4D7TA

Structure of the sthk carboxy-terminal region in complex with camp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
198
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEAAQIQELAVRRKEELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords STHK_CNBD_CAMP
total genus 55
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7tA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7tA02
4EV0A 3BB6A 3PLQA 5J7MA 2FQPA 1X7NA 2HKXA 2ET7A 3CF6E 2GC1A 3SCGA 4KL1A 1WA4A 3NW4A 4UXAA 4FBFA 1ZNPA 4XEZA 4WVZA 3I59B 3E6DA 3CL1A 1FI2A 4ZU5A 4TLFA 5LRSA 4E2SA 1O4TA 3OCPA 1CAUB 3KCCA 3I54A 1U12A 1EPZA 3WW4A 5BY5A 3NKTA 1CAWB 5CADA 5EZWA 4X6RB 1J3QA 2I45A 2ATFA 2OPKA 4GULA 4H7LA 4L2NA 4AQ6A 3NJZA 2OZ6A 5FPXA 5LEKA 4Q0UA 2PAEA 2Y0OA 1Q43A 3CO2A 3IDBB 2PHDA 1RGSA 3FJSA 2D5FA 2Z2SB 3MPBA 1EYBA 5I0RA 3H3UA 2VPVA 4YARA 1XRUA 3OTFA 3LA2A 2HJIA 4OFGA 5BUVA 3RYRA 1ZRFA 4EWDA 3PNAA 4KWLA 3ST7A 5KHKA 3D0SA 3QACA 3GBFA 3H8UA 1NE6A 4MGYE 5KHHA 1YFUA 2WFPA 4YSFA 3BCWA 1PM7A 3CJXA 5T3NA 4BIFA 2XLFA 3SHRA 3KGLA 1RUOA 1ZZCA 3KMHA 4YRDA 4FT8A 3LA7A 3BPZA 3G7DA 1ZX5A 3B02A 3RYKA 2Q0AA 4D7SA 3DV8A 1X8EA 5I8YA 2IC1A 1RL3A 4KWJA 4L11A 1TQ5A 4XFBA 4HSJA 1YFYA 2D5HA 1J3PA 3N4MA 4E2QA 4XF9A 4ZU7A 2BEOA 1DGRA 1UIJA 3TNPB 3S0MA 2F4PA 4IEVA 4AVAA 1O7FA 2BGCA 1NE4A 1RTVA 3E5UA 4F7ZA 2GC2A 2BNNA 5I8SA 3H7YA 4LEJA 3VHRA 1ZRRA 1QXJA 3GYDA 3RYPA 5JCTA 1QXRA 3EJKA 4K8FA 3MZHA 4MGKE 3R6SA 3OD0A 4IEOA 5BXXA 3HT2A 1NYWA 5AVPA 3FHIB 3ZDSA 1PMIA 1FXZA 1FT9A 2EA7A 5I0TA 1UD1A 1XE8A 1G6NA 1WGPA 2EVXA 2VECA 3NVCA 1OMIA 2PHLA 5JAXA 1YFXA 4XF3A 2GAUA 3E5XA 4FAGA 5KHJA 4CYDA 5BPXA 1L3JA 3FE5A 4IEYA 1SFNA 1I6XA 1LRHA 1YLLA 2CAUA 3SCFA 2IXHA 1ZZ8A 1NXMA 5K8SA 1I5ZA 5FCCA 4MGIE 4MZUA 2PFWA 3EHKA 1DGWA 5JR7B 4IEWA 2PTMA 3ACLA 2OYZA 1Q5OA 2K9ZA 2GC3A 2IXKA 4I0BA 2QCSB 2XLGA 4MGZE 4JV4A 2XKPA 4XFCA 1RC6A 4D7TA 1YFWA 1ZVFA 4IEXA 2MHFA 4I0AA 1CX4A 2ZCWA 1CAVA 3FX3A 3D82A 1ZRCA 2XKOA 3E97A 4QM9A 4QGMA 1O3SA 4HN1A 1IPJA 4Q0QA 2H6CA 2XLAA 1EP0A 2XGXA 4IESA 3FZ3A 1LKNA 2PYTA 4LUMA 1NZCA 4Q29A 2PA7A 2OZJA 4OLLA 4Q0SA 3EQEA 5BV6A 3E6CC 3L2HA 4PJYA 4KU8A 3IBMA 5C8WA 2Z69A 3DL3A 1J58A 1UIKA 2GZWA 4JTOA 3RNSA 4XF4A 3H9AA 2H0VA 4Q0VA 4KU7A 1UW8A 4UBHA 3UKTA 4R8HA 2VQAA 5EFUA 3HT1A 4N9HA 3TNQA 4HVQA 1OD5A 5C6CA 4P9GA 2XL7A 2Q30A 1O5LA 1SEFA 4ZU4A 4Z07A 4UBGA 3SMHA 2B8MA 3LZZA 3NL1A 4HN0A 1ZRDA 2Q1ZB 4HVOA 5J3UA 4KWKA 1CAWA 4I09A 5FLHA 4XFIA 4J1WA 1J1LA 2PQQA 1CAUA 4ONUA 3E6BA 4MV2A 4J1XA 4I01A 1RUNA 3ETQA 3OGJA 1LR5A 1JUHA 3PVBB 1CAVB 5CU1A 4MX3A 1VR3A 2P17A 4IEZA 1OFNA 3ES1A 1OI6A 4LA3A 1IPKA 3OF1A 1WLTA 3IWZA 4EWEA 2QNKA 3FFQA 4I3PA 2PAKA 2DCTA 3RZZA 4A2UA 3D0JA 4HZFA 4BHPA 2ETEA 3H1WA 2QVSB 3MDPA 2GU9A 3HIFA 4EROA 4DINB 3M70A 3E5QA 3USSA 1ZREA 2ZKLA 4XFGA 2BYVE 2GC0A 3LWCA 5FPZA 4LTAA 4NVPA 4EWAA 3SCHA 1QY4A 1UCXA 2IXCA 5CVRA 3DN7A 1CAXB 4META 1YUDA 4O9GA 4HMZA 3FWEA 3IIAA 5I8TA 4QM8A 4XFFA 3S7EA 4LULA 4IEPA 4ORFA 4AQ2A 2C0ZA 2IXLA 2WC2A 4MUVA 5FLIA 3IDCB 2K0GA 4PIXA 5FQ0A 3S7IA 4N9IA 5F1RA 1HW5A 3H3ZA 5I93A 4HVRA 5JSPA 3KGZA 4I2OA 2B9UA 5FQ0B 1V70A 1O3QA 3I7DA 3M3IA 2XHKA 4JVAA 4I02A 3U10A 3WW3A 4B29A 4PIYA 4AVCA 4LLOA 1SQ4A 4QXKA 3LAGA 4R52A 3UKNA 1XE7A 4X6QB 1CAXA 2ET1A 2FMYA 3RDIA 4RD7A 3C3VA 2N7GA 1CGPA 1X82A 1O3RA 4WZCA 1QWRA 3LA3A 2XL9A 4HBNA 2CV6A 5JSRA 4XF0A 1ZZBA 1GQHA 4MH0E 3U0ZA 4QGNA 5KHGA 4HLTA 5I91A 1GQGA 5J48A 5FLJA 2BNOA 4Z82A 2EAAA 2UYAA 1VJ2A 3BALA 4F8AA 4XFAA 3DKWA 2OA2A 5I0SA 2MPFA 4E2GA 2MNGA 3QOPA 2V09A 1ZZ6A 3U11A 4XF1A 4YYOA 4IEUA 3H7JA 4YNIA 3O14A 5LEJA 1J59A 4XETA 1YHFA 2UYBA 1Y9QA 3ES4A 3H1YA 1LB2A 2QJVA 3WW1A 4BH9A 2PAMA 3KSCA 4LUKA 5KBFA 4Q0PA 1DZRA 4IERA 5FDBA 4XFHA 5HI0A 2D40A 2UY9A 1O5UA 1ZZ7A 3RPQA 3CEWA 5D1IA 4PIZA 3SXWA 3CLPA 1ZZ9A 4LA2A 3WW2A 2UY8A 4AXOA 1Q3EA 1EY2A 1O3TA 2IXJA 4QMAA 3NSTA 3BU7A 3JZVA 3EBRA 2CAVA 3I59A 5LRRA 5JSOA 2O1QA 2D93A 2QDRA 1H1IA 1VP6A 2E9QA 4BYYA 4QGLA 1H1MA 1Y3TA 2H6BA 4IETA 4FAHA 1J3RA 3ELNA 4O9EA 2CGPA 2IXIA 1UPIA 3HQXA 2O8QA 3H50A 5KHIA 4JTNA 4IEQA 4QX5A 5E1RA 4AVBA 3LOIA 4WBBA 3MYXA 2BNMA 1DZTA 2Q4SA 5E16A 4HSLA 3H1MA 1YWKA 1X8MA 3UKVA 2GH2A 5I0UA 2KXLA 3EO6A 2B5HA 3ROUA
chains in the Genus database with same CATH superfamily
4EV0A 2ZGLA 3I4IA 3VBOC 1YXWA 2EICA 1EFRG 2QWQB 1AR5A 4UWDA 3LCPA 4X9QA 4DV2B 1J83A 2C2AA 4OX9O 3I49A 1JFFA 4QPJA 1AUYA 2DVDA 4HAMA 2PHWA 3KCCA 1VQOV 3ZXDA 2WLMA 4FPGA 3NJZA 2BRTA 2QZ2A 3BI3A 4QXHA 3JD0A 3TEYA 1WBLA 4AFMA 2ZGKA 1RSOB 3ZMUA 4JHTA 4DUYO 4LP8A 1P49A 2BTVC 1ULGA 3D0SA 3RGBA 4L8JA 1JZ8A 2WNVA 3RZJA 1OLRA 1KU9A 2ZDIA 2F6BA 1H9WA 4JAVA 5CZKA 4LWSA 1XOYA 3TRSB 2D97A 4AEDB 1CWPA 5FMOL 4XUOA 3ILFA 4DK1A 4JHZA 2FHRA 2V1DA 2A6YA 1V6JA 3WZ1A 3TK1A 5I8SA 3E35A 2BCCH 2GMEA 3DYOA 1W6MA 3JQXA 3MW3A 3ZSJA 3DPRC 4IYIA 1VQKV 1FPN1 3ABMC 2BWCA 1MVQA 3W7UA 4UAPA 2ARAA 2J7MA 3ZFFA 4AI8A 1PO23 1KB9F 2IJIA 3T08A 1OXCA 3U78A 5IK8A 4NXMB 4FOYA 1R1BA 5CMUA 1FPOA 1PO21 4AHCA 1HDKA 2Y34A 4YIOA 3NV2A 1X4TA 2V5DA 2UXDO 1AR61 4IE7A 2R0FA 2Q8CA 1DYKA 1TNFA 3OTOB 1YTFD 4OMDA 2IXKA 2QCSB 1ODMA 4CSWA 3P3NA 5FZDA 