4D7TA

Structure of the sthk carboxy-terminal region in complex with camp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
198
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEAAQIQELAVRRKEELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords STHK_CNBD_CAMP
publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
total genus 55
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7tA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7tA02
3KGZA 4JV4A 4PIYA 2BNMA 4HVRA 3LA7A 2ATFA 5D1IA 4MH0E 3ETQA 4ORFA 1YHFA 2CAUA 1RUNA 3IIAA 3I59A 4MX3A 4IEUA 1LKNA 3SXWA 5FLHA 3PVBB 3DV8A 1ZZ8A 5K8SA 3E6DA 1UD1A 5LRSA 1FI2A 1O5UA 2HJIA 4KWJA 2WC2A 2KXLA 3S7EA 2D5FA 3I54A 4IETA 2MHFA 3WW2A 4EWEA 2K9ZA 1GQHA 4Q0PA 1YLLA 4XFGA 1FT9A 4I01A 5E16A 3CEWA 4YSFA 3FFQA 1YWKA 2PA7A 4FAGA 4XF1A 2XHKA 1CAVB 5LRRA 4I0BA 3HQXA 3ST7A 2CGPA 3OD0A 1YFWA 2BNNA 4EROA 1VJ2A 2GC2A 1CAXA 4I02A 1O4TA 1VR3A 5FPXA 5BPXA 3ACLA 2GC1A 5EZWA 4LEJA 4XEZA 3EO6A 1Y3TA 3NVCA 4KU7A 3O14A 4MUVA 3WW3A 1YFUA 2QCSB 4YNIA 4E2QA 3EJKA 3LA3A 2GC3A 4QX5A 2H6CA 3WW4A 4PIZA 3BCWA 3NL1A 4J1WA 2PFWA 1QXJA 4AVBA 4XF4A 2XL9A 4IEPA 2IXIA 2FMYA 4KWKA 4Z07A 2QDRA 1RL3A 3LA2A 1WGPA 4JVAA 4Q29A 4IEYA 1ZZBA 3ELNA 3FJSA 4XETA 4QGLA 2ET7A 4FBFA 4BYYA 3RZZA 5FQ0A 5BY5A 4XF9A 4XFHA 1O5LA 1QWRA 5I0UA 1NE6A 2FQPA 1J58A 2DCTA 1RTVA 4CYDA 1LR5A 2ET1A 3L2HA 4H7LA 1J3RA 2EAAA 3GYDA 2E9QA 1OFNA 1CGPA 4I0AA 2D40A 3CLPA 4HN0A 3FZ3A 5FCCA 2UYAA 3DL3A 3TNQA 3H7JA 1CAWB 2GZWA 5JCTA 4L2NA 3RDIA 4O9GA 5T3NA 4F7ZA 4MV2A 5J48A 2EVXA 1PMIA 3OGJA 1O3TA 1ZRRA 3MPBA 1O3QA 3H9AA 4WVZA 4HZFA 4ONUA 5E1RA 4YYOA 3BB6A 1DGRA 4HMZA 2O8QA 4XFFA 4ZU7A 5EFUA 4HSJA 3MDPA 1DZRA 1Q5OA 3H3ZA 3S0MA 2PAKA 2O1QA 2MPFA 5I8YA 5CADA 4A2UA 2Q30A 1O3SA 5KBFA 2BGCA 3PLQA 4QXKA 2GH2A 1XRUA 1J3PA 4F8AA 2VPVA 3E97A 3M70A 3I7DA 4L11A 3E6CC 2Z2SB 