4D7SA

Structure of the sthk carboxy-terminal region in complex with cgmp
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEIAAQIQELAVRRKEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STHK_CNBD_CGMP
publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
total genus 58
structure length 197
sequence length 197
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7sA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7sA02
3E97A 3H3UA 2H0VA 3KMHA 1O5LA 3NL1A 4HN0A 3H1YA 2Y0OA 4I0BA 4DINB 5BPXA 2Q1ZB 3U10A 1DGRA 3E5QA 4E2QA 4IEPA 2QJVA 5LRSA 4META 3DL3A 3HQXA 1I5ZA 4IEXA 4QMAA 5C6CA 4IEVA 4PIYA 4E2GA 2PAMA 2HKXA 3LOIA 4IETA 2F4PA 2PAEA 5JR7B 2BNMA 4AVBA 1ZRCA 3SMHA 2BGCA 4IEWA 4UBHA 2IXLA 4IERA 3I7DA 4BYYA 2HJIA 4FBFA 2MNGA 1H1MA 1O3TA 1LR5A 2Q4SA 4EWEA 4I0AA 1ZRFA 2K0GA 2QDRA 5I0TA 4HSJA 2XL9A 3QOPA 3S7EA 3ZDSA 2O8QA 3OF1A 2EA7A 4RD7A 2XL7A 1WLTA 1IPKA 1YWKA 1O3SA 1RUNA 5CVRA 3IBMA 2PHDA 3SCHA 1UIKA 1Q3EA 4HVRA 4HBNA 4MX3A 3H1MA 3KGZA 5KHHA 5AVPA 3M3IA 1YFYA 2EAAA 4AQ2A 3I59B 1L3JA 2WFPA 3EQEA 3JZVA 4ZU4A 3ROUA 3UKVA 1CAUA 5I0UA 1OMIA 3NJZA 1X7NA 2GC0A 4MGKE 2PA7A 3FX3A 3ST7A 3CJXA 1SEFA 1NXMA 4AVAA 2MHFA 3SCGA 2Z2SB 4FT8A 1U12A 4ZU7A 3O14A 4WBBA 5JCTA 3N4MA 1XRUA 4QX5A 1X8MA 3BPZA 1ZNPA 4QM8A 3RPQA 1DGWA 3D0SA 3SXWA 1CAUB 4LUKA 4XFCA 4YRDA 3DKWA 2IXCA 4I01A 4OLLA 1CAXB 3GBFA 1WGPA 2DCTA 1QXJA 4N9IA 1VP6A 2VECA 1Y9QA 1J3PA 3UKNA 4MUVA 2FMYA 3S0MA 3KGLA 3E6DA 4Q0QA 4WVZA 2ET7A 4J1WA 3OCPA 1DZRA 1PM7A 3PVBB 5I8SA 2PAKA 2ZKLA 3MDPA 1UW8A 2PHLA 1VR3A 1DZTA 4HZFA 4I3PA 3WW3A 3LA2A 3RDIA 4Q29A 3I54A 2P17A 3IDCB 2VPVA 3FWEA 4E2SA 4XFBA 4XF0A 1O3RA 2UYAA 1ZX5A 4OFGA 1SFNA 2QCSB 3D82A 1OD5A 3MPBA 2GC1A 1UPIA 1FT9A 2BEOA 2PQQA 1QXRA 1G6NA 2GZWA 1LRHA 2BYVE 3IIAA 3LA3A 4MGZE 2GC2A 1EPZA 3H50A 3HIFA 4Q0UA 4XFHA 3H8UA 4QGMA 5BUVA 5JSRA 1CGPA 5KHIA 4BH9A 4Q0PA 4PIZA 1ZZ8A 4PJYA 4QM9A 1YHFA 2IXHA 3LAGA 3GYDA 4X6QB 3VHRA 4UXAA 4FAGA 5KHKA 4YYOA 1YFWA 5LEJA 3MZHA 5I0SA 3CEWA 4AXOA 4D7TA 4MGIE 3NSTA 1RTVA 3KSCA 1RL3A 3CLPA 4IEOA 3E5XA 1OFNA 4F7ZA 5I8YA 4IEYA 1WA4A 5EFUA 3BALA 3D0JA 1RC6A 4LLOA 5KHGA 2WC2A 1GQHA 3OGJA 4KWKA 5FQ0A 2XLAA 3PLQA 4YNIA 1X8EA 1Q43A 4I02A 1EYBA 4GULA 2H6BA 5I93A 3DN7A 3FZ3A 5J48A 1ZZBA 2D40A 2VQAA 2D5HA 3ELNA 4Q0VA 1O4TA 1I6XA 2GH2A 1XE7A 2B9UA 3EBRA 1GQGA 3H1WA 2Q30A 4XFFA 2BNOA 1QY4A 3WW1A 5KHJA 1JUHA 2O1QA 1ZREA 1ZVFA 4H7LA 2C0ZA 2XKPA 1XE8A 3CF6E 4P9GA 2FQPA 1EY2A 1NZCA 4ONUA 1Q5OA 4LUMA 4F8AA 1FXZA 4IESA 2OZJA 3IDBB 4L11A 3BU7A 5I91A 3R6SA 5BY5A 2UY8A 4K8FA 3NVCA 4LA2A 1FI2A 1RUOA 4NVPA 2XGXA 4XEZA 1PMIA 2ET1A 1J3RA 4MGYE 4ORFA 3BCWA 1UIJA 1TQ5A 5BV6A 4XFAA 3ACLA 3H3ZA 2BNNA 5E16A 4XF4A 4JVAA 3G7DA 4Q0SA 2H6CA 4BIFA 5FLJA 1X82A 3OD0A 4UBGA 3H7JA 2PFWA 4LA3A 1Y3TA 4J1XA 1ZZ6A 3LWCA 2OPKA 4EWDA 1NE6A 3SHRA 5LEKA 4KWJA 1RGSA 4HSLA 1UD1A 4A2UA 1ZRRA 4Z82A 3WW4A 4BHPA 3DV8A 1ZZCA 4TLFA 3MYXA 2XLGA 2QVSB 4LEJA 4AVCA 5FLHA 2K9ZA 3CO2A 3B02A 4XETA 2N7GA 3RYRA 3IWZA 3OTFA 2XLFA 1CAWA 3U0ZA 3ETQA 3ES4A 2CAUA 3EJKA 1UCXA 4YARA 5KBFA 4XFIA 4O9GA 3NW4A 5CU1A 2XHKA 2Q0AA 5F1RA 3H9AA 4KWLA 4WZCA 3CL1A 5I0RA 4XF3A 1VJ2A 3L2HA 1YFUA 4JTNA 5J7MA 3PNAA 1CAWB 3FFQA 4MH0E 3HT1A 2D5FA 3USSA 5FPXA 4O9EA 5FPZA 2PYTA 2OA2A 2B5HA 1NE4A 5CADA 2QNKA 3LZZA 5JSPA 3SCFA 2UYBA 4HVOA 3RZZA 2D93A 4JV4A 2GAUA 4LULA 5FLIA 3I59A 3RNSA 5EZWA 2CAVA 1J59A 4KU8A 2IXKA 2CGPA 4MZUA 3UKTA 4XF9A 4I09A 1CAVA 3U11A 2EVXA 2GU9A 5C8WA 4X6RB 4IEQA 4XFGA 1J1LA 1V70A 1QWRA 2ATFA 5FQ0B 2IXIA 4R52A 4CYDA 5LRRA 2OYZA 1YLLA 2KXLA 2IC1A 5I8TA 1ZZ7A 1YUDA 4HLTA 4EWAA 5K8SA 1ZZ9A 2V09A 4XF1A 5JAXA 4L2NA 4HN1A 5D1IA 4IEZA 1OI6A 4MV2A 3RYKA 1CAVB 4JTOA 1NYWA 5T3NA 1CAXA 3QACA 1SQ4A 3S7IA 3NKTA 2UY9A 2Z69A 3E6BA 5FDBA 3M70A 1LB2A 4AQ6A 1J58A 3C3VA 3EO6A 1J3QA 4QGLA 4EROA 2I45A 5BXXA 3LA7A 1CX4A 4PIXA 4LTAA 4B29A 1O3QA 3TNQA 2ETEA 3EHKA 5HI0A 4R8HA 3ES1A 3E5UA 4D7SA 4HMZA 5J3UA 3H7YA 4EV0A 3KCCA 4KU7A 5FCCA 4N9HA 3FJSA 2GC3A 3FHIB 1HW5A 2B8MA 1IPJA 2XKOA 3BB6A 3WW2A 2MPFA 1YFXA 1LKNA 5E1RA 2ZCWA 4Z07A 3HT2A 3RYPA 2CV6A 4QGNA 2PTMA 3FE5A 2IXJA 4ZU5A 1O5UA 1H1IA 3TNPB 4FAHA 1O7FA 5JSOA 3E6CC 1ZRDA 4I2OA 1EP0A 4KL1A 4QXKA 2OZ6A 4YSFA 4HVQA 4IEUA 2E9QA
chains in the Genus database with same CATH superfamily
4CCCA 4KG8A 3H9VA 5LBBA 2A6VA 5B1BB 4JYCA 4DV0B 1OQDA 1M06G 1W6OB 1H2MA 3KG2A 1D2DA 3FUQA 3ZYIB 4IETA 5A6QA 5HFMA 1U5IA 4S2FA 5L3BA 1H8HG 4LITA 4JI2O 2GNMA 2YV8A 3FUOA 1I5PA 4GD4A 2ZEYA 3I2GA 1ZRFA 3INAA 2E75B 1AJQA 2YXSA 3WG1A 4YW6A 2XL9A 3MLJA 1FPOA 3DYOA 3TN93 1RUNA 4O2AA 5B1AB 4U3JA 5L7OC 4YW2A 3TEYA 1MS4A 5BNNB 2IJIA 5KR7A 4C1WA 4Q4X1 2HLEA 5JQGB 1PIV3 1H6YA 2YXYA 2PYLA 3AK2A 5KAIZ 5CKQA 4JKKA 4NXMB 4P08A 3MIBA 3IN9A 4BZ4A 5IVJA 1MSDA 5KXEA 1U12A 2A5ZA 1IDSA 3JD1A 3UK9A 3U07A 5EZYB 4FPYA 4JI8O 3MUZ1 5LBCA 4B3RB 4FLYA 1PPJH 3WG7C 4GX5A 2GMPA 3M8LA 3ZRSA 5BNOC 2TUNA 4OPAA 4NHMA 1OCCC 1WGPA 4LF9O 4OULA 2GMMA 5HBAA 1L7RA 4Y3OA 1J3PA 4FOQA 1XL6A 2Q8OA 1HXS3 5EBMC 3LOBA 2XJTA 2E6VA 1LCLA 2EICA 1IBLO 1NQJA 5IJ9B 3GBGA 4GXLA 3I54A 4Q4Y2 3MHHC 1KQRA 4KUMA 4FO9A 5JJJB 