4YW1A 1AL21 2C9KA 3D82A 1HJGA 3PU3A 1VBA2 3E97A 3BY6A 3JARB 2E6VA 2W87A 3B69A 3FZ3A 4AR2A 1LKNA 1COWG 5KUMA 2WNVB 1Y6XA 4YM0A 3K3WA 2VH9A 3GWOA 4Q0SA 1T2XA 3EQEA 3SYQA 3HPLC 2V4DA 1N1YA 1ORQC 2Z69A 1IBLO 3VLBB 1YZBA 5B1AB 4CUBA 4UBHA 5CA1A 5B3SB 1V0AA 1QNMA 2ZNIA 3DPRA 4AL9A 2W52A 4Z07A 2NNUA 2P34A 3V0BA 1RUF1 1IG0A 4S2DA 4ZZ8A 4UUJC 1CP9A 1FFXB 1IQAA 1QJY3 3O1RA 4I01A 5H9SA 1ZUQA 4A4AA 5DAXA 4NMIA 4NXNB 1YF2A 4YJ2B 4DUYB 2DMXA 2WZR1 1M57B 5C93A 4FPLA 2JEMA 5CU1A 5A7QA 1PIV2 4Z92B 2IZWA 1JU3A 4JDNA 3NMBA 1BZKA 2QNKA 2JDYA 4M3CB 1YJ9V 2MW2B 3UT5B 4ITCA 4S2GA 4XJAA 2EXJA 4FVVA 3R4SA 2RS51 4IHJB 3PHMA 2BYVE 4WM8A 3AKRA 2Y69C 4NOTA 4XPVA 4COZA 4LFAO 2EILC 2HH9A 4JGYB 4YGBA 2VZ1A 2CTWA 2EJRA 3ZBHA 2RS53 2R9RB 3IKWA 4DV6B 1PGW2 2H3OA 3UGHA 3M7AA 3IDCB 2A6XA 2XAGA 2F4VO 2Y6KA 1A6CA 4PA3A 3AJYA 1LHNA 5I93A 2YY1A 2ADDA 3PUHA 2B9UA 5K0UB 3ZCCA 1V70A 3OYWB 3E22B 5ERLA 3ZSEA 4AVCA 1S3JA 1F2NA 3LE0A 1JJ2U 3KZIZ 4XBFA 5BMVB 1CAXA 2ET1A 3LNNA 4PLNA 3BIWE 1GWMA 1IDSA 4BK5A 4Q4Y3 2Y4UA 5FZEA 4P9XA 4ZI7A 1WD3A 4A7YA 5I91A 2B5UA 2JG9B 1LNQA 3VDAA 1UOFA 1XNBA 1EN4A 1R3JC 3TGUH 3T1MA 2E75B 3BYWA 5F7UA 1Q86W 3O14A 4CXYA 5C8YB 3UV9A 1YIJV 1OQEA 1LB2A 3I3DA 3WW1A 1M1KW 4RL7A 2MEV3 4IERA 1Q81W 3WF0A 2VQEB 2NYYA 1W6QA 2WZEA 4DUZO 1GH6A 4QX3A 1ENQA 1BKZA 3OMAB 2MEV1 3WV6A 4CDXA 4OHWA 1TUBA 2HEWF 3O1OA 1G86A 1N32B 1W2OA 2PF4E 2YS8A 3GVMA 5H9RA 4FP2A 2XJTA 1SKVA 3K0DA 2QQMA 1JI6A 4YWAA 3K3OA 3AP6A 4R6ZA 4QX7A 4QDSA 2X6BA 1BK0A 3ZN0A 2IXIA 4AAXA 1DQ5A 1YYNA 1RUI1 3QBQA 2H8PC 2BNMA 2E5LB 4UCTA 3UKVA 3JCUZ 5F37A 3BB6A 5J7MA 1GN3A 2VG9A 4YVSB 3L75H 5EBLC 4GMP0 3LKJA 1J95A 1RHI1 5CISA 1JCHA 1B06A 4ZU5A 4AHWA 3JXSA 4U7OA 1HR0B 5L3FA 5GZDA 3ZLIA 3RMYA 3C7OA 4X6RB 4HKWA 4L2NA 4EN9B 3RJ2X 5FPXA 1SBFA 5FBZA 2OX0A 3V64A 2ZTNA 2FMLA 3ASNC 3U75A 4UF0A 5IVCA 3I3QA 1P8JA 5LA6B 2L35A 1QBZA 2PMWB 4AEKA 2WAOA 3WNMA 1P7GA 3OEHG 2ZA9A 1K3EA 3IAYA 4WVWA 3CCVV 5C5TA 4P5HA 3RYRA 5BUVA 5IVBA 4GH4A 1HB2A 4QPIA 4JAAA 3POFA 4IQPA 2WAAA 1CVNA 5C5UA 2GNMA 2JB8A 3JSLA 2WFPA 4YSFA 1JOYA 1BK1A 1FMD2 4UV9A 5FP4A 2UUCB 5F2WA 1Q6HA 2OS2A 4KWUA 3RYKA 4LBOA 4OHXA 4QX0A 5B1BB 4WF9V 3R4DB 1W2NA 3V0AB 5BNOA 2JE7A 3JD72 1KQSU 5F5CA 1M9NA 2BJSA 3C3TA 3FYEB 4LMFA 4JX0A 2FDIA 1BMFG 2O8OA 1GWKA 4XDOA 4L9BA 4IYHA 5C3QA 1ZRRA 3IM0A 1K42A 2VAUA 1SDDB 3FFZA 4FQ4A 3A0BZ 2DJVA 4DV1B 4IIJB 3PVNA 1H8EG 5F9TA 1WW4A 1HWYA 1JBCA 5I0TA 5IAXA 1PM4A 1RXFA 5BNNB 2KD7A 1KGYA 2QSAA 2WWWA 1OCZC 2GAUA 5F5IA 4YG3A 2CK3G 4FO9A 2OWOA 3ZYGA 3KVAA 4FLTA 2YXLA 1EV12 4YLZA 3UETA 4Q26A 4LIVA 3HKCB 1PO13 1C1FA 1X9TA 1Y76B 4RHV2 2C1FA 4FFGA 5HCAA 4I0BA 3AKQA 2P6HA 3QTCA 2XKPA 4XFCA 4MXWB 5DAVA 5DZGA 1G8WA 2QBXA 2CGNA 3ECQA 4HN1A 4YW7A 3GB7C 3M3EA 4Q0QA 3ETEA 5LBCA 2GTSA 4MG2A 2BTQB 5L3BA 3AK2A 5DEDA 2PUSA 4PLMA 1UYPA 1FAYA 2RS11 4WVMA 1GOFA 3ZHQA 4P9GA 4AQYB 1WB7A 3KVBA 3T2PA 4R9CA 4KWKA 4NPMA 3BABA 1W03A 5ITZA 4OI2A 4XMAA 1N8RW 5FP3A 5A32B 1J5EB 4IL7A 1RUG1 1KUQA 1ZAUA 3ETPA 2CH7B 2RR12 2DFCA 1GP4A 1QJU2 1OCCB 4NIIA 4QDQA 3RS6A 4NIGA 5L3GA 3B4SA 5IATA 4DO2A 3RBZA 1Q8PA 5LP6A 3LSEA 4RO2A 3AEIA 1F35A 4YZ2A 3VBFC 2RVAA 4NVPA 4CU6A 2CUGA 4HMZA 3BUCA 1N32O 3VKFC 5LA6A 4JI4O 2R32A 3WG3A 1FFTB 2B1IA 3APOA 3ZXFA 3CXHF 4ZIBA 1BHBA 1K33A 1YJKA 2ZINA 1POV3 2YBKA 4EB6A 1VRH1 3ILRA 2P1BA 1TGOA 2X5IA 5LZ6A 1W6NB 4YW4A 4LT5A 4W65A 3ZRWA 2JKXA 3P6BA 5C8YA 2A5ZA 2FMYA 1FATA 1OOPB 3DGEA 4DV3O 4JRAA 5A3MA 3LA3A 4Q4Y2 3AG3C 3PUQA 3T1YB 5J48A 3ZN1A 2CDYA 1VJ2A 1ROPA 4E9KA 2HYKA 1NVPB 4AHXA 3O7OA 2EZPA 1WLCA 1TE1B 1XNAA 2C9AA 1XNKA 3ZFGB 3GCWA 5LP6C 2XXZA 4XQDA 4NHLA 3JUUA 5LK7B 2LGQA 3H1YA 1JZ5A 4E4EA 1MG1A 5FYHA 1VBE1 1OH4A 4X20A 1W8UA 3VUOA 1EM1A 2ZT9B 1OVSA 4EE2A 2R042 3ZHTA 2VVFA 3ASOB 1J84A 4YY3O 5IK7A 3TXQA 1E5RA 2QTSA 1LOEA 5FYIA 3WSOA 1H1MA 3M2MA 1AROP 2X6AA 2H6BA 4CXWA 4AFDA 3IC9A 3RYHB 1Q7YW 1KKDA 1I1EA 1LOAA 1B3QA 4B3TB 5C4WA 4LF9O 3W21A 2Q4SA 3MICA 1EV13 3AG4B 2GH2A 4ZI7B 4FPCA 4IE5A 4JYBA 1VBC1 3KV6A 1KS5A 1EV11 1FYUA 1AR1B 1W06A 3KT1A 5CKQA 1JMUB 5LRSA 3H9VA 2BP6A 1N33B 3JSNA 1DF0A 1W8HA 1Q8OA 2VNVA 2ZE5A 2JJ2G 1GM7A 4GULA 2PAEA 3BA9A 4CP9A 5IYYA 1K9MW 2EIKC 1OT5A 1MS8A 4NPRA 2NMNA 5FYMA 2P90A 1QJX2 3ST7A 4OQ8A 5A6XA 3H8UA 4TQFA 2DW4A 5BXZA 5LBBA 4HG6B 3SHRA 3JCIA 4RR3B 2A79B 1OF3A 1OA4A 3RYCB 4ZS2A 2ZOEB 1R64A 4Y1XA 4KWJA 2L6LA 4UYBA 3HAGA 1AI4A 4JYCA 4BQ1A 2YIDA 2UU9B 3MEPA 3OSDA 4AE2A 2WSSG 4LWSB 4J9ZB 1JA8A 1ACCA 1VBD3 2ZGRA 4Y24A 2GSMB 1RUG2 4PJ0Z 1ASJ3 4ZBMA 4LEJA 1FFXA 2JE8A 4BQ5A 2YDEA 1EAH1 3NQHA 1FXKC 2Q69A 3AP7A 3GYDA 1XREA 3R4UA 3BFRA 3JCZA 3RI9A 4C0BA 3T1LA 2Z4FA 3HT2A 4MADA 4X62B 3EFFK 1UMHA 4BZ4A 4YZ1A 2VL4A 2AHYA 1QLNA 2J42A 5L19A 1WA8B 5A7SA 3M3QA 4L0PA 3JAKB 3T2QA 2G9FA 4M0NA 1YO8A 3N9QA 5DABA 1NXMA 4MGIE 3ZKYA 3VKMA 2Y6JA 3EHKA 3OPZA 1ENSA 3ACLA 2HHHB 3WHTA 2OYZA 5L36A 4DR3O 1RUI2 3T0AA 4LQRA 4PLOA 1GUIA 1ODNA 1QR8A 1URXA 4OZOA 1JYIA 2BZDA 4XMIA 5CBGA 2QQKA 3MIHA 3R0RA 3IBMA 4K35A 3BTXA 3ZIXA 2GZWA 3IPVB 3SISA 4ATEA 2P37A 3ZFFB 5CBHA 3LDRA 2B8MA 4CCOA 5FJKA 5JIAA 2ZGOA 3QD6A 1IS6A 1IZ3A 3HBZA 2PQQA 3CZJA 4NKGB 