2PQQA 1UW8A 2OZJA 4J1XA 4ZU4A 3H1MA 4XF3A 1J59A 4IESA 1NXMA 2EA7A 4P9GA 3DKWA 2OZ6A 4O9EA 3U11A 1HW5A 1O7FA 2XGXA 4HN1A 2WFPA 5KHKA 4LA2A 3RYRA 2D5HA 3R6SA 3SMHA 4BIFA 1H1IA 3FWEA 3KGLA 1O3RA 2OPKA 4HBNA 5AVPA 4HSLA 4IEQA 3BPZA 2H0VA 4UBGA 5FDBA 1OD5A 5KHJA 4JTOA 5I8TA 3IDCB 4WBBA 4BH9A 3SHRA 2MNGA 1I6XA 1WLTA 4DINB 3H8UA 3CF6E 2Z69A 2GC0A 1CAUA 4IEVA 3ZDSA 4QMAA 1U12A 3H1YA 3FE5A 1X82A 1OI6A 2UY9A 2OA2A 1UIJA 4Q0VA 1Q3EA 1CAXB 1DGWA 2IXJA 5BUVA 4B29A 3UKTA 2Q0AA 1EP0A 5I8SA 3OF1A 3CO2A 1LB2A 4N9IA 1RC6A 3S7IA 2GU9A 4D7SA 2VECA 2IXLA 5KHGA 4EV0A 3E5QA 3LAGA 2ZCWA 1WA4A 4QGMA 4IEXA 4AQ6A 4KL1A 3CL1A 5KHIA 3HIFA 4AQ2A 3MZHA 3E6BA 5KHHA 4FAHA 1JUHA 4XFIA 4LLOA 1XE7A 3LWCA 5F1RA 4Q0QA 5FLIA 1QXRA 4I3PA 4IEWA 2BEOA 2Y0OA 3UKVA 5J3UA 3ES1A 3OCPA 5I0TA 3ROUA 3TNPB 4MGIE 5FQ0B 1XE8A 2N7GA 5LEJA 4K8FA 3LOIA 1SQ4A 2IXHA 3E5XA 3D82A 3H7YA 3KMHA 2V09A 1UPIA 1ZRFA 1TQ5A 5C8WA 1DZTA 1CX4A 2I45A 4IEOA 2UYBA 5HI0A 2PYTA 2QVSB 3FHIB 5I0RA 1ZVFA 2P17A 5BXXA 3BU7A 1SEFA 2Q1ZB 3CJXA 5I91A 2QJVA 2IXKA 2D93A 3SCHA 1Y9QA 4IERA 1ZX5A 5CU1A 3EQEA 4PJYA 4QM9A 3QACA 3HT1A 1H1MA 1ZREA 1EPZA 2Q4SA 1X7NA 4Z82A 1ZZ6A 3G7DA 4LULA 1ZZCA 1YUDA 5JR7B 3QOPA 4YRDA 4XFCA 3RPQA 3I59B 1ZRCA 1Q43A 3B02A 1RUOA 3OTFA 2HKXA 5J7MA 4E2SA 2PHLA 2ETEA 2H6BA 3JZVA 4LTAA 4UBHA 1X8MA 1QY4A 4LA3A 1IPJA 4D7TA 4MGYE 1CAVA 4HLTA 2VQAA 4QM8A 2B9UA 3EBRA 3BALA 4I09A 4HVOA 4X6QB 5CVRA 3N4MA 4Q0UA 3VHRA 2BNOA 4KWLA 3C3VA 3GBFA 3H1WA 1UIKA 4Q0SA 1L3JA 4HVQA 3NSTA 2XKOA 1NZCA 4EWAA 2CAVA 2GAUA 1J1LA 1LRHA 5JAXA 2C0ZA 3ES4A 1UCXA 4TLFA 3RNSA 4MZUA 3UKNA 2UY8A 4BHPA 4UXAA 3KSCA 2PHDA 4XF0A 3SCFA 1YFXA 3NJZA 3H50A 5JSOA 1RGSA 5LEKA 4I2OA 2K0GA 4R52A 3LZZA 4LUMA 2B8MA 3D0SA 3U0ZA 5I93A 4FT8A 1ZZ7A 1ZRDA 3KCCA 2QNKA 2PTMA 1SFNA 2B5HA 3EHKA 3M3IA 1CAUB 4E2GA 5C6CA 4GULA 1GQGA 3D0JA 4ZU5A 1OMIA 2IC1A 1NYWA 3MYXA 1EYBA 