4D7SA

Structure of the sthk carboxy-terminal region in complex with cgmp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STHK_CNBD_CGMP
publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
total genus 58
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7sA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7sA02
2QVSB 1SFNA 2GZWA 3RZZA 5FPXA 5CADA 2VQAA 4I2OA 4RD7A 1LR5A 4ONUA 3B02A 1CX4A 2XLGA 3H1YA 2D5HA 4IETA 3ETQA 3EQEA 3FX3A 4XFCA 1ZVFA 4A2UA 2H0VA 5BV6A 4L2NA 1PMIA 1GQGA 2K0GA 4IEQA 3E6CC 5E1RA 3KMHA 2UY9A 2UY8A 4P9GA 5EFUA 4HMZA 4IEXA 5FLIA 1YUDA 3MZHA 4Q0QA 3EO6A 1QXRA 4AVBA 5LEKA 5T3NA 2QCSB 2OZJA 1EP0A 2Z69A 4ORFA 5BUVA 3RDIA 4GULA 4QXKA 3PNAA 2Q1ZB 4Q0VA 1ZRFA 3PLQA 4E2GA 4IEOA 2GC3A 4F8AA 3NW4A 3KGZA 5J7MA 4HSLA 4MV2A 3NJZA 1UCXA 5I0RA 3NL1A 4MUVA 4N9IA 1IPJA 4MGKE 4ZU4A 4QX5A 3BB6A 4JV4A 3CO2A 3WW2A 3E97A 3QOPA 1CAVB 4QM8A 4I02A 1Q5OA 1J3RA 2XLFA 2MPFA 4XEZA 4XETA 1ZRDA 4PIYA 5J48A 2N7GA 1I6XA 1XE7A 1ZX5A 3ES4A 4EWAA 2C0ZA 5I0SA 1O3QA 2PAKA 2O8QA 3H7YA 4XF4A 5LRSA 2IC1A 3NVCA 5KHKA 4XF0A 2CGPA 3GYDA 2XL9A 5D1IA 2Z2SB 3LWCA 1YHFA 4NVPA 3L2HA 4KWLA 4CYDA 2PHLA 4IEYA 3M3IA 5K8SA 4MH0E 2ETEA 4K8FA 3SCHA 4KL1A 1OI6A 4Q0UA 3DV8A 2Y0OA 3CJXA 1YFXA 2GC2A 3OTFA 4HLTA 2OYZA 1J3QA 5JR7B 4Q0SA 5FLHA 3CF6E 5FLJA 3ACLA 4QGMA 1LB2A 1O3TA 1ZNPA 4O9GA 1RTVA 4WZCA 4XFAA 4BIFA 3DKWA 1HW5A 4EWDA 3FWEA 1H1IA 3D0JA 3CL1A 2QJVA 1CAUA 3RNSA 3CLPA 2WFPA 1J1LA 1XE8A 2IXJA 2ZCWA 2Q30A 4XFBA 4YRDA 4KU8A 4X6RB 3TNPB 4J1WA 1SEFA 2H6CA 3OF1A 4WVZA 2O1QA 3EHKA 4EROA 1VR3A 5FPZA 3FZ3A 3LZZA 1O3RA 3H3UA 5I0TA 5FQ0A 3BCWA 3UKTA 1O5UA 2D5FA 4MGIE 4HZFA 4QGLA 1JUHA 4TLFA 4FAGA 2BEOA 1YLLA 1OMIA 2BNOA 5AVPA 2DCTA 2E9QA 3TNQA 1UD1A 2D93A 1NXMA 1UIKA 4LUKA 2BNMA 5I8TA 4XFFA 1RUNA 3OGJA 1EYBA 1FXZA 2MNGA 1UPIA 3KCCA 4KWJA 1YWKA 3EJKA 4PIXA 4E2SA 3H50A 4QGNA 3H7JA 3BALA 3D82A 3E5XA 3H9AA 4ZU7A 1RC6A 4JTOA 2OZ6A 4HN0A 4WBBA 4LA2A 1H1MA 3EBRA 2IXKA 5I8YA 2PAMA 1XRUA 4KWKA 2WC2A 3I59A 4LUMA 3ST7A 5I91A 1ZZCA 1NZCA 1O7FA 3E6DA 4IEVA 2CV6A 3SMHA 2B8MA 4B29A 3CEWA 4J1XA 1YFUA 1EPZA 2EAAA 3MPBA 3U0ZA 3RYKA 3LA3A 1EY2A 2FMYA 1ZZ7A 1J58A 2XL7A 4BH9A 4EWEA 5LRRA 4L11A 4LULA 3WW4A 1YFYA 2PA7A 4Q29A 4YARA 4YNIA 4R52A 2I45A 4X6QB 2D40A 3FFQA 2PTMA 1SQ4A 2ET7A 2UYBA 3IWZA 4Z07A 4IEZA 2KXLA 1X7NA 1CAUB 3SXWA 3GBFA 3PVBB 4DINB 2H6BA 5KHIA 3VHRA 2V09A 3BPZA 4UXAA 1X8MA 4HSJA 4IEPA 4HN1A 3FHIB 1YFWA 4BYYA 1CAWA 5C8WA 1CAXA 3ROUA 1RUOA 2B9UA 5FQ0B 4HVRA 4IERA 4Q0PA 4IEUA 4IEWA 2K9ZA 3U11A 2OA2A 3E5QA 4UBHA 3C3VA 1ZZ6A 4YSFA 3IDBB 5BPXA 3S7EA 3N4MA 1IPKA 3H1WA 4R8HA 4OLLA 5KHJA 1J59A 3BU7A 4ZU5A 1ZREA 5JSRA 2QDRA 4JTNA 3DN7A 3O14A 2F4PA 2UYAA 3DL3A 4META 2ATFA 2IXHA 5BXXA 4EV0A 3KGLA 5I8SA 1X8EA 1QWRA 1ZZ9A 4D7SA 4MGZE 4XF3A 3SCFA 3I54A 2GH2A 2EA7A 2B5HA 3ELNA 3G7DA 3HT2A 1O4TA 2ZKLA 1Y3TA 4XFHA 1RL3A 1ZZBA 5F1RA 4F7ZA 3HIFA 3HQXA 1TQ5A 5KHHA 2PYTA 2PQQA 1I5ZA 2P17A 4O9EA 3S7IA 1PM7A 1Q3EA 2OPKA 3I59B 4Z82A 4MZUA 3LA7A 4MGYE 2VECA 1NYWA 1NE4A 3IDCB 2ET1A 2BNNA 3SCGA 3ES1A 3QACA 5EZWA 3IBMA 3UKVA 4AQ2A 4QMAA 1UW8A 2GC0A 4IESA 1DZTA 4QM9A 2HKXA 5I93A 5JAXA 4I0BA 3OD0A 4FAHA 4AVCA 1ZRRA 4AQ6A 3JZVA 2EVXA 1UIJA 5CVRA 4HVQA 2IXCA 4BHPA 5JCTA 4N9HA 3E6BA 3UKNA 5E16A 2GAUA 1G6NA 4XF1A 5J3UA 4I3PA 1L3JA 2XKPA 1DZRA 3MDPA 1O3SA 4KU7A 2HJIA 1CAWB 1DGWA 2XLAA 3R6SA 1WA4A 1CAXB 5KBFA 3RYPA 5HI0A 1ZRCA 3USSA 3H1MA 3LOIA 3NKTA 4MX3A 5LEJA 5I0UA 2FQPA 3M70A 3KSCA 3H3ZA 2GC1A 4UBGA 3LA2A 4OFGA 4HBNA 4YYOA 1VP6A 1WGPA 4JVAA 4E2QA 4I01A 1X82A 1V70A 1GQHA 1U12A 2VPVA 1WLTA 1Q43A 2XHKA 2BYVE 3SHRA 2Q0AA 1Y9QA 3E5UA 3RPQA 2GU9A 2MHFA 3NSTA 5JSPA 4FBFA 3MYXA 4AXOA 3HT1A 4XFIA 5JSOA 1FI2A 4HVOA 1RGSA 5C6CA 2CAVA 5FDBA 3OCPA 1QY4A 2PHDA 1QXJA 3I7DA 4H7LA 1LKNA 4LA3A 4LEJA 3S0MA 4PJYA 1FT9A 2IXIA 4I09A 1CGPA 1O5LA 1OFNA 1NE6A 4XFGA 2IXLA 4LTAA 3H8UA 2XGXA 4AVAA 1CAVA 4XF9A 3U10A 2XKOA 1OD5A 5CU1A 3WW3A 2PFWA 3FE5A 3LAGA 4LLOA 2Q4SA 4PIZA 3WW1A 1DGRA 5KHGA 3D0SA 2PAEA 4D7TA 5BY5A 3RYRA 1ZZ8A 2BGCA 1J3PA 3FJSA 1LRHA 3IIAA 4FT8A 3ZDSA 2QNKA 5FCCA 4I0AA 1VJ2A 2CAUA
chains in the Genus database with same CATH superfamily
5J37A 1K5MC 2EINC 3K79A 1ACCA 1V54B 4XAAA 4AEMA 1H30A 1AR4A 3POSA 2FDFA 5F7UA 4JI7B 1SQQH 1GV9A 1WD3A 1OHFA 3AYCA 3ZMVA 1V00A 4WM7C 3ZX6A 1GNHA 2PLV3 1DFQA 3AEIA 4JYBA 2ZM6B 1NTMH 2UY8A 1IS6A 3SEPA 3RYFB 4AVBA 2NM1A 5LEKA 2QCSB 4UW5A 1RUH1 4QQOA 2WLNA 1W6OA 2KQXA 4AAPA 5IYZB 1KECA 5CFCA 4CXWA 3ASIA 4QNHB 1B09A 1JS9A 5JIAA 3G80A 4JF3A 5DEDA 2IWGB 4AG4A 4K0KO 1R3JC 1QDOA 2E7QA 4PCRA 2RDRA 1SLLA 2ZEYA 5T54A 4AQTA 4K20A 5FK8A 2BJSA 3T1YO 3HB3B 3VB9A 1W99A 2EIBA 1V6KA 2W39A 2P6CA 5FO8B 3OR7C 4DV5O 3VD9A 2XWJB 3I2JA 2WSVA 3MPPG 3IMNA 1Q86W 3NR7A 3B00A 2XAJA 5EPAA 4GD4A 1MS4A 2BQPA 3B8NA 4NHMA 3K04A 5LY2A 1KXGA 4QGPA 1XNCA 1LGBA 2X6CA 2GNMA 2WNOA 1AX1A 2VY0A 5GLZA 3KT4A 4JQTA 1Q8QA 1EV13 3TWIA 2AHYA 2EIJC 4AI0A 3HEIA 4GUNA 4XCBA 5IT6A 5B1AB 3WZ1A 4FTSA 1ST8A 2JDYA 3JD2A 4QPGB 3U14A 1CAUA 2Q8CA 3I2FA 1V6IA 1W3VA 5A3NA 1VPHA 1NQTA 3K2OA 3MIHA 3RRDA 1XMOO 4NN0A 2RR12 