1COV3 3OEBA 3RRDA 2VUJA 2ZHNA 3OUJA 5FO7B 3WT3A 4AVSA 4Q4X1 2CTVA 2DUOA 2WLKA 4P02B 4QKBA 2OUJA 1VR3A 1FKAO 3R65A 3ZMNA 4BDVB 3JATB 1OI6A 1ALYA 1COV1 4MVOA 1GM9A 2FCTA 3UQ8A 4QQ2A 4Z2WA 4DR2B 1BBT2 1Y9GA 3JQWA 1PO12 1BQ0A 1C1LA 3FUQA 2PLV2 3K5NA 3E5QA 4PBPA 3AG2C 2A9HA 4LF5B 1YUDA 3J4UH 5I8TA 4O4HA 5IYZB 4ASLA 2EIMC 3TEXA 2VZQA 5LMUB 4RQEA 2YC4A 3B5LB 1KJRA 5L7OB 3S7IA 1RITA 4CUCA 5F1RA 4Q4V3 3NO8A 4HVRA 1HRI3 2DQ0A 1O3QA 3TN92 4JTDB 3T0BA 3WP6A 1UU6A 2A3WA 5GLVA 3ZIAG 5IJ9B 2ZX4A 3WG7C 2DURA 1UY3A 3RDIA 2JKBA 4DR4B 1REFA 3VBFA 1Z78A 3AK1A 1QWRA 5JSRA 2E32A 4YW6A 2LW7A 1K97A 1ZBA3 2DQ3A 4ES9A 3TEZA 2X7RB 4IV3A 1VIBA 4FK5C 2Y6FA 3VD4A 4UCVA 4QB6A 3MFAA 1V9PA 4FCAA 1QJZA 1NLRA 4AWDA 1SQXH 2WNVC 4YNIA 1HKDA 3CIHA 1H2LA 1Y9QA 2DWRA 1CPMA 3VKNA 2TEPA 4H14A 3ZYJB 1XU2A 1UFIA 5JVVA 3ACIA 5A7NA 2Y38A 4LO7A 4FPYA 2EINC 3X2QC 1ZZ9A 5IE9A 3K2OA 1SQVH 1LGCA 2WINB 1N3OA 5C3PA 4QMAA 3JZVA 4DUZB 1K4CC 4EQVA 3PMSA 1W0PA 1DLCA 2ZPXA 3NNJA 2DN9A 3PURA 1CZSA 1C8M3 3NJXA 3H42B 4KFMA 5CG9A 1HQWA 1AL22 5H5NA 1GAXA 3NJYA 2WNOA 4Q2FA 2LQTA 5EIYB 1AP5A 4IEQA 4LF7O 1DZTA 1VQ6V 3KHBA 3FKSG 1DQ4A 1PK6C 2FQPA 2ET7A 2WO3A 5FY0A 2WNUA 3P32A 1LU1A 2ZE6A 2JWPA 2CGOA 1GOHA 4CCLA 2A6VA 2HWF1 5JXGA 1SBDA 2PI4A 3AMNA 1RXGA 1UF2C 3G71V 4OMCA 5KC5A 1HRI2 1EN6A 3K58A 1H6XA 2XWBB 4GX2A 2YSUB 3KS7A 2Y0OA 2DU1A 1R082 4Q20A 5HBAA 2Y6HA 5IVFA 4JASA 4LO4B 1XRUA 1H9PA 2HJIA 1HNWO 3BCCH 3PNAA 1AILA 1WBFA 1WWYA 3QACA 4WM7B 3GBFA 2RQ6A 2B1GA 3DYMA 2ZEWA 2QWPB 4DQAA 1XC6A 1E5SA 3R05A 3NRUA 2WQZC 2E31A 2JIGA 3OY8B 1W6PA 2R071 1VBB2 4BWAA 5EYYA 2RN9A 4PELA 3N4MA 4GX0A 3ORJA 2ZGQA 1GFF2 2XVGA 4I0XA 1QMJA 2GC2A 5ITZB 3VL8A 5A80A 2AENA 5FZ6A 3ZSLA 1Z5VA 5BNNC 4DO0A 2KSDA 4EB6B 3VBOB 3I3EA 5GKAC 3GHMA 1XE8A 1G6NA 2UXCB 4XQWA 4RQPB 3NVCA 2PYJA 5G04L 2HBUA 2OXBA 3GJBA 1XNDA 1Q8VA 5BPXA 2CWSA 2P06A 3M4FA 2KG7A 3VZLA 3ZYBA 5LP6B 4RFRB 4BAYA 5T54A 2VOTA 1F5JA 3D4KA 1OA3A 3TETA 4FLUA 5ABJC 4O2BB 4ARYA 4NRMA 4DR6O 3GZEA 5FP9A 2AZ2A 3OPWA 3CS5A 1OHFA 2YZ4A 4ATFA 2W9XA 1A8DA 3MIEA 1VBD1 4I4TA 4UCSA 1IPJA 1XE0A 4QT6A 2DBNA 2VU9A 3MFCA 3U1XA 4Q29A 1NCQB 4D69A 2SLIA 1LGBA 4CEYB 3WB2A 4D8MA 2P7TC 1BCCH 3UKTA 2PHFA 2VM9A 5LA1A 2Q30A 4CDXB 2QJ1A 3MLKA 3SYPA 1DGRN 1XMQO 1PX3A 3O1TA 1VRH2 4YG6A 3FB8C 1CAUA 3E6BA 4FPPA 3WQ0A 4ZZ5A 3MHSC 1K34A 1A78A 3JYCA 1RVF2 3IT8A 2P17A 4QQLA 1N36B 2XVKA 1OFNA 5HV4A 2VGDA 4P5YA 3HBKA 2ZM6O 2ZACA 3RYFB 4O2BA 1BEV1 1OURA 3AK3A 2G19A 1PNFA 4Q1PA 1Q8SA 4O2AB 3PDQA 2YMZA 1TME1 1F31A 4EN7B 5FZIA 4O61A 1DZQA 3HKEA 4LPLA 4JZGA 3B00A 1SLAA 2ZZJA 1OUSA 1C5IA 3SCHA 4K0KO 1TME3 1CAXB 4DFSA 1QJU1 2A1XA 3FN9A 4MXVA 4QM8A 1F4MA 4LULA 5IWFA 4LHNA 4LNUA 3AMHA 2YIBD 3OEEG 2WLPA 2QQVA 1H38A 2GSYA 3S30A 1WP7A 5FJHA 2GDSA 1IG3A 4YG0A 3AL6A 2AEYA 3OBRA 3ZYHA 1RMU3 1KS4A 1UN1A 5IYZA 4Q4X3 2WWSA 3NV4A 4QAWA 4DRVA 5T52A 4HNAA 2ZX0A 2UUBB 1NBMG 1NT0A 2JJ1G 5FYCA 1HV0A 1O3RA 4MTFA 4GXLA 2QA4V 2QQPA 3FHQA 4HBNA 4O4IB 2PHXA 3OUFA 3J80N 2RV9A 3AKTA 3ZXLA 3RT3C 3VHNA 5FP7A 5A6YA 5LMUO 3OB8A 2RJKA 1ZBE2 4FIPC 3OMNB 4KHPB 4JGZC 3DGTA 4A7ZA 2E3CA 4YYOA 4Y4RA 1SZXA 3J7MA 5K0UC 1U96A 1GYKA 3WU2Z 2QJVA 4UW5A 2Q7GA 5CA6A 4LITA 4JRLA 4WFEA 4Q0PA 1JHJA 3PL0A 1SC5B 4A41A 5FYYA 3ZXAC 4WVVA 2F4VB 2JVDA 3V0BB 4A6SA 4BM8A 4V2WA 1WCKA 3B3QE 1EY2A 2VZTA 4GT1A 1K5SA 1ZX3A 5IT6A 2HP8A 2VQTA 3AKSA 3ZR5A 4D6QA 1V6NA 4Y20A 3ICXA 5A33B 1N1SA 4X1YA 2ARCA 4GJZA 1ZBA1 3GZUC 4JTNA 4WBBA 4IE0A 4GWNA 3FAVB 5CB7A 1YWKA 1M57C 5T5JA 2W39A 2ZM6B 3FBYA 4AI2A 3PLQA 1OKOA 5CB4B 2JDUA 4UFLA 2LRPA 4YJ3A 4AI1A 1UMIA 3T2MA 3JD1A 5DM6V 3CL1A 4EFBA 1BLZA 3IZOA 4B3MB 5LW9A 1U12A 2HG5C 3HR0A 2PGGA 1J3QA 4GKJB 4OUEA 5ACA2 1LOBA 1QQP2 1HB4A 1N1VA 4LO6B 4QHOA 1YIPA 4CUGA 4HKOA 4WFBV 5A7WA 2DVGA 1E1QG 1QJFA 1ENXA 4TZDA 1RVF1 2XASA 2JEXA 3PUSA 2ZEYA 4RUFA 2BVBA 1OJHA 1ZBA2 2HWC3 5E79Z 5BNQA 1RUOA 3G7DA 3PTYA 1JX9A 4RGKA 5TSWA 5LXTB 1AP6A 4HFSA 1GP5A 5EP9A 4JF3A 4JI6O 4PA7A 4XAEA 1UPGA 4J6GA 4WFFA 1GMMA 1IS5A 3MPPG 2YI8A 3W7XA 3B9CA 3FX7A 4DV6O 2HWF3 3VZJA 1QXJA 2QQIA 2UU8A 4RHV3 2P6JA 4GKYA 3MZHA 2BFUS 3I2JA 3ZDSA 1PMIA 2BOCC 4YZ4A 2WYSA 5FZGA 1C57A 3PUAA 1SLCA 4RHV1 3O12A 5IAVA 2F4LA 1JOJA 1QHTA 1JYTA 5JWPA 5E89A 4L8QA 3AZYA 5CFCC 4FZ1A 4XDLA 3RG0A 1SF9A 2J1UA 2PN5A 4RA0A 2XAQA 5FFOC 4LF8B 4RQPC 2JDHA 3BPSA 3FHAA 1L0NH 4L87A 2RMKB 4RWUA 2VW1A 2EBOA 5G05L 3NAPA 2K9ZA 4J80A 1PVC3 1RUJ3 4N43A 5H2FZ 5IVYA 5DDJ3 5JOYA 1DHKB 2ZGMA 3J7LA 4A3ZA 3CCRV 5LXTA 3APQA 2BV4A 4ZHQB 1RUH3 5LA9A 2JECA 1RUJ1 4P08A 5JMCA 2Q8VA 1REDA 3I97A 1GO3F 2WDBA 3POJA 5BV6A 1YQ2A 3T4DA 1FXHA 3RJRA 1MR5A 2KM2A 3HEIA 1ZYBA 5FZBA 1ND2C 1UU5A 2KB1A 3KB5A 3WD5A 2VQAA 3HT1A 5HCFA 4BPZA 3F5TA 1OD5A 2XL7A 1O5LA 4E4DX 1VBB1 3DEMA 2Q1ZB 3TEWA 3CCMV 1QNYA 4N8MA 5C8CA 2ZCEA 4QQOA 4I3GA 4JQRA 4F6EA 4FFKA 2WABA 2QQWA 4FFHA 4JC1A 4I5SA 2Y69B 4YFZA 4MX3A 4XXPA 1NQJA 2DVAA 3B8MA 2P4EA 4JV5B 2W3JA 5FZ1A 3IWZA 2YPDA 4I3PA 3NAPB 1NY71 3SYCA 3K06A 4BXFA 1OKQA 3EMRA 4CEWB 2GU9A 3M70A 1VRBA 1ZREA 2FDFA 2ETNA 1PK6B 4LTAA 3BU0A 2Q73A 1UY2A 2JIZG 1V54B 4XUNA 4XJ9A 1RUC3 5FPVA 5IYBO 5DG2A 