1G6NA 3PNAA 1V70A 4MGKE 3E5UA 3IBMA 3IDBB 1VP6A 4PIXA 4AXOA 4JTNA 2ZKLA 4XFAA 2XLFA 2IXCA 3IWZA 4OFGA 5JSRA 3U10A 2XLGA 4AVAA 4EWDA 4X6RB 2XKPA 1X8EA 3NW4A 4META 2PAEA 1ZNPA 2PAMA 4NVPA 1CAWA 1EY2A 4QGNA 4XFBA 4AVCA 5BV6A 4LUKA 1I5ZA 5FPZA 5JSPA 3RYKA 3WW1A 5FLJA 4N9HA 2XL7A 4KU8A 4R8HA 1IPKA 1ZZ9A 3H3UA 2OYZA 3USSA 4WZCA 1YFYA 3DN7A 4OLLA 2XLAA 1NE4A 4RD7A 3NKTA 2F4PA 3HT2A 1FXZA 3SCGA 1PM7A 4MGZE 2CV6A 1J3QA 5I0SA 2BYVE 3RYPA 4YARA 3FX3A 4IEZA
chains in the Genus database with same CATH superfamily
1IQAA 4JQRA 2FDGA 1KRIA 4IV3A 1FPOA 2XAJA 1UY4A 3HKCA 4GH4C 5K8SA 1LOAA 3AKRA 1ZBE1 4IV3C 5DZGA 4QPWA 5T50A 2BVVA 4TT3G 1RVF3 5IT6A 3KLSA 3GCXA 5E16A 4B3TB 1BEV3 4XACA 5ITZA 2QEXV 4GWJA 1YIPA 2OT5A 3NJYA 2CL2A 5LRRA 4HKOA 2ZNJA 1OURA 2D6OX 2AHZA 1HB2A 2NP0A 3VD7A 3O0WA 1H8TB 3LDBA 1HR0O 3I3MA 2QWOB 2ZAAA 4B08A 3ZKUA 4KQ7A 3IJ4A 4YVSA 4URAA 1YJLA 2ZNIA 1G6UA 2P34A 3ETDA 4CH5A 4X88A 3HWJA 5FZGA 3CRQA 5C33A 4QDSA 3SITA 3C3TA 2N74A 1LOCA 4Q29A 1VIBA 3GJBA 2ORXA 5BMVA 4N23A 2A0LA 4KBBA 1YITV 3TAYA 4DYLA 1VQ9V 4FTEA 1VBC2 1W05A 4P02B 5CEHA 3C7GA 3MLKA 5IVBA 4KWUA 2Y38A 4LP8A 1QJX1 2VW0A 5EXOA 2C9KA 4HZFA 5BNQA 1KD1W 4H55A 4CSWA 3POGA 3X2QC 2CTPA 1GP4A 3GALA 2DCYA 5F5AA 2XNDG 5FYZA 3JQXA 5HBAA 2JD4A 2B7YA 4F3JA 3ZSLA 4CEWC 1UZWA 3ILRA 2WNUA 2WZEA 2L9LA 1OFSA 4QXKA 2YXSA 4QX8A 1KP2A 4O61A 1RVF2 4O4JB 3E6CC 5T54A 1UW8A 1BEV2 2WNUC 2Q8VA 1KFUL 1NXMA 3KM5A 3QCWA 4DV6O 3DYMA 1HW5A 3OBTA 2CUGA 2ODMA 3NXSA 4GZRB 3JCUZ 3OT7A 3FWEA 4XDOA 3VLBB 2OPKA 1N1SA 2H8PC 1B6QA 4NUBA 2GH8A 1CJDA 3N3HA 4A6OA 3S3XA 2WR9A 1QH7A 2VUAA 4GX2A 1OLRA 5FL7G 1WLTA 2YYOA 1W59A 1VQOV 5G04L 2OS2A 1FAFA 4ZBMA 3FE5A 4UW5A 5HXVA 1LB2A 1Y76B 4BQ1A 1GNZA 4WM7B 2RS31 4PI2A 4CCNA 1YTFB 4UFIA 5IYZA 2ZM6O 4QGMA 2X6AA 4IHJB 5LA6B 2YC0A 5IJ0B 3HIFA 2DYCA 4FFIA 1XU2A 5KA5A 1JUHA 5IUQA 2GN3A 1TVKA 5F2WA 