1GICA 2M6YA 3W5NA 2LP7A 4FAGA 4RHV3 1TME1 1XUQA 5LBCA 5J2UB 3MV11 4DY3A 2PHFA 3QNEA 4RYDA 1LEMA 3WOGA 3HKCB 3AP6A 4CDWA 2BNMA 2ZD9A 5FYBA 3ZHTA 3WNXA 1JZ4A 5C9AC 1FXZA 2MNGA 1JODA 1WNSA 5F5CA 1D0HA 2WS93 3H8RA 4P30A 2QQMA 4PA4A 1UOFA 2WNUC 1A32A 4N90A 2NMOA 5F3EA 2WZPP 3H1KH 1BYHA 1PGL1 3PHMA 4WM8A 3WP6A 5I91A 4QPJA 3VOUA 4WZFA 2IUWA 5FBJA 3UGGA 1XBFA 4IEVA 3B94A 4PLMA 2R49A 3X29B 4A41A 1VAKA 4B3TB 1EY2A 4DYLA 4LULA 1RSOA 1QR9A 2BGPA 1JZ2A 2A6WA 5ABJB 5DZFA 2DWEC 1SETA 3K46A 4JGZA 4NTWA 3VHOA 3LDBA 3AXEA 1Z5WA 3RVZA 1D2DA 1KP2A 4RUFA 2HH9A 5KX5B 3JD3A 3MD0A 1UKRA 3K4AA 4A3XA 1OA2A 1OCZB 4XYXA 2GTSA 2RJLA 3BAAA 1RUC1 2P6HA 3QCWA 3BKZA 2WR9A 4S2GA 1ASJ2 4YVSA 1W6PA 2ARAA 4YGEA 3W21A 2IXHA 3AG2C 3FMGA 4PQ9A 5E79Z 5HXMA 3KCXA 5LHIA 1X8EA 4LHNA 3CSXA 3HQUA 1AJKA 5FL7G 5GM0A 5FPUA 1N33B 2ZKLA 5AFBA 5KX5A 1KJRA 5H9PA 3AP4A 3Q4HB 4AHCA 5IVJA 3WR0A 3JAMN 5FP9A 4I9QA 4BMEA 1NKDA 1H6XA 2YC4A 2ET1A 4JI4O 4WFHA 2VUCA 2CH7A 3DECA 1QCEA 3OEBA 2OYQA 3ZOIA 3DEMA 4QM9A 1QJU3 1X59A 1HRI2 4LIVA 3LEMA 3ZX7A 1BJQA 1BZKA 1BSMA 3UKNA 4CP0A 3AKPA 4LFAB 2VZSA 1CP9A 4QPKA 5FPBA 5D5PA 2QQLA 2J1SA 3Q8EA 4YZ4A 1Z78A 5A1LA 3VBUA 2DVAA 4AVVA 1XNQB 1IG3A 4JTDB 3T09A 4HBNA 3ZRWA 2PMWB 5JPNB 1SLTA 1C1LA 3UYJA 1NCQB 1NT0A 3LDKA 2H0BA 4FBFA 1REDA 2XJQA 2G9ZA 2YGMA 3POIA 5JJEB 3ZFEB 4WF9V 4XW3A 3NQHA 1QY4A 1H0BA 5IVYA 1NI8A 3JAKB 1WMDA 1XQ8A 1DK1A 1Q56A 5F5IA 3NJYA 1K4CC 3BOWA 4LKSA 3OGRA 1XE0A 3WHUA 1WW6A 2WT1A 3FAVB 2CL2A 5A3LA 2PFWA 3U1XA 1AVMA 1LTEA 3AK3A 1F31A 3POFA 4QXHA 1UOGA 1J3PA 4CDUA 3VD4A 1NTKH 4IE6A 1WW4A 3VUOA 3RZZA 3WCSA 4GB32 1ZL8B 4IE0A 5K0UB 4LF8O 3W9AA 4UF0B 3JD0A 2BPA2 5B5EZ 3FX3A 1LAJA 3KMHA 1ND3B 2UY9A 4UFIA 5EFUA 1PNFA 1JOJA 2DYRB 4FFHA 4IHJA 3VZKA 4Y22B 3FFZA 2C6SA 4H37A 4GQ7A 5T55A 5F2WA 2KB1A 5FZ4A 3WG7B 5BNPB 5FXXA 1T5EA 1W2NA 3VBHA 2QWOB 1U5XA 3F5TA 1QNMA 1OLQA 2HWB1 2R073 1SQPH 4D69A 2LUWA 2XAHA 1CAVB 4E4DX 1R64A 2XG3A 4Q6GA 2R0HA 2PYLA 3S6PA 4JPRA 1HXS3 1W9YA 5CG8A 2CUGA 1RHI1 2ZXWB 3DXUA 1JHNA 1DLBA 2D98A 2AGAA 5EIBD 3LWCA 2EILB 1RINA 2XBO1 1IBKO 1FS0G 4WFAV 2VL4A 1Y76A 4HPKB 3OUHA 4YHHB 4MHRA 1YFXA 4FXKB 3OBRA 4DXSA 4LBQD 1G9BA 5FLJA 1M93A 1SQBH 2R041 3AFGA 2E51A 1M56B 1KDKA 1N1YA 3WXPA 3TCUA 4CU8A 3CL1A 1WCSA 4LNUA 3W7WA 1XE8A 4YRDA 2QJ1A 3TNPB 3H0OA 4NOTA 1UJWB 1FJGO 4X66B 1VBE1 3UT0A 1JYTA 2JJ2G 1VQNV 5C93A 5GTHZ 2ZE6A 2D93A 3L75H 4JI7O 1E1RG 2VCAA 4XURA 4CC5A 1SA0A 2MEV1 1F4HA 1XYOA 2VNRA 4YVWA 3NV3A 5A7SA 4RS5B 3E5XA 2ZM6O 3QG5A 5DZEA 5GTIZ 2R9RB 1IOAA 4ZY9A 2ZA9A 1OV9A 1QU0A 3O1TA 3USUA 1WD4A 3CIHA 3AG1B 4CRQA 4Q8LA 1YI2V 1RUE3 1N36B 4RQPC 1KFUL 4U2AA 5LB6A 1VRH3 1J58A 4RL7A 2ZR3A 3O1RA 1CIYA 3SXWA 4I4TB 2LALA 2JKBA 4QHOA 2ZBJA 3ZFGB 1OCCC 4DUWA 1POV3 4YG0A 2OVUA 4HVRA 3UV9A 2WZR1 3RN4A 5FNVA 4AZZA 2JG8B 3EXAA 4PF1A 4NRMA 3X2QC 2QQIA 3F95A 5KXCA 2UWAA 3ZSJA 5FWJA 1J59A 4HANA 2VQ0A 4LBLA 5LYJA 4YW7A 3RFRA 2MEV3 1QJZA 3ZVXA 1U5YA 3W59A 2B39A 1JMUB 2UYAA 1GUIA 3CC2V 4XF3A 3LGRA 4XTMA 3R4DB 2WUHA 2E32A 1BCXA 3AJYA 1HNWB 1QJEA 2P5BA 1E1QG 3TEYA 3J9SA 4K1ZA 1VBB2 2ZEXA 4XDJA 2Y6JA 4MZUA 4GH4B 4HL0A 1TUBB 4Q5OA 2K1EA 3ES1A 3QACA 4TUYA 4MVZA 4M4RA 1SBFA 1OH4A 1RUD3 4B4RA 4FPGA 4XBNA 4LK7A 1WKYA 4KNCA 4CCKA 4AVCA 4AQ6A 2EVXA 3RYCA 3TN92 3E2EA 3H1LH 2F43G 5H9CA 1JX9A 4P9LA 4EN0A 5FO9B 4XXPA 1C5HA 3POYA 2IVJA 5LMUO 3D36C 3HKEA 1F8VA 1DYPA 1DGWA 5DAQA 1WA4A 2VW1A 3PVOA 4RGAA 5DUVA 4B3RB 4JAAA 4PF5A 1PZ8A 3KSCA 2BDRA 4AEDC 4BQWA 4DR7O 5JPMB 2XHKA 2JXAA 2BYVE 3ALQA 3LOBA 5A32B 4AGVA 2BVVA 3OY8A 4K6BA 1IKQA 1VBD2 5BMVB 1NH2B 1TVKB 3IGAC 2JGDB 2IVIB 1H1AA 5C4WA 2XJRA 4JV5B 4LA3A 3CMGA 1HV0A 4LE3A 4QU1A 5A80A 2LM3A 1AI7A 2YI9A 2YU1A 2WN2A 4H13B 4CCJA 2XQRA 4LBQA 5DXDA 2JE8A 2WABA 4G9SB 1OPOA 4MW8A 5IVCA 4KP4A 2L35A 3JB8A 3IDEA 4EN8B 2YUEA 2BV4A 4ISRA 3JCZA 3AM2A 5CIRA 1ENSA 3ZDSA 1K5JA 4B4QA 2PHWA 3BY6A 2X6AA 1SBEA 5DMYA 5CA6A 4PBOA 5LY1A 3B9IA 3ITQA 1IBLO 1K9MW 3DPRC 1H8TC 4XUOA 4EQVA 1N33O 1M57C 2R72A 4I2OA 1LULA 1FPN3 4M3CF 3L2YA 2NQYA 1QBZA 1QQP2 1COV1 4A2UA 2H0VA 3HKDA 4LC1A 3CJIA 5E1RA 1HJFA 4NIDA 4Y1XA 4K21A 1VBA2 1AX0A 4HMZA 2QTWB 4Q0QA 2C24A 1KS4A 1YJ9V 5EBMC 3WUDA 4GKJB 5T3NA 2OZJA 4AW7A 4XIOA 2ZGSA 2VQEB 2A06H 5KMGB 1K92A 4RFRB 4BQ4A 4HSLA 4MV2A 4LFAO 2RS11 4PA7A 4ZI7A 4LF7B 4MGKE 3ORJA 3SYQA 1W0OA 1J3RA 4B3SO 5KWRA 1XNTA 5AFEA 5G05L 4JRLA 2WNEA 3SPGA 4TQDA 1XNQO 1ZX5A 3CRRA 3CXCU 4XDLA 1UZ0A 5L3DA 2O8QA 4P9IA 1HNZB 1W6QA 2WQ4A 3IZOA 4XF0A 3R66A 5DDJ1 5D1IA 1ODMA 2IJIA 1YHFA 2ZZJA 2W47A 2LGQA 2NLJC 2C9AA 1IHMA 1FXVA 3SCHA 1U96A 4XILA 4JYAB 2F23A 1C28A 3M7MX 2XJPA 3N7KA 3K3NA 4CEYB 3PTYA 4HLTA 1OHHG 3FHAA 1ULOA 1J3QA 1S0GA 4QT6A 2E53A 1LB2A 5CN0A 1OPMA 1PO21 3DGTA 1X33A 4JI5B 2VZRA 1LOCA 3AG7A 3WQ1A 5H9SA 1JOYA 3SITA 1YHQV 1PVC1 4BW5A 3C7FA 4NWVA 2W52A 4FFGA 1SEFA 3ABLB 1A6CA 1AYN2 4XABA 3QH7A 2A3WA 4Q4V2 1XU2A 1REEA 2ARXA 3UGFA 3CC7V 4XQWA 3OPWA 1XOYA 4O65A 4JAVA 1AL21 1FX5A 3TNQA 4MXVA 1NXMA 3LKJA 1B04A 5ACA2 1KUQA 1EYBA 4E4ZA 4GALA 3EJKA 1NUKA 4PDWB 1SESA 3BALA 2Y34A 3E83A 2YBPA 4LA2A 3SC7X 4GZRB 3OFNG 2HYKA 2HWE2 