1ZBE3 3U75A 5FKCA 1W9SA 1K73W 1OOPB 4FMTA 2X6BA 1QVGU 1AJKA 1IS3A 2VNOA 3JQWA 4DRXB 3I2DA 3EB7A 5L7OA 1ENVA 2ARXA 1OBNA 4A45A 1Z7S1 1AR83 5BUVA 1OVSA 1BJQA 3OBAA 4BH9A 1ZZ8A 2PELA 2W1SA 2WN2A 4JDNA 2AACA 2WSSG 3B5LB 3VHRA 1YFWA 5DXDA 3T2OA 3CEWA 4AR2A 3NSTA 2W47A 1EM1A 2YFZA 4GMP0 4DV0O 2JDHA 3T0AA 2B5UA 2OUHA 3MLLA 1YXBA 3SPCA 5IT6A 3MV01 4YNIA 5I93A 3DN7A 4BXSV 4RUEA 5J48A 3I49A 1KXGA 2NN4A 1W6NA 3WD5A 3ECQA 4DXWA 3TCUA 2OPWA 5DDJ3 2O1QA 4ZKIA 4BB3A 2Q4PA 3NR7A 1YVWA 3CF6E 2RS52 2WO1A 4BWAA 1FXZA 3IDBB 2QJ1A 3GGLA 1SF9A 1CPYA 5LBFA 2EALA 3VL9A 2VQUA 1U5YA 1LHNA 4NXMO 4CUGA 3ZRWA 5FLJA 3IAYA 3W58A 3WG3A 1XYNA 5IY5B 2QKAA 4WBNB 4YHHB 3E8BA 4S2DA 3OR7C 3HPLC 2NLJC 2VVDA 5T5OA 4HL0A 3V56A 3CO2A 1R3LC 4RQPA 5FUIA 3NV2A 3B4SA 3PUAA 1REEA 1O4YA 4BLIA 4GX2A 4ASKA 1BBT2 2DCJA 3JAMN 2BU9A 4D6TH 4JTNA 3N9MA 2WSVA 2WBKA 3RYIA 1RMU2 2JG8B 4UW6A 2HWE1 2JD9A 1DTOA 4LK7A 3KQ4B 2B5HA 1B04A 3ZFEB 1W9TA 3CRMA 4MT8A 2ADPA 5GONB 2BUKA 4LO6B 4J42A 3NRUA 1JUIA 2EVXA 2RJLA 1XNDA 4NOTA 5KC5A 2ATFA 4CYDA 4QD2A 1HX6A 3ABLC 4NMIA 1DZQA 1ULDA 4OUEA 2RHPA 2RE9A 4HLTA 3RZKA 2DWEC 5GZDA 3R4DB 4P14A 3HOBA 4WM7B 1OI6A 2OXBA 1W0NA 1PM4A 2DV9A 2P1BA 3VKNA 1GOGA 1IKQA 4EB6A 5K1PA 4QX1A 4DV2B 4JKMA 1PGW2 5FXXA 2WZEA 3JSNA 4DR2B 1RIRA 3HNYM 1P8JA 1FPN3 3ML0A 4XJ9A 1FAFA 2WLIB 4LHKA 1RUI3 2QQUA 3N7LA 5LA6B 1PVC3 1QH6A 2LW8A 2B8MA 4EFEA 1DQ6A 1ND3A 1YEWA 1SKVA 3I3DA 1TME2 2JEUA 3HAGA 4ZZ5A 1ENQA 4O4JA 3WDUA 5EC1C 1GKFA 3CJHA 1V9U3 4L97A 2OZ6A 3R05A 3E97A 5FZ7A 5B4XA 1QOOA 1TMF1 2Q1ZB 4YHHO 4P5YA 1MS3A 3VBSB 1Q86W 3AEIA 3ZXEA 1D7PM 5C6CA 1QOSA 1FJGB 5ACA2 2R043 4GX1A 1UQXA 5JR7B 2UXCB 4IEWA 1OZ0A 4YG3A 4EKWA 2P4KA 2D3OW 2IXLA 4IERA 5FYZA 3I7DA 4FBFA 4H14A 3VBHC 2QSAA 4JTAB 4EWEA 4P5HA 3H3LA 2QDRA 3I8TA 2YYOA 2XPJA 2IH3C 2IVIB 2VMHA 4UW4A 2VH9A 1IPKA 4BQ3A 3P5BA 5CVRA 1VQOV 4XXPA 1UO9A 3J26N 3AG4C 1N3OA 3VBOB 1NH2D 2LQTA 5KHHA 1R6TA 4M0HA 4ES9A 1XOYA 5L19A 1K92A 1WLDA 4QQOA 1CAUA 3L73H 1OD3A 3EVKA 2RR13 3ST7A 4MHRA 1JH5A 4NHXA 1G9AA 2LALA 3UQ8A 4D7YA 3ZHSA 3JB8A 5H9RA 1S0CA 2HEYF 3AG1C 5JCOA 1HRI2 4XFCA 4YZ2A 5GZCA 2Y6LA 4CEWA 4QU2A 2JKBA 3KD4A 4Y1VA 3DPRC 3WNXA 1DGLA 4BIZA 3O1TA 3S0MA 5FO9B 3G6JB 3OCPA 5FZOA 2WL1A 2RVAA 5LASA 3D8CA 4DV2O 1SBDA 4QPIB 4UCRA 4DR2O 3N9NA 4CCMA 4D94A 3FB6C 5JJEB 1QLEB 2AEYA 2YI9A 3FWEA 4URAA 4AI2A 3AVSA 3ZS8C 1ZX5A 1NY71 2HWB1 1C8M1 3JD2A 4YLZA 5FNVA 3B09A 1FT9A 2R061 3POSA 2ZGMA 1QHDA 4RR3A 5D5PA 2VUCA 4XQ4A 1F31A 2WT2A 1SZXA 1UU5A 2R7EB 4Q0PA 4IV3C 3HKCB 4FAGA 4UXAA 1LEDA 5LEJA 5I0SA 1HRV1 2WNEA 2J1VA 1W2UA 2VC9A 1EV12 4LIUA 1R092 2WQZC 4ZOLA 3H8XA 4QPGC 3KHCA 4JRLA 2XLAA 1Y4MA 4C1XA 1FJGO 5DUXA 3ASNB 2GMEA 3BFRA 5HXMA 4L92A 3CJIA 5FYYA 2UXCO 1A3KA 1W59A 2W6IG 1XE7A 1XYOA 3NNLA 1F23A 2ZR3A 4J7ZA 4YJ2B 2AHZA 3K59A 4DV7B 3SYCA 1JI6A 4CVUA 2X7RB 4N7IA 5L73A 2KQXA 1HV0A 2X10A 4QX0A 5C7GA 3BU7A 1U97A 4K8FA 4L0PA 2OS2A 5EHDA 3TBDA 3NXSA 5D5QA 1URXA 2XGXA 4UFJA 4OHVA 2G9GA 2J1RA 4U36A 1CJDA 4ZXEA 1ZYBA 5IYDO 3W7UA 2JDZA 3JALA 4DUZB 3N7MA 5HCFA 1LESA 4UBGA 4BWOA 1QXPA 1GFF2 1ZZ6A 4XURA 2CUGA 1XNCA 1RGSA 3RG0A 1LENA 2F6BA 4BHPA 1MACA 3TN91 3BU0A 3ZFGA 5FXVA 4DUYB 3ETQA 4LK6A 3BKZA 1W2NA 3EJKA 2V1DA 4B8EA 5FP3A 1PIV1 4KNCA 3NW4A 3LEMA 4CDXB 4GJZA 4EN6B 1D0GA 3H9AA 2WT1A 1UPGA 3VDDA 4X9QA 3BPSA 2ZHLA 3OOXA 1N0JA 2P6JA 5FPXA 4QXBA 2BSKA 4N53C 4UFLA 1U0AA 3LZZA 1P49A 2VOTA 3LGRA 2E31A 3I59A 4N90A 1VBD2 4DO0A 1BL8A 1HXS1 2DU1A 4YGEA 3K03A 3OEBA 5C8WA 4BQ5A 1NVPB 3WY6A 1XUQA 4Y1UA 5KAFZ 3AG3C 1ASJ2 1JOJA 5EPAA 4K1YA 1ZBE1 3VKMA 1SPPA 5T3NA 2EULA 4N21A 3LNNA 1PMJX 4L87A 4CDWC 4DK0A 4U2AA 1HQLA 1PL4A 3DXRA 5A9GA 3R65A 2Y26A 4DEQA 4P9YA 4DV7O 4QGLA 1AR81 2ZXQA 1ULCA 1JCHA 3AMQA 4MYEA 1CX4A 5CG8A 3ENRA 4JI6B 1Q56A 3PVEA 4LF8B 5J96B 2IJHA 4E4EA 1S72V 2ITDC 1VBC1 2WZR2 2ATKC 1HJGA 5E1AC 1DQ5A 5K0UB 4ZI7A 4I9WA 4BIOA 4L8JA 2R9IA 2YC4A 1UNBA 2NN8A 3CC7V 3HT2A 2CV6A 3UO2A 1RUH2 4LBOA 4B08A 4DUZO 3LSSA 5CB4A 1FNZA 5FY9A 4Y20A 4HVQA 4GQ7A 3P6BA 2N04A 3LPGA 1Y66A 5EK0A 2N05A 2Y0OA 4X66B 3BEHA 4J11A 2V4VA 4ASMB 3T4HB 5C3QA 4JI0B 3E8HA 4JKLA 3V0AA 3U4XA 2R30A 3MW4A 2NM1A 2PAMA 5JWPA 1PNFA 3KB5A 1AR63 3AYEA 1NCRB 4O4LA 1SQBH 4XAAA 3Q4HA 3OD4A 3B8MA 3C3TA 4UCVA 2XWBB 1IOAA 4MS2A 5GZEA 4AHXA 4QKFA 2IU3A 4O4HA 4I0AA 4AAPA 1DP0A 3AKRA 5A2QN 2LJ2A 3DECA 2DUPA 1UWWA 4AHWA 2ZA9A 3OMNB 2JD4A 2PHDA 1KRIA 4IGGA 1Q7YW 1ND2B 4MX3A 4P02B 1L7QA 2ZGUA 2Y34A 5HPOA 5A7PA 2LP7A 3HQUA 4MVTA 2WNVA 4DXSA 1VEWA 3ON7A 3IKWA 1YNAA 1W2AX 4XQDA 2VY0A 2B9VA 1XMQB 3FLRA 5T5PA 5JCTA 1BKZA 5JI7A 3D3AA 3NNGA 5JZGA 1ULOA 4QHOA 3K9SA 1YJNV 4A6SA 4CS3A 3QVNA 1ZAUA 3AL6A 5FK7A 4K21A 2XVGA 5A3PA 5FIXA 3CIHA 4J1WA 4DEVA 1C1LA 1JHJA 3SPJA 1RUG1 1QJY2 5IK7A 1B6QA 1SLCA 3WW3A 4PLNA 4JI6O 4Y22B 4LF8O 3OBZA 4JI1B 2A6XA 3ACFA 2Y0IA 2Z4FA 5FZBA 1VBE3 1ORQC 1SFPA 5GKAC 1JU4A 2R9AA 4YGBA 4MTGA 4XBNA 5LBEA 1BEV2 2BGPA 3HBZA 1BLZA 5K1XA 4QGMA 5KHIA 5KUKA 3IMNA 1PX3A 4TV9A 3GYDA 3J81N 5FZ0A 1UPSA 4FTSA 1B06A 2QZ3A 4X66O 2V73A 4F7ZA 5IE9A 1T6GC 1THZA 3D0JA 4YVSC 1QBZA 4JI0O 3MW2A 1FPN1 4AILC 2VCBA 4H55A 3OGJA 