4W6XA 5I0TA 3WHUA 3ZFEB 3T1HB 1XE8A 3H42B 1UZ0A 4P2ZA 3K5OA 3D82A 2XH6A 2A7WA 5H9CA 2VUDA 1R3LC 1ZTEA 2UYBA 3AMQA 1LOFA 2F4VO 1BT8A 2PYTA 4DZGA 4W65A 4FPEA 4O4IB 3W7UA 1FNZA 2Q1ZB 2IVIB 2IXKA 2D93A 2EULA 5CA1B 5C8YA 1RUE3 5GKAC 3PMEA 2VMDA 2EJ7A 1L1FA 5SV5A 4FLTA 4M3CE 2XVKA 1MS3A 2UXDO 4FPHA 1FXKC 1L8DA 4YM1A 2NMNA 2H3OA 4UCTA 3TB0A 1J84A 2XPJA 5FNVB 1VBA1 3JAWA 1QR9A 1XREA 4BOWA 4N43A 2K2SA 4CEYC 1B3QA 4MTXA 1ZL8B 3MFCA 3MPPG 5IYCO 3VZLA 1AR93 2FDKA 1NUKA 5JQGA 4LH7A 4JI1B 5C70A 1CESA 2EXKA 3ZJZA 4U7NA 5IWFA 3HR0A 4LUMA 2A71A 4UOJA 3I2OA 2X05A 5C8CA 1YQ2A 4ZS2A 3RS6A 3JALA 5FJHA 3K03A 5DEDA 1SERA 3NO8A 1XB9A 5IYBO 4O2BA 5C8CC 5LMNO 3NNLA 2W47A 2ZGOA 1S0JA 2DUOA 2W0FC 3RYHA 1UMHA 2P67A 1NX9A 2XLFA 2P06A 4CDXA 1O4ZA 1Z7S3 3BOWA 3IWZA 4XABA 5B1OA 3D8CA 4N7UA 4H44B 4DV4B 1ONAA 4NKGB 4XE9A 4B4QA 2DURA 4Z2WA 4QPKA 2EINC 1VRH2 1SLLA 3OY8B 4B3SO 4H37A 2OYZA 2R061 1YFYA 3DN7A 1W9YA 4Y22A 3LIGA 1HQNA 1JFFA 5DABA 1W90A 3TXSA 1RUE2 5EWSA 1FXHA 3T4ZA 3VDAA 2W1SA 5L3EA 3N27A 3M7AA 3HBKA 1HRI3 4QPGB 2R0FA 2F1MA 3ASNC 4AI2A 3K3NA 4YW3A 3ZDVA 1YNAA 3R4DB 1DQ6A 1OUXA 2BU9A 1RUG1 1Q90D 2QQJA 2V73A 1FFTB 1XQ8A 4R50A 1DLCA 1YXBA 1A3KA 4BM8A 2P3YA 5IY5C 4QHOA 1JZ5A 1AR92 1U5XA 5IVCA 3HNYM 1H2KA 4QQHA 1REEA 2GC2A 1WAZA 5CA0B 1R64A 2AZ0A 5BPXA 1JS9A 2UUCB 2C6SA 2ARAA 1W8WA 2CAZC 1OHFA 1GANA 4Q5OA 1YFUA 4LF6O 3VKNA 2DOSA 4EN9B 5A7PA 5E1AC 4QQ2A 4XUNA 5DPNA 1GNYA 1M06G 4XBLA 4FPFA 2ADPA 3A4UA 2VOWA 1Z7S2 5IJ9B 1YJKA 1BVVA 3MI8A 3MHHC 1DQ5A 2IFRA 3WG2A 2WWJA 5C4WA 4XETA 2KSDA 3VBHC 2E31A 4BYYA 3OM3B 4MYEA 4UF0A 3CJHB 2F93B 2R49A 1RTVA 4AQYB 2E9QA 1UOBA 4QIWF 4CU7A 4YZ1A 1NOVA 4JGZA 5IT9N 1WPBA 4BXFA 3P32A 1OVSA 2QWPB 1S5JA 3AK2A 1WA8B 4MV2A 1GZWB 1O3TA 3VBSA 4CCMA 4TUYA 1MS4A 1NCQA 4YYOA 1YDXA 4HMZA 4JGZC 1QJY1 2UXNA 4D0QA 2DVDA 1YJ9V 1MA1A 1S0FA 4I5SA 4I9QA 3V0AA 1W8OA 