3SJCC 1MS3A 2Z5WA 2EX3A 1MS1A 4GJZA 3SMHA 2WO1A 3AMMA 3H8OA 2ZE7A 1KRIA 3E8GA 4JHTA 5DN6G 3KV5A 5T52A 2XL7A 3K3WA 1T2XA 4YNIA 1KGYA 3VBFA 1YJNV 3UO2A 4Y5TA 3K9SA 3VZJA 5FZKA 4CDQA 3ILNA 4UVAA 1O8SA 1HDKA 4UXAA 1X8MA 1JYNA 4U3JA 3JASB 4NXNB 5A33B 5FQ0B 4JCKA 4Q0PA 3HQRA 4KGQA 1HRV1 2AYHA 2E74B 3ZYPA 1R3KC 4YHHO 4C1XA 5FXZA 4TV8A 5L7OB 2DW4A 2OIGA 4EEQA 4Y5Z0 1CPYA 4AFDA 4NMIA 4X88A 4OMDA 2YY1A 5FY8A 4SLIA 4RR3C 4GT1A 4P9YA 1BE3H 2EIKB 4PJ0Z 1FV2A 5KUKA 2Q7HA 5KUMA 2E3CA 1VBC2 4F7ZA 4YLZA 5F1RA 4G27B 2EXJA 3AK1A 3C7EA 5EYXA 2ZZQA 1V0AA 1ONAA 4ZIBA 1ZBA1 4ZS2A 5A6ZA 1VQ7V 2ZHNA 1RVF2 1ALYA 1PIV1 1VQ9V 1S2BA 5JR2A 3QO7A 4WVMA 1NCRB 3CNAA 5A7QA 1GN6A 1LGCA 3IKWA 3S3WA 3RYIA 4I30A 1UF2C 1IURA 4XF1A 2E26A 1DTOA 4JDOA 1CAWB 1MZFA 2AXTZ 2WLLB 3EXUA 3T1HB 5F32A 5FZAA 5KBFA 3MEPA 3M99B 2XASA 3O12A 3MO4A 3DC5A 3M70A 2HWD3 4OFGA 5FY4A 4BJ0A 3MBWA 5LBFA 1FOD1 5A1AA 1NVPD 1IX9A 2JIGA 3OEEG 1VIWB 2A7AA 1V9U3 1RUI1 2IH3C 3LSQA 4WFEA 1YJWV 4WCEV 5DG2A 4A6OA 4QDSA 3CJHB 3VBSC 4DRVA 3BHPA 4AWDA 5K7PA 1WBLA 3MIEA 3JCIA 3KV4A 1GANA 1PGW1 4NIGA 4DXWA 1H2KA 2XGXA 2SBAA 3CMEV 2YS8A 2EXKA 2X5IB 5IATA 1PK6C 3AK2A 3BVOA 1R1A3 3K08A 4UOJA 4CP2A 4FT8A 4CA9A 2DUOA 1HR0B 3ABTA 1UY3A 1O6UA 2GMPA 5FPXA 1JI6A 2WNVA 2VQAA 3P30A 1F4NA 1HNWO 4XJUA 2V5YA 2ZR2A 2ZGUA 1S0IA 4FLXA 4XMAA 1KJLA 1A8MA 3V56A 4QX8A 2Q6AA 4QD2A 2VG9A 4JZ2A 5BNQA 3UCSC 1JUIA 3WV6A 4BM8A 1DQ4A 5CAZA 2YDEA 2WT2A 1ND2A 3CQOA 2CHHA 5BUVA 2DJVA 2FBEA 3KQ4B 4Q26A 4Q0VA 1V54C 4FM1A 1XNRB 3KGZA 5EV7A 2ZAAA 2ZX4A 2GP5A 2PLV2 1H8HG 1OCRB 4A6SA 1EPWA 2BOBC 3BB6A 3I2DA 4X1KA 2DYSB 3OR6C 2BERA 4H2AA 1NA1A 1H2NA 2UUAB 3C90A 2QQPA 4ZKTB 4MO3M 4DR4O 3VBRB 1AI5A 1RFYA 4UCRA 1JOPA 5JMOA 3ABZA 4JGYA 4KWLA 1O9GA 3E22A 3THPA 3ZXAC 3N3HA 2LTNA 4Q0UA 5FZDA 1X9TA 1PNLA 3G6JB 5JZGB 1GKFA 1YQ2A 2Y48A 1UMIA 4MVUA 2WAAA 1XOUA 2LFRA 4JV5O 1BKZA 4QX0A 2Q9LA 1O3TA 1ZNPA 4PA9A 4WZCA 1AR71 3FWEA 3ZYFA 2QSAA 2EXIA 1XMQB 4ASUG 2Y0PA 2UXCO 2X09A 1RIRA 1VB2A 5IWFA 2O1QA 2W87A 3P5BA 1N3OA 4JTCB 1MZ6A 3HNBM 5I0TA 5H2FZ 1Q81W 4XCAA 3ZJZA 3B4SA 1AR61 2VRZA 5B1BB 4DR6B 1EV12 3ZYJB 2O0OA 3I3QA 2JG9A 1UD1A 5JQGB 2YSUB 3H3LA 2VZUA 5L9RA 1W0PA 4XFFA 4CUBA 2W1UA 5B1AC 3UM7A 2GNDA 4MYEA 3APQA 4AI2A 3PUHA 1URFA 1OKOA 2EICA 3H50A 1HQWA 3H7JA 1F4MA 1I94B 3ZSMA 4IL6Z 2P90A 1AYM3 4JTOA 2R6QA 1XRUA 1ZAUA 4RHV2 3OTOB 2PI4A 1C1FA 4GMP0 1BEV1 3JATB 3KT1A 1IVSA 2CAZC 1S0BA 3IAYA 3ZXFA 2VQEO 2CV6A 1YFUA 3CRQA 2FDIA 3J81N 1QJY1 2PN5A 1R73A 2WS92 2O8OA 1LOFA 4O4HB 2X6BA 2PA7A 4I55A 1QDCA 2I45A 1BHGA 3UL2A 2Q0OC 3IWZA 4DR3B 5LASA 4AQYO 1J5EB 4HXCA 1CESA 3LNMB 2B7YA 4O61A 1UAIA 4E8DA 1KU9A 1HNZO 4CU7A 4UBHA 3U11A 1HIXA 1SPPB 1AZDA 4B7KA 2I2SA 4BDVB 1JYWA 2WLMA 2J1VA 1N4CA 3O14A 3AXDA 5HCBA 4JI6O 4EV0A 5M0TA 2I74A 2WO3A 1MG1A 5ABJC 2A0LA 4W50A 4KHPB 3RWNA 2DBNA 3LIHA 3PURA 2AH2A 4JI5O 5GALA 1Y3TA 2RQ6A 5DN2A 1K5MA 2UWCA 2YFUA 1BEV3 4Y20B 5F37A 5JH7A 2P4KA 2WLIA 1OCZC 5LBEA 3PUAA 4WM7A 2BFUS 2WAOA 5FPLA 2CGNA 4OZXA 3ZXGA 1AR81 3SH4A 2D3OW 2LRPA 1AP6A 2WZ8A 2D3PA 5LA6B 1PGL2 1WUVA 4HVQA 3LPFA 1GP6A 2IXCA 3A0NA 4DO2A 1UOBA 2IZWA 2J1AA 1G6NA 2YU2A 3TXQA 5LK5A 2AGSA 2RMU1 1I1EA 3AZZA 4IGOA 1YCIA 4KI5M 3ZSLA 1SC5B 1BMFG 3N2GB 2D6KA 1QJU2 1GM9A 4FMTA 4DR2O 3WF2A 1HQNA 4Y4RA 2VOKA 2FYUH 5ERLA 3RYHA 1Y9QA 2HJDA 1IXMA 2P5OA 3THTA 1BCCH 4Z2AA 4MVOA 5FPRA 1RGSA 4X20B 4PBPA 4BZ4A 4A45A 5FJHA 1W6NA 3P32A 5CG9A 1YRZA 2ODMA 1PL0A 4HYOA 3G6BA 1LEDA 4QWNA 2R7EB 2RVAA 2XMLA 3BU0A 4UFKA 1SKVA 5BYNA 1LHVA 2HWF3 1WMXA 1WA6X 2YG0A 4EN7B 3OGGA 4K3UA 1NCQC 1FKAO 1FV3A 2EAKA 4IE4A 3WNOA 5C33A 1R083 4XDQA 2EJRA 2W3JA 3I2OA 2OKXA 3ZFEC 3ZYGA 2Z5UA 4L8QA 2QE7G 2KG7A 5FZ1A 2H8PC 4JI8B 2UXDB 3GGLA 1W90A 4K7JA 1AP5A 1E79G 4Q27A 2P3YA 1URXA 2VVFA 5C9AA 5ANQA 1V6MA 4ES9A 5FLIA 1LHWA 3BTXA 3LF7A 2WNUA 2BTQB 2NR5A 2F95B 3N7JA 1GKBA 1SMVA 3NXSA 5LBQA 4LJHA 4TV9A 2YBKA 3FBMA 1CWPA 4JI2B 4UFMA 2ZCEA 1BBT3 3VZLA 2BFUL 1G7YA 2Z79A 5K0UC 2G38A 4FLTA 3JSLA 1JBCA 1OXCA 1JZ7A 1PO11 5D21A 3CO2A 1OD3A 3SEEA 3MFCA 3N9PA 3S3XA 2P22C 4X1IA 1ND3C 5FUNA 1LNQA 3NJXA 3LE0A 5CMUA 2DYRC 5LXTA 1VQMV 2ARCA 4NHYA 5C5UA 1VAVA 3RZMA 2YBSA 2W0XA 2PHLA 3WG7C 4GX2A 4J6GA 5BNPC 1H4HA 2R072 5FYSA 3VDDB 3AMNA 2GBOA 4LR3A 4JKMA 2UWBA 2Q73A 4Q0SA 3JD71 3AMQA 1NR1A 3CF6E 1HXS2 3QH6A 3O5SA 4AK3A 1UY1A 2W0FC 4X65B 1WZXA 2P4VA 4BIFA 2Q7EA 1FNYA 2ZXWC 1H1IA 1DQ0A 3JAWB 5FZLA 1OF3A 3CRAA 5JIUA 3URFA 2EILC 4NIAA 5L3CA 1FMD3 3KT7A 2JE9A 4CVUA 1OOPB 5FZ3A 1EFRG 2ITDC 2MK3A 4YIOA 4HT1T 2D5FA 1QJX1 1HR0O 1W06A 3F5WC 4FFBB 2BNOA 1S1AA 2CTQA 2E9QA 3L74H 1CZVA 5B1OA 4FPEA 4BQ1A 3AZXA 2EULA 5FYZA 2WFF1 3RVHA 3D6EA 5T5LA 5EC2C 1M56C 5EHDA 2C5DA 4XBFA 3WG3A 1TUEB 4K8XA 2OQ6A 3ZSKA 4FPFA 3BIEA 3DXRA 1GOFA 2HHHB 5L9BA 3JXSA 1XB9A 1W8UA 2V5DA 1W8HA 2Q1MA 1V6NA 5SV5A 4TSVA 1YSCA 4MHUA 3VKLA 3LEIA 4CS2A 3MFAA 1RHI2 3ABKB 4FZ0A 4ZHQA 1JHJA 4UFLA 5KAIZ 2W95A 4JI1O 1RUF1 2QBXA 1PX4A 1Q90D 1MR5A 2AUYA 4AFCA 1X7NA 1K4DC 4XQDA 4FSJA 4RS5C 3M3OA 1YTFD 2V09A 5IW0A 5B4NA 1W28A 5C8WA 3QVNA 1J84A 3AKTA 4OUMA 2ZGPA 3J7AU 1IQAA 1RUE2 2LS6A 