ZIXA 2NLRA 3HNMA 3RYIB 1R1A3 4M3CE 4QD2A 4CCMA 5CKNA 3VBSB 1H2KA 4XBNA 5JCOA 1R091 1FXHA 4GMP0 3U11A 2PYJA 3TYJA 4YVWC 1WLTA 3GWOA 4NMIA 3AVSA 4J9YB 4WVWA 1UX6A 1L7RA 5LATA 3LOIA 1ZM1A 5CFDA 5BNOA 1K3IA 4AFBA 5FNVA 4YVSB 1N4CA 5JUVA 4AEJA 4U2AA 3USUB 2BEOA 5FYSA 4O4IB 3TJTA 3VZNA 2VQAA 4BWOA 1HJFA 3AZZA 3KF5A 4MVTA 1Q6IA 2QQVA 3PHMA 3WNOA 3W21A 5C3RA 5BNPA 1UPIA 1AR91 2WLHA 2ATKC 3CC2V 1R092 5H5NA 5FMOS 1NX9A 4YJ3B 4JAUA 1FYJA 1IOAA 5LMNO 1H30A 3PIJA 2XH6A 4B08A 4QX5A 1LB2A 4AHCA 4L2NA 5HCFA 1ENVA 4RHV1 1BK1A 4A45A 4YJ2B 2J1EA 4ES8A 2VQFO 4PDWA 1P8JA 3KGZA 2QDOA 3UESA 3ST7A 1F7YA 1K5MC 1COV1 2EXHA 1XMQO 5L9BA 4MTGA 3OGSA 4Q4Y1 5J1XA 3ZMSA 2BZDA 2DUPA 2RS11 4MLOA 3WUCA 1IBMB 1O5LA 1C8NA 2BYVE 2YGLA 2JIZG 1KDKA 1UU6A 4BIFA 4OYUA 4BA6A 4QGLA 3LDEA 1CONA 5IATA 3VZJA 1NQTA 4YNIA 3Q4HA 1POQA 4B3TO 1YWKA 4RHV2 3V0AA 1K92A 2UURA 1ZZ8A 4AFMA 3MI8A 2WYSA 1S0JA 3HVDA 2OPWA 5A3NA 2VWJA 1REFA 2BVBA 4KFMA 1COV2 5HXMA 4ZOLB 3W20A 1PVXA 4WM8A 3ITQA 3NNJA 5KHJA 1RUG3 4IIJA 3ZYHA 2VQ0A 4Q4Y2 5JI7A 2GBOA 4AF9A 2ZKLA 2Y4UA 4FZ0A 1IBLB 4CDQC 4KQ7A 4TV9B 3ZN6B 4Y1XA 1HRI1 2YIDA 5FMOL 4FM0A 2QFEA 2FZ2A 5FPLA 3CC7V 1HN0A 1LENA 3V0BA 2DURA 1IGOA 4HPKB 3N7JA 4UXAA 5FP4A 5DZFA 4NAOA 2P2KA 5E88A 3VD5A 5CADA 4FPOB 3I2DA 4XCAA 4UB8Z 4ZHQB 2DQ0A 1W9WA 3ZYPA 2VNRA 1CN1A 4LF8B 2JDMA 3N35A 5CBFA 1ZLZA 3QH7A 2JKXA 4XFCA 4XETA 2ZMNA 3ZFEB 1HRI2 1ZTEA 5G04L 4YGBA 3N27A 2QBXA 1VAMA 2ETNA 1GAXA 2DN9A 5A2QN 3VDAA 3AJYA 4FTBA 3T08A 1ULCA 3PN1A 2HLEA 4YXWG 4PDLA 2J1SA 4O4HB 4RR3A 3K9AA 4LULA 5FYBA 3G6EV 5DDJ1 1BQZA 5JH7B 3OY8A 4TUYB 4QWNA 1KQRA 1LODA 2QQWA 3L70H 4QX8A 3FC0A 1M56B 2PHFA 4XILA 5CA0B 4XZPA 3U14A 1DP0A 3IPVA 1QVGU 2FMYA 1X4TA 2RS53 5L7OB 5LMNB 4YARA 3K3NA 3OPWA 3IAQA 2CTQA 1SETA 3RT3C 