3SH5A 3E8BA 5A2QN 1AI4A 2X29A 3BEHA 5I8YA 4IIJA 2E5LO 4A2UA 2WINB 4IW3A 4ZONA 3NWKA 3THTA 1EV13 4WFHA 4F8AA 2VPVA 3KD4A 1NJIW 2WO2A 2XJRA 2CH7B 5HPOA 2FZ1A 4E4EA 2Q69A 5H2FZ 3H1MA 2X5IB 1J59A 2JDHA 3KV5A 4IE4A 1KC8W 1AR4A 2X0LA 3G6EV 4EFBA 5KWRA 4WV8A 4Y1XA 3SISA 1CONA 5F6LB 4QB2A 4FTBA 4PA7A 5KHJA 2QQWA 1LHVA 1XUQA 3TN91 4LKEA 3ZYFA 1UKRA 2Z69A 5JPMB 4QMAA 4FLZA 3J26N 5KAIZ 2IXJA 4IE6A 3RYFA 4AFCA 4PA6A 3BIEA 5FPOA 3OF1A 4UW4A 4FFBA 5FAXA 4ZZ8A 4ZOLA 3M1HA 2IXLA 1N32B 2JGDB 4O4LB 3E5QA 5FO7B 1H38A 4X89A 5IYYA 1WCKA 2WS93 3P30A 3LCPA 1ND3A 2PUSA 4LBQD 1HRV3 1RM1C 3LWCA 4XILA 1ND3C 3AZXA 2YPJA 2F6BA 4TQDA 5FZLA 4R6ZA 5FMDA 1UPIA 5LY1A 3POYA 4HK9A 2EAKA 2ARBA 3PURA 3JD1A 1OC1A 1ZA4A 5FMBA 2YEVB 3WG7C 1EV12 1ZX5A 1GZ9A 1F4NA 2PLV1 3HT1A 1URXA 2E32A 2ZDIA 4N8MA 2LW7A 4UB8Z 1IG0A 1JYCA 4MW8A 1QJZA 3VD5A 3JZVA 4D7TA 1YIFA 2ZX3A 4PDWB 1VAMA 2B9UA 4AEDC 1WLWA 4GWIA 5JMCA 5KR7A 4A3ZA 1L3JA 4J11A 2OT7A 5H6QA 2FD8A 1NZIA 1W8HA 1J1LA 3I5DA 3CCEV 2W5FA 4BHPA 4LHKA 4GIQA 4OMDA 3NJZA 1SQBH 1E5SA 3VBFB 4GA9A 5T5JA 3F95A 1K5SA 3TBDA 3U0ZA 4QPIB 3Q8BA 3VHNA 4I7ZB 3VQYA 4P30A 1PVC1 4E2GA 2YZ4A 5T5LA 2E26A 2ZOEB 3POBA 3D36A 4YGEA 2EIJB 3IBMA 4XJ8A 2IW5A 4UCOA 1T6GC 4DR3B 4AXOA 2VD7A 3AK1A 4OZOA 3D36C 1EFRG 3O1MA 5DUWA 2R0HA 2ARHA 3FN9A 3NMBA 1JYXA 3OSDA 4LBMA 1ODMA 2QWNB 4LUKA 1I5ZA 2BE3A 4XIOA 1VQ6V 1GN3A 1F15A 1O4YA 1VP7A 3B9IA 3ZSMA 2XJPA 2F4PA 5JUVA 1LOGA 1NG0A 3DEMA 3MIDA 1XDCA 1JZ6A 3RYCA 3RYPA 3AYAA 1IDSA 1VBC1 3KGZA 4CVUA 2WAMA 1SPPA 4TV9B 2ATFA 4LIUA 4O4JA 4FPPA 1XILA 1EN5A 5GLZA 1SBFA 1POQA 2WWSA 1SETA 3JD2A 3KB5A 4BK4A 1RJ7A 1UD1A 1XNBA 4AVVA 2OTLV 3I54A 3TEWA 4LPLA 1I94O 5B3SB 1GQHA 1KQRA 2YB7A 3MUY1 3CEWA 3O5SA 3SPCA 2VOXA 5ABJC 5LMUO 3AKQA 3W7WA 4XF1A 3VBUB 1O8PA 5ANQA 3VDBA 4GWNA 5C9AB 2C4XA 1Z2GA 1RVF1 1BVP1 1BEV1 2ZXQA 4XQ4A 3Q8AA 4UFZA 5FPVA 1H9PA 