1QEXA 2W1WA 3AG1C 3O7OA 1VRH2 3H1WA 3SYPA 1FPOA 3RT3C 4EFEA 3G6EV 4DZGA 3VDBA 2ZX3A 1Z7S3 4CP9A 1GK9A 4HZ3A 1EN4A 2A6VA 1GLHA 4XJAA 5LOVA 3ZFGC 3HT2A 3G7DA 5GZFA 1CN1A 3J26N 4Q2FA 4FLYA 2ADPA 2ZIMA 3K48A 3POWA 3GWKC 2OPKA 2JG8C 2JDMA 2VECA 4PI0A 1JU3A 3SCGA 2MEV2 5IK4A 2WLQA 3IBMA 3WY6A 3JYCA 4LNVA 4EFBA 3AZVA 5DAXA 1RMU3 2G1MA 1UPSA 1Y66A 1SQXH 2JIZG 1S2KA 4FM2A 5E16A 4KFMA 3SJQC 1DZRA 4RO2A 5FUPA 4KU7A 1I94O 2XLAA 1SZXA 4GH4C 4QHBA 4NYKA 2N05A 5IYCO 1DQ6A 1RUG1 1DF5A 1RUD2 3ZSEA 5KXDA 1W59A 1IPSA 4W6WA 4DV6O 1HWYA 1GQHA 2UU8A 3N35A 1N47A 3UJQA 3BOPA 4HKWA 5GLVA 4HNAB 3AMPA 1UQXA 1LECA 2BWCA 1RPOA 5C8YA 3AVSA 1QXJA 4UI9L 4DR3O 5JUVA 3WVJA 1J5EO 2LJ2A 3AVRA 2BGOA 1YO8A 2RM21 2AZ0A 4O2BB 5FZEA 4LFCB 4QB2A 1FAFA 2XKOA 2VZ3A 3CCSV 3LAGA 1MS9A 2VGDA 5BNNA 1ZWIC 3D0SA 3Q8BA 2PAEA 4D7TA 1KMIZ 3QTCA 4FOWA 4LF5B 1KITA 1ZSPA 3WF1A 1P7BA 1DP0A 2CAUA 2DFBA 3FYIB 2OIEA 4IGGA 4I3GA 4IIJA 1AJPA 5CADA 3K4ZA 3B8MA 3MAQA 4LOSA 4Q4X3 4OI0A 1POQA 1OZ0A 2ADQB 3VBOB 2DUPA 4XDOA 2OCHA 4O4JA 4XFCA 2K0GA 1T6GC 3T1MA 5SV8A 3ZN4A 5FZOB 3ILRA 4L99A 4C0HA 3TBDA 2JEUA 3HWJA 2BE3A 2DOSA 3ACFA 1GBGA 4IEOA 1K33A 4ZOLA 5CBHA 1FPN2 4LE4A 4GKKO 2XOMA 3DGEA 3NJZA 1UPGA 3NL1A 3UKMA 4RQPA 4TWTA 1Q8PA 4NRPA 4XXAA 1ZRDA 1L7LA 3V0BA 4ZKIA 2IH1C 1VQLV 3KB5A 4MOAA 4MVMA 3ZRSA 1R6KA 4DO0A 2FZ1A 4L92A 1KP3A 1FXKB 3L2HA 2JD4A 4BMBA 5J2TA 3JALB 1R091 2VQUA 4K8FA 2UXNA 1TZOA 4BISA 5E8AA 2Y6FA 4IT5A 5GONB 3K57A 4LQRA 3AP9A 1DYKA 2WLPA 4MTXA 3W7XA 5J9PC 1VQPV 1SLIA 3OM3B 1GN3A 1LNSA 3J8F3 1C57A 1RTVA 5C3OA 2JGUA 4EWDA 3D0JA 5FTTC 1D4M1 4DIQA 4Q20A 3WX5A 2Z3YA 1BT8A 3ZMTA 5A6XA 4R8CA 4YW1A 4WVZA 5JVDA 3ZIXA 1DIWA 1AR5A 2RHPA 1VQKV 4LHLA 4CEYC 1B35B 2JIJA 5L9VA 4E4EA 4AAXA 5FZFA 3V65A 4CE8A 1GOGA 3CCLV 2W46A 4JI8O 4ITCA 2UXDO 1Y9GA 5I8TA 1DGWX 4I0XB 2DE0X 1FXHA 2QM7A 4KWJA 1YWKA 3IB3A 1S77D 3LUTB 2VUDA 4DXTA 5CKNA 5C3PA 1ULPA 4W4ZA 1R093 5JLVA 3ABLC 3D36A 4OGQB 1O4ZA 3ZYHA 3N36A 1TE1B 3JARB 4RUEA 4TOIA 3OOXA 1HNXB 1VMHA 3B69A 3J7LA 2N74A 1ZM1A 1JMKC 1GAXA 5BR8B 4JI2O 3LSDA 5T5PA 1OVSA 3RYKA 4AEDA 3LA3A 5EYPB 2ZX1A 5FY5A 4L11A 2R061 1D4M3 1SQ4A 4LO8A 4PDWC 5H6QA 5DG1A 1PMJX 2ZGLA 3ABMB 2PZSA 4SBVA 4CDQC 5DQ0A 3GXUA 3JQWA 5IYDO 1CAXA 1RUOA 4BQXA 4CSWA 3UT5A 2CWSA 1HB3A 1OC1A 3IFXA 2CTVA 1VQ5V 4M3CA 1AR91 1BK0A 1ZBE1 3NKGA 2UURA 3SYCA 2OX0A 4GJYA 4X65O 3IC9A 4DPNA 2ZDIA 2AZ2A 5HV0A 4DV2O 1YYNA 1V55B 1M06G 3DPRA 1H8TA 2WLKA 3CDZB 2GDFA 2OCCB 2PYTA 2ZHLA 3IT8A 5D5QA 2HWC3 2P4EA 5KC6A 1LCLA 2RS33 2QWNB 2ZIOA 1MQTB 5L7OC 1UW8A 5LHGA 1H9WA 2R063 4DK0A 2HKXA 2DFCA 2WA4A 3LCPA 1LOAA 4JRAA 3OMIB 4LF6O 1N34B 4MXWA 2EIKC 2NN4A 5F3CA 5L3FA 2KD7A 2C4XA 3MDPA 1R1BA 3GNEA 3UQ8A 1N3QA 4HAMA 4GYCB 2LW7A 3SH3A 4TN7A 2HHHO 1LOBA 2WWSA 3C8XA 3Q9OA 5I0UA 1GYKA 2GUZB 3I2HA 1C3HA 1IS5A 3D4KA 4TT3G 3JQXA 3WNMA 2RV9A 1ZBE3 1NCRC 1IGOA 4I01A 1K42A 3R4SA 1BQZA 1V70A 1DF4A 3QO8A 4CEWB 4FQ4A 1RUJ1 3RPQA 3QF7A 2Z0AA 4XHXA 3SKVA 1Q8SA 3Q8AA 1FI2A 2Q7GA 5C6CA 1JYXA 5IJ0B 1NY72 2ZEZA 4GMP1 4N53B 3BTYA 2BSKB 4TTGA 5LBBA 3E8FA 1AVBA 3ETEA 1JYCA 3NWKA 1VMFA 3CZUA 1FFTB 2B46X 3KF3A 4YJ3B 2VZOA 4PJYA 2HWD2 2XWBB 2FKXA 4E8CA 2ES3A 4D7YA 3ZRXA 1LODA 4M01A 4QB1A 3KQRA 1V9U2 3F7YC 4IV3B 1OJHA 1WW7A 2TNFA 1MSDA 2DBIA 2DVFA 5KHGA 2ZE5A 5L73A 1E5RA 2BGCA 4COVA 4LR4A 2ERFA 4XBLA 1VMJA 1TMF3 1YQ8A 5F6KA 4RD7A 4ONUA 3IPVA 3L70H 3HVDA 1FNZA 2XLGA 3NAPB 3FB6C 1AX2A 4OMCA 2D5HA 3ZN6A 4IW3A 1EAH3 2X5IC 4IEQA 1R1A2 5GKAC 1Q8VA 4MTOA 1NVPB 2D43A 1SERA 4UCTA 3GVMA 1QXRA 2YXSA 4GMP3 3ACIA 4QXKA 2Q1ZB 4PHZA 1DQ2A 5CEHA 5HFMA 2F93B 1FOD2 3TK1A 3NNGA 4GWMA 4WBNB 3BIWE 2J1UA 1SDWA 1VARA 1US6A 3WW2A 4DV4B 5FMOL 3QOPA 3E8BA 3A2FA 4FPYA 4QM8A 1Q5OA 3O0VA 5I0SA 2KA3A 4XJWA 2HYXA 2B42B 2ZGRA 1P8JA 3PDQA 4IEYA 2OTLV 2ETEA 2XQXA 2ZGOA 4WBNA 3DV8A 1AROP 4K35A 1MSWD 1E5IA 4OHZA 2Y6LA 3HAGA 2VD7A 1OCRC 1Z2GA 4IL7A 2DMXA 5JR7B 1SFYA 5FLHA 1VBC3 2DYSC 3BTAA 2W6IG 3GM8A 2XUEA 4UFHA 1W8ZA 4LFCO 3B09A 4RR3A 3VBRC 4WVWA 4YXWG 2W9XA 3K59A 1OLME 2R16A 4RWUA 4KU8A 2XAGA 4BAYA 5A7NA 1Y74A 4EROA 2BZDA 2F17A 4ASKA 3ZHRA 2Q1FA 1KD7A 3LDRA 1W6MB 4LLFA 5KLVH 1WLEA 1YLLA 3CEIA 2RR11 3JBG3 3MHZA 2HEPA 1YZBA 5FREA 2V4VA 1DYOA 5CA0A 3L71H 2NLRA 1DZQA 1W0JG 4W4KA 3KZ4C 1UPIA 1WP7A 3PU8A 5C3RA 4QGNA 3CCJV 1S0FA 2OZ6A 4K8ZA 1PNMA 4QJFB 3AP5A 2IFRA 3B40A 4Y5SA 1W04A 1OLMA 4JYYA 4MSVA 4YJ2B 5B1BC 1OA3A 4A7YA 2XDVA 5CFDB 2QTOA 3GZUC 1F2NA 3MPBA 2ORZA 4XZUG 1K3EA 3RSJA 4OZOA 3T1CA 1IXBA 5FRAA 1AXKA 1AYM2 1LU2A 4Z07A 1GM7A 2KXLA 1LOFC 2O14A 4LITA 3STZC 4CCOA 3T4DA 3BGAA 2ZMNA 4KMQA 2VBBA 5KHIA 3VBSA 2WIIB 1UY4A 5A2QN 5KXEA 1ZZ6A 4BK5A 4YM1A 1VLNA 1UKGA 4GAZA 4YSFA 5CA1A 1V6OA 1IPKA 4R8HA 1WA8B 2QQOA 1F4AA 3BU7A 5FYYA 5FOBB 1Y4WA 2AREA 3DN7A 1PK6A 4X62B 3DL3A 1ASJ1 3RJRA 4Q4W3 5FUIA 1JFFB 4Y24A 1K3IA 4DS0A 2VR4A 2JDKA 4LPLA 4J25A 1AR62 3OAAG 1H2GA 3POGA 1G9DA 1I7FA 1UU5A 3IAQA 4GCZA 5KHHA 4NKGB 3LA7A 1J1TA 4YGDA 3CCRV 1NYWA 4XJ8A 4OPHA 1R3IC 1KC8W 4Z1MG 3HOBA 1S5LZ 3ICXA 3G67A 3ZN1A 4L87A 3PJQA 1IKPA 4O2AB 5I93A 1UZVA 3JZVA 3KVBA 1HRI1 4FK5C 1BEV2 5DAWA 2B9ZA 