1XC6A 2XASA 4OPHA 5LOVA 1X9TA 5A6XA 3GZUC 4LF6O 1C8M1 3TN93 3ABMB 2O14A 1HDJA 4FK5C 2CWMA 3TOJA 5AC93 3OUIA 1N47A 2PAEA 1X50A 3G71V 3P5BA 1F4AA 3B7MA 3SJAC 1SFNA 4XF0A 2FCTA 1W6QA 3AZYA 4X20A 4HT1T 1VBD1 3HN3A 3WG3A 5LGNA 4K1YA 3ABKB 3ZHTA 1JZ3A 5HCBA 1POV1 4AZZA 2XVLA 2ZABA 2ZBJA 2J22A 2CTRA 2D6NA 4H55A 1IPSA 2OQ7A 1JXNA 5KX5A 2A3YA 2BNMA 4B3TB 4ES9A 2ZACA 4PIZA 1RUNA 4AGRA 1EN6A 1C8M2 1M06G 1RXGA 5LA6B 1YVWA 4GKJO 2PHTA 4NWVA 4D7SA 1DQ2A 4LFAO 1CAVA 3VDDA 1SQGA 3MLKA 2R6QA 3C2UA 4LF4O 1ZA7A 1FKAO 1AX1A 2Q8EA 4Z2WA 1VBD2 1AROP 5A1LA 2YBPA 2B7YA 1Y74B 1OCZC 4TV8B 5IK7A 1NVPB 5BR8O 1CESA 1EM1A 1BEV3 1QJU3 1RPOA 3NV1A 1ALYA 1LULA 2P3IA 4BQYA 3U07A 5EBWC 4E2SA 3PVBB 5C8WA 1SRYA 5FP7A 5F1RA 3J9SA 2WQZC 4AI8A 2WZR2 3G4SV 4FLXA 1HXS1 3T2PA 1A8DA 1LOFA 1RUD1 1W8OA 4CYDA 3SPGA 4QQOA 2WQ4A 1ZRIA 1OUXA 1GH6A 2WLLB 2MK3A 1TMF3 1LCLA 1WB7A 3TRSB 3UJQA 1PNLA 2VPVA 3WD5A 1FPOA 3FB5C 3GZTB 4LHSA 4LKEA 1RUC3 1N0NA 3NSTA 5LXTB 5FPXA 3HPNA 3AP5A 3B94A 3H42B 3WT3A 1L3JA 4TSVA 1AP5A 2PMWB 3RW0A 3WQBA 2PAMA 1SLLA 1N1SA 2D93A 2CGNA 1O4ZA 1RUD2 3K3WA 5K0UC 4QX2A 3QG5A 2EXIA 4RQEA 1VMHA 4X8PA 1RUH3 1B06A 4BYYA 2X5IA 2J42A 1VJ2A 4Q6GA 5GJ6A 4UOJA 5KXBA 2V5YA 2A9HA 1X7NA 1ENSA 2FDIA 4WFEA 4QHBA 3SH4A 3KLSA 4DR3B 5HV4A 5DN2A 4CU8A 3ZPYA 3K59A 1S2EA 4DO0A 3SYOA 1DQ6A 1YI2V 3E22A 4EKWA 1RUJ1 4HL0A 1JYNA 2GTSA 4XVHA 2A1XA 2GZWA 2R061 3OB8A 2OVUA 5DABA 3M8AA 5FBZA 4YIOA 2YYOA 1V9PA 2YXLA 3NAPC 4JF3A 3ASNB 3ABTA 1MS5A 3TB0A 5KUMA 2YB7A 1Q6HA 5J7MA 1NU1H 1UKRA 2IJJA 5DAWA 1GMMA 1AYN1 2GN7A 4Y1YA 1BQ0A 4R52A 4ZIBA 3MIGA 4GX1A 3SEPA 1DLCA 2YU1A 4YM0A 3ZMZA 1RUJ2 2XBO3 4F8AA 1NT0A 1Q8OA 2AREA 2ZGQA 2R062 5KMGB 4IEOA 1QOTA 2TEPA 5C4WC 1HX6A 1XQNA 4MG2A 2AEZA 3DKWA 2LGWA 3KWVA 1D5NA 5C3OA 1ZVFA 3Q9OA 