5IDJA 4AQYO 4BWOA 1RUC1 2RR13 3VOUA 1RIRA 2XHKA 2GN7A 1XQNA 1E79G 2ITDC 1W6MB 3OGRA 4UFHA 1JQ0A 1ZWIC 3LAGA 1GR3A 4W4KA 3X2QB 2RNBA 1SCRA 1D2SA 4YHHO 4LF8O 1G4YB 4Y1ZA 2JENA 2VQEO 3ETDA 3ACGA 4X65B 1NZIA 4N53B 2W2IA 5KX5B 3E2EA 4YPJA 2MPFA 3OUIA 3B77A 4P9PA 1S2BA 5J2UA 4XOGA 1PV0A 2YU1A 1H2MA 4JKKA 3WCRA 3BN6A 2GDFA 4Q1RA 3CD6V 3KLSA 5LEJA 3GALA 1S0IA 4NYKA 2VCMA 4PDWC 1VMFA 4F83A 2V4VA 4JI4B 1DF4A 2Q5ZA 1JYCA 3OGVA 3IMNA 1S0BA 2D6KA 2WQ4A 4QPGB 2WQ8A 1G9CA 1GZWA 4B3SB 2AUYA 4JAUA 2BDRA 4M0HA 1FJGO 2A0LA 1H8TC 4C91A 2YROA 5FR3A 3AYEA 1O3TA 5FOBB 1XNQB 4BXSV 1POQA 3AL5A 2KA3A 1SZTA 1QOOA 2D3SA 1MSDA 1LJ7A 2XWJB 3T1CA 1OQDA 1FPN2 2CSGA 1NA1B 3Q8AA 5L3EA 3ZN4A 4YXWG 2ZIOA 3SGIA 1W05A 2J1VA 1L0LH 2DFBA 1R083 4Q4X2 4Q6GA 4HETA 5DUUA 4XW3A 4GLXA 1VMHA 1AL0G 1X7NA 4QX8A 4LBEC 3CF6E 1GN2A 5A33A 1DP0A 5A3WA 3FL7A 1R081 4HONA 1T6GC 3HKCA 1AYM2 1KMIZ 4OZXA 2ORXA 1XBFA 3AG7A 2W46A 2X5IB 3ZXGA 5LB6A 4EJRA 2EILB 4QJFB 2ERFA 1W9WA 1CAWB 4XXAA 3KV5A 3N2KA 2OPWA 1DLBA 1LESA 2HWB3 1JMKC 4CBCA 4CDQA 5H9PA 2JDZA 3BVCA 2J1RA 2LALA 2Z2SB 3VBSA 3G80A 4RAIA 4K21A 4MGQA 3WP4A 3U14A 3IDAA 3JD3A 4EWDA 2HWB1 5IJ0B 1IURA 5FNVA 2W1SA 1B35A 5A7OA 2ZGNA 3T1HB 1FNYA 5FY9A 1YFUA 2ES3A 4HK8A 1HNWB 3W58A 1S0GA 2VVEA 2CL2A 4KH9A 4CC6A 5DECA 2HR3A 2J1TA 4QHBA 1ZX5A 1H8VA 5JOZA 4P9IA 4XFBA 1ZL8A 1W8FA 2YBPA 3LEKA 1QF3A 4IV3C 4E2QA 2VBPA 2XTAA 3IC7A 4OI1A 2HWD3 1NE4A 1ULDA 2BNNA 2XHNA 2VQ0A 1CZTA 1WP8A 5JZGC 1XILA 5CBLA 2E53A 5D21A 1LGNA 1D0HA 2B9VA 3I5DA 2RM21 3DCQA 4EZHA 2WFF2 2HEYF 1RPRA 5FTTC 3L72H 4FXGB 3J26N 2JX9A 1JPXA 3OW2U 3Q9OA 3MI8A 3POYA 3H1KH 1AXYA 1D4M2 3ZHVA 3HNYM 5KHJA 1YI9A 1SQPH 3AG1C 2ZHLA 4XUPA 2I2SA 2OYQA 5FZAA 2VW2A 1R091 1R6NA 5K8SA 2PFWA 5LASA 1AR93 4O2AA 3SPHA 4GB31 2VQFB 2Y64A 1HIXA 1XB9A 4IDZA 2D98A 4GD4A 1OZ0A 4CXXA 4AGRA 4ES8A 3OY8A 4EN6B 3IB3A 5IWAB 3THOA 2BGPA 4J42A 1KP3A 1WMEA 5IVVA 4IESA 2NM1A 1AR73 5ABJB 3FB6C 1WAZA 1T6BX 3B8NA 4FOVA 4KU8A 5BZBA 3DXUA 4X1KA 1DFQA 1PGL1 2XNDG 2IW5A 4KU7A 4UFZA 4WVMB 5EFUA 2CTQA 2HVKC 2UWCA 3Q8CA 1W39A 2XUMA 5DQ0A 5FO9B 4MSWC 2W47A 2W68A 4DY3A 4S2FA 2VNGA 2FDGA 3K08A 2P22C 4ONUA 1BBT1 3WNPA 1NY72 4X1IA 2YPJA 1FXVA 3SC7X 1A8MA 2V4AA 4C7UA 1YNAA 2RCVA 4EWEA 3THPA 1S0DA 1MZEA 3GCXA 1Y7BA 3VDDB 2WNEA 1VF7A 5FZOA 3AYAA 1ND2B 2R041 1D2QA 2DDUA 3HWJA 1VEWA 1H1AA 4UI9L 3N9LA 5L9BA 3HB3B 4HK9A 5IJRA 3WG4A 3HJRA 2R043 4CDQB 2IXLA 5EWSA 5EC2C 5FQ0A 3EYPA 5JSPA 5EZYB 1W99A 4AW7A 2JDMA 2YICA 5C33A 4FVMA 5FREA 4PIYA 4E2LA 1VF5B 1WPBA 4QXBA 1UX6A 4R9AA 2R9IA 3C8XA 1L8DA 2WLIA 4UOJA 1AJKA 1AR81 4WM8C 1W9TA 1VAVA 1ZZBA 2UUBO 3H1IH 3VB9A 1GM8A 1LUWA 3UT5A 4F8AA 4AAPA 2Z79A 5I0SA 4B7KA 1LHWA 2JD4A 3ZIWA 4GH4B 1NT2B 1JZ4A 3C90A 3B40A 5J2TB 5EIBD 1W2TA 5KBFA 1UXXX 3KM5A 4A7KA 1O5UA 3CC7V 3BHPA 2DYCA 4XHBA 1L7RA 5L7OA 4GZRB 4YVWA 4XDQA 2ZXWB 5JVDA 3WG1A 3UESA 2DYSB 1NTKH 1GRJA 1A34A 3G4SV 1VARA 1ZLZA 1C8M2 5KA6A 4BMEA 2IFRA 4QGLA 3LFIA 2KQXA 1D5AA 4QQPA 4PDMA 3AMQA 1FNZA 1XJAA 4HYOA 5H9QA 2RS33 5KHIA 3O5SA 4B3RB 3MUZ1 4A44A 2JG9A 5FPUA 3JD4A 1NKDA 4HSLA 2DTYA 1X8MA 1I7FA 5I0UA 1YJNV 3IGAC 5FPOA 2Q1MA 4LF4O 3VBFB 4FLWA 3AX4A 3QH6A 5JUVA 1POV0 1BGYH 1FXKA 3WF4A 4BLIA 1RUC2 2CY6A 4DR1B 3MW4A 3NNMA 3ZYIB 3E6DA 4NIHA 3D36C 1MEC3 1WA6X 4EEQA 4DV2O 1DQ1A 1NS1A 1OCCC 3HR9A 1HXS3 3NKTA 5CADA 3RZKA 1VMGA 1IQDC 3HNMA 2DYRC 4YGCA 1HXS1 1I5XA 2ZGTA 4E4SA 5CA1B 4O4HB 2UU9O 5C71A 5FKCA 1GZCA 2OCCC 3JAWB 3ZPOA 4YARA 5IY5B 3CC2V 5L7OC 4OFGA 1MS5A 1G7YA 2W0XA 3OD4A 1NQDA 1TMF1 1NZ6A 3IN9A 5DDJ2 3B01A 4HOOA 1HNXB 3LA7A 5BNPC 1HRV3 3LDBA 2Q0AA 5EXOA 3HKBA 1X8EA 4TV8A 2BFUL 4FPHA 4MVMA 1U97A 2YGLA 2VMCA 1V00A 3M3CA 4NTWA 4LBNA 1DGRA 1XL6A 5KMGA 2F4PA 2VCBA 4AVAA 3KV4A 4MHRA 4I9WA 1IKQA 2ZHKA 5EIBC 4PQ9A 4GMP1 3ASOC 4IW3A 3RYPA 2XVLA 1OCRC 1JTZX 3NNGA 1V55B 4IEOA 1A32A 2WLJA 1FT9A 1RUH2 2EA7A 4M01A 2VCCA 4Q8KA 5B1OA 2B9ZA 5FYBA 1Q56A 4DYLA 2RDCA 4Z8BA 2YB7A 4QPKA 3AXEA 4AQSA 4BU2A 1L3JA 1UPSA 1Q8QA 1LRHA 4XHXA 4YFWA 1GV9A 2P3IA 4IV1C 4O65A 4YZ5A 3N7LA 5JR7B 2EX3A 5B4XA 4IEWA 4CVUA 4JYYA 4R50A 5FXWA 4QPGC 1GSLA 4JV4A 2FCVA 3G6JB 1JJOA 4TV8B 4AEDA 4DR7B 1CAVA 3FX3A 3FAVA 4J7KA 4CCNA 3WNOA 1V6MA 4U3JB 1QDOA 5LHGA 1AVMA 4LF9B 1RSOA 3H9AA 1K5QA 4LXLA 2FDJA 1AR92 1O8PA 4HVQA 3WLUA 4R8CA 1NG0A 4UBGA 3SMHA 4ASKA 3LZZA 3ZX7A 1OSGA 1AHSA 4O7XA 5T5OA 3JBG2 2JDAA 4FPJA 4TSVA 1RUD3 1TME2 1XEQA 4G27B 4A45A 5FWJA 1R3IC 2G38A 1G9BA 3H3LA 3AZXA 3KT4A 1AR91 1SS3A 4BQ4A 1RUD1 5CB4A 4LA3A 4P14A 2YIAA 3E8FA 2GP5A 4NRPA 4M3CF 2RM22 5CA3A 2J1EA 4JI5B 4HZFA 2GN3A 2QVSB 4UV8A 3CJIB 2XR4A 4BQWA 3N2GB 4JQTA 2A3XA 3POWA 5FZCA 2ZKLA 1RP3B 1AJPA 2GH8A 5CVRA 3VD3A 2E74B 1G6UA 1Y66A 2X10A 1UKGA 5FXZA 4UFKA 4NXMO 3WQ7A 2A75A 4IE4A 1OLQA 4LFAB 2C0ZA 4MUVA 2X0LA 3RMXA 3LEMA 4PIXA 1BHGA 4NJ4A 1CPYA 3CRMA 4AVVA 5FQ0B 3UYJA 3I7DA 5ACA3 3CRQA 4AGGA 4LLOA 4J25A 2DCYA 2XHBA 2JDIG 4QXKA 1XE7A 2E63A 3GXUA 2WRAA 1BZWA 1CJPA 4YJ3B 2WAMA 4RS5A 2QE7G 1W90A 2D7FA 3VKLA 3VL9A 1X33A 3D3IA 3U0ZA 3VDBA 1H6YA 2R1DA 4PBOA 1DYOA 1TVKB 4TYSA 3NV3A 1N33O 4E2GA 2MNGA 5J1XA 1IBLB 2UUCO 1IS4A 1HRV2 