1DHKB 4HOOA 1S0EA 5DPNA 4IYIA 2QE3A 4UFJA 2UXBB 4L8JA 1ZRCA 3LB9A 4LBEC 1WAZA 4CXXA 4QPIB 4MX3A 4BOWA 4BWAA 3H42B 2QGNA 3DKQA 1PD3A 3H3ZA 4ARXA 4MT8A 3PU3A 2CGOA 4CZSA 1F51A 1HNXO 1RXGA 1QH6A 3WF4A 2YEVB 2CTPA 3RYFA 5JXJA 4L9BA 2VTXJ 1VALA 2DCYA 4H14A 3OPZA 4M0NA 1W8OA 3N9MA 3WB2A 5IYZA 5FDBA 2GNBA 3FC0A 2EALA 3I7DA 1SCSA 4CUGA 5A3TA 4Y4YA 1ZX3A 4XQ4A 1NE6A 4J7ZA 1ZLZA 4UAPA 4AVAA 1JR9A 3WW1A 3N9OA 3FB7C 3D3AA 1GWMA 5DUWA 1ZZ8A 1EUUA 3PIGA 4PT6A 4AQSA 5C8CB 1RUH3 3AB0A 1B06A 3HN3A 4Q1RA 3AL6A 1PPJH 1YQCA 2V4AA 5H6RA 2YZ4A 3M8AA 1D2QA 4UXNA 1ULCA 3RZLA 1QJFA 2HWF2 4GB31 4JI3B 3MLKA 5FY9A 1TAEA 3ZKUA 5BV6A 5E89A 3V0AB 1R082 5A7PA 4QPGA 4IEXA 5LA1A 3SYOA 2CYFA 2ILMA 3GHNA 3J80N 1RB8G 4P5YA 3EFFK 2PGGA 4V1PA 3DYMA 2JB8A 1O8PA 5LMNB 2ZJCA 4FP3A 2VC9A 3AKSA 1XREA 4NTXA 5J2UA 1Y4MA 4GWIA 3HKCA 4O7XA 4GWNA 2AEZA 4XETA 4YPJA 2N7GA 3WB1A 4RQEA 3SISA 2ZGQA 4K40A 1W3XA 3ZHVA 5CBLA 1K34A 1CD3G 3BN6A 3N7LA 1HQLA 1BBT2 5K8SA 4MH0E 4QPWA 3HNMA 4DEQA 4CZZA 3WT3A 3VKNA 1Y43B 4LBJA 3WNKA 2PF4E 1TME3 2ZPXA 1BVVA 3WP3A 2CDYA 3VZMA 4QGMA 3RWRD 1ULFA 2L9LA 5FBZA 4OI1A 3TGUH 3DKWA 3KVAA 4OX9O 4NXMB 5ABJA 2QJVA 4RN5A 3CLPA 2EF6A 3OF1A 5LHHA 3KLSA 2HBUA 4Y1UA 3EHKA 2YPDA 3CS5A 5CB4B 3O0WA 2EJ7A 3VDDC 2RDQA 2Y26A 2EIEA 4DR5O 4I50B 5IVEA 2FDHA 1G4YB 2J22A 2W1SA 1XNAA 4COZA 3NO8A 3NV1A 3RI8A 3T2PA 4ABMA 2QQVA 4E27A 1FMD2 4X9QA 1KDMA 1YIFA 4ZU7A 1UMZA 1K12A 4HN0A 4WBBA 3Q4HA 3KS7A 1OOPC 2KKWA 5C70A 1JZ3A 1Q6UA 4NPMA 2Y60A 3ASOB 1NKGA 4GIQA 3KV9A 4UCSA 1UNBA 4OULA 2YC2A 4CP1A 3K4DA 1RUC3 4YGCA 4FFIA 2HVKC 3CPWU 1WCQA 3TB0A 3AJZA 2H94A 2M7WA 5CNAA 2JDUA 2FDJA 2XT9A 4X6QB 4B1MA 4DUYB 3WDUA 4DV4O 4I0WB 5FZ0A 2FMLA 1OQEA 2UXXA 2Q8VA 5IVBA 2WYFA 1OF4A 4DR1B 1OA4A 3AMHA 2ZKOA 3MIBA 4JX0A 2OUHA 4PDMA 3CCVV 2WPDG 5LA2A 3WDYA 4PDLA 1NR7A 3ABKC 2DN9A 2JENA 2A6XA 3GZEA 4B1LA 1NCQA 5I8SA 4DMIA 1QWRA 4D0QA 4PLOA 3ZFEA 1YDXA 4JHZA 1P7GA 2UUBB 3JAKA 3M8LA 2P17A 3I59B 2VMFA 1DLLA 3T4ZA 4UVCA 4QQLA 1VBB1 1NE4A 3NRUA 1XSRA 5C3SA 2QKAA 2IW5A 5EZWA 4J10A 3FAVA 5FYVA 2LQTA 5JCOC 1Z7S2 2R9AA 2D6LX 3FL7A 2BTOA 3C7GA 2GC0A 5LP6B 5FY0A 1HLCA 2VE1A 2W68A 3LNNA 1QNWA 2VMGA 3ZHUA 1UIJA 5T5JA 5EJZB 4N9HA 3W7SA 1PHMA 4R4XA 3TN91 4I3PA 4OVEA 2RDSA 4B8EA 4XVHA 2QQJA 3JD1A 1ZL8A 5K0UA 3JD4A 2ZHKA 4UF0A 5IY5B 4I7ZB 3GB7C 3HMYA 1VP6A 1M9NA 1SF9A 1RMU2 1ND3A 1YJKA 5HPOA 1HB1A 2P06A 4OQ8A 1UU6A 4RA0A 3A7QA 4Y22A 2HBTA 1EN5A 4LF9B 3SPIA 3OYWB 4HVOA 2UU9B 3M1HA 4IV1B 2WSUA 4QDQA 2Q8OA 3OCPA 3OJBA 5BNPA 3RJ2X 4QIWF 3GZAA 2CE4A 5KA5A 4UT5A 1W8TA 4LEJA 1DBNA 4FOYA 1M1KW 4I09A 4DRXB 1VIBA 4F6RB 5JJJB 1U97A 2VTXA 3H8UA 1CAVA 3KF5A 1DU3D 3K51A 5JI9A 2VQFB 3WW3A 3VGIA 4INDA 1TA8A 4PIZA 4BB3A 2NN8A 4LWSB 5IVFA 5BNOB 3ZMZA 4IV1A 1SDDB 4X89A 3ZMSA 1PKXA 5BNNC 4CTEA 3A0BZ 4N23A 4X62O 4EN6B 2ZGMA 4P00B 4HPKA 1QOSA 2VVEA 1YXBA 4N43B 2W08A 5JXIA 4NIIA 1AJOA 4V2WA 4FFKA 5LWBA 2HWB3 3N27A 1LJ7A 4IETA 3ETQA 1N1VA 5E88A 1L0NH 2FTKA 4LH7A 1QOOA 1G9AA 4P9GA 5A3WA 2FL4A 3MZHA 3FBYA 1RHI3 3LIGA 4K0KB 1U5IA 4JZRA 4S2DA 1VBA1 4J7JA 1JJOA 1M4WA 4ORFA 5C7GA 1V9PA 2XBO3 4ET7A 3PNAA 1JZ8A 1RUG2 3PLQA 4Q4X2 3A23A 1PGSA 5JJNB 3C7OA 3VD7A 5F3IA 5F5AA 3OMNB 4J9ZB 2EXHA 3VBOC 2UXBO 3CCMV 2R043 2ETNA 1SQVH 3AP7A 4PIYA 4LBNA 2WA3A 4DB5A 5HXVA 5LRSA 4RS5A 4FLVA 4CPBA 4JKKA 3T2TA 1MNGA 4M4PA 5CA3A 1QR8A 1W03A 3KHBA 2VMCA 1VBE3 2QQNA 1POV0 2BOJA 2DU0A 3OSDA 2QDNA 5EXOA 5TSWA 2G4IA 3VZNA 3Q8CA 3ATGA 1KKDA 2HG5C 3A8TA 1HW5A 2QWQB 2QEXV 4UW6A 5IYYA 4I4TA 3ZFGA 1FXKC 1W39A 4FZ1A 2X53S 3FZ3A 1I0HA 1ULDA 2Y6KA 3BCWA 5ITZB 1AYN1 2BWAA 4QX7A 1J95A 1HKDA 1NT2B 2JG8A 4MGIE 4TLFA 4RFT0 4K8RB 1DGLA 3J8F2 4AHYA 5K4LA 5JWPA 4JASA 2ZS6B 4ZXKA 1YVWA 5A7OA 1D7PM 4JI3O 3ZKYA 2CDPA 4GWJA 5ACA1 4UW4A 2A5ZA 1M90W 3ZXEA 5FK7A 2E7AA 5D8AB 2KR2A 3ML0A 1GH6A 2ZINA 1NQDA 5FYMA 3ZR6A 3D5OA 1JCHA 1JYVA 2D44A 4GH4A 1BGYH 1B35C 1VE0A 2HWE1 2WZR3 1TUBA 3HBKA 3E86A 3B9CA 5JXGA 2VBDA 2V72A 2Y6GA 1O59A 2DCJA 2IU3A 1VP7A 4HFSA 5DM6V 1W05A 2E76B 1CQ9A 3WW4A 4O4IB 2D97A 4YARA 3APBA 4G28B 1R092 4XPVA 4OHYA 2GN7A 3RZJA 4D6RA 4O4LB 1QHTA 3BPZA 4B3TO 2PI5A 2DQ0A 2WINB 4FJCC 4IERA 5A6YA 2GALA 5F6LB 2WAMA 3FB5C 2W91A 1M5IA 5L19A 5HCHA 3MIDA 2P1BA 1D4M2 4X1YB 3K75B 1I08A 4URTA 3WQ0A 2Q4PA 4DV7B 2F4PA 5A32A 5BXXA 5BMVA 3W5MA 2RMKB 3M3EA 2IU0A 3N7MA 1TVKA 3UNPA 3ABMC 3ZN0A 4JI4B 2JGDA 4CUCA 2ZX2A 1VB4A 5L3EA 4YGBA 3D8CA 1O4YA 1S5JA 3HQXA 1TQ5A 2ZDIC 1WMEA 4AGGA 4XAEA 4Z82A 1KQSU 4MGYE 4LT5A 4EB6B 2H3OA 5JMCA 1QIQA 4IDZA 5FP7A 1SRYA 5C5TA 3BA8A 1LHUA 2E31A 1WWYA 4UCOA 4OI2A 5JVVA 3ABUA 2ZNIA 1WCUA 3H1IH 1UXXX 1E5HA 5IK8A 1KKCA 4W6YA 4W8JA 5GZCA 5J3UA 1QMJA 4H0LB 1N3PA 1V55C 1QH7A 3HBZA 2HWC2 5IK7A 4RGGA 1I5PA 2OCCC 2RS32 2DVDA 4BE3A 1F9KA 5F5QA 3UGHA 4COYA 4AI9A 2R062 4YW5A 2VZQA 3O1PA 3ZS8C 1H8VA 1MQTC 2J1EA 2R1BA 2V1DA 3A0KA 3EVKA 2VPVA 1Q43A 5KXBA 3V64A 5AC91 2MHFA 1OLRA 4NAOA 4NUBA 3IAPA 5KAFZ 2XTAA 1GZCA 2ZGKA 4DUYO 1NZ6A 2Y8KA 4H7LA 3VKMA 2QFEA 5KMGA 4MTFA 4XBQA 3OGVA 2NMNA 4PQQA 1ZBE2 5FZ6A 4ZBMA 2GP3A 5JOWA 4DR1O 3M7AA 2YMZA 1Q7YW 4X8AA 4JAUA 1COV3 4UV9A 