1VBB3 4QQLA 4YIOA 3PLQA 1WCQA 4AVSA 4E4HA 3POJA 1RUI1 4P9IA 3ELNA 1WA8A 4A6OA 3RYHA 2ZM6B 4Q0VA 2CDYA 5FYMA 5C8CC 1FFXB 2FCUA 5ABJC 2VMIA 3WEZA 4GZRB 3T0BA 1V9U1 2HJDA 1US2A 4ONUA 3PMSA 1PK6C 1NJIW 1PO12 1M4WA 2HJFC 4QX7A 2BDRA 4PDRA 1GZCA 4COUA 5A1FA 4A3ZA 4LE4A 2UU9B 4MGYE 4BPZA 2WPDG 1TQ5A 3LE0A 4FLUA 2EIEA 1BS3A 1XMQO 2BNNA 2BV4A 1J1TA 4FQZA 3K5LA 3ZMSA 4LA3A 1LOFC 4NPLA 3QCWA 3MIFA 3M99B 2JDNA 4KWJA 4TLGA 1JFFA 4MVRA 3ZN1A 5IYZB 5FY5A 4A44A 1R6NA 3RWRD 2E32A 4M3CB 3AFGA 3I2FA 1XHXA 2VMFA 4GIQA 4JI4B 4OI4A 2EIMB 2BZDA 5LOVA 2F4LA 4YVSA 1FOD3 1HB1A 1Q8IA 3CC4V 1WLCA 4I30A 3W59A 2RR11 5I0RA 3OBRA 1KP2A 3L70H 5KLVH 3K2OA 3CWBH 4JI1O 3RYFB 3C7EA 5IFPA 3E89A 1JYIA 5DAPA 5ABJA 3HT1A 3BRCA 3VOUA 1WCDJ 4TSFG 2VR4A 4LBJA 2HLDG 2DYRC 2JDKA 5A7WA 3JUUA 4LE3A 5IHRA 1WD4A 3RYCB 3RNSA 2FL4A 1RJ7A 4YM2A 1UYYA 2VZTA 1R083 3SJBC 1WKYA 1WBFA 1YLLA 3HQRA 2Q67A 1ZZ7A 3QG5A 3G6BA 1ZZ9A 2RMU3 5FO7B 5T52A 5LK7B 2RM23 2D3RA 4X1KA 5BZBA 3ZXLA 2A75A 2ZM6O 3D4KA 4UFKA 2QQOA 4EN7B 4OHWA 1CPMA 2NYYA 4DV5B 3K4AA 2ZGLA 1ZSPA 2XJPA 3K48A 4DV3O 2X53S 3J4UH 5IAXA 5LBQA 2VBDA 3ABUA 3VL8A 4ABMA 3FJSA 2YIDA 3THCA 3BB6A 3WP3A 1W6QB 1NX9A 4OCTA 2UU9O 1NA1C 3AZVA 2LS6A 1MG1A 1HN0A 3L74H 3FE5A 1DDLA 4XBFA 3ZYJB 4NIHA 4PDLA 4IEUA 4F4LA 1PP9H 2XB6C 3M7MX 2BWCA 2DCYA 3ZJZA 3N27A 5DQ0A 2VXJA 1NVPD 4LO7A 2ZQMA 4UOJA 3VKLA 1WAZA 1K5MA 4QQHA 5LHHA 5FY8A 4QMAA 4JI4O 4YM3A 3O1PA 2WYFA 5K7PA 5EIYB 5L36A 3SMHA 1VARA 5FPOA 3SISA 4LFCO 2PHRA 3R4UA 3CX5F 2C9AA 3SYQA 2Q68A 1OJHA 1DF4A 1A8DA 1TNFA 5AFBA 1UZZA 2H94A 5FY0A 1NI8A 3GNEA 2YY1A 5CN0A 3APBA 1WB8A 1KD1W 2EXJA 1AR72 2DYCA 2GNDA 4EN0A 4DIQA 3J8F3 2YU1A 3UKVA 1G9CA 4JPRA 1X7NA 4J9ZB 3NAPB 4X1YB 4N23A 1LHOA 5BNPC 2KG7A 1ZTEA 3SCGA 4RQFA 2VUAA 2D7FA 2V72A 3OTOB 3LDKA 5J1XA 1IHMA 4DFSA 3CCVV 4MADA 1FXKB 5C71A 2QQIA 5FOBB 4AHCA 1GBGA 3M2MA 5HXVA 3JBG3 1VP6A 4YZ4A 2FMYA 3KGLA 4B3TB 3RT3C 4IV1A 2YGLA 2D6OX 2ZKLA 5A1AA 1UW8A 1D4M3 1US3A 4DV5O 3ZFFB 1WZXA 4AI3A 2CY6A 2HEVF 4M0NA 4LXLA 3OPTA 1ZBA3 2EINB 1AI4A 4XACA 5EJ3A 5C4WB 5FZGA 2YXLA 3ZN6A 1DLBA 3N2GB 2A71A 3MPBA 5JI9A 4OUSA 3VHPA 1AP6A 1S5HC 1F8VA 5EBWC 5FZ1A 4Q4V2 3ABMB 4MGZE 2GC2A 3VBRB 5JVVA 4AGRA 3IGAC 1RUC3 3HIFA 3KLSA 3O1RA 1IXBA 4XDPA 1YHFA 5T5LA 5CIRA 3KV6A 3GVMA 5FO8B 2RQ6A 2YUEA 2JEMA 4AYUA 3ABKB 1OFNA 4INDA 3VBFC 4H13B 5EFUA 3LPFA 4PT6A 5BNPA 4NUBA 5FQ0A 1H2KA 1MVEA 3JD73 5LMNB 4YFWA 3V64A 2XHNA 3RRDA 3QLQA 2VOWA 2OUJA 1C5HA 4TXWA 3PUIA 1RUE2 1GTOA 1QKQA 1WMDA 3OPZA 2FB5A 3UJOA 2XT9A 3OMIB 1O8SA 2ZGPA 5LP6C 2VZSA 1VF7A 2W08A 1K7DA 1WP7A 4CDQA 1H8VA 3U78A 4XVHA 4F8AA 2HG5C 2JEXA 3WR0A 5BMVB 2FYUH 3OGSA 1OHFA 4YJ3B 3BCWA 4QPYA 3DYMA 4G9SB 3KT4A 1AR61 4K3AA 4WV8A 1K5JA 4COWA 4JI3B 1PO22 1LGNA 3OUSA 3FMGA 3OTOO 2WUHA 4BQ4A 4GH4C 3IT8A 1RXGA 1S0JA 3ZPOA 1W6MA 1FYJA 4XMAA 2P3JA 2JE7A 2E5LB 1CAWA 3BGAA 2PHWA 3WNNA 2PZSA 2W68A 5F2SA 2ZABA 4Y1ZA 4K40A 1JPXA 4Q6GA 5F9TA 1PGL1 3N2KB 1CWPA 3W5NA 2LFRA 4Q4W3 5A3LA 4XF3A 5KA6A 3KF5A 4YWAA 2BTOA 1NAEA 3CKHA 2VMGA 4YVWB 5CA0B 3AFKA 1Y74A 3IPVB 2P22C 4MGTA 2Y33A 2UYBA 2WO2A 3LUTB 3GCWA 1E5RA 3HPNA 1LOEA 3CCQV 3O7OA 1MZ5A 2CL2A 3O1SA 4PD4F 3VZNA 4QKDA 2E63A 2RS11 5B1AC 5BNNC 5FMCA 5LMNO 1QNMA 4KXRA 2EJ7A 4OQ8A 1VBE1 2ZR2A 3JARB 1MQTB 1EAH2 4LF5B 2H0BA 3K4ZA 5IK8A 3S7IA 3MF9A 4AAXA 4X20B 1HWYA 3E6BA 3AK3A 4QQ2A 3D3IA 4XCAA 3LA7A 3SPGA 3LB9A 2AHYA 2EJRA 2QQJA 1S2KA 3I2HA 4AFCA 3HR9A 1IPJA 2WN3A 2WZPP 3MEPA 1V00A 4RWUA 2A6ZA 5LY2A 4A41A 1AYM2 1DQ4A 1W6OA 2C4XA 1STMA 2CDPA 2O0OA 2A70A 1DG6A 4R4ZA 1H1IA 4JI3O 1PHMA 1ZRDA 5IJ0B 4KL1A 3WXPA 3C3SA 1RYYA 2GUZA 2Q7GA 1GKBA 3LQCA 1OOPC 3LDRA 1I0HA 2DBIA 2R32A 2F95B 1RUF1 2PAEA 2E5LO 2HFEC 3FHQA 2BGCA 2DDUA 3VBHB 5DZEA 2ADDA 1UZ0A 1AL22 5BNNA 4IT5A 5LYJB 1VBA1 1JOBA 4UWDA 3K77A 2AH2A 4CXYA 3P30A 4FPHA 1AR92 4LH6A 1XNBA 2PHUA 2O8QA 3AVRA 1YWKA 4TV8B 1NS1A 1NR7A 1ONAA 5D8AB 2WFPA 2WFF3 3JZVA 2YDEA 1AP5A 4C7UA 2P7TC 1X50A 2D6MA 1FOD1 1IPSA 2DURA 3FAVA 3TJTA 3ZHRA 2ZMNA 4K35A 4QX5A 1CR7A 2PYJA 3FBYA 4J7KA 3GBFA 5G04L 5IJ9A 5GTHZ 2W95A 1WCUA 1DLCA 1G8WA 3B7MA 4LLFA 4GYCB 1JR9A 3UJQA 1OOPA 3PVBB 5EP9A 3OGRA 4DPNA 2WAOA 2AZ2A 3MBWA 4YFZA 1UJWB 1FX5A 4HZFA 3ETEA 4GMP3 1GM9A 4WFHA 3S3XA 3ZSJA 1VRH3 3SR2C 2WLPA 4BQ2A 4XAEA 5IY5C 1M5IA 1D0HA 5D21A 4ISRA 4GB33 2E7QA 4WVVA 5L3FA 2LM3A 3IC9A 1UPIA 1PKXA 2ZAHA 4RUFA 1H2SB 1EPZA 2RDSA 1AJNA 1CGPA 2YGMA 4OUMA 3OW2U 3WQ7A 2BFUL 5KHKA 4AXOA 2ZGNA 3MIDA 3P32A 1KITA 3AG7A 5C9AB 1UX7A 3E5XA 1JMUB 1Q8QA 3MHZA 4X64B 3KT7A 2JG8C 5HCAA 1R1A2 4AVVA 3QO7A 4XUNA 5FV3A 2ZE6A 1ZZBA 2D40A 3ZFEC 3C90A 5E88A 3JAWA 4RFRB 3H1WA 3AKSA 1UKGA 1J95A 2GN3A 2KM2A 4H7LA 1JS9A 2XKPA 1CQ9A 1XE8A 1O9GA 1KBHA 2QKCA 2D98A 2QA4V 4XZPA 2BRTA 2WQ4A 3HNBM 3KWVA 4NYKA 4AFMA 4Z8BA 1S0IA 2CH7B 3GBWA 4Y4RA 1RUOA 3Q8AA 4WM7C 4WBNA 2F17A 4AI8A 3LCPA 4XFAA 2P6HA 4ZHNA 4FFBA 3HMYA 5FWJA 4F6RB 4CUAA 1OKOA 2YS8A 4JRAA 4XJZA 1OCOB 1RUD3 1KU9A 4UT5A 1RPOA 4DV4B 1ZM1A 3OTFA 3NQHA 3C7OA 1LOAA 3NNJA 5LA2A 2ZGSA 3J8F1 4NWWA 2WS91 4H0LB 2Q0AA 4FLXA 4AI0A 2OIGA 2VJXA 2Z5WA 2FDIA 4EE2A 5GONA 3I2JA 3I2KA 4MHUA 3IAPA 