1F23A 4LHSA 4BCUA 4DIQA 5FZ8A 3N7KA 4CPBA 2D3PA 1F4HA 3K4DA 1SPPB 2NN4A 4FFBA 2UY9A 4U36A 4JKLA 3JASA 1SZBA 3K5LA 3CEWA 2EIDA 3RFRA 3BOWA 3A0NA 4AXOA 1GP6A 1L7QA 3ZPYA 4TUYA 1S0FA 2ZNJA 2X09A 4LKSA 1S0JA 1HXS2 4W6XA 5LA2A 1M93A 1GLHA 2IUWA 5CFCB 4OUSA 1PZ9A 1XMOO 1AR83 3POGA 4IETA 3WB1A 4O9EA 2CGPA 3HQXA 3RZHA 3ME2A 3DF0A 4KG8A 2ZXQA 5A9GA 4PF5A 5BR8O 3ROUA 5LCWL 1RM1C 2IVIB 1R1A1 1SETA 5FZ0A 5A1AA 2A6ZA 3SPIA 4RN5A 3J8F3 5C7GA 4KL1A 2HWC2 4UXAA 3LEIA 3IMMA 3MO4A 5A7PA 1CJDA 2ZR3A 4IE6A 2KG7B 3OCPA 4DXWA 1CAUB 1TG7A 3QG5A 2RS52 3J8F1 1APNA 1C28A 5EZYA 3GF6A 4COUA 2GNBA 4GCZA 3NR7A 4H7LA 2LTNA 3CNAA 3QCWA 1RHI2 3LQCA 1DBNA 1LTEA 3MLJA 1RGSA 5CFDA 1H2GA 3M8LA 3H3UA 1NX9A 4CRQA 3OTFA 1ZRFA 2BTQA 1NCQA 5F6LB 3VBOA 5DZFA 3KG2A 1HNZB 5EV7A 3I2FA 5KWRA 2XMLA 3BCWA 1CONA 3KGLA 1ZZCA 2E7TA 1VQ8V 1PKXA 5I8YA 3QO5A 1QEXA 4L11A 5F39A 3L9DA 1KDKA 1EPWA 2EIJB 3E89A 1RUE3 2P3YA 1J5EO 3O1PA 5HV0A 4NR1A 2B46X 2DF7A 3S57A 5FPRA 2B39A 3WDXA 3OUSA 1RUE1 3ZRXA 4FLYA 3J8F2 4XDPA 4PQQA 5H6RA 4B3MO 1ZA4A 1FOD1 5GM0A 1SBEA 3ZMVA 4LH7A 1UD1A 4H13B 2NPIA 1WGPA 1X59A 4UF0B 4B4PA 1FOD3 1BMV1 2P6CA 1QQCA 2WA4A 4IIJA 2WFF1 3E5XA 1GNHA 2AACA 2G4IA 3HKEB 1TMF3 3WF1A 1YLLA 2VVDA 2IXHA 5JXHA 3WG7B 3FBMA 4DR5B 5GZFA 4QNHB 1P7BA 4J10A 2BU9A 2QQOA 3O0XA 1VF6A 3ZYRA 4PI0A 3LPFA 2R072 4A5UB 3F95A 1CX4A 2XB6C 3TOJA 5A3UA 2FD8A 3LOBA 2YU2A 3VV1A 4LCUC 4XURA 3TN91 4C1XA 2PYTA 5FPAA 1W6OA 4DW1A 2YXSA 1CQ9A 3AG2B 4UFIA 1UMZA 3TN93 5C9AC 3MLLA 3WUDA 3J7NA 2H0VA 4G2KA 2NQYA 1Y67A 4PI2A 3RVYA 3QVNA 3A0HZ 4XE9A 4DXZA 1O6UA 1DDLA 4XFIA 5LYJB 1JS9A 3VZNA 3C7FA 4PDWA 1MVEA 4YGDA 5BNPB 3E86A 2JK5C 4CDWA 5DMYA 1CESA 3VQVA 5AC91 1I0HA 3V0AA 3K0GA 3OF1A 3M8AA 1H8TA 4GYCB 1F4NA 2EALA 3FFQA 5K1PA 5FZ7A 1AXZA 2DCTA 2KR2A 3QLQA 3N7JA 4XUQA 5M0TA 1UXZA 4XJWA 1VPHA 4U2AA 3JB8A 3USSA 4WM7A 1PNGA 3EXAA 2AW9A 2XBO3 2R061 4H37A 1RINA 1SCSA 2JXAA 4AQ2A 4UXNA 4W4LA 1VBA3 2XT9A 3WNLA 1SA0B 2K0GA 5C9AA 2ARHA 2R72A 4MGSA 3UNPA 2GTAA 2XBO1 4KP4A 3C2UA 4ZHNA 4I2OA 5D5PA 5CA0B 5GALA 3DXRB 5LHHA 4JVAA 1VBA1 2E26A 3Q8BA 1LCLA 2WZR2 1DQ0A 4JI5O 5EBMC 2UWAA 2K1EA 1MZ5A 4CH5A 4CZZA 5DAQA 2ZIMA 1CGPA 3K77A 4NAMA 3W7WA 1IPSA 2JE9A 4UVAA 1LNSA 4CDUB 1RUI3 1O9GA 2EAAA 1PO22 3VD9A 3BALA 3CCUV 2DTWA 2VW0A 3X29B 2JDKA 3E1F1 3FLPA 1PNKA 3H7JA 3LEGA 4AI9A 1UKRA 4B08A 1PZ8A 2Q7HA 1FD9A 3WOGA 2CTPA 1B04A 3AFGA 4RGGA 4GWJA 5FPLA 2GMMA 5J37A 5JR2A 2QM4A 2VRZA 1YQCA 5JI7A 3SQOA 1WN7A 5IFPA 3W59A 2YFZA 5D1IA 1GN4A 1RUD2 3ACFA 2RDRA 5F32A 1W9SA 1QQP1 5JJNB 3O9OA 3UM7A 5C3OA 1RJ7A 1W0OA 1S2KA 1NTMH 5LRRA 2Y33A 4ZPIA 4MGTA 1GKBA 4JTCB 4WM8B 3NAPC 1AB3A 2CYFA 4UB6Z 3H0OA 2BTOA 2EXKA 3S3XA 3KCYA 4IV3B 2HWE2 3MGUA 2M7WA 4M3CA 1UYXA 3QH7A 3OEAA 1IHMA 1ENRA 3BRCA 2A06H 4S2HA 2IU3A 2XJVA 1NAEA 1MA1A 3DC5A 2B5HA 2XUEA 3SCGA 2BSKA 2VNRA 1UY1A 2ADEA 4FBFA 3JB4C 3SYAA 5IJ9A 3OGCC 4JI8O 4CH6A 1OUXA 4LOSA 5F2SA 4TLFA 5A2QN 4WFGA 2VZPA 1TNRA 3I54A 2FCUA 1GBGA 4FLVA 3T4VA 3EB7A 5FZMA 2WT2A 3JAKA 1KRIA 5IK4A 4GKKB 3OJBA 4FI9A 5DN6G 5LEKA 5EC1C 1S72V 1SMVA 1YC61 1EYBA 1GTOA 5B2GB 3S3WA 3IPVA 4F6RA 1TA8A 2VPVA 2Q68A 2E7AA 4AVTA 4YM3A 5FYSA 2GNDA 2A70A 5JI9A 4U3FH 3VZOA 2CNAA 4JV5O 2VMFA 1COV2 1PM7A 3CJXA 4EN0A 3I2KA 4N53A 3WDTA 4D7SA 1UJWB 3OPTA 1HB3A 1O4ZA 4UW3A 2WL1A 1R1A3 4SLIA 4QKFA 4ZS3A 4HT1T 2VZUA 1V9U3 1R6TA 3DUIA 5APAA 4O4LA 2D6NA 1Y74A 1AI6A 2PYLA 5FOJB 2DVBA 2A73B 1OPMA 3QO7A 1SQQH 5AVAA 4J7ZA 4JI2B 3K5MA 1HQNA 1OD3A 4IGQA 1NCRA 3U4XA 2RS13 3MD0A 5LBFA 1MABG 2QQLA 5JAXA 2B4KA 4XF3A 4Y1VA 1WW6A 3FD9A 3L9JT 5FRAA 1XQ8A 3RQ0A 1EAH2 1TVGA 2CAUA 3B2EE 4TXWA 3NNFA 3AP4A 1I5ZA 3J7HA 3W7SA 1CXZB 2GC3A 1CIYA 1W8WA 5FK8A 4LBJA 3ZVXA 1ZVFA 3C7GA 5E1AC 3CKHA 2Q9LA 4AYUA 1PNMA 4EKWA 1XYPA 2LJ2A 4QM9A 1O3SA 1OC1A 4AZZA 3VZKA 5C4WB 3A0KA 1W8ZA 3CMAV 2YIBA 5H9CA 2QZ3A 3L2HA 1XNTA 1DGSA 5C8WA 2W1QA 4B7EA 4RUEA 4DW0A 4Q0VA 3SJBC 4QGPA 5C6CA 4MVQA 4P9WA 3CYOA 1IGOA 4ZU4A 5F3GA 1JZ3A 4HN0A 2WFF3 2LW1A 1QJEA 4OI0A 3ZRVA 1FV2A 4MV2A 3KCXA 3ZFEA 1FAFA 2C26A 2P67A 1DG6A 1B6QA 1JUHA 2BSKB 1M5IA 1QJY1 1HLCA 3Q8EA 2ZDIC 3D3AA 4W4ZA 1UOGA 1Z7S3 2XQXA 2OTJV 1RUJ2 4H0LB 4CCJA 3BODA 1KD1W 1LULA 1G1XB 2ILMA 3U07A 5FK7A 1Z7S1 3NNLA 3EXUA 1OV9A 2W94A 2QDNA 4NIAA 3NKGA 3AXDA 1WJZA 3FMGA 1MQTA 5FMCA 3S7EA 3ATGA 5FAXA 4BIOA 4K8XA 2R16A 4QDRA 1HW5A 2RJZA 3IDEA 2WLLA 1SHWB 4LBMA 3DYPA 3WDYA 5C9AB 5LY1A 5J96B 3WNNA 5GZGA 2HHHO 2YUEA 1WKYA 2ZMLA 3T1HO 3LUTB 3AC0A 3UKNA 4XBLA 1H4HA 3T3YA 1WW5A 4WZCA 1A3KA 2XL9A 2F23A 3SH4A 5KHGA 1VQ5V 1S77D 1GQGA 4HLTA 3S6PA 3LF7A 3VDDA 4XFAA 3H1HH 2JS3A 4YW5A 1FS0G 1REEA 3MBWA 4HXCA 1H8TB 1HV1A 3MIBA 5B5EZ 1Q90D 3ZXKA 1IVSA 4RYDA 3R66A 4F6RB 1J59A 4NO4A 4MTGA 2W95A 5IUQA 3SDLA 1U5ZA 2PQSA 4QKNA 1YQ5A 3RWKX 1QLEB 2XAJA 2EIBA 3MIGA 3WINE 1JOPA 2QKAA 4FMTA 1NVPD 3LSSA 4LNUB 3LSDA 3VN4A 4OPAA 1B35C 2EF6A 3N3HA 3EBRA 4QXCA 1BQZA 2QDOA 2E9QA 4GX1A 4BYYA 3HQUA 1S5JA 4J9YB 1VLNA 1QHDA 4Y1UA 1WMDA 4FAHA 1JUIA 3ELNA 1E5IA 5FY4A 1GU3A 1FMD1 4LFCB 1RHI3 4O4IA 2CWMA 4X1YB 1VQ7V 3PTRB 1FMD3 2VOVA 4AG4A 4Y20B 1GMGA 2LW8A 2BUKA 4O4JB 1MEC2 1ZNPA 