1FFXB 3AKRA 4CEWC 3M3QA 1D0GA 1N32B 3BPSA 1DG6A 3HN1A 3BI3A 3DTUB 2HEWF 4AVSA 3IIAA 1W8FA 4ATFA 5FCCA 4MGTA 2Q68A 1NAEA 4N53C 3SKJE 2GZWA 2ZEWA 2GN3A 4CEYA 1VRBA 2J1RA 4XACA 3SJAC 5F2SA 4D8MA 3T2OA 1W0KG 2YICA 2TBVA 4XC9A 2RS13 2UUBO 2OPWA 4XTPA 2NNUA 4I5SA 1AJNA 3UO3A 2DCKA 1F23A 2VU9A 2Q67A 4P08A 2GDSA 1MZEA 3WQBA 3SJBC 2OS2A 1PMIA 5EZYB 5AC93 4IV3C 4YW4A 3TEWA 1YUDA 3TETA 2VWJA 4CBCA 5DDJ3 1QVGU 3VL8A 1TMF2 4DV3B 1WBFA 4CCEA 3U07A 3A0HZ 2XVLA 2XH6A 3ZMNA 4QDRA 5EP9A 3NAPC 4PDRA 1EAH2 3BODA 4N9IA 3O9OA 4ZU4A 1US2A 2PLV1 1IBKB 5FKCA 1PO23 4JDNA 1XXNA 1Q8OA 4PDWA 1OH3A 2Y6HA 1PVC3 2CGPA 3TJTA 3MLJA 2CDOA 4AEJA 4JKLA 3FD9A 5EK0A 4NPRA 2QQKA 2JDIG 4LF9O 3ZYBA 4GLXA 2BU9A 2ZX0A 5CZKA 1WJZA 3HKBB 2VMHA 1YITV 4LH6A 3GJBA 1QQCA 3A21A 1UX6A 3W7TA 1AL23 2WZEA 3WD5A 2JDPA 4U3FH 2FCVA 4PLNA 3BYWA 4YY3B 2PXJA 4XFBA 3JASA 4FVVA 3HKBA 1W6OB 3QBQA 3LZZA 1B6QA 1ZTEA 4X8NA 5A33A 2OQ7A 5CFCB 5FQ0A 1S72V 3UKTA 3GDBA 4HZFA 1XJAA 1OSGA 1AUYA 3K9AA 2XAQA 1EZJA 2VCMA 1WLCA 1FYJA 3AK0A 1BL8A 3ME2A 5L7OA 4DV1B 1EV11 3ECQA 4X66O 2PHXA 3MW2A 2DWRA 1RUNA 4TLGA 5FWEA 4IGPA 3E1F1 1TG7A 2W6JG 3D82A 3CCEV 3TEXA 4NWWA 3EBRA 1ENXA 3HR0A 3WU2Z 3JBG2 3PUSA 1OKQA 4BK4A 4CUAA 3WDVA 2ZOEB 4RHV1 2VO5A 1HRV3 1UYYA 5FP4A 3CD6V 1BQPA 5IAVA 1NCRA 1US3A 2JE7A 5JI7A 1JJ2U 2CY6A 4R52A 2WS91 4BXFA 2UYBA 4QE9A 4LO4B 1CAUB 1N36O 3GBFA 2E5LB 5FZ7A 1DLCA 1ZUQA 4FO9A 4R6ZA 4BYYA 3DSQA 1CAWA 1VQ4V 2WLLA 4ASLA 5GZGA 5CYYA 3I5DA 1NLQA 5KC5A 5CFDC 1ZBA3 4Y26A 2PHUA 4YW2A 1KB9F 1UXZA 1PIV3 4LO6B 4CDWB 1DDLA 5D2AA 4G2KA 1ZREA 4C90A 3K3OA 3U78A 2A6YA 2Y64A 4A4AA 5T5OA 1F5FA 2R1DA 2RN9A 4UYBA 1BS3A 4HK9A 5FZ8A 2NZ9A 3CJHA 1ENQA 3WG1A 5IJ9B 1HDJA 4WM8B 5FYTA 2XR4A 1Q3EA 5FXVA 1BMV2 3PMSA 1EM1A 4URAA 4OPAA 5FPAA 2JEXA 2ORXA 1C8M1 4Q4W2 1FOD3 2X5IA 3CXHF 5LMUB 3AG3B 4BW9A 1RSOB 1RUI3 3AG4B 2JVDA 3H1JH 5K1PA 3FHQA 5J1XA 2FCUA 3E6BA 5IJ9A 4NHKA 3O1VA 4JGZB 1L3JA 1AI6A 3WDWA 3RZKA 4DR7B 3LOIA 2XONA 3NKTA 1HV1A 1UFIA 4CCLA 2WSSG 3C3SA 1XYPA 2GC1A 3LA2A 4YYOA 1YI7A 2QM4A 5A3PA 3PTRB 1QJU1 4FFFA 4YVSB 1W6PB 3STLC 1AF9A 4JC1A 4B3RO 4CCMA 2Y69B 2VMEA 3ON7A 4BXSV 3NNLA 1STMA 4XFIA 5EIYB 3INAA 2CAVA 4R4ZA 5DAVA 4Z8BA 5C71A 3KG2A 3WUCA 4R50A 1FT9A 4QPIC 4BQYA 4AGRA 1O5LA 1OFNA 3R05A 4Z92B 1VF6A 1C8M3 2ZNJA 2VXJA 1QXPA 1CIWA 2BOIA 4WV8A 5FY1A 2CH7B 4W6XA 2XPJA 2JJ6A 1AHSA 1IBLB 3WG2A 3BA9A 4LO7A 3KKYA 4IE7A 3SH5A 3VBRA 2JJ1G 3P3NA 4KUMA 4LXLA 4AI8A 3HR9A 5BY1A 3FJSA 5FMBA 2RS51 4DV7O 3PMEA 2YPJA 1GO3F 1S0VA 2CTRA 3VV1A 1PZ7A 3N9NA 4FP2A 3OD4A 4YW6A 5JZGA 1M4UA 1NXD1 1GMGA 4MVQA 1W9FA 3VBUB 2VOWA 2WJSA 3GCWA 2WYSA 1MACA 4FOQA 3ZRWB 4OQ9A 4QKNA 3J7HA 4COUA 1MVEA 4QKDA 3H01A 4YZ1A 1MABG 1RUH2 1GN4A 3WG4A 3EO6A 1W9SA 4QPGC 5C8CC 5IJRA 5DUUA 2Z69A 2VZPA 2UUCB 4BIOA 3I8TA 2GC3A 1W9TA 1P84F 4B3SB 4S2HA 3O1SA 2RG4A 4AOCA 2WKKA 4ZHNA 3WF0A 4GKJO 1SZTA 1UCXA 5I0RA 4MUVA 1GRJA 3VKFC 4CH6A 3ZFFB 4QX5A 2VCBA 5JQGA 4LBOA 4BA6A 2VCCA 3EHBB 1DQ5A 2DVBA 2IM9A 2XLFA 4R9AA 1AR73 1UWWA 3NJVA 4LF7O 2RS53 3AYAA 2PAKA 2X10A 2WQZC 4NVPA 4CDUB 1UYPA 2JS3A 3IMMA 2CWMA 3ZXKA 1CJPA 2RCVA 3JATA 3ZFFA 2A6ZA 1AR63 1UZWA 2R071 4NO4A 4R9DA 5A3UA 2VVDA 4BIZA 2LFSA 4NROA 4JYAO 4O4HA 3BUCA 1HXS1 5LGUA 3OGSA 4XHBA 2C26A 3OBTA 4Q4Y1 4AEKA 3OEHG 2IXJA 4IHJB 5IFTA 1N32O 5FKBA 2P37A 1TME2 3I55V 4QHZA 4PDVA 1SPPA 2YXLA 3VBHB 1OMIA 3CU7A 2F66C 1S0DA 1XNDA 1QJY3 4ICGA 4LF4B 2G9GA 3FUQA 4F4LA 4LKDA 3OE7G 3RBZA 4PIXA 2G19A 3H9AA 4PD4F 1EUTA 4UW3A 1H1MA 4L0PA 4Y20A 1GNYA 2PAMA 4XDPA 4PI2A 1Y76B 3ST7A 1ZZCA 3MICA 1ODNA 2QDOA 5EBLC 4G4FA 3RS6A 4DV3O 1EPZA 5FYCA 4AVTA 1BZWA 3WDXA 3I3BA 1Z5VA 5LRRA 4Q4Y3 5LA6A 2W1QA 2P67A 5FP8A 4LNUB 2CSGA 3NNJA 4XIKA 2QQUA 4IEPA 3T0BA 4FLWA 3ASOC 1RUC2 3PUQA 3N2GA 4ISQA 5BPXA 1RUE1 4CDXB 2WN3A 4NXNO 1AR83 1VRH1 2QWPB 4ZU5A 3LQCA 4META 2JWPA 3FX7A 1SA0B 4JGSA 1KYOF 4CH3A 4MGZE 5HFLA 4YVWB 4FPLA 4X20A 3GF6A 4AFBA 1ORQC 3K5MA 4QPYA 4MTGA 2RMU3 1K7DA 1POV1 1P49A 4YY3O 4V2VA 2R9IA 4NE9A 1I5ZA 2ZTNA 1RJ7A 4C8DA 2VXRA 5B66Z 3B7MA 3ZXJA 4CDXA 3MHSC 3JSNA 4MW3A 2NP0A 1EBOA 5APAA 3USUB 2QUOA 2D6OX 3PIJA 4QMAA 1PP9H 4U36A 4A5UB 1MOFA 1Q6HA 4B3NA 1ZRRA 5IHRA 4GKXA 1OQ1A 2XB6C 3DCQA 5CVRA 4CS3A 2CK3G 4DV1O 4Q1PA 3CMAV 4LOTA 3WHTA 3WQ7A 5A9GA 1LOEA 2ARHA 3TYJA 3K77A 2XKPA 1W2TA 4G3YC 5CB7A 2GHYA 5HI0A 3GBGA 3W7UA 2EIDA 4NB5A 2V73A 5FNVB 1F7YA 2FQPA 4EKWA 2WL1A 3O65A 4KWUA 1L8DA 1MEC1 4PA3A 1NTZH 5LP6C 1RUD1 5LYJB 3T1HO 4AFAA 3VD5A 2J1TA 4AXOA 2BTQA 3EB7A 1YIJV 2JX9A 2LO1A 1D2SA 3NV4A 3ZPOA 1LKNA 3CP1A 4R7CA 2E5LO 4LBMA 5IVVA 5T50A 4FLUA 2IXIA 1JN2P 5IY5C 2FD8A 2IXLA 4LTAA 1DGSA 1WPXA 3VHNA 4TUYB 3WSOA 5CU1A 3KM5A 3O0XA 1S55A 1G8MA 2LW1A 4N8MA 1XHZA 3RYCB 4ZS3A 3MF9A 3RI9A 1LRHA 3W20A 3WP5A 4IV1C 4KG0A 1VJ2A 1G8WA 4AILC 4J41A 5B1NA 3HKEB 3VDDA 3A22A 3GWOA 2W94A 1CX4A 1MEC3 3VLBB 1N8RW 3LDDA 3DF0A 1PO13 3EQEA 3N9LA 4J42A 3OGIB 3VHPA 2JICA 2R70A 1GQGA 2Y33A 1LHOA 1PNKA 4MS2A 1G1XB 3JAWA 3IJ4A 4NHLA 5BNOC 2VMIA 3UETA 3OY8B 3WNNA 1RP3B 2D6PA 2WLJA 1AL0G 5EBWC 1OOPA 4N43C 5C4WB 2HWB2 4FFBA 2D6MA 2QR4A 1JA8A 1N1SA 1FPN1 4DR4B 