3VBSC 4UV8A 2UXBO 3L2YA 3RMXA 4C90A 2X05A 5JMCA 2PYTA 1QJX2 3ACGA 3PVNA 1WUVA 2WZ8A 2VW1A 3OYWA 3JD3A 2X8KA 3O5SA 3TXQA 1KFUL 4Q26A 2XBO2 4WM7A 2HWD3 3PURA 1AF9A 3K9AA 3B77A 3PN1A 4LKFA 3QBQA 1XQ8A 2WNUB 1UOJA 1I94B 3GCXA 5DUUA 5JXJA 4X64O 2GTAA 3BUCA 2Y6KA 2OYZA 2KXLA 4PDWB 1VF5B 3VBOC 1UU6A 2AZ5A 4L2NA 4CDWB 1SBFA 1UOFA 1CAVB 2O14A 3D36C 2WLIA 1SQPH 1V0AA 4I50A 5AFEA 3ZYRA 2JS5A 4I4TB 5LA6A 4LKEA 1HIXA 2RS33 2I45A 4UB8Z 4B29A 4OZXA 2A9HA 1RINA 3THPA 1TME3 2YHJA 3T2PA 4C91A 4N9HA 5CFDB 3KQRA 2VTXA 3PDQA 2XKOA 3C2UA 3KCYA 4LO5B 1RHI2 3A0RA 4X1IA 3P3PA 3JD71 3VBSA 4JI5B 4MOAA 4A7ZA 2B9ZA 3OEHG 2ZEWA 4IE7A 4DYLA 2Y64A 2CE4A 4QPIC 2C1FA 4QXKA 1ROPA 4X8PA 2YC2A 1GNZA 3ZDVA 5TSWA 1QLEC 3LSUA 3TAYA 1DGRA 1TVKA 1MMMA 5LXTB 1MEC1 4X62B 4IEPA 4GCZA 3DKQA 1KJLA 2OX0A 4DV4O 2Q9LA 1F15A 4PIYA 4NIDA 4FCAA 4IE4A 3E35A 4BYYA 3VBOA 2P3IA 5F7UA 2WWSA 4QPJA 3D36A 1FMD3 4RHV2 2P5BA 3ITQA 4JGZB 3IBMA 4RYDA 3I5DA 4WF9V 4DXZA 5CG9A 3UCSC 3SPIA 3T0DA 1US6A 2R1BA 5DAVA 3ASNC 4JYBA 4RSUA 4GWJA 4B4PA 3T1HB 4LT5A 1C8M2 1TVGA 1V6JA 1OH4A 3ZYGA 4JGYA 4PA3A 1AI6A 5KUMA 1UZVA 5EYPB 4TQDA 3ETGA 1X9PA 4QIWF 4EZ4A 3CMAV 4TZDA 2W92A 2EX3A 2K9PA 1I94O 4QM8A 4Q4W1 1DGWA 4O4IB 3GHMA 4LUKA 4X8NA 1OLQA 4QPIA 4YRDA 4EYUA 3HKBB 2X6AA 5LGTA 3HKDB 4QXCA 2HP8A 3S5QA 2V4AA 1COV1 3CDZB 3CU7A 5FZ9A 4LFAB 3FBMA 3PL0A 3FC0A 5TISZ 3CRQA 2RG4A 4AFAA 1VIWB 3PIJA 2Y4UA 2JB8A 4JAUA 1F4HA 2BGOA 4OI1A 4DR6B 1V6NA 2KKWA 3RDIA 2RJ2A 2WO7A 4Q4X3 3CMGA 3STZC 4XF0A 3J7NA 3HKCA 2GP3A 5LL6Y 2GNBA 2QWRB 2VGDA 4E4SA 3ZYFA 3T4ZA 3UT5B 2ITCC 4K8XA 4JI5O 1EV13 1R093 2DBNA 3WT3A 2VZVA 1PNKA 2DVGA 3ME2A 2ES3A 5FZ3A 5J37A 3LAGA 4CDXC 3SH4A 1P4RA 3PUHA 3U4SA 3DC5A 1RL3A 2VWKA 1D5AA 5I8YA 2JJ6A 4X62O 1RC6A 4YJ2A 3CCLV 1Q81W 4YZ1A 3KCXA 1VRBA 5DEDA 1YJ9V 1WW4A 1O4ZA 3FZ3A 2BOBC 5FKBA 1JZ3A 2QWQB 1VALA 4YXWG 3JD0A 3TN92 5GJ6A 1KJRA 3IM0A 2JJ2G 2E7AA 4O2AB 2R9RB 4GZ9A 2QE3A 2VQTA 4R9BA 2HWF2 2XAQA 4RQEA 2P5OA 3VHNA 3B3QE 1ENXA 4ZIBA 1MS1A 4KGQA 2ZDIC 1H2LA 5JVDB 3T1HO 3G6EV 1H30A 4FPEA 3UKMA 4ZHQB 2P90A 2JGUA 3E83A 4BA6A 3HD8B 2JGDA 5BV6A 1R64A 4MVZA 1MZ6A 4FTBA 5CB7A 4XF4A 1X82A 4QJFB 4SBVA 3H7JA 3ZXAC 1L7LA 2ZACA 3O1VA 3SHRA 1ZA7A 1I08A 1M93A 4CDXA 1HXS2 5FTTC 1VAMA 4O2BB 2RN9A 2J1AA 4QKNA 4XETA 1DQ1A 5K0UC 1WW5A 1XILA 1HW7A 4LFAO 3UYJA 5IVBA 1EFRG 2VO5A 2XHKA 4M4PA 4PDMA 4CEYC 4S2GA 2CNAA 5LGNA 1HNZB 3BIWE 1SQGA 1C4RA 1V54B 2EZOA 1HLCA 3J9SA 3U1XA 1JVMA 4KBBA 2P4EA 1FFTB 1QR9A 1OURA 1RITA 3DTUB 5ANQA 3UV9A 1XEQA 4A3XA 4CRQA 3VDBA 1NCRC 2VW2A 3EXAA 1AXKA 3O12A 1F7YA 1ASJ3 4Q4Y1 2AW9A 5T55A 4W4ZA 1XYPA 3WVJA 4K8RB 1JYCA 2F66C 1DYOA 2JVDA 4R52A 1IBKB 1XB9A 1N47A 4UCTA 5FAXA 2Y6JA 5AC92 3WLUA 3HVDA 1VRH1 3E86A 4FVVA 1UMIA 1W6NB 1ND2C 1O59A 4XF1A 3WF0A 5CBGA 5H2FZ 4GB31 4PA9A 3VZMA 5D1IA 3RVYA 5DDJ2 1OV9A 5B66Z 2DFBA 1UXZA 3OR6C 2F4VO 3UT0A 4JHZA 3NKTA 2E7TA 1JMKC 2OQ6A 2WA4A 2AEZA 3STLC 3WUCA 4HKLA 3WHUA 1O3QA 1EZVH 4ISQA 1K33A 3AZYA 1GOFA 3HN3A 1OCRB 1TGOA 1NA1B 2GC3A 4XHBA 4KH9A 1GR3A 2MPFA 2XJRA 4KP4A 5FLXN 4ZS3A 3ZRWB 4Z07A 4OMCA 3A0KA 2IXJA 1EBOA 3FFZA 2ZX3A 5JSOA 2YIBD 4I2OA 4YSFA 2RS51 1NCQA 4FOYA 1O5LA 3NL1A 4HN0A 3BAAA 4I0BA 4P9OA 3KV5A 1IX9A 4EZHA 3E5QA 3OB8A 4R8CA 4RQPB 4JZ2A 3VZKA 5B1OA 1FNYA 1I5ZA 3P3NA 2JKXA 3SJCC 4IXLA 4DNYA 3SH5A 4UV9A 3LIHA 1NLQA 4N43B 1T2XA 4DV6B 2ADQB 3E22B 3KM5A 1POV0 2Q4SA 2JRIA 2K0GA 3RYIB 3S3WA 1HNZO 2QQNA 3POWA 4AHZA 3JAKB 1MS0A 2GH8A 2EA7A 2MEV2 4C0BA 3B40A 2XL7A 4UB6Z 5AVAA 4SLIA 1UZWA 3VQVA 2ZIOA 1TEIA 4WM8B 4CCKA 4AQ2A 4CXWA 2ZE5A 2R49A 4GKXA 2WWWA 3NJZA 2BVBA 2ZMLA 4FFHA 3RBZA 3VHOA 1BBT1 1VQ7V 3FX3A 2XOKG 2HHHB 3Q8CA 4AVAA 2Z2SB 3BODA 1LHWA 3RW0A 2BOCC 3LFIA 3E2EA 1XNRO 1SZBA 3IAQA 1HV1A 1BMV2 4WFGA 4CU9A 4NHLA 4Y22A 4W50A 1QJY3 4EB6B 1VQ9V 3WNLA 1Y9QA 5F8PA 3SJAC 1DZRA 1OT5A 4Q2FA 1I3HA 3RI9A 3WDTA 2Y69B 4I3PA 1RUI2 3RVZA 5IK5A 1PVC2 3UGGA 1JHNA 1NOVA 2VW0A 3ZO0B 5BY1A 2R072 4MW8A 1FKAO 4YM1A 3BTYA 1ND3B 4BXFA 3JCIA 5LA0A 2CAZC 1V9U2 2EIMC 1NXD1 2F23A 1E79G 1PGW1 5CFCA 2NLRA 4XFHA 1JZ7A 3POYA 2Q6AA 1PMHX 1N34B 4OMDA 5C93A 1GN4A 2B46X 1SLBA 2Q5TA 4X6QB 3RZLA 4HPKA 3MZHA 1BK1A 1K8AW 2IUWA 2R042 4NIAA 2XAFA 4LBKA 2Q8CA 4KHPB 2BE3A 1G9DA 2BBAA 2W1UA 2VCMA 2ZS6B 1FFXA 3H1HH 4W6WA 1TME1 1YJLA 4CH3A 1X8EA 3R4SA 3RSJA 1K9MW 3ASOC 4DV6O 1YQ2A 2WLLB 3WDWA 3LEGA 2FMLA 1UOGA 3WB1A 4RA0A 1ODMA 4E8DA 3PMEA 3GB7C 4IGQA 2VCCA 4FP2A 2OT5A 4CCLA 2HYXA 4R7CA 2DVAA 2R063 1SFYA 5ACA1 5EYXA 3C7GA 1VMHA 1D4VB 4LUMA 4XPVA 3UNPA 2ZGRA 2RDNA 1LNQA 4B3SO 1QDOA 4DXRA 1HRV3 3FN9A 1UMHA 1GZWB 1FYUA 2MW2B 2HHHO 4M3CA 4YW4A 3N35A 4BR6A 2ZTNA 1Y3TA 2TBVA 1GQPA 3LWCA 1OUXA 1UX6A 4CEWB 2ZIMA 2DVDA 4JAVA 1ZRRA 3K46A 4RAIA 4Y26A 2E76B 1K4CC 1QOTA 4LEJA 3RYFA 5FUPA 3RYRA 3IWZA 5JMOA 4A5UB 4XJAA 3U0ZA 3TETA 2QE7G 1KEXA 3ACIA 4XFIA 2ARCA 4X8AA 1R6KA 5DAXA 3PJSK 1HRI1 4LC1A 4FPGA 4NPRA 2CWMA 1K45A 3RYCA 2BOJA 2ARBA 3AMPA 3AX4A 3PNAA 2OIEA 2D2CB 1MNGA 2C5DA 4DUXA 3WNPA 2OIIA 1AL0G 2X29A 4YM0A 5F5AA 3NWKA 2JIJA 1O6UA 2Q1FA 1EN4A 4NN0A 1N34O 2ZNIA 4NXNB 4MXWB 4JTDB 4MZUA 2EZPA 3K57A 1YITV 3BA9A 