1C3HA 2O14A 1M06G 3M1HA 3H8RA 4CS2A 1PPJH 5D8AB 5A6ZA 2Y60A 1XI1A 3TBDA 4YVSC 2W1UA 2VC9A 2ID4A 3N9OA 1Q43A 2EXHA 1PL0A 2WIIB 4WBNB 5KXCA 2MK3A 2D6PA 4FM1A 2QWOB 3ZYFA 5KHKA 1W0KG 1OH3A 2Q67A 2P5OA 4NWWA 3ZSKA 4J41A 2FMDA 2YEVA 5KHHA 1AR4A 4BIFA 1XDCA 3A2FA 4MTXA 5F8PA 5A3LA 3BPZA 2V5YA 3SJCC 3B02A 1QGLA 1RL3A 1ZBE3 5C8CC 1N4CA 3THTA 1J3PA 2BEOA 2OCHA 1W6PB 3OFNG 2GMPA 4AF9A 4LKEA 1RTVA 4IL6Z 1ZBE1 3AJZA 5A3TA 5J36A 3VHRA 2CDPA 1QXRA 1SESA 3M7MX 3R6SA 2LUWA 5AVPA 1LENA 5LWBA 4DR7O 4TWTA 1NKGA 4QKDA 2LFSA 1WB8A 4SBVA 4X89A 3ZS8C 2LS6A 5LMNO 4Z2AA 1YFXA 2XOKG 2ZKOA 2RHPA 3KWVA 5T5PA 2HWB2 2NLRA 1I6XA 2XOMA 1ND2A 2OQ7A 4LKDA 3CCEV 5AC92 4GUNA 1BL8A 2W6JG 2DBIA 3TWIA 5BNOB 5GZCA 1V55C 4JGZB 1KC8W 1M56C 1H0BA 4UT5A 3SEEA 2BERA 4AFAA 5F3IA 2ZCWA 3A21A 4UW4A 1PO11 1L1FA 3GJAA 2YXHA 1V9U1 4X1IB 1KFXL 1DQ2A 3N7MA 1JU4A 2IWGB 2H6CA 2I74A 1GNYA 1NZCA 5FZ3A 3MF9A 1NR7A 1SLTA 4EZ4A 1FPN3 4NROA 1US3A 3P30A 4JTOA 2YI9A 5BNNA 1VALA 5FZLA 4RQPA 3VBSB 3O1UA 5CFDB 3VHOA 4YVWC 3TCUA 2ORZA 4X1KB 1W28A 4JZ2A 4ISRA 1HRI1 5J3UA 2LGWA 4C8DA 1QCEA 4LJHA 4CCCA 5C3SA 4A6OA 3AZWA 1RUNA 2DYRB 1HR0O 4CCMA 5LATA 1DYPA 4IEZA 3N36A 5GTIZ 3ES1A 4HPKA 3AMPA 2WYFA 2F17A 3B7MA 4B1MA 2BQPA 3CWBH 3FLRA 4DR1O 1RUG3 4CCKA 1I5PA 3CMGA 4AFBA 2YEVB 3U4SA 3CPWU 3K79A 1U0AA 1U5IA 4OPHA 1HX6A 1H2NA 5FPZA 5KXDA 4FM2A 3WX5A 4O9GA 2LM3A 1SG3A 5IVJA 4DV3B 5IVEA 1POV1 4K0KB 2XJPA 5FLIA 2TUNA 3F5WC 3KF5A 1QXPA 4PDRA 3VGIA 3M99B 4EFEA 3KGZA 1SPPA 4I02A 3F2ZA 1OLMA 5KXBA 2WT0A 5JDBA 5IT9N 5A6QA 3AP9A 1YVWA 2IJJA 1AF9A 4JDMA 3VBUA 4JKMA 2AXTZ 1ZSPA 1LOFC 2UYAA 1W2UA 5AFEA 2XQRA 2F1MA 5FIXA 2ZE7A 5T55A 4FTSA 3QOPA 1MS3A 2V09A 3JBG1 3ZN5A 1KITA 1NI8A 5H6QA 3AP5A 2Z0AA 5IJ0A 1BS3A 1D5NA 4JGSA 1JOBA 3USUA 5FY8A 1YSCA 1F51A 1N0NA 1YJLA 2JEUA 3WR0A 2PAMA 3KSCA 5FZ4A 3WNXA 1STMA 2D40A 4CP0A 5BR8B 1ZZ7A 4GALA 3VQXA 1GZWB 1N3PA 2XH6A 4Y5Z0 3CBNA 1PVC2 5A3PA 4MSVA 3DKQA 4JCKA 2X53S 3ZN6B 1N36O 3SLIA 2R1BA 1AVBA 4Q4V2 2QDRA 1S0VA 1RPOA 2XJRA 2E7QA 3CB2A 3B9IA 5DUWA 5AG2A 1V9U2 1Y3TA 2ZX3A 4U3JA 1LUVA 1NH2D 3K57A 1GK9A 4CEWA 1G9FA 5A1FA 3H1MA 4MW3A 1PP9H 3BTZA 1D0GA 1AYM1 1ZRIA 3LDDA 1XSQA 4ZXEA 2JG8C 4DV0B 4IGGA 5FLXN 5FYVA 4PA9A 2OW4A 3VBBA 1AYM3 2QM8A 4JYAO 4WM7C 1VBC3 3OYWA 3ZFFC 4JTAB 5C8CB 3W5NA 2BBVA 4H33A 1DIWA 3A0RA 3M3OA 4XC9A 2OPKA 4YW3A 3CJHB 3L74H 3SH3A 3VDCA 1DF5A 4LFCO 4EN8B 4GKKO 2ADPA 5JZGA 5I0RA 5D5QA 1QH7A 3L73H 1UYYA 4BB3A 3PMEA 3URFA 4E27A 3LA2A 3I55V 3RWRD 3AZZA 4ISQA 1PK6A 2BPA2 3L71H 1NE6A 5GLTA 2PHRA 1ULFA 5GLZA 4DV5O 5T3NA 2QTOA 3ASNB 2D44A 3K46A 1SACA 3B09A 3HQRA 4JI3B 1MS0A 2ZD9A 3CDZB 1WCSA 2F66C 4Y4YA 5GLUA 4XF9A 1EAH3 4ZU7A 4DEVA 4YJ2A 2BGCA 5C3RA 3E5UA 4RR3A 3IAQA 1DGWX 4K1YA 4QB2A 1K5JA 2QGNA 3T4ZA 5K0UA 2IFWA 4CEYC 4INDA 4MGKE 1QDCA 5A3NA 1YI7A 1NYWA 2B42B 4K40A 1H4GA 1BSMA 3FHIB 2RJ2A 1FXZA 3GM8A 2ZX1A 4LNVA 4BQ2A 1F7YA 4R4ZA 1KJLA 1EZVH 2FYUH 3CJHA 4JGYA 3FB7C 4CDUC 2A7WA 1Z2GA 5LBEA 5IW0A 1WMFA 3CCLV 3KD4A 2VUDA 3OTOO 3L2YA 4DV7B 3VBHA 2IBZH 1JFFB 1BVVA 4QE9A 1BXHA 4OX9B 5LK5A 1KYOF 5D2AA 5F5QA 5FV3A 4I0WB 4I0AA 4BISA 3HKBB 3ILNA 1E5HA 2HBTA 3TYJA 1U5XA 1ZM1A 5J9PC 5LMNB 1EP0A 1WUVA 1VBC2 2EIKB 4URTA 2XG3A 2OZJA 1AX2A 3E6CC 1XOUA 1UZWA 4P9YA 4F3JA 2ZGPA 1UIKA 2ZAAA 3ABKB 1UW8A 5HFMA 4DR2O 5LBQA 5EHDA 4JPRA 1WZXA 4TSFG 1K4DC 4LORA 3K4ZA 1ZA7A 1ZRDA 4DS0A 2GUZB 4CTEA 1XMOB 2RS12 2ZKNA 4MYEA 4MHUA 3SKVA 3JARA 5L9VA 2XAHA 5KMGB 4XAAA 2NN8A 2H0BA 4XUTA 1F5FA 1NR1A 4RGAA 1UNBA 4N43B 1Z5WA 2YHJA 5HFLA 1Z7S2 1ZTEA 3D0JA 2WJSA 2OT7A 3UGGA 3G67A 3HIFA 4QD2A 3P3PA 4MTOA 4FQZA 3F7YC 3ZMSA 1JYNA 1SLLA 3LWCA 2GHYA 4M00A 5T50A 1IBMB 3DN7A 2HWE1 1QJY2 3FWEA 2F43G 4Y5SA 3MAQA 3ZSMA 2HJDA 4GWIA 2VWKA 2JJ6A 4N23A 4PCRA 4NHKA 2QTWB 1US6A 4QU2A 5EYXA 5J2TA 3D5OA 3FLTA 2VCAA 1XHXA 4R52A 2V7QG 3SJAC 1IS3A 3CCJV 2GV9A 3SJQC 3D3QA 5LY2A 2ZR2A 2FL4A 5LOVA 3L70H 2OIIA 4PF1A 2B7YA 4BW9A 3K51A 4WCEV 2WUHA 4WZFA 2PY5A 1BJQA 5DUVA 1ZZ6A 1MS1A 4LE3A 3I2GA 3ZO0B 4XIKA 4CC5A 2PELA 4LE4A 5JCOA 4YW2A 2RMU2 3MIDA 4XETA 3K9SA 5B4NA 3TB0A 5HCHA 4XFHA 2QKCA 1WCDJ 4D6RA 4X20B 3RPQA 1K92A 3MV11 4NXNO 1VRH3 1SA0A 4LA2A 2HJFC 3WW2A 4KNCA 1I08A 4OCTA 3NWKA 4JDOA 3OBTA 5A70A 1JYWA 4Q27A 3NSTA 4TN7A 2P2KA 2O1QA 4JI7B 5HXMA 1XHZA 4PHZA 5KAIZ 2RDSA 3MHZA 4FJCC 4LK7A 5ABJA 2J1AA 5BY1A 2R062 4QU1A 2N05A 3CX5F 1C8M1 2VS0A 3A22A 4NIDA 2Y48A 3JBG3 5K1XA 3P1IA 1LECA 4G4FA 1WW7A 3KV9A 3RZGA 3I2DA 3E8BA 3LDKA 4BIUA 1YTFB 3NW4A 3I59B 3ASIA 1O4TA 3GGLA 4YVWB 1TUEB 5LYJA 4GIQA 2WWUA 4C0HA 4UCRA 1VBE3 5EZWA 4Z1VA 1IBMO 1MQTC 4AQ6A 5JIUA 4B1LA 1UOJA 4KUMA 5IYCO 2PHDA 3IDBB 1CR7A 4AEJA 4LK6A 1MPXA 1SQFA 1HN0A 1W6OB 3E8HA 4DV0O 2R073 4JI2O 1YCIA 2CTRA 4OHZA 4Y1YA 3T0DA 2FBEA 1G8MA 3POEA 1IBKO 3WDVA 1W8OA 2W91A 3RSJA 4FPEA 3WDWA 1PVC1 4NRQA 3J81N 3AG4C 1NLQA 4DRRA 5DDJ1 1OOPA 1RUH1 4XCAA 3LSQA 4IEVA 1PX4A 1O7FA 4LKFA 2C6SA 4K6BA 1SQBH 2UUAO 3KT7A 3UJOA 3HD8B 4DR5O 5JCTA 1AJNA 4K8FA 5FXVA 1RFYA 1O8SA 2Y8KA 1PVXA 2DWDC 2W0FC 1NXD1 3HNBM 4IXLA 1I94O 1ULEA 3CRAA 1Y9MA 3MDSA 5ANNA 4XQ4A 3N2KB 2HFEC 4XIOA 4ZKTB 5CBFA 