5LZ6A 4HKLA 4TQFA 4E4SA 3JD73 4ZZ8A 2JRIA 2MW2B 1VF5B 2D3SA 4LBQB 1XNRO 1WP8A 3ES4A 3PVEA 4QE7A 2XBO2 4M0HA 2PUSA 2A3XA 3O1MA 4CU9A 1BVP1 3TAYA 2VMDA 1AI4A 4P02B 4CYDA 1TGOA 2UUAO 3S5QA 1OI6A 1S5HC 4HETA 3O1UA 3WLUA 1XBLA 2ARBA 1QJX3 2GC2A 4FIPC 5FOJB 2R042 4OI4A 2PYJA 2UXCB 2Q5TA 3P6BA 4O9GA 1H4GA 2PELA 3MLLA 2WFF3 3HKDB 4YZ2A 3CJIB 3GCXA 2YIAA 3K58A 3RVYA 1J1LA 2Q30A 3UESA 1VBE2 4W65A 5FPZA 3BFRA 4OUSA 4H44B 4J9YB 1O5UA 4WFFA 5DAPA 3ETDA 1XMQO 2RNBA 5CKQA 4D6SA 1AR1B 3VQWA 5LCWL 4ZI7B 4KBZA 5JCOA 1BHAA 1UIKA 1GP4A 5IYBO 4DRRA 2NYYA 2BW8A 5FFOC 3KCCA 3I56V 1JW6A 4HKOA 4DR6O 1RUF3 5FZMA 4E2SA 1H38A 1MS0A 4BQ3A 3THDA 1W6QB 4FOVA 3L9DA 1XEQA 1HB4A 5C3QA 2DYCA 2QM8A 2QTSA 1JPXA 3VN4A 2WC2A 1KBHA 2D7FA 3E89A 2UUCO 1LGNA 1X50A 1OT5A 4EJRA 2X29A 4AQYB 4P9OA 5KA6A 3U0ZA 3FB8C 3OTOO 3LSSA 1NU1H 2FMYA 4C1WA 4BH9A 2AR6A 3D3QA 1YFYA 1PZ9A 1NJIW 3THOA 5D8AC 2FHRA 3PVBB 4DINB 3MW3A 1XILA 3VHRA 2OT7A 4LKFA 4HSJA 2WZR2 1NLSA 1CZTA 4NHXA 3FLRA 4Y1ZA 4X64B 2F1MA 2HFEC 1Q6IA 5A1FA 5A3MA 4IEUA 2Y4TA 4JI6B 1SS3A 1PNGA 3MI8A 1C5IA 3FN9A 5IFPA 5GLTA 2F4VB 1W8WA 2XUMA 4NTYA 4KXRA 1RJ8A 3THCA 4NR1A 1WLWA 4RSUA 4HNAA 1JOBA 2JKXA 3ZDVA 1A3KA 3I54A 2GH2A 2FCTA 2DF7A 4K1YA 1SCRA 2F6BA 4MVTA 3TOJA 5B4XA 5J98B 5LGNA 4CH5A 3RZGA 1ZZBA 2QKCA 1K8AW 4ZXEA 1D5NA 5JOZA 3VD3A 4O2BA 4KHPO 2XJUA 5GW7A 1RUG3 1SQFA 3UKVA 1L7QA 4JI0B 3SDLA 2Y38A 3VBBA 3I3MA 4FAHA 4QX1A 4XUNA 1QOTA 3VBFB 1UN1A 5B3SB 1W2OA 4CDQB 4LF4O 3RQ0A 1HN0A 4DR2B 4U3JB 3OUFA 4CH4A 3ASNB 1SG3A 4EZHA 5IUQA 2RM23 4P9JA 5IK5A 3VBOA 1ULEA 3W58A 3ZIAG 2TEPA 4JVAA 3ETGA 2WDBA 4TV8B 4MG2A 5DABA 5FZOA 5JSPA 3MYXA 4TSFG 4D6QA 5A6QA 1XL4A 1SLAA 3HD8B 5H9QA 4MGQA 1NY71 2JDNA 1YEWA 3CX5F 3T1LA 1OQDA 4P9PA 2HWD1 1ULGA 4A7ZA 1OD5A 4WVMB 3FE5A 3J7NA 3LFIA 1V9U1 3Q8FA 1H8EG 5EC1C 1VEWA 3BRCA 3OUSA 2DU1A 4BLJA 3RYRA 1SBDA 4KQ7A 3RYIB 1FXKA 2QNKA 3JALA 4P5HA 1CEZA 3LSEA 4GZ9A 1SFNA 1ZYBA 3EMRA 2CTWA 5GONA 5LATA 4XZPA 4COWA 2ZMKA 1U0AA 3B02A 2VUAA 1COV2 3AZYA 2OWOA 2YB7A 2SLIA 3SYAA 2VULA 4L2NA 3CCQV 2AZ5A 1PX3A 2X7RB 1R1A1 4PELA 4AHZA 3ZBHA 4A44A 2RJZA 3RDIA 4XJZA 1VQ8V 4J7KA 5BXZA 2RS12 5FP3A 1B35A 3NW4A 3CE2A 4FPJA 4AI3A 2RJ2A 2VOTA 1GWKA 4ZPIA 2XHBA 2XNDG 4DOUA 4WFBV 4CCNA 5AC92 4JV4A 2BBAA 4I0XA 4I02A 1HP8A 1YC61 3M3CA 5LGTA 5J48A 1I6XA 5FMDA 1MMMA 5DDJ2 4EWAA 1ZA7A 4QQ2A 3ZHQA 3NVCA 4JTAB 2XL9A 5FR3A 3CZJA 4GX5A 1BLZA 5FV3A 1K5SA 3PN1A 2ZE8A 3M3IA 2E33A 1W2BU 3JARA 5FZ9A 5GZDA 2Y0OA 1YI9A 2WNVB 3OTFA 2PHTA 2OYZA 4DXZA 2W2IA 2XJVA 1PO22 5EJ3A 1K45A 3ZPYA 5EYPA 1PVC2 1GSLA 3OBZA 3CB2A 5FIXA 3R4UA 3CRCA 4LMFA 3MHHC 5CBGA 1FATA 3DYPA 1ND2B 2XXZA 3ZRVA 4IQPA 5EQUA 4X6RB 4I9WA 4NRQA 2Q5ZA 1QNYA 2JD9A 2E75B 1AL22 3T4VA 2XJSA 1VQOV 3O1OA 2DURA 3K0DA 3IM0A 4DXRA 4X1KB 1IQDC 4JYCA 3OGJA 1NA1B 2K9PA 4FPKA 5FMOS 4E2LA 3PJYA 1RC6A 3CHXA 3VKOA 4B7EA 3DXTA 4JGYB 1S3JA 4DW0A 1W2AX 3C7HA 5CFCC 2BBVA 3E22B 2JK5C 3B77A 2JEMA 4GA9A 4JI1B 1GP5A 4LIUA 4Q8KA 3CEWA 3MGUA 1MQTA 3FKSG 4HK8A 5H9RA 2EIMB 1AR93 4EWEA 2A3YA 2B45X 5LK7B 3FFQA 4CC6A 1XSQA 4MADA 1SHWB 5IT9N 4B3MB 3T0DA 1AYM1 1X36A 4R9CA 4DW1A 1YFWA 1JYIA 1GZTA 2WQ8A 1HRV2 4AHWA 3T0AA 1SACA 1H2SB 2GUZA 2QKSA 1GQPA 2JECA 4RGKA 5DUXA 2JG9B 5L36A 3A0RA 4HONA 1THZA 3UJOA 4CEWA 4AYUA 2ATFA 1SLBA 4D7SA 3GJAA 3ACGA 5F9TA 3IIIA 4YG3A 1UZYA 5IJ0A 4N53A 2BSKA 2BOCC 3HIFA 1REFA 4O9EA 4YJ3A 1G9FA 1ZBA2 4GX1A 2QA4V 2WLHA 1PIV2 1OCOB 2KSDA 2D2CB 2V7QG 1UO9A 3U37A 3KD4A 5HBAA 1Y6XA 4CDWC 1JVMA 1S4CA 4IV3A 4I0BA 2HR3A 1RUJ3 1L7RA 4I55B 2HKOA 2VNVA 3I3EA 1RM1B 1NS1A 2XOKG 1QLEB 3J7MA 1QU7A 4C7UA 4F6EA 3U4XA 1GN2A 1O3SA 4WM8C 2JDHA 4UVBA 4DV6B 3B3QE 2A7WA 1K73W 3J4UH 3RYPA 2YFZA 3H1HH 2BRTA 3ACHA 2ZACA 1YXWA 3NAPA 1L1FA 3QD6A 2GTAA 1JU4A 4UUJC 4LHKA 4E2QA 2RJKA 5G04L 2RE9A 1X82A 1RUI2 4L97A 1DCSA 3AG3C 2O57A 1J83A 1F15A 4ES8A 4X8PA 1WLDA 3LEKA 5J36A 3RWKX 3AG4C 4WVVA 3HT1A 2DUQA 4JGZC 4U7NA 2PHDA 5A70A 2WO2A 5FXWA 2VQTA 1K5MB 2EINB 1ZA4A 2ITCC 5JH7B 1PGW2 2IJHA 3KZIZ 4P9WA 2WLIB 2VH9A 1CGPA 3SPCA 5L3GA 1D5AA 3K5OA 4WM7B 4X64O 3BTZA 3HJRA 2GMEA 4NJ4A 1XC6A 4FI9A 1VF6C 3D3IA 1GWLA 3K06A 4YVSC 1WPBA 2Y69C 3CC4V 2F4VO 3JB4C 5E1AC 5BY5A 4FTEA 3LSUA 2VTFA 2ADEA 3MUY1 4D3WA 4NPLA 3LDCA 3PUIA 1C8M2 1K97A 3T4HB 3KHCA 1LR5A 4XOGA 2RDCA 4LF5O 5JZGC 3JUUA 3VQVA 1UL9A 2HWF1 4QXBA 3GBWA 4YM2A 1YF2A 2E6VA 4Y1VA 2AHZA 2GNTA 3RYHB 1KEXA 1IS3A 1NBMG 1R081 4GKKB 1NZIA 3QO5A 4W4LA 4JI0O 1OURA 2YV8A 1XHXA 1LHNA 4LBKA 4GULA 1NG0A 3L9JT 1ZRFA 1W6NB 1W6MA 4TXWA 3TRSB 2CNAA 1IG0A 3HNYM 5K1XA 4Y1YA 1W8NA 5IE9A 1IPJA 4XUQA 3VBUC 2WT0A 1IDSA 2G9FA 3SNMA 4S2FA 2VNGA 4FPPA 3B2EE 3AC0A 1I9RA 4A3ZA 1U5ZA 4XEZA 2EIJB 2A73B 2MPFA 5HCAA 2TUNA 1XE7A 3ZXDA 3CKHA 4IGQA 2C0ZA 1O3QA 3H7YA 3KV6A 4UFZA 3APOA 2GSMB 4QQPA 3VQYA 4AL9A 2JDZA 2KG7B 4KL1A 4LP8A 1BBT1 4YJ2A 3CJXA 3ZYRA 4BWOA 2RR13 5CFDA 3ZFFC 2PHRA 1AR72 5FYHA 1K5QA 2RS52 3DYOA 1TEIA 1WMFA 5C9AB 1AXYA 3ILFA 3PJSK 2KM2A 2QWRB 3RNSA 3SR2C 1XU1A 4LK6A 1Q82W 1YNAA 2WNUB 1HW7A 2OIIA 4XUPA 4CDUC 4JZGA 2ZXQA 2R32A 1IZ3A 4QXCA 4TV9B 1JZ6A 4QGLA 1JUHA 2VOXA 2BEOA 1H9PA 