4ZOLB 3DC6A 1NLRA 4I5SA 1LOBA 1X33A 3RJ2X 5K9YA 3NMBA 3TXSA 3WNOA 4KHPO 2UWCA 5LRRA 4CH5A 3CJIB 5F5IA 1NTZH 1W0JG 1S0EA 2V09A 2EF6A 3AM2A 2BTQA 1EPWA 4L9BA 3ZYBA 3DCQA 4WFEA 3OG2A 3IDAA 3NAPC 1AJPA 4I0XA 4W8JA 1SLAA 3BA8A 1EV11 1R091 4CP1A 1W6QA 2R16A 5BXXA 2QQKA 4B1MA 2ETEA 3CCMV 2VTFA 4CBCA 3SYAA 5L3DA 3ZHVA 1LU1A 1JN2P 3LEIA 4Z92B 1FXKC 3SJQC 3G80A 4YGDA 3C7HA 2L6LA 1UMZA 2HH9A 5EJ1B 3JALB 1POQA 1BXHA 5FYTA 2VL4A 4GAZA 2VQEO 1Y4WA 4CP9B 3ZFFC 5FXZA 3WSOA 2DWRA 4BU2A 1KECA 1OA2A 3QO8A 2XAHA 3RVHA 3ZFGB 4XW3A 3CRRA 2EINC 1ULFA 1MVQA 2A7AA 5C4WC 4META 1AXZA 4BAYA 2XDVA 3K5NA 3CYOA 5FY7A 3CP1A 4MW3A 3TWIA 4RFT0 3ABMC 4U7OA 5FP9A 4UUJC 5CBFA 2DFCA 3VBRC 3ZRVA 1Z0HA 2MNGA 1WW7A 4QB6A 3LDCA 1XQNA 3ZSLA 5IUQA 4QX3A 1VBC3 1N0NA 1L0NH 4JX0A 3PUSA 4JZRA 3AP7A 1J84A 1A8MA 3VZOA 5A7NA 3NAPA 4GJYA 3OEAA 3ABKC 3L71H 1IG3A 3CE2A 2BSKB 3ZXDA 4UVBA 2J1EA 3RQ0A 1XC6A 1SDWA 3I59B 3O1OA 5BNOA 1RXFA 2P06A 3RFRA 3E8GA 1FXKA 2PA7A 2Y6GA 4NXNO 3CJXA 3U14A 1Q8VA 2VUDA 3K58A 1L0LH 2QGNA 2ZHMA 4WBBA 3O1MA 1G4YB 2V4DA 4BQ1A 3BTAA 3ZCCA 1A78A 3RPQA 3K0GA 3VZJA 1VF6C 4AEDC 3ZFFA 4AWDA 4FM0A 4MTFA 2DCTA 2PF4E 3DXRB 3UKNA 3GF6A 4COVA 5CA1A 4WVZA 5C4WA 5FK8A 5EC2C 3N2GA 4CU7A 2R70A 2V7QG 2A3QA 4B3RO 1QU7A 1ASJ1 4Q29A 4JASA 2P17A 3VBRA 1XBLA 2YI8A 4BK4A 4OHXA 4G27B 4ZI7B 5F3GA 1JYWA 1O91A 5L3EA 4UI9L 1ACCA 1W8HA 5E89A 2BEOA 5HV0A 2FZ1A 5L3CA 1QXRA 2LGQA 2FDHA 5IK4A 1C28A 5CB4B 1JU3A 1DHKB 1R1ZA 1SERA 5JIUA 4OGQB 2CTWA 4YYOA 3OBTA 3BYWA 3G67A 2WZR1 1WBLA 3KSCA 2UUBB 1QIQA 1AYN3 3V0AB 3VD9A 1S5LZ 1N1VA 4AZZA 4O4LB 1RUE3 1BCCH 4YVWC 1RUG3 3AZZA 3GM8A 1S0GA 1O4TA 1M4UA 1O9HA 2P67A 4AFBA 5FZDA 3IDEA 2DWDC 2ZHKA 3KS7A 1ZWIC 2FDGA 5BMVA 1OLMA 2LW1A 4HKWA 1OH3A 2ETNA 4YJ3A 4MTOA 4K0KB 2UURA 2Q8EA 2RDQA 1NZCA 2W9XA 4IESA 4CPBD 1K3EA 5KA5A 4QB1A 4FZ1A 4TWKA 4ET7A 4NJ4A 4UAPA 1J3RA 1ODNA 4FTEA 1MQTC 3TYJA 2IW5A 1UIJA 2LROA 1BHAA 1K4DC 4FJCC 3MAQA 4Q0SA 1GP6A 1W9FA 1H38A 3DYPA 2IFRA 5DN2A 1ZUQA 3ZSEA 2LFSA 3MIGA 4UVCA 4P30A 5FWEA 3RWKX 4Z82A 3GZUC 4TLFA 2YICA 3N2KA 5CEHA 5FLHA 1JW6A 3DEMA 5C33A 1H4HA 1G9BA 3IJ4A 1VQ4V 2WKKA 4YVWA 5CA0A 1OLRA 1X9TA 3IPVA 1BK0A 5F1RA 1VBE2 2KSDA 3VD4A 4BW9A 5J9PC 2VZ1A 4Q1RA 4H33A 1TUBA 4LWSA 1H8TC 1S2EA 4XC9A 2OA2A 5CADA 3SCFA 5A7QA 4Y5Z0 5J2UB 1QJY1 1GMGA 2CYFA 4LFBB 4LULA 2GAUA 2X5IC 2AC1A 1OA4A 1B35B 2IXKA 4CU8A 3U11A 1VBB2 4FK5C 1V6KA 1N36B 3JARA 2UUBO 1J1LA 4Y4YA 1UZYA 1G86A 4OI0A 2VNVA 2JS3A 5GW7A 2IC1A 1UYZA 2C6SA 3WUDA 3DSQA 3SKJE 1BEV1 1Z78A 1HN1A 5CNAA 5D8AC 3RYHB 1SMVA 1CN1A 4JTOA 5E8AA 1FS0G 1CAXA 2C26A 2QTOA 4DO2A 3AG2B 3PHMA 1APNA 2Y48A 1M57B 2GNTA 3M70A 4HYOA 3ZIWA 2J42A 1J58A 4AL9A 3MHSC 5F3IA 4FP3A 3VKOA 3JATA 2FDKA 2VVEA 1LECA 4K0KO 4FIPC 1AYM3 1NKGA 1B3QA 4D7SA 5DAWA 1KFXL 4BW5A 3KCCA 5IJ0A 1AROP 2ZEXA 3FD9A 4Y5SA 4EN8B 4QE7A 4NTWA 3VQWA 2IZWA 1FXHA 3K3NA 1RB8G 1Q82W 3HKEB 2EIGA 4QAWA 4NRMA 3VD7A 2VCAA 3QD6A 1CZVA 4FFFA 1JFFB 2E9QA 2DMXA 3VBHA 1W2OA 1GICA 5F32A 1PO11 4DOUA 1DFQA 2Z42A 5LGUA 4JHTA 5LYJA 1Y6XA 1GP4A 5LOVB 4LQRA 4ITCA 2QJVA 3O0XA 4G2KA 3DL3A 1CIYA 1C8NA 4JDOA 1AR93 3NJXA 5ITZA 3WOGA 4TV8A 4XILA 3ZHTA 3ALQA 3OUFA 1IG0A 3FB5C 3DUIA 2HJIA 1BMFG 5F5QA 4QPKA 3PUQA 2GSMB 3POGA 5FPVA 1Y9GA 4F3JA 4AFDA 3JASB 3H8RA 2RCVA 1NTKH 5C9AC 1O3SA 2M6YA 4HVRA 5A7WB 2HEPA 4JGSA 4RN5A 3ZXGA 2WWJA 3RMYA 1R082 4ZU4A 1GK9A 4LFBO 3DPRA 2R1DA 3WCSA 4UFIA 5IYCO 1N36O 2RMU2 3AYDA 2IWGB 2RM22 1XRUA 4OX9B 2J1UA 3SXWA 4FFGA 3DKWA 3CXCU 5EXOA 5T54A 3F95A 3UL2A 4WCEV 1KB9F 5ISLA 3G4SV 3W7WA 1QXJA 1COWG 1HNXB 1A34A 1W0KG 1SESA 2QBXA 2PAKA 2A1XA 2HWC2 1N3QA 3NO8A 4IV3A 4GKYA 3VD5A 2VPVA 4E2SA 1W3VA 3WG4A 2J7MA 3APOA 4QGPA 4AG4A 1OCOC 1NLSA 3D82A 4HONA 1DGRN 2ZXWB 2GC1A 4I55B 5C9AA 4QPGA 3ZMOA 1G6NA 2BYVE 1AVMA 2E33A 4MSVA 5H6RA 3TK1A 3CRCA 4BISA 4JQRA 4QM9A 3AYAA 2IXHA 3WP5A 4HNAA 4OHYA 1R1A3 3ZXJA 1PD3A 1K42A 1K5MB 4D6SA 2VZUA 4DY5A 1DK1A 4E27A 4MXVA 4IEYA 5DUWA 4UW5A 2VZOA 5KHGA 1W6PB 4RGKA 5LHGA 4S2HA 1GQHA 3WQBA 3ZOIA 2P34A 2SBAA 1AI7A 4CH4A 4M3CE 3WF2A 4ES8A 1I6XA 3CS5A 2FCVA 1GWLA 3EBRA 3JQXA 2QWNB 1TAEA 2CH7A 4IYHA 1JUHA 1ZREA 1H1AA 4A42A 1QF3A 1W0OA 2X09A 1GM8A 3J8F2 2WNUC 2A6YA 3MF6A 1N32B 3CZJA 1H2GA 2ILMA 2OZJA 4PDWC 1YC61 1SHWB 1XNQB 2ZX0A 2JIGA 1S1AA 4J7JA 3SPHA 3AXDA 1NBMG 5G05L 2KG7B 2R0HA 1GU3A 5FYIA 1UY1A 3AL5A 5HCHA 1SACA 2XUMA 3JBG2 3GDBA 4CDUB 5KXBA 1S2BA 4GKKB 4HAMA 5M0TA 4PDVA 2E3CA 2XLGA 4Z2AA 1XPWA 4HETA 5CFDC 1D4M2 3B02A 1HNXO 3A22A 4CZSA 4AQTA 4N53A 4MVSA 2BPA2 1VIBA 4PHZA 1ZBA2 3POIA 4CEYB 3SGIA 4LBNA 2FKXA 5KMGB 3BCCH 4QU1A 2PHXA 2OCCC 4O61A 2D6NA 1VJ2A 1QJX3 4K8ZA 3TB0A 4BM8A 2YIBA 5GZGA 1RUC2 4DUYO 3V0BB 2XBO3 4DQAA 2B1GA 3UESA 2LTNA 3JXSA 3TEXA 1ST8A 4PDWA 3F5WC 2CAVA 1CX1A 3R66A 2CDOA 1YQCA 3RN4A 3UKTA 4CDWA 1CAVA 4J10A 3JD72 3OY8A 2PI4A 5FQ0B 4KFMA 2VNGA 2WR9A 4B7EA 4JGZC 4BMBA 4Q4V1 5JAXA 1KYOF 1PZ7A 1K34A 5LMUB 1UN1A 1YCIA 4LH7A 4HFSA 4JF3A 3JCZA 1NYWA 2DN9A 3F2ZA 4FM1A 2D44A 4XYXA 2Y38A 1JZ2A 2PY5A 2Z69A 3D5OA 3RZMA 3ICXA 4IE6A 4P00B 1UXXX 1GANA 3C3VA 1Q8SA 3ZYPA 4CDQB 2BP6A 3SLIA 1RHI3 1N32O 4B3MB 4B3NA 