1SFNA 5DG1A 4CPBD 3AZVA 3GNEA 1RJ8A 1TMF2 4MZUA 4CU9A 2W5FA 4TV9B 4ASMB 3RYFA 1GANA 2AZ0A 3OT7A 2VUCA 1Y76A 2QQUA 1JZ7A 4IEXA 1CD3G 1XMQB 1ZRCA 2VMEA 5JJEB 4CDWB 3OOXA 1K5MA 1ASJ1 1OOPC 2WNUC 4XBQA 3SPGA 3U37A 1QIQA 3AYDA 1XYOA 2A3YA 4PJYA 5FL7G 4XJUA 2BWAA 2K46A 1HN1A 3OBZA 3RNSA 2BOBC 3CP1A 1NJIW 5T5LA 3N35A 5FYTA 4N9HA 2ZGUA 3IIIA 2AEZA 4IV1A 1Y4WA 1THZA 3T30A 2VNOA 4J7JA 4QPGA 4URAA 2XBO2 1UL9A 4C90A 4CH4A 4LHLA 3GDBA 4ZKIA 4DY5A 4DV4B 3EHBB 4R9DA 1N34O 3OGJA 3I56V 1W3VA 3I2HA 4G28B 1PHMA 1AR82 5EBWC 4QWNA 1ONAA 5KX5A 2ZMKA 1UZVA 1NU1H 4TWKA 4GKJO 1XSRA 4ZOLA 4LIUA 4BIZA 4DV1O 4DINB 2EJ7A 1BEV3 2DCJA 3J7AU 1JVMA 2HYXA 4LO8A 2GC0A 5CFCA 3J9SA 4JZRA 4UCUA 2QWRB 2IXCA 4N21A 1K5MC 3PJSK 3IIAA 2EXIA 4LR3A 5K4LA 1XU1A 3E22A 4RFT0 3ZDVA 4C1WA 1Q6IA 4BW5A 3BAAA 4D6TH 1QJU3 3GBGA 5IYDO 4OXSA 3ML0A 1YXBA 3ZRSA 1MZ6A 2VUAA 3WW3A 4GJYA 4B29A 2VQUA 4Y5TA 3THDA 2VOWA 1M90W 2ARXA 4N7IA 3ABTA 1X82A 1JXNA 2H94A 3SITA 3JD2A 1GICA 3W5MA 2EIEA 1M56B 2JDNA 2AYHA 1K3IA 3AYCA 3PJYA 2AC1A 3WB0A 4XVHA 2QQNA 4RS5B 3ON7A 1AX1A 2HWE3 2FB5A 4OI4A 1NA1C 1OF4A 1LODA 2WN2A 2ZEZA 5GLWA 1M4UA 1UO9A 2P4KA 1F4AA 4V1PA 1AI7A 4ABMA 1SLBA 1OQ1A 1ENVA 3RZMA 4CCEA 3TAYA 1S55A 2UXDB 3WFVA 4Q4V1 1HNZO 1KECA 2QQJA 2QUOA 2ADQB 1H30A 1VIWB 1Z0HA 2IXJA 4Q4W2 2HLDG 3I59A 5JSOA 4XILA 3LB9A 3WCSA 1OPOA 4OVEA 1D7PM 1HJFA 3N2GA 2P5BA 4LBQB 4I30A 5F5AA 1JZ2A 2VULA 4BK4A 4FZ0A 3UKMA 3MYXA 3H1LH 5E16A 4LR4A 4RSUA 1S4CA 2ZBJA 1Q8IA 3LPGA 4B4QA 4BQXA 4J11A 3ABLB 2VTFA 2GC1A 4G9SB 2WKKA 4KBZA 3QF7A 5DN2A 3W7TA 2HWD1 4FFFA 3VBRC 4TLGA 2EIJC 1W6QB 1YHQV 2KKWA 4YM2A 4P9OA 1V6OA 1K73W 2I45A 2D43A 1CX1A 4B3NA 2OZ6A 1WNSA 3GZAA 1K12A 4MW8A 2UXNA 2YGMA 2ODMA 3RVHA 2VOKA 5KLVH 3FJSA 5J09A 2WR9A 4FPOB 4IGOA 5L3CA 3OUHA 4R4XA 3VBRB 2B45X 5FZKA 2YXYA 4IHJA 5DUXA 1F15A 3I8TA 4MGYE 1R092 1URFA 5EJ3A 3V56A 1SFPA 1V54C 1Y74B 2P3KA 2VBDA 1RVF3 2X29A 4FT8A 5DAWA 3DV8A 3SH5A 3GZTB 4G3YC 2HWC1 3EVKA 2OIGA 1KD7A 1YFYA 5FMDA 3APBA 4JI3O 1LOFA 2Y0PA 2K9PA 4BE3A 5BMVA 3UO3A 3S0MA 3TNPB 4ZONA 4FXKB 4P9JA 3OAAG 4UB8Z 2I07B 3VBHB 1YDXA 5CFDC 2Q8DA 3CCQV 2E5LO 5AFBA 1P4RA 4I55B 5LGUA 4P2ZA 5F6KA 2X05A 1FV3A 2WLLB 2R7EB 4GH4C 3VBRA 3I3MA 2VZ3A 4GAZA 4W8JA 3JAWA 1JN2P 1GZTA 4BR6A 2XDVA 2QWNB 4BQ3A 1R3KC 2WLNA 3V65A 1TEIA 1PZ7A 4DZGA 2F95B 2VECA 1S1AA 2OUHA 1QLEC 2WSUA 4ARXA 2ZGSA 2VO5A 3K4AA 3F7VC 1NUKA 4FAGA 5KA5A 3RZLA 4JI0B 2YUAA 1SRYA 1YQ6A 3A8TA 2VOXA 1P84F 4X8PA 2D6MA 1BBT3 4YGEA 3OGGA 4LF4B 1XXNA 4ZY9A 3ABZA 1BCXA 1YQ8A 4COVA 2WWJA 4AFCA 2JG9C 1MS9A 3INAA 3ZM8A 1YFWA 4CE8A 2JGDA 1DLLA 1S5HC 2BW8A 3PIJA 2XKOA 1Q82W 2GBOA 4AOCA 5A1LA 1VQNV 3ZFEB 4NAOA 3E83A 3AVSA 4LBQA 5KC6A 2JG8A 2XJSA 4Y3OA 2V72A 4FPFA 1J58A 4OQ9A 2TBVA 2LO1A 3CQOA 4Y22B 3TNQA 2OVUA 3SR2C 3ZN6A 3HPNA 5JPMB 2P3JA 1QR9A 4W50A 2D6LX 2GP3A 1HNXO 5FLHA 4I55A 3VQYA 3RW0A 1XNRO 4LF6B 4JGYC 4XDJA 1S76D 2QKSA 1YEWA 3ETQA 1R73A 3PIGA 4W6WA 1Q6UA 4ZHQA 3BTAA 1WLEA 3HKDA 5EYPB 3AMMA 1N1TA 1GZ9A 4D7YA 4MVTA 4BLJA 2VE1A 3WQBA 1BQPA 2IH1C 2YC0A 2TNFA 4CZSA 5LA0A 4FSJA 4BHPA 4NUBA 5CEHA 3RYHA 4EYUA 2XJQA 2FTKA 1QOSA 1OFSA 1AJOA 4DK0A 4HKLA 3KKYA 2YV8A 3ZRWB 1AR62 3LDEA 4KGGA 2K2SA 2D3RA 2GNTA 2AR6A 3H3ZA 3TXSA 1PIV3 4MS2A 1JYVA 3M3IA 4I7ZB 4QPWA 3K5OA 4K9SA 5JJJB 2A3QA 1QKQA 4DR4O 2VZSA 2RR11 4CH3A 2V73A 4H55A 1YITV 2AGSA 3AKPA 2OQ6A 1ULPA 1I9RA 1GQHA 4AI0A 2ZE8A 2RS31 4MOAA 4DUVA 4H3WA 4P30A 4LOTA 1WLDA 2DV9A 2JS5A 3STLC 4HPKB 4DEQA 3CU7A 4HNAB 1ASJ2 5JZGB 1YHFA 5GONB 1O4YA 1YRZA 4QHZA 1W6NA 1JR9A 5FDBA 5HI0A 4AGVA 4GX5A 3C3SA 1BYHA 1WMXA 1MMMA 2ZQMA 4LO5B 4PIZA 3BVOA 4KI5M 4IV1B 1EZJA 1CZVA 1RMU1 2N74A 4D94A 1PGSA 2CAVA 4NE9A 1SQGA 4BOWA 2AREA 2VMGA 1GWLA 3T2TA 1XUQA 4CEYA 3CRCA 1UZZA 3JALB 5F3EA 4CU8A 4TT3G 4LF7B 3N9NA 1J3RA 1NCRC 1XNCA 5FZOB 1S2EA 3T09A 3RYIB 4ZOLB 5E1RA 1X9PA 4GZ9A 3WG2A 4RS5C 3LGRA 1HRV1 4D0QA 2G9GA 3O1VA 1KP2A 4CDUA 2XPJA 3H1JH 4L97A 2R9AA 4UCOA 2IJHA 1D4VB 4BA6A 4X64O 1WA4A 2D3OW 3ZMOA 4L92A 1DQ6A 3WP5A 2QM7A 1SFYA 5GTHZ 4OHYA 2IU0A 4MO3M 4E2SA 3O1MA 4UW6A 1KXGA 1OVPA 1QH6A 1X36A 3CZUA 4XCBA 5SV8A 3ZX6A 3K48A 5FYUA 2R0HA 2ATFA 4M3CE 3IAPA 3HVDA 3Q4HB 3OBAA 4GWMA 4L99A 1OA2A 1WCQA 2Q7EA 2PHUA 5JXIA 2Y0IA 4CUAA 2HEVF 3ABUA 1LAJA 4PD4F 3FC0A 1K5MB 2BOIA 3MV01 2Y4TA 3CC4V 4H44B 3OGIB 2PXJA 1T5EA 1I3HA 3KMHA 5LL6Y 4CA9A 1ND3B 4LBLA 5CG8A 2IC1A 2C5DA 3AK0A 3OG2A 2WO1A 2D5HA 4UVCA 2BGOA 1ZL8B 1EN5A 4D6SA 4CCDA 1S0CA 1OCOC 2WLIB 4TV9A 2JD9A 1M4WA 3S5QA 4M4PA 3HN3A 2RM23 1JH5A 2YC2A 4PDWB 3H7YA 4JYAB 3OMIB 3MW2A 1SLIA 3EJKA 3BOPA 4D3WA 5GJ6A 5JPNB 4IUGA 2HWF2 5L3DA 2CU5A 2HEPA 5FUPA 2WSVA 1FX5A 2A71A 2EZOA 1UY4A 1S5LZ 1R3LC 4N53C 3BKZA 3W9AA 1JW6A 4K20A 4IT5A 1J1TA 5HXVA 1UAIA 2LROA 2RDQA 3FE5A 4IEYA 4TQDA 5FWEA 2UXBB 3SCFA 1VBD2 2VTXA 3QNEA 1OHHG 4DR6B 4OYUA 1QOTA 2RS32 1DGWA 1NCQC 2VBBA 1N0JA 1VQ4V 5HCBA 2WNUB 3O0WA 4DUXA 4XDKA 3KQ4B 5K7PA 3H01A 1FJGB 3WEZA 1R093 2DE0X 2XLGA 4MGZE 4KQ7A 4XJ8A 1RC6A 4JGZA 3JU9A 2MHFA 4GB33 1K7DA 4F4LA 3LDCA 1PD3A 1V6IA 2FZ1A 4GB32 1DK1A 3RYIA 2PA7A 4I50A 4K8RB 1AXKA 5ISLA 4H7MA 4KHPO 2ATKC 1HDJA 