5AVPA 1I5YA 1XQNA 4UV8A 1WA8A 1Z0HA 3R65A 4LUKA 4X1IB 3K5LA 1JFFA 1PVXA 1X4TA 2C1FA 4RAIA 2VUJA 3POBA 4TWKA 1KS5A 5LXTB 1O9HA 4BPZA 3MF6A 3AFKA 2Y0IA 1FMD1 3WCRA 1R6NA 1BXHA 5I8YA 3B5LB 1UX7A 4LFBB 3VBHC 1NZCA 1O7FA 2AW9A 4DV0B 1QJY2 1Q8IA 2ZGNA 2GH8A 2VS0A 3VL9A 2AACA 5IDJA 4O2AA 3ENRA 1UMHA 4YZ3A 1ASJ3 3AG2B 2D40A 3S57A 4IEZA 1OBNA 1PM9A 2Q8EA 2XVGA 5BR8O 4LKEA 2H6BA 1AXZA 2Z4FA 3VQXA 1GZWB 2OT5A 1COWG 1CPNA 5FZIA 1G86A 2B9UA 4KGGA 2V4DA 3ZO0B 4QPIA 1BQ0A 1W0NA 3S7EA 2OXBA 4OLLA 4Q4Y2 1X9PA 5KHJA 3OPTA 4GXLA 1FYUA 4DV2B 2QDRA 2YEVA 2AC1A 3N9QA 1Y7BA 5FZHA 1GZWA 4ASMB 1HRI3 3GHMA 3SCFA 4N7UA 4H7MA 3ZMOA 3T3YA 1XNKA 1MA1A 2B5HA 3DXRB 3VZOA 1MVQA 4KH9A 4AR2A 1GZ9A 5FY7A 2PQQA 2BP6A 3OMAB 2P34A 4LF6B 3G71V 1AR82 4FLZA 5J96B 1IBMB 2X05A 4DY5A 4CDXC 2YHJA 3VDCA 2JDAA 5JAXA 4ZHQB 1Z7S1 2VZ1A 2ZT9B 4AI1A 4B4PA 2WRAA 4YVWC 4EYUA 4GKYA 5C8CA 2RMU2 4MSWC 2VOVA 1UZZA 3OBAA 2K2SA 2GAUA 1GM8A 2A75A 1A34A 2B5UA 3NV2A 1S0JA 1CR7A 2XAFA 3NMBA 1N34O 2PQSA 3H1MA 2L6LA 3SGIA 4MLOA 3WEZA 1XYNA 3UK9A 1MZ5A 1T6BX 4B08A 3V0AA 1U12A 3RMYA 1EZVH 3RZHA 4ARYA 1RMU1 1GFF2 4CP9B 4YFWA 4M00A 1PL4A 5LOVB 2LGWA 1SLCA 1CONA 3AX4A 4B3MO 2YI8A 3ZN5A 1YIPA 1YQ5A 3WB0A 3IN9A 2OW4A 2FB5A 4GB33 2IFWA 4J80A 3OGCC 3U10A 4Z1VA 2YIBD 5IWAB 2I07B 4BQ5A 5JDBA 1PV0A 1AB3A 4FPHA 5ISLA 4UCUA 2HEYF 2Q4SA 2ZAHA 3F7VC 1IS4A 2DDUA 1TNRA 2CU5A 4CXYA 4HG6B 1CXZB 2NPIA 4FVMA 2DVGA 4F83A 4OUEA 5FYUA 2DV9A 2FDGA 1SFPA 4RQFA 3MUZ1 1ZVFA 1WW5A 2VW0A 3GALA 2B1GA 4DQAA 5LL6Y 2WO7A 3ZIWA 2HLEA 1UOJA 3I49A 3CWBH 5JXHA 3OT7A 5FZCA 1LUVA 5C8YB 5CKMA 4BQ2A 1JQ0A 4LO5B 4F8AA 4WFGA 3DC6A 5CB4A 1MEC2 4DUZB 1OUXA 3RMXA 4Q4X1 1CJDA 1PO12 4I50A 5EYYA 5FYIA 3ZXLA 2P7TC 2IBZH 3N2KB 2WWWA 1DF0A 3E97A 2P3JA 4MVRA 2A9HA 3M4FA 5BNNB 4CPBD 2IC1A 4QX2A 3GYDA 2Z2SB 4DEVA 4EN9B 3KCYA 4YW3A 5EIBC 5C4WC 3ETPA 3T08A 3N2KA 4IIJB 1MPXA 5IAXA 3JD72 4QAWA 1H6YA 3I3DA 2VBPA 3ACLA 5GJ6A 1YJLA 3RW0A 4O4JB 4XFAA 2DQ3A 4P14A 2HJFC 4XDKA 3LDEA 2WFPA 2ID4A 4J1WA 4QKBA 4AE2A 1R6TA 4MVSA 1VR3A 1QJX2 5J09A 1O3RA 4FTBA 4AHXA 5FPVA 3PVNA 1QLNA 4ZOLB 2QKDA 2R0FA 4A7KA 2HEVF 1B3QA 1SZBA 3OB8A 2WWUA 5JOYA 2DCTA 2PY5A 1OVPA 5F2VO 2WFF2 1YQ6A 2GV9A 4RQPB 2A3QA 5FO7B 3QLQA 4UB8Z 3J8F1 1F35A 2DCZA 2AENA 1O91A 3SLIA 3CJIC 1WB8A 3V0BB 5DECA 4UCVA 3SPJA 2B9VA 5A3OA 1HN1A 2ZHMA 1HJGA 1G9CA 4IYHA 3B01A 4YM0A 4EE2A 3ZMUA 1SQGA 1GMMA 1OCCB 2IXKA 4IE5A 1UY2A 1KQRA 5J2TB 3SPHA 4KWKA 3I59A 4P9XA 1NX9A 1GR3A 2B1IA 2C9KA 1YTFB 2ZKNA 4KBBA 1QF3A 3X2QB 5EJ1B 4J1XA 4E9KA 5LP6A 2LROA 4FPOB 1RUF2 1ZZ7A 4UB6Z 1D4VB 1GTOA 3VDAA 3C2UA 4K3AA 4J11A 1QGLA 3LD8A 4XJ9A 1FD9A 3BABA 1PMHX 3FHIB 5JVDB 3JCUZ 2WBKA 1TVGA 2LW8A 2EZPA 1VBD1 2Q8DA 1A8DA 4IEWA 2K9ZA 1LOGA 3E5QA 3C3VA 1VAMA 1VBB3 3IDBB 4H33A 3N4MA 2P6JA 4IUGA 4CU6A 4H3WA 4OYUA 4KG8A 5JSRA 3RG0A 3KGLA 2YIBA 1NH2D 1AJQA 1CPMA 3OYWA 4MGSA 2FMDA 3TN93 5TISZ 2EA7A 1OFSA 3WP4A 1WCDJ 1VQ6V 2XHNA 4XFHA 1RL3A 3PL0A 5B2GB 1JXNA 1PM7A 1F5JA 5E6HA 4DRXA 4F6RA 1FAYA 3IDCB 2BNNA 4LHSA 5AVAA 4N7IA 2JS5A 2FDKA 4AQ2A 4OCTA 1XDCA 4FCAA 1N0NA 4AEDB 2X0LA 3WNLA 4LWSA 3OD0A 2HP8A 3E8HA 1V6JA 3IDAA 3NNMA 5BNOA 4XE9A 1QQP1 2YUAA 1CX1A 2A1XA 4QKFA 1G6UA 4P2ZA 3AZWA 1VBD3 2XJTA 5CBFA 2A71A 4M3CE 2HJIA 5HCFA 4N43A 3ZEDA 4QB6A 3R6SA 1CZSA 1CAXB 3T1YB 5EWSA 2HWC1 5CISA 1AILA 2BCCH 1NLRA 2RS31 5LEJA 3S5AA 3UT5B 4PV1B 4LFBO 3OW2U 4UBGA 2DTYA 4DV5B 1BHBA 3CYOA 4NAMA 1NOVA 4JQRA 4M3CB 3C3TA 4DV0O 4R9BA 1UYZA 2YROA 3M2MA 1WLTA 2Q0AA 2GU9A 1S2EA 3VBFC 5B3SC 1N1TA 5JSOA 1S76D 1DQ1A 2ATKC 3P1IA 1WB7A 2AEYA 2VWKA 1Y9MA 2RM22 2IJJA 3DPRB 1H8TB 3ASNC 1JTZX 3S0MA 2F4LA 1M57B 4CCDA 1R3LC 5KR7A 1Y67A 2QZ2A 4XF9A 3FUOA 4A42A 4ZONA 1QQP3 1DGRA 3WNPA 2YC0A 3LPGA 4QX3A 1UYXA 1XMOB 1XL6A 3MDSA 1VBA3 4MXWB 3B93A 2GSYA 2QVSB 2ZQMA 3ZCCA 1RXFA 3I4IA 5FZBA 1ENRA 4NIHA 4ZZ5A 1QVFU 3IC7A 3H1YA 4Q4V1 3E35A 3ZM8A 3ZR5A 5FJKA 3TEZA 4BLIA 3E6CC 2X8KA 1IBMO 1XPWA 1L0LH 2HVJC 4TZDA 4FXGB 5FMCA 2B4KA 3G4SV 4CS4A 3T2MA 1LUWA 1LU1A 1EP0A 5AG2A 3P3PA 5ITZA 1LR1A 4E2GA 4LORA 1TMF1 5J7MA 4F3JA 2GMMA 4QU2A 4Y3OA 2WWJA 3WF3A 1HX6A 3CCUV 4QQHA 2J7MA 1EAH1 2EIGA 5LMNO 2VNOA 2YXYA 3HPLC 4YM3A 3KWVA 3LFMA 4U7OA 2IJKA 3T30A 1WCKA 3I97A 4XF4A 5D8AA 5KHKA 3MIFA 3ZLIA 1A78A 1KD1W 3OUJA 1H2LA 1XI1A 3ZYIB 4OHVA 3F2ZA 3NNFA 5FZGA 2VZTA 5LA9A 1AYN3 3A4UA 4C91A 3EYPA 2N04A 4OX9B 1VF7A 4Q4V3 2FZ2A 3IPVB 2OTJV 2W92A 3ZN6B 4TYSA 3BVCA 4O4IA 3I2KA 5FAXA 4ATEA 2W5FA 3K0GA 3MV01 1W9WA 4AFMA 5ACA3 5IWAO 4DR5B 3SQOA 2ZCWA 4Z2WA 4O4LA 2H6CA 1UU4A 1MS5A 1GU3A 1S0CA 1KFXL 3FLPA 1C8NA 4Y33A 3H3UA 3AL5A 1JZ5A 1W2UA 2J42A 4NXMO 3L73H 2HWE3 2WNVC 1LESA 4DFSA 3FYEB 1GOHA 2OUJA 1VBC1 1LENA 2BVBA 3MW4A 3POJA 4X1YA 2VZVA 3WINE 4YZ5A 5HV4A 3HPNA 3L72H 2QZ3A 4FQZA 5I0DA 1RVF1 4EZ4A 3AKQA 1ND2C 2C2AA 1RPRA 4DNYA 4YIPA 2YYOA 4BU2A 4D94A 5LA0A 4FPCA 2HLDG 2VAUA 4LUMA 2XVKA 4EB6A 4K9SA 3JBG1 5F3GA 3E6DA 2B8MA 4B29A 3ZHSA 4N21A 2VM9A 5BZBA 4DUZO 2EAAA 1N0JA 1NA1C 4Q29A 1QHDA 2PTMA 2VJXA 2ET7A 3MIGA 4RR3B 2YXHA 4YWAA 1ROPA 3WDTA 3RGBA 4JGYC 1E5SA 3U4SA 4HN1A 3GZTB 1Y74B 3R0RA 4AF9A 3WFVA