5GLZA 4HMZA 5IT9N 2CU5A 3H7YA 4EV0A 5FBJA 1AYN1 1XNQO 2ZMKA 2UUCB 4YZ5A 1PNMA 2PLV2 1RUE1 3KV4A 5H9SA 2ZE7A 3B2EE 1GV9A 3TGUH 3ZKYA 1DIWA 2RS13 4FAHA 4JI2B 4J6GA 3K0DA 5C3OA 4FPPA 2XJUA 5BYNA 1EUUA 1W6MB 2D6KA 1RUJ2 4IIJA 1YTFB 3HQXA 4IEXA 4WVWA 5FRAA 2ZT9B 4OXSA 5EQUA 3KF3A 3I2IA 4AVBA 2JDYA 1DQ0A 1W05A 4O7XA 1PO21 2GN7A 2P4VA 5I0TA 1SLIA 1T6BX 2O57A 4LF6B 5IFTA 1Y74B 2W6JG 3QF7A 3LFMA 4B1LA 2JJ1G 5EYPA 1MR5A 2PI5A 3JSLA 4UCOA 3CB2A 1VQKV 3OGVA 2QTSA 5IW0A 4O4IA 4D6RA 4FOVA 3WX5A 1RPRA 1Z5WA 3HKBA 5FZ4A 1SCSA 1FATA 3HKDA 4Z2WA 1JJ2U 2W46A 5FPAA 1W2BU 2MHFA 4FT8A 4TWTA 1JBCA 1DLLA 1RUF3 4RGAA 2JDUA 4I7ZB 3C8XA 3H1IH 3AJYA 1VBA3 2GALA 2WWUA 1M56B 1W8OA 1UY0A 1HP8A 5A6ZA 3KT1A 2ZPXA 3VGIA 4WVMB 3K08A 5FZ6A 4Q0QA 2FD8A 1WA6X 2UXDB 2FDFA 2W91A 1E5SA 4A4AA 2YEVB 4G28B 5JH7A 1DF0A 4J41A 4BIUA 4B3MO 3OGIB 4NIIA 2UYAA 4CCEA 1LHVA 2I2SA 2UUCO 1QQP2 2VE1A 5FJHA 4BQXA 1EAH1 1OQEA 1YJKA 4ATEA 4K7JA 3T2QA 1OLME 2YB7A 1YI2V 3OFNG 3H8OA 2GUZB 5IWFA 4K6BA 2NZ9A 1PZ9A 5C8CA 2Z5UA 4Y5TA 1FD9A 4GKJB 3OEEG 4Z1VA 4UCUA 5HFLA 5LWBA 1V54C 2WINB 3ASOB 4KWKA 1YIPA 4XXAA 4RGGA 1AX1A 1AYM1 1Q43A 1UY4A 1PK6A 1BYHA 2W94A 1M9NA 1R3JC 2HWF3 1Y67A 1OF3A 3UM7A 5JVDA 4BDVB 1RJ8A 3G71V 1VMGA 4ZHQA 4Y1YA 4LF6O 3ILNA 1KDKA 3FB7C 2WFF2 4E9KA 2XH6A 2FQPA 1LOFA 2QFEA 2DTWA 3RS6A 5I91A 3X2QB 1V6LA 1AL21 2X6CA 4F6EA 1OQ1A 5IVYA 1AR91 2BVVA 3FAVB 1Q6UA 1R3KC 4O2BA 1H9PA 5B5EZ 4JYAB 1LODA 2XVLA 4CC6A 4XUTA 1OFSA 2PN5A 4AEJA 2PFWA 1QLNA 1K97A 4W65A 5DMYA 4A2UA 4FLWA 3WW4A 1OCRC 4XMIA 1V55B 1LNSA 1UF2C 3I55V 3R0RA 1K3IA 2QM8A 3N7KA 1SQVH 4UFZA 1VRH2 2UXDO 4FPCA 4LO4B 5B3SB 3NV1A 4JV5B 5C5UA 1F4AA 4I9QA 4GB32 1R1BA 1OCZB 1YQ5A 4PA4A 2XUEA 2A79B 2JG9B 2YPDA 4RQPC 5ERLA 3ZN4A 4DUWA 4QT6A 2WA3A 1KKCA 4N43C 4HVOA 3JCUZ 1KKDA 3BY6A 2ZOEB 5J2TB 4OHZA 5AC93 4KU8A 4CTEA 2CGPA 2ZCEA 3LKJA 3M8AA 1CJPA 5FZAA 5GM0A 4GKJO 1QJU2 4DR4B 1GM7A 2ZHNA 1CIWA 1F5FA 5KXDA 3M3OA 4PI0A 5I8TA 2YBPA 4HOOA 5K8SA 2WS93 4YW1A 5H5NA 3WDXA 4PLOA 4WM8C 3JAWB 4PF5A 4LF4B 4IEZA 2XXZA 3CNAA 5IWAB 3AK1A 3LDEA 2VZ3A 2XHBA 3VDCA 1NA1A 2VZPA 2XAJA 1SA0B 2JENA 1J3QA 4X65B 1SG3A 2HYKA 1R1A1 4Q5OA 2DOSA 4NWVA 2W52A 1S4CA 2YMZA 4TTGA 3F7VC 1CONA 3CC2V 4YG0A 1BT8A 4FFBB 3CSXA 1POV3 5FPBA 3A8TA 2OTJV 4JYAO 1GH6A 3WF1A 3TNPB 4TSVA 1RUD2 2Y69C 2VULA 4N43A 1X36A 1TZOA 3ZR5A 3KMHA 1RM1B 3POBA 3E22A 2DJVA 3U10A 1LUVA 1WMFA 1VMJA 1BQ0A 1ND3C 4PLMA 1G1XB 2DU0A 3JAKA 5A1LA 4X88A 1ZRCA 1SQFA 3CD6V 2MEV3 4RS5B 4JV5O 2W2IA 2B1IA 4XTPA 4WM8A 2A6WA 1XNKA 5FPUA 3OF1A 4MO3M 4UFMA 2NR5A 2XJSA 5AVPA 3FL7A 5GLTA 2FCTA 1NZ6A 1YFYA 3OYWB 1BQZA 4FVMA 3HB3B 1S0BA 2HWD2 1YIFA 2WAMA 2DE0X 1SQXH 4LMFA 3T1LA 2D6LX 3VD3A 1MEC3 1PL0A 1NT0A 4ZU7A 3O14A 5B4NA 4AEDB 4DR4O 3BPZA 1D2SA 1RSOA 4AEMA 3USUB 1XNAA 1QJX1 4OLLA 1HB3A 1GNYA 1YTFD 5A32A 4LF4O 4V1PA 2B39A 4I50B 2RS32 5IWAO 1MSWD 3E6DA 2XBO1 3RGBA 1ZL8A 1NKDA 4CPBA 4XUPA 1GRJA 1MABG 2R073 4X65O 2WJSA 3MIHA 3CPWU 2AREA 5JCOC 3ZN0A 1NUKA 1FXVA 4J9YB 4CEWC 2DF7A 3EHBB 3LNMB 3WQ1A 3OSDA 4X1IB 3VBFA 3UO3A 1OD5A 4B3TO 4AEKA 3WB2A 3N3HA 5FZLA 2XVKA 3IIAA 4Q0UA 5H9CA 4AHYA 4PJYA 4Q8KA 1REDA 1RVF2 4C8DA 1TVKB 2WLLA 2UXXA 3CLPA 5JIAA 2ZGOA 4FI9A 1COV3 4LLOA 1RHI1 5LP6A 2YIAA 1VLNA 4R4XA 3A0BZ 4RR3C 2V5DA 1EYBA 1W06A 5LB6A 1FMD2 3HN1A 2FZ2A 1GN2A 3I2OA 2R0FA 3OUJA 4TUYB 2ORXA 4MG2A 1QGLA 1AHSA 1SC5B 4LIVA 2B9UA 2XR4A 4FLVA 4LBQB 5F3CA 2PUSA 3WW1A 4AK3A 5KHJA 1ZVFA 1ULPA 5JXGA 3WP4A 1GZWA 4MSWC 1D2QA 1E5IA 1W8WA 4AOCA 3CJIC 2VS0A 4IHJB 3D6EA 3R6SA 4GH4A 5L9VA 1NU1H 1FI2A 4JGYB 1Z5VA 1C3HA 4RHV1 4XBQA 3ZYHA 3ACLA 1X59A 5FPLA 1MS9A 2J1SA 2A73B 3SKVA 3G7DA 5K4LA 4P9WA 5DZGA 3A0NA 1U96A 4IE0A 5LA1A 3ZN5A 1CP9A 2GBOA 3VBUB 3GWKC 4IE5A 4NB5A 4UF0B 4YGCA 5GLUA 1I5XA 3M3QA 4ARXA 3APQA 2N7GA 2WQ8A 2ZZQA 1VQ5V 4R6ZA 4Q4X2 4ATFA 5KBFA 4COZA 4LR3A 3LDBA 5JOXA 3ZRXA 1HQNA 1KP3A 3L2HA 1H8TB 1H9WA 3AZXA 5J7MA 1IVSA 4MTXA 3ZFGC 1K5SA 4MXWA 4JYYA 4HK8A 3FFQA 4MH0E 5DM6V 1LGCA 4H44B 1QDCA 3NNMA 1JQ0A 2VU9A 2X5IB 2QNKA 5JSPA 1H8EG 2Q8DA 1YI9A 3RZZA 2D93A 4QX8A 4CS4A 1LHUA 3VDDC 4JDMA 3ZMTA 1GP5A 5JQGA 2PXJA 3ZR6A 4OI2A 2XASA 2EILC 4W4LA 2N74A 1IBMB 4LPLA 2Y8KA 3WINE 3DF0A 5EZYA 4COYA 1MZEA 4MV2A 4BLJA 1GYKA 3RYKA 1ULEA 3DXUA 3EFFK 4MVQA 4PI2A 1OUSA 2DQ0A 2EIJB 4ZBMA 4TYSA 1V6OA 5J09A 3AK0A 3EO6A 1Z7S2 2Q5ZA 4OPHA 4DW0A 1EUTA 1REFA 4EEQA 1HB4A 1Q8PA 2VTXJ 2CTVA 1LUWA 4BE3A 2NMNA 4CP9A 5IVVA 2QDOA 4LF5O 2JGDB 1IURA 3KVBA 1W9YA 4Q4Y3 1HNWB 2ID4A 1I5YA 5FMOS 4FLZA 4QGNA 4DRXA 1CESA 3BTZA 1M1KW 4DXTA 3ACHA 1OC1A 1OXCA 4ZU5A 3E6CC 2HWF1 1QHTA 1IQDC 4TT3G 5BPXA 4YPJA 2ERFA 5FZFA 4IEVA 2BOIA 4E2GA 2JICA 1WCSA 1XI1A 4UBHA 3ILFA 3CRAA 1W0PA 1W3XA 3HNMA 4Y1XA 3D3QA 3QOPA 4K20A 1WLTA 1SS3A 1GN6A 3NV4A 3JU9A 1Q6HA 1H6XA 1JOYA 1QR8A 4QKBA 4UW3A 3KGZA 2D3PA 1JX9A 1FV2A 1C57A 1L3JA 3EQEA 3I3QA 5FYSA 2RS53 5JJNB 3FKSG 3HBKA 5JOZA 4MGKE 3WF4A 2XNDG 1S3JA 5DZFA 4Y33A 2EAKA 4XABA 3M4FA 1WPXA 1F5JA 4PBPA 3K75B 1DGWX 4N7UA 3AP5A 3N4MA 1F4MA 3QTCA 2VQ0A 1IBMO 2VQFB 1X8MA 2Z0AA 2CTRA 2WNVC 1NTMH 4BOWA 1JOPA 1Q6IA 3GALA 5EIBD 3B9IA 1DQ2A 1J5EB 