1Y76A 1WMEA 4GUNA 4PQQA 2DE0X 4WM7A 1RUD3 1Y3TA 2JIGA 4K1YA 2XBO2 3VKFC 1XNQB 4YNIA 3N9QA 1M4WA 3EYPA 4FI9A 2YFZA 1A34A 5FYBA 3WW4A 2BGPA 3LOBA 5IJ0A 5A3TA 2F23A 1G9AA 4MGQA 4XF4A 2IXIA 4MT8A 1JH5A 3ZFEA 4BWOA 4BAYA 2RM23 2XHBA 1PZ7A 4HONA 3R4UA 3SEPA 2QE3A 3GZEA 2C2AA 2D40A 4OI1A 2YBKA 4Y1YA 4YGBA 1N47A 3HPLC 2Z79A 4O4IA 4YZ2A 5GONB 1B09A 1N0NA 5LGNA 3LSUA 1GH6A 5CA1A 5CG9A 1YEWA 1TAEA 2OVUA 5CBHA 4Q4X3 1VF6A 3ETPA 4ZU7A 4JI4B 2GTSA 2BVBA 4DRVA 3H3ZA 5C3PA 4FVMA 2HKOA 3WB0A 5CADA 1KEXA 1VF7A 3CYOA 1DG6A 1VF6C 2WL1A 3OGIB 5FNVA 4MSVA 2VQEB 2ZEXA 5A1FA 5DM6V 2Y8KA 1AX0A 4ZU4A 1BMV2 5DUXA 5HCBA 4P9GA 2GNTA 1MSDA 2XGXA 3VB9A 5KHKA 1RJ8A 2BZDA 2VRZA 3R6SA 4BIFA 2E76B 3POEA 3OUJA 4ABMA 3W7XA 1UYPA 4WVWA 4MLOA 4MTOA 4H0LB 3UM7A 2XUMA 1RUD2 3OUSA 2ATKC 4K0KB 2GC0A 2DMXA 5DZEA 4IEVA 4BLJA 1OF4A 3HAGA 1X82A 3K9SA 4QNHB 3ON7A 3QLQA 1KXGA 5I8SA 3ETEA 3K0DA 4RA0A 5FPAA 1FOD3 1VALA 1B35C 1WA4A 1XYNA 4UFKA 2EBOA 4X20B 3OE7G 2ZKOA 1NQDA 1CJPA 2RM22 3HR9A 4K6BA 1OSGA 1W6QB 3W59A 2EXHA 4DV3O 1VRBA 3B94A 4CCLA 2DWDC 1OH3A 1M93A 3I2HA 3ES1A 1Y66A 4X1IB 2WWWA 4P00B 1R73A 1R083 4LF4B 1SQ4A 4AHXA 3J8F2 2SBAA 4UVAA 5EC1C 4Q4X2 2VZUA 3VDDB 1N33O 1NT2B 4WBNA 2I45A 5JXJA 3DYOA 3HBZA 2OX0A 1AYM3 2QVSB 3JD4A 5JDBA 4QPGA 3WXPA 4CP9B 5F3CA 1B06A 5CU1A 5EYYA 3AG7A 2AGSA 3KVAA 2Q4SA 1X7NA 4QPGC 1M5IA 4NAOA 3AL5A 1RPRA 4RL7A 1EUUA 3B02A 1S0IA 2HKXA 1RUE1 4B3RO 4YZ4A 1KDMA 3G6BA 2W08A 2XJVA 3CMEV 3CC2V 5F2VO 2AH2A 3POIA 4DR4O 1F4AA 5CA0A 2E3CA 2JD9A 4DR7B 3PUAA 2EIMC 3K4ZA 4XJUA 1GFF2 5FBZA 2DDUA 3JBG2 1RUI2 3PU3A 4R9DA 1SBDA 3W7TA 4XHBA 1FOD2 3QO5A 3U75A 5IJ9A 1AR91 5LBCA 4FFFA 4UVCA 3AG4C 5J36A 3DUIA 4JRLA 2JRIA 4MVSA 2L6LA 2W46A 3CCRV 1EN4A 3CJHA 1BHGA 3U10A 4QQOA 1JU4A 3VDCA 3CKHA 1R082 4LCUC 3RI9A 5FBJA 1JW6A 3ZHUA 2UUAO 4URTA 1W03A 4IDZA 4MTFA 1WA8A 2A06H 4K3AA 1Z7S1 2D3PA 1UY0A 