4CP2A 1AX0A 3DL3A 2W92A 1OLME 1AR71 2WLQA 5KAFZ 4R8HA 4TUYB 2WLHA 2UXXA 4AILC 3OGSA 1EUTA 4B3RO 1SERA 2JICA 3UL2A 2EIMB 1KFUL 5CNAA 1W04A 3PVOA 1R1ZA 1UQXA 3GBWA 3ZXEA 2CAZC 3FB5C 4XABA 2Z5UA 4BJ0A 2G9ZA 2VMIA 2NLJC 1LR5A 1O9HA 3O1SA 3PVBB 2DUQA 4MVSA 3G6BA 4DV4O 1NLSA 4V2VA 4DB5A 2C4XA 2WA3A 3QO8A 2HVJC 3G6EV 1HP8A 4X65O 2BBAA 4PV1B 4A2UA 5J98B 3C7EA 3H1WA 4R9BA 2PZSA 5HPOA 3D36A 2VR4A 4XFGA 1KEXA 4LLFA 2M6YA 4DR3B 1W9FA 5KUKA 5I0DA 2VJXA 1C4RA 5L9RA 2YFUA 4XZPA 3VDDC 3ZFEC 4ORFA 1TUBB 2RJLA 3HMYA 1VBB3 2NMOA 4X8AA 3ZOIA 3PN1A 3ABKC 2PLV1 5FZ9A 4MVRA 3LIHA 1UU4A 3OM3B 3U10A 1UYZA 1U5YA 4QB1A 1MQTB 3PJQA 2BE3A 2PLV3 3B94A 3DECA 5FZFA 5KR7A 3WNKA 3C3VA 1BEV2 2UXBO 1EUUA 5FKBA 5JMOA 4XF0A 4E8CA 2X6CA 3ALQA 3CJIA 1TVKA 1O59A 3CHXA 4CS4A 2O0OA 1RUF2 3ZFGC 4M4RA 3BTYA 4JI7O 1FOD2 2X8KA 1PM9A 1F8VA 3U11A 3NV1A 4XF1A 3POIA 4QIWF 3AVRA 1BVP1 3ES4A 5L73A 4BH9A 3SPJA 2HLEA 2C24A 1W8NA 4YZ3A 4H2AA 1XL4A 2ZX2A 3KZ4C 3K3NA 1C8NA 1IXMA 4PDLA 4FM0A 4ET7A 3CLPA 1PIV1 1TAEA 2UY8A 3VKOA 1Q3EA 2VXRA 4R7CA 5JLVA 4Y22A 4UFJA 2WPDG 5GONA 2HKOA 4FLXA 1L7LA 5FZHA 1DGLA 2IJKA 3I2IA 4YVSA 2WS93 4X66B 1GN6A 1AZDA 4OULA 3H50A 4YM1A 4QX5A 1W59A 1UZYA 2FZ2A 3ZEDA 2KXLA 4RR3C 1BT8A 4GA9A 2HKXA 1KDMA 2VMHA 2CE4A 5EQUA 1OBNA 3OR6C 1KQRA 5EJ1B 4B4RA 4CP1A 1VAMA 1HQLA 1QVGU 4OGQB 4N90A 4Q5OA 3NXSA 3WW4A 5FY1A 5BY5A 4JI1O 2GUZA 1NTZH 1DU3D 1R1A2 3ABLC 3T4HB 5FY5A 4WV8A 4Z1MG 1ND3C 1VAKA 4BMBA 3BGAA 1WA8A 2XJUA 3ZKUA 3CO2A 2HWD2 2D5FA 4E4ZA 2DU0A 4RQFA 4NHXA 4FOQA 2QE3A 1N47A 3RWNA 5LGNA 2OTLV 5EJZB 4X64B 2JG8B 1N3QA 5JH7B 5EK0A 2VQFO 4LF5O 4YRDA 1QU7A 3VZMA 1QVFU 3WXPA 3UT0A 2VZOA 4HSJA 1QJX1 4FOWA 3JATA 1DCSA 1UZ0A 2QEXV 2JIJA 4NN0A 1UIJA 4Q4W1 2FDHA 1VQ9V 4AHYA 4CS3A 3OR7C 3MF6A 4F7ZA 1QJX3 3VQWA 5E6HA 3PUIA 4WFHA 1TZOA 4W6YA 4PA6A 2DCKA 1FYJA 5A7WB 5FMBA 4XYXA 2AZ5A 1NQTA 3LSUA 4GMP3 1LU2A 3BA8A 3K04A 1OCRB 5CN0A 2EVXA 1VE0A 3PU8A 1NCRB 1OMIA 3LNMB 3K9AA 1WD4A 4U7NA 2ZJCA 4COWA 1PMJX 3ITQA 3HN1A 3T2OA 4XJZA 4GKXA 1ZZ8A 3JD73 5TISZ 4NTXA 4N7UA 1RB8G 1US2A 5AC93 3IJ4A 1MZFA 1PGW1 2PI5A 2R30A 1Q5OA 3K59A 3AM2A 4B3TO 3NJVA 4D7TA 1QU0A 1G9DA 5KXEA 1CEZA 1F9KA 2RDNA 3ZHSA 1W2AX 1AI5A 5IY5C 4DNYA 2XGXA 1N34B 2OCCB 2WZ8A 2AH2A 1ULOA 2UUAB 4OLLA 3UK9A 3UCSC 4FTBA 5B1BC 5LGTA 1VBE2 1W0JG 1E57A 1LEDA 2BVVA 3KQRA 4QPIC 5DZEA 2RG4A 5JXJA 2Z42A 3MIFA 3ZYPA 2ITCC 1SEFA 4JI1B 5JOWA 3NL1A 4DXSA 1GQPA 1BMV2 2O57A 3ZMTA 4HVOA 2ARBA 2FDKA 1YI2V 3CMEV 4J1WA 1J1LA 4K8ZA 1WLWA 2N04A 3PVEA 4B3SO 2VWJA 3B93A 5GZEA 4NHYA 1LHVA 4JI6B 3USUB 1CAVB 2E33A 1MACA 4NTYA 4LF6O 1FXKB 3RN4A 1W2BU 2EIGA 1RUE2 3WY6A 3RYCA 5LHIA 5B66Z 5IHRA 3RZZA 2IH3C 2ETEA 4MVUA 5JH7A 4K3AA 4EROA 2CHHA 2IM9A 3CSXA 1NOVA 4EWAA 1MNGA 1XBLA 4LFBB 2W1WA 1UCXA 4CEWC 2XAFA 5BYNA 3C7HA 3LIGA 4XFFA 3FUOA 4CDWC 5ACA1 3STZC 1YIFA 2JGUA 3ZMZA 3VBSC 4B8EA 4I9QA 2E76B 4KG0A 1MSWD 1RM1B 1XPWA 3OE7G 3BIEA 3H8XA 3VD5A 1K45A 4O4LB 5C70A 4NHMA 4CU7A 4YHHB 1LOGA 3CE2A 5FY7A 4LBQD 5FYZA 1LHOA 5JQGB 4X6QB 1Y43B 2ZABA 5F3CA 4RD7A 1IX9A 3WUCA 1W9YA 5K9YA 4KGQA 3D6EA 1CN1A 2DCZA 5FMOS 1PL4A 2JB4A 3O0VA 4XZUG 3I3BA 2BNOA 4KXRA 4FFIA 3ACHA 2Y6LA 3TJTA 5BNOC 2VD7A 2UWBA 3WP3A 4HL0A 3VBUB 3LD8A 2ZS6B 1IOAA 1GOGA 4DV7O 4IEUA 2Z3YA 2AGAA 1JODA 3SYOA 5A32A 2IVJA 1MOFA 4CP9B 2OT5A 1VB2A 1DZRA 3N9PA 2ZMNA 5SV5A 4CDQC 2Q1FA 4DMIA 5CA0A 2EAKA 2D2CB 3THCA 4LC1A 3WQ1A 1H2KA 1XNQO 4AI3A 3VBUC 1AYN3 4KMQA 1EBOA 2ZAHA 2YYOA 2Q8OA 4LH6A 4FTEA 1BE3H 1VP6A 3ZFGA 4XBNA 3RI8A 4QX2A 2NP0A 1AYN1 1HB1A 3UGFA 2XONA 1KBHA 1IXBA 2WN3A 2LFRA 2D6OX 2RE9A 3LOIA 1PMHX 4E4HA 2E51A 5B1NA 3EO6A 1GNZA 5EPAA 3SKJE 5IFTA 4DUWA 3CRRA 3MUY1 2VMDA 3WHUA 2Q6AA 2Q4PA 2J1SA 3VBHC 2QR4A 4XEZA 3WF2A 4WVZA 4A42A 3AG3B 3N27A 4K3UA 5BNPA 3ENRA 1FI2A 3D8CA 3BEHA 5JVDB 5FUNA 3DXRA 1EPZA 5IWAO 1IBKB 1SDWA 1DTOA 4X66O 3K75B 3KHCA 5CYYA 3E8GA 4FLZA 3IFXA 3UJQA 1W3XA 5CKMA 2JDPA 4Q0UA 4ASUG 1RMU2 5ANQA 4DXRA 4K7JA 3CJIC 5DAPA 5CKNA 3S5AA 3MPBA 4X8NA 1H2SB 4P00B 4COYA 3I2OA 1RYYA 1VQLV 1NH2B 4KWLA 2QKDA 2WS91 5GW7A 3DTUB 4XTPA 4XACA 2DVFA 1V6LA 1E1RG 1K8AW 2XLFA 4FP3A 4I4TB 5B1AC 2FKXA 4X88A 4MVZA 2BOJA 3O65A 1AR63 1V6KA 3H8OA 2ENRA 2W08A 4DRXA 4MXWA 1TQ5A 4PT6A 2CH7A 2EINB 3SNMA 2Q8EA 2OIEA 1AL23 3KF3A 1ND3A 1BHAA 1PNLA 4PDVA 3WF3A 1MEC1 4JI8B 1X50A 1G9AA 2CDOA 4K1ZA 2F93B 1C5HA 1B35B 2Y6GA 4QPIB 3OD0A 3ZHUA 5BXXA 5E88A 4AHZA 2DYSC 2WZPP 1LEMA 3VD7A 4QE7A 5FP8A 4WBNA 2Z5WA 3Q4HA 1KKCA 3JAMN 2PHLA 2WS92 1RUF3 4AK3A 2L9LA 3MHHC 4CYDA 4I50B 3DXTA 1OCOB 2WO2A 3GWKC 1R6KA 5CAZA 2UURA 2VY0A 5FCCA 3AFKA 2WZR3 2PTMA 1LHUA 1ST8A 1B09A 1MS4A 4OUMA 2NZ9A 4LFBO 2UXCO 4X62O 3SEPA 5FO8B 4PA4A 4Q4W3 4QGMA 3SPCA 2ZHMA 2XLAA 1NA1A 4LHKA 4LUMA 4XTMA 5FBJA 5CIRA 3POBA 5A3OA 5E8AA 3JALA 2DUPA 4XF4A 4NB5A 4GQ7A 2PHTA 2ZEXA 2X5IC 5IK5A 1VMJA 2AHZA 1OCZB 4FPKA 2VZRA 2VZVA 3A7QA 4DPNA 1AYN2 1CAWA 3A23A 4I09A 2QFEA 4N43C 5JCOC 5D8AA 1VB4A 4TOIA 4AQTA 4FFBB 1LOCA 2A7AA 4AEMA 4NPLA 4JI0O 3UO2A 4A3XA 4J1XA 2GALA 3JD71 4I0XB 1UX7A 4Y33A 1AR72 4MLOA 1VP7A 3CEIA 1IPKA 4Q4Y1 1WLTA 4UFMA 2G1MA 1S0EA 2J22A 4QQHA 2Q5TA