4L97A 3RYCB 3ZXDA 2CH7B 2DWEC 4EROA 1SCRA 4GH4A 2QUOA 3DGTA 5HV0A 3HIFA 4XOGA 2EA7A 3QLQA 1AYN2 5K1XA 4NTWA 2A06H 4CEYB 1IPKA 5F3IA 2R30A 2W2IA 4KL1A 5EPAA 2WLNA 2D6OX 3RMXA 1Z7S1 2XAGA 3O9OA 4PQQA 1JZ7A 3HPLC 3WDUA 4JAVA 1KYOF 3PMEA 3KVAA 1VQ5V 4LFBO 4QB1A 2Q7EA 5EFUA 3I56V 4A6OA 2PGGA 5JJNB 1UMIA 5JZGB 3FMGA 3R66A 1Y67A 3LSEA 3HBKA 3L74H 1HV0A 4N43C 1R1ZA 4DB5A 4YZ2A 1ZYBA 2ARAA 2ZGPA 3OCPA 1SLTA 3AK1A 4YVWA 4ZZ5A 4L8JA 1F4HA 3CLPA 3GGLA 4QB6A 1US6A 1PPJH 4E2LA 4J7ZA 3WZ1A 1NA1A 2QQOA 4KBBA 4GULA 2R043 1J5EB 1QJX1 2IFWA 4OLLA 3GJAA 4CP9A 2D3OW 5EZYA 3GNEA 4PA7A 1DZQA 3IFXA 4LOTA 2ZHNA 5A70A 4OHYA 4XQWA 4FCAA 1R3JC 2YBSA 1AF9A 5A7PA 5D5QA 4PJYA 3ML0A 1YJLA 4IGOA 1R1BA 3VDBA 2OT7A 5AG2A 4N7UA 2XHBA 4XUOA 1C4RA 5FDBA 4CDUC 1CAXB 3LGRA 4CBCA 2P6JA 1HQLA 5HCAA 3LEIA 2OIGA 3U37A 1LR5A 2JJ6A 4N53A 5A7WA 1K5MA 4BXFA 1SQ4A 2EALA 4BWAA 1PHMA 1OLMA 3JB8A 4Y4RA 1FT9A 3TBDA 1BHGA 5C7GA 2RMU1 1JA8A 5A3MA 4RQPB 1YCIA 1OCRC 5KXDA 4EQVA 1Z5VA 4FPEA 3E83A 3OEHG 4DNYA 4TN7A 5IVCA 4NVPA 5JQGB 2KG7A 2WNVB 4AVCA 1V54B 4OVEA 3Q8FA 4BW5A 4FMTA 5CA1A 2NN8A 2HBTA 2X8KA 2BVVA 2OCHA 3A4UA 1N1TA 1K33A 4EFBA 2RDRA 2ZHLA 2EICA 4NIAA 5I0TA 4DQAA 4JYAO 3NL1A 3H3LA 3UKMA 5D8AB 5JAXA 3VB9A 3WB0A 1F4MA 1SHWB 5T5PA 3WF1A 4TXWA 4UFZA 4YM1A 3OEBA 1COWG 1RTVA 4CDQA 1G9DA 2AGSA 4MGKE 5FZBA 1BYHA 3C7OA 3W9AA 3KQ4B 1W0OA 1PO11 3DN7A 3OUHA 1NCQB 1WUVA 3K46A 1ND3B 3H7JA 3S3XA 1JYTA 3DPRA 2ARXA 4OI2A 1CJPA 1TUEB 2M6YA 3ZRWB 2YIBD 5B4XA 4IEYA 4F7ZA 3OJBA 2VR4A 3WVJA 1NG0A 2QE3A 2VCMA 4META 3N9NA 5B1BC 2VGDA 5KHGA 2N04A 2WSSG 4GZ9A 3W59A 1OH3A 5L3CA 5GM0A 4GB31 4F6RA 1KRIA 1JX9A 3VQVA 4AILC 4WBNB 1JN2P 1HB3A 5FZ9A 3M4FA 4AVVA 1LU2A 3K5NA 3WG4A 3VHOA 3JQXA 3DXTA 1O4TA 2H6CA 5C8CC 3QO8A 2A7AA 2UUCO 3E97A