4CCDA 2HWE2 3POEA 2WSUA 4FXKB 4DY3A 1PM7A 1JTZX 2B4KA 4LHSA 3O0VA 2QM4A 2YPJA 1VR3A 4PQ9A 1DZTA 1ENRA 5FZHA 1JYNA 2AYHA 3B93A 5AC91 5JZGC 4QX2A 3ZIXA 2RMKB 3WNKA 1GWMA 2GP5A 4QDSA 5DECA 2OQ7A 5B1NA 1WLWA 2Z3YA 1ZLZA 4LR4A 5A3MA 1PVXA 5DDJ1 4UYBA 1BBT3 1SFNA 4CA9A 3N9LA 4FFIA 2YG0A 1HNWO 2JG8A 3J7AU 2PQQA 3PJQA 4WFBV 1JZ5A 1LRHA 5LW9A 4JZGA 2UU8A 1RMU3 1YDXA 3SH3A 1NCQB 1AR4A 3ZFEA 4JTCB 1H4GA 4FPKA 5IVCA 1VQ6V 2JWPA 5A80A 4XHXA 1EN5A 1WMXA 2ZINA 3ZLIA 5EBLC 4MVUA 5KX5B 1IS5A 3AP6A 3AKPA 4IGOA 2DCZA 4AGVA 5L9RA 1K5QA 4YG6A 4QDRA 2L9LA 3T1YB 5FMOL 2VQAA 5A33B 2DUOA 2D5HA 3SEEA 4G3YC 5DG2A 4CZZA 2FTKA 1B35C 1POV1 3VLBB 3I56V 4GA9A 2Y4TA 3THDA 3AZWA 1HDKA 2C2AA 2YXHA 1ZA4A 5CA6A 1WNSA 3N7JA 1VMFA 3SQOA 1TMF2 2VMDA 4IL6Z 4LA2A 3M7AA 4EJRA 4NVPA 1HR0B 5JUVA 1PMIA 4LO8A 1QCEA 3AG2C 3HEIA 1M57C 2A3XA 3CCUV 1WCKA 3S5AA 2MEV1 1TUEB 1PNGA 5A3OA 4PELA 2VQFO 5EV7A 1MPXA 4QDQA 1GO3F 1ZZCA 3RJRA 2D43A 1N1YA 5CYYA 1J5EO 3FB8C 3MFCA 2LW7A 3WFVA 3ZHQA 3T1CA 4DRRA 4EQVA 4GLXA 1GUIA 4CP2A 3AKTA 2OCCB 1UCXA 1CD3G 1LEMA 2XONA 3SEPA 1IGOA 5ANNA 3L9JT 5ACA3 5JOYA 4LBQD 1IXMA 4WZCA 3JYCA 4PF1A 5J2UA 1BMV1 3WF3A 2ZE8A 1UY2A 1B35A 4M00A 2WABA 4MVMA 1A32A 3USSA 4O9EA 2YU2A 4UXNA 5CFCB 5FPZA 1NE4A 1BHGA 2RJZA 2VMCA 5CZKA 4EN9B 4HPKB 4JV4A 1VB2A 2B7YA 4LBLA 5FXWA 2FBEA 1Y76B 1PVC1 1J59A 5CA3A 5JDBA 2PGGA 4NROA 5H9QA 2R071 2EIDA 5J98B 3N9QA 1V70A 2CWSA 4ZS2A 4GX0A 5A3UA 4DUVA 4DV3B 3BIEA 2ARHA 3ZBHA 2E26A 1NY72 3T1YO 1F9KA 2HWB2 3BOWA 1HRI3 1RFYA 1CEZA 3A21A 3H0OA 3L72H 2R062 4R9CA 4D69A 3H42B 2RV9A 3T3YA 3CMEV 2R041 4LNUB 4G4FA 2WDBA 1AX2A 3HKEA 3C7FA 5HI0A 3A2FA 3WHTA 2VOKA 4FPOB 1HRV2 3HR0A 2G38A 3J7HA 3PVOA 5FCCA 2XQRA 2R72A 1W99A 1HW5A 5C3PA 2YC0A 1HR0O 3WW2A 3AJZA 3FYIB 1LKNA 3ZXKA 3S30A 2TNFA 4UFHA 4EFBA 4QQPA 2YBKA 1JYTA 5JXHA 1VB4A 4K9SA 1N3PA 3W7TA 2EIKB 3H1LH 1BHBA 2FDJA 4LFCB 3CZUA 4ASUG 2DYSB 1U5XA 2C9KA 5IAVA 2VBPA 4LF7B 5FY4A 2NNUA 1I1EA 3JD4A 3LIGA 5A7SA 2ZGKA 4YW3A 5C8YB 3JASA 4AVTA 1S76D 1SQQH 3S57A 4B4RA 4R9AA 5JPNB 2ZXWC 2BNMA 3VV1A 5E79Z 4BCUA 2WLNA 1PGSA 3B8NA 5APAA 4IGPA 1KS4A 4AQSA 2QQMA 3B9CA 1XHZA 2BWAA 4RL7A 4A7YA 1VQ8V 1K5MC 3ZDSA 4RD7A 3EYPA 3T2TA 3CBNA 3JB4C 1UIKA 1Q3EA 3Q8EA 4LP8A 2EAAA 3SYPA 1F51A 2LGWA 3ILRA 4CCOA 3J80N 5I0UA 5EJZB 1VQMV 5GTIZ 3ZMUA 3SITA 4DS0A 4U3JB 2DTYA 1NXMA 5T50A 1QNWA 4GWIA 4NTXA 1PIV2 2D6PA 4E4DX 2AGSA 2P2KA 1WMEA 3CCEV 2XJQA 2BTQB 2XQXA 4N8MA 5FP4A 3FHAA 2L35A 4WFAV 2HWC3 2VECA 4I0XB 2KA3A 4KWUA 2M7WA 4NAMA 5KC6A 4LBMA 2YZ4A 5JPMB 2Q73A 3PJYA 4I55A 3MW3A 2JECA 2G9ZA 3RI8A 5GLVA 4XBLA 4CDUC 2LUWA 1OKQA 2ENRA 1AXYA 4IV1C 2BQPA 4IL7A 1W8UA 1IQAA 1KD7A 5FMBA 2AGAA 1ZBE2 3CHXA 1W6PA 3H8UA 5JSRA 4W4KA 1DU3D 4DR6O 3LSDA 3OUHA 3MFAA 4MGIE 2OT7A 1YSCA 4IEOA 4LF7O 4TN7A 5CBHA 1AR82 3B01A 1WA4A 5L7OB 1VBD3 3I97A 4H3WA 4GULA 1SDDB 4AF9A 2ZDIA 1VBC2 1FV3A 4BMEA 4R50A 2Q8VA 4AW7A 1ENSA 5FZEA 4UCSA 5IJRA 4CXXA 3UETA 3QH7A 4CH6A 3ZMVA 4LKSA 1AR5A 4XDQA 4NAOA 3WG7B 3ABZA 1SETA 2YUAA 1QU0A 2J1TA 2P3KA 1WW6A 5BNOB 3CCRV 3WU2Z 1OCCB 5A3WA 1HJFA 1XNTA 3PU3A 4CUCA 1R3IC 1IS6A 3GXUA 1JXNA 4CDUA 1S0FA 2WZR3 5LA9A 5K0UA 1DYKA 4D3WA 5E16A 4JVAA 1N4CA 2NMOA 2VG9A 4LHLA 5F6LB 2QZ2A 4CDQC 4J1XA 4E8CA 3CCSV 4CEYA 1RUH3 5KMGA 4HSLA 5D2AA 4UVAA 4FM2A 3MYXA 4FZ0A 5IATA 3I3MA 2IH1C 5CA1B 1YO8A 3O65A 3F7YC 1C5IA 3ES4A 4M01A 3V0BA 1TA8A 1NCRA 1GZTA 2CTPA 3X29B 5F39A 4H7MA 3CL1A 2WLHA 4XDLA 2ZKOA 3F5TA 3THTA 3MLKA 2WIIB 4AI1A 3FYEB 1KQSU 3ORJA 4XUOA 2JE9A 3MUY1 2ZNJA 3AYCA 1OVPA 1LJ7A 3PIGA 4OQ9A 5CAZA 1DYPA 1SLTA 2P3YA 1ND2A 4DR1B 1Q8OA 5FP8A 2QUOA 1AYN2 2XAGA 1YI7A 3VUOA 2NQYA 3OMAB 4XF9A 4F83A 2BJSA 3TEWA 4X6RB 1RUG2 2IXIA 1IZ3A 4ZZ8A 1CXZB 3W9AA 4GALA 5DUVA 3T1MA 4HN1A 3ZM8A 4W6XA 3E1F1 1SQ4A 1AUYA 3B94A 5FDBA 1LB2A 2CHHA 3SYOA 1RMU1 4O65A 4NRPA 5J36A 4EROA 3SNMA 1IBKO 2Q69A 3M1HA 4CS2A 1XBFA 2HR3A 1H2NA 4CC5A 2PLV3 3B00A 3ES1A 3BVCA 4KU7A 1LULA 5FR3A 4YIPA 1QEXA 4H2AA 2XMLA 1M56C 1FPN2 1YIJV 1IS4A 1GOHA 3A4UA 2CGNA 2E53A 1RUJ3 5CKNA 1V6IA 4ASLA 3T09A 4NE9A 3GZEA 1LGBA 1TG7A 3BI3A 2F43G 1BEV3 3THOA 2H0VA 3W7XA 4DINB 5FYHA 1JYVA 3AXEA 2NP0A 1YQ6A 1E1QG 4O4JB 4FPFA 5L9BA 1E5HA 5B1BC 3CJHB 2HKXA 4XJWA 1BCXA 2JK5C 4KQ7A 5JR2A 1H1MA 5AG2A 1O3TA 1HQWA 1LR5A 3GZAA 2X0LA 1TUBB 2KB1A 4LWSB 3BN6A 1AZDA 1XE0A 3KKYA 4KG0A 1VAVA 1UKRA 2W1QA 3ABLB 3T4DA 4JI7B 3K79A 5CBLA 1EN6A 2HKOA 4CCJA 2JB4A 2JE8A 3GWOA 3M3IA 2HEWF 5F5CA 1A6CA 1XJAA 2TEPA 4DR1O 3LSEA 4Q8LA 1OMIA 1VE0A 2GC0A 1PO13 2I74A 2LRPA 2PHTA 1I9RA 2GDFA 1SEFA 3AP9A 3ZMZA 1S0VA 5FY1A 2H3OA 4WVMA 2BBVA 2BFUS 1JJOA 1MZFA 2RR12 3AC0A 1PNLA 1CAUB 1DCSA 5DN6G 1W03A 2IXCA 4FLTA 5FYCA 4DR7B 1CVNA 2BERA 1CAXB 2YEVA 4B7KA 2OYQA 3X2QC 5IYZA 1NR1A 3ASIA 4MUVA 4PA7A 3AMHA 3JATB 2WRAA 4XE9A 1VBB1 1YHQV 3VN4A 4QNHB 4LNVA 3BVOA 3CEIA 2A7WA 1QQP3 2KR2A 2ZGQA 2JX9A 4JC1A 4PCRA 1SRYA 5BR8B 1O3RA 1XDCA 1W8NA 5FZOB 3N9PA 2QCSB 5C3SA 5LZ6A 3CCJV 2B42B 1V55C 2F93B 1LOGA 2QWPB 1LU2A 5B2GB 2WLJA 4KMQA 3H50A 4LOSA 2EBOA 3MO4A 5B3SC 4XTMA 3U37A 1F4NA 1W9WA 3TEZA 1OCZC 4LOTA 2WO3A 5FNVB 3I3EA 3OAAG 1UOBA 5FZKA 