4M3CF 1AYM2 3MUZ1 4OLLA 1NE4A 3QNEA 1K34A 4QX2A 2D43A 1I7FA 1PO23 2ZGSA 4S2FA 2VMHA 1NKDA 4Q4V2 3ZRVA 5C3SA 2JJ1G 2RS13 1R6NA 4LF9O 1MS8A 3KHBA 2P6JA 3PJQA 4PI0A 1CEZA 2CH7A 3DF0A 1VQ7V 4ORFA 2VUCA 5A3MA 3I59A 5IK8A 2X8KA 2X5IA 2XB6C 3SJAC 2ILMA 5IVJA 2VAUA 4TWTA 5GTIZ 1KDKA 4CH3A 2E7QA 1OKQA 3V56A 1HXS2 4YSFA 2QR4A 5AC93 4K1ZA 4Q1PA 2VNVA 2A3YA 2VVEA 4HL0A 4J10A 3OD0A 4ZY9A 5JXIA 5FZEA 1GWMA 2VZ3A 2JGDA 4O4LA 4E2QA 4MOAA 5IJRA 3ZXLA 2GC3A 1A8MA 3CQOA 2W39A 2QM8A 4RO2A 1UZYA 2EIBA 2R9RB 3QBQA 1HR0B 3DTUB 1EAH3 3O0VA 1S0GA 2R1BA 3BVOA 4IEYA 1YO8A 3WDVA 1WBFA 3IIIA 3B8NA 5L9BA 3FBMA 1W9FA 1HNZB 3LDKA 4OYUA 2Q5ZA 4V2VA 2VXJA 3STLC 4GMP3 2R6QA 3ABKC 1XHZA 4R9BA 4DV5O 5CBGA 4DUXA 5K0UA 1AI5A 3ZEDA 4AI0A 1C28A 1PO22 5H9PA 4MVMA 3OEBA 5JCTA 2YEVA 2ZXWB 3FD9A 2RS12 3K04A 4AL9A 3TK1A 1NS1A 5K0UC 4CDWC 3JD3A 1US3A 5LA2A 3R0RA 2KKWA 3ZPOA 2PXJA 3WD5A 2MPFA 1W28A 2HLDG 5FXZA 4CDQB 3QG5A 3I7DA 4ARYA 2OKXA 4PDWA 2X6CA 4C0BA 1GMMA 3I3BA 4A4AA 1DQ0A 5AC92 1BBT3 2IH1C 1EV11 5LW9A 2GNMA 3KS7A 3AZZA 5A32B 5AVPA 4FMTA 1M56C 4S2HA 3ZHRA 3VBFA 4DV6B 2W9XA 4NWVA 3HKEB 2MNGA 1QJU3 4QPIA 1ULEA 1W0OA 3WF0A 2X09A 2WQZC 3VBFC 1UIJA 2ZAHA 1XNAA 2Q0AA 5JR2A 1OCRC 4D7SA 2VECA 3FYEB 2D6LX 4Q4Y3 4FPKA 4COZA 3NV2A 5IVEA 2DYSB 4IEXA 2F66C 3UV9A 1URFA 5K4LA 1V55C 2RDRA 3KCXA 4CS3A 2OQ6A 4CPBD 4XFIA 5F3GA 4AOCA 4QPJA 1OOPC 1QMJA 4I3PA 3N36A 1SHWB 4MGIE 3WNLA 4P14A 1F35A 2Q7HA 5KMGB 4I0WB 1HRV1 4AQSA 3WNNA 4Q8KA 1JOBA 2F17A 3CBNA 4K8ZA 3KMHA 4YZ5A 3MF6A 5FR3A 1V9PA 5HI0A 4LT5A 5FY9A 4TV9A 3NNGA 3I55V 2AW9A 3ZXAC 1TNFA 1JMUB 3FKSG 2GBOA 4PJYA 4NPRA 2LP7A 3GBWA 1LCLA 3B2EE 2F4VB 2VZOA 5C71A 4XDLA 4DO2A 4NXNO 1FYUA 2EXIA 1BBT2 3RPQA 4JI7O 1F4HA 2CTWA 4U36A 1KJLA 2BUKA 3OTFA 3P6BA 2RS52 2BFUS 3OBZA 3ILFA 1GKFA 4E4ZA 1K73W 4NRMA 1LECA 5A3WA 3VBUA 3OGRA 5C9AA 1AJNA 3ZX6A 4Q0SA 2E51A 4NIAA 