3RWNA 4OZOA 2ZD9A 4RR3B 3BALA 3AG4B 2JG9C 3TOJA 5ITZB 1AI5A 1KUQA 4PA6A 1LTEA 4HK9A 2EIBA 1HB2A 2HVJC 4WFFA 2YBSA 3RZHA 4DR5B 2IFWA 2AENA 2QM7A 4FSJA 3GZTB 5E6HA 1OA3A 3VQXA 3HJRA 4AGGA 2Q30A 2XJVA 3WG2A 4OYUA 2OVUA 2RDCA 1Y9MA 4ZONA 4X89A 3O0WA 3J7MA 2A3YA 3AG1B 2XOMA 3ETDA 4JI7O 1EY2A 1BE3H 2UY8A 4DW1A 3NVCA 3DPRB 2IBZH 3KV9A 4XEZA 2P6CA 4URTA 4ZKTB 4ORFA 1QNYA 3H3ZA 4QPWA 1PX4A 3WQ0A 3OD0A 4JAAA 4IDZA 5L3GA 1NE6A 5LEKA 4DB5A 4HZ3A 4HKOA 4DR7O 1R081 3T2MA 2W3JA 5F3EA 3VBBA 1AX0A 3FLPA 2UXBB 3ZMNA 2XLFA 2JG9A 2VVFA 4AQYB 2CAUA 4YW7A 2RMU1 4IV3B 3H1JH 2RM21 2EXIA 3KVAA 4KWLA 1UU4A 2CSGA 2ZGTA 2AUYA 2B45X 4FXGB 3OUIA 1MS8A 1NZIA 5BR8O 5J2TA 1RM1C 3PU8A 4PV1B 2IJJA 4DMIA 1BVVA 4QPGB 1FAYA 1XOUA 4QXHA 5IVFA 5EIBC 1LR1A 3M3EA 1URFA 1XU2A 3VDDB 4HNAB 5FL7G 1QJU3 4RS5C 5FLIA 2R6QA 2HWC1 2EILB 3VB9A 3QNEA 1AR73 2AXTZ 3BTXA 5FYVA 1ULGA 2GU9A 1GWKA 1DF5A 4IEQA 1GMMA 4X1YA 1JYXA 1QWRA 1T5EA 1SA0A 5F2VO 2OKXA 1QJFA 2GDSA 3PTYA 1YUDA 4EWAA 4CE8A 4HANA 1WD3A 3K3WA 4DR5O 4TOIA 4PQQA 2W0XA 1JZ8A 2WYSA 2UY9A 3W20A 4DV1B 2MK3A 3POFA 3QO5A 1H0BA 1P84F 3K51A 3VZLA 3EHKA 1G7YA 4R8HA 1SPPB 3IIIA 3PTRB 2EXHA 2VOXA 4MGSA 5FFOC 3FHIB 1VBD1 4MLOA 2PHFA 5C3RA 3BOPA 2KD7A 1PZ8A 1QQCA 1KGYA 2GV9A 2QWOB 3N36A 1CZTA 5CMUA 2Q7HA 5HV4A 1YQ8A 5FZCA 3K04A 5FOJB 1EP0A 5A3NA 4Q4V3 1OPMA 4RS5A 3DXTA 2RDRA 3Q8BA 4CCNA 4E2QA 3EMRA 3KZ4C 2JDAA 4K3UA 1WJZA 5LRSA 4N53B 1YRZA 2OCHA 5FUNA 3OM3B 3ZSKA 4DK1A 2F4PA 3A0HZ 2RNBA 1IKPA 1SBEA 4Y20B 4AQYO 3MPPG 2QQWA 5FZ8A 1BSMA 1KC8W 4M3CF 2G19A 3ZXFA 4K1ZA 3JBG1 1AR62 5FPRA 4HSJA 3S7EA 3WB0A 1OSGA 2OWOA 1L8DA 2HBUA 3AG3B 3Q4HB 1D4M1 2CTQA 3UGFA 1GSLA 3OGGA 3SCHA 3B69A 4HBNA 1VQPV 3H1MA 4M4RA 1N33B 1RUH1 1AB3A 5DABA 1VF6A 4O4HB 4AEDA 4PJ0Z 1ZBA1 5DPNA 1QMJA 3K3OA 3ROUA 3USUA 3VKFC 1ZX3A 3OY8B 2VBBA 2UUAB 2E74B 2WLKA 1KMIZ 4XIOA 5A70A 4U3FH 2Q7EA 2WNVB 1RUC1 1PGL2 5FP7A 2CK3G 3A7QA 4FOWA 1JZ4A 4I01A 4P9PA 1PO23 1KDMA 2A0LA 4L8QA 1W04A 3ZVXA 5GALA 1DBNA 4JGYC 2F1MA 1QJZA 1W8FA 1X4TA 4AI9A 4DV1O 1VQNV 5I8SA 5JZGB 1YYNA 4JQTA 5JOWA 2PHLA 2VNRA 3I3BA 4NHKA 1YZBA 1XREA 1XSQA 1SZTA 2ZX4A 3IDCB 4IUGA 3ZX7A 5SV8A 4XFBA 2UXNA 3VBUC 1NQTA 2W5FA 1SCRA 3MICA 2W39A 4YY3B 1XL4A 1QH7A 1R73A 1N1TA 1P7BA 2RS12 3ABTA 2W0FC 1S55A 1RVF3 4XCBA 1Y43B 4MGQA 3ZHUA 3WDVA 1LAJA 2FHRA 3H1KH 3OGCC 1GLHA 2ZX2A 1V6MA 2GSYA 2BW8A 4LBEC 4P9JA 4BQYA 4IIJB 2DVBA 4TUYA 1RTVA 4ZY9A 1XMOB 4B4QA 3MGUA 3IC7A 4XJ8A 3T08A 2PLV1 4LBQA 4CP0A 2WC2A 1W90A 4I02A 4TV9B 1BZWA 2OW4A 4HG6B 2Y0PA 4IHJA 2Y6HA 3IMMA 1MQTA 5EWSA 1QY4A 3O9OA 4DR3B 1JA8A 4X20A 1WPBA 1EAH3 1RUJ1 2DCKA 4DRVA 3NV3A 1S77D 1BQPA 4I3GA 4QHZA 3VQYA 2GTSA 4NIGA 4P9GA 1HKDA 1YF2A 4LORA 2AZ0A 1WA8B 1Q5OA 2DQ3A 4Y24A 4L11A 5KXCA 1N33O 2Y6FA 5F37A 3UGHA 3MI8A 3VBUA 2ET1A 2AR6A 2IJKA 4UF0A 1RUF2 2QQPA 1UY3A 3IZOA 2EIJC 2UUAO 5HCBA 2OTLV 1VBA2 4NHYA 2XTAA 2OPKA 1U5ZA 3IB3A 4XOGA 2VMEA 1UD1A 2YSUB 4TQFA 1P7GA 3DV8A 5IDJA 3Q9OA 2Q1MA 4I0WB 2DW4A 1JZ6A 1Y7BA 1SLLA 2QVSB 4AVCA 2K9ZA 2IU0A 1H8TA 1Z2GA 4L99A 4WZFA 3E8FA 5IYBO 1UYPA 2EXKA 5H6QA 3NKGA 5KWRA 4HT1T 2Q0OC 2RJKA 3TRSB 3V65A 4Q27A 5JH7B 4QWNA 3AB0A 3AMMA 2X5IA 4ARYA 4NR1A 1NG0A 1FOD2 5GZFA 1YFUA 1PV0A 5A6YA 2UWBA 5EYYA 5SV5A 1AL23 2WLMA 1VPHA 4YVSB 1AVBA 4XJUA 4YY3O 2D5FA 1OPOA 3WNMA 4CSWA 2K46A 1MOFA 2J22A 2A06H 1I7FA 4LKDA 3GHNA 5D8AA 1G6UA 5A7OA 3MD0A 2QKDA 4H37A 2IVJA 3DGTA 5LY1A 5C8CB 2F4VB 5ABJB 4I09A 1W39A 1XMOO 3T30A 3J7LA 1QQP1 2W87A 2P37A 1PK6B 3CQOA 1G8MA 2A3WA 2JXAA 5JLVA 2QQVA 3EXUA 3OJBA 5FYBA 1Z7S3 4J25A 1XSRA 2D3SA 1E57A 3BABA 1M90W 3QACA 4LJHA 2DUQA 1XXNA 4AQ6A 2IM9A 3WCRA 2VXRA 1GN3A 1WWYA 4DR3O 2FMDA 1WN7A 3W21A 3H01A 2UWAA 5FREA 2K1EA 4X1KB 3CXHF 3E5UA 5J3UA 3WP6A 2O8OA 1GZ9A 5A3TA 2ZZJA 3L9DA 3ZKUA 5LATA 5A6XA 4Q20A 3RYPA 2JDMA 1N1SA 2LO1A 4PBOA 4IQPA 4QE9A 2XG3A 1W2TA 2WFF1 5LK5A 4ICGA 2ZBJA 5C70A 3AMNA 4V2WA 3H3UA 4U7NA 3H1YA 3BHPA 4YW5A 2PMWB 5DG1A 1N8RW 1LOCA 2GHYA 2VRZA 1D5NA 2QDNA 4XDOA 2DYRB 2ZJCA 3LOIA 1XU1A 4KGGA 2HBTA 1ALYA 1CZSA 2QQLA 1NCQC 3SDLA 1WB7A 5C5TA 2V5YA 2ORZA 4D8MA 2NPIA 3M3CA 2G1MA 4QB2A 2WT0A 3S6PA 2ODMA 1WLEA 2VWJA 3LF7A 2DVFA 1NQDA 4A7KA 5I0DA 4GMP1 5DAQA 1XNRB 1ZRIA 3MV11 3IFXA 2XWJB 4MVOA 5H9PA 4FPLA 4JCKA 3ZSMA 1YJWV 2WS92 2E51A 2VUJA 2G4IA 4XZUG 5JXIA 3K06A 5FZMA 2ZAAA 3OE7G 1ZNPA 2HWE3 4F6RA 4XDJA 3D0SA 2PQSA 3RZGA 4KBZA 2Z79A 1BGYH 1GNHA 4N9IA 3FLTA 2JDPA 3GJAA 3NNFA 5LCWL 2ET7A 4W6YA 2JDIG 4FPJA 3RZJA 4DZGA 3MDPA 5IYYA 1QJU1 3AP4A 4LHNA 1YXWA 4OX9O 2BCCH 3K5OA 4FFKA 4GT1A 2QTWB 3LA2A 3SC7X 1AR71 3LDDA 4LCUC 3KZIZ 2VAUA 2W1WA 3I4IA 4IV1B 4OFGA 4BJ0A 3NJYA 1UL9A 5CISA 1C1FA 3N9OA 4RO2A 1GAXA 5KX5A 1PM9A 1MA1A 5CKMA 3HWJA 2D97A 2G9FA 2ZX1A 2GZWA 3LA3A 4BK5A 4YZ3A 4GWNA 3FX7A 5LHIA 2HVKC 4PIZA 4OVEA 1UAIA 1HDJA 3ZN6B 5A33A 4D7TA 3KHBA 4J80A 5FBZA 3T4VA 5FYUA 2WNUA 4FQ4A 2SLIA 2H6BA 1AJOA 4Z1MG 5CFCC 5GLWA 4D6QA 1O8PA 4NO4A 1RUD1 4B3SB 2GH2A 1V9PA 4QHBA 1GQGA 1AILA 2BNOA 5BNPB 1VQLV 4E2LA 1TMF3 3ZIAG 4IW3A 4I4TA 1BZKA 2C0ZA 4E4ZA 1E1RG 4NTYA 2VD7A 1W8TA 4KI5M 2WLQA 4V2VA 3W7SA 5BY5A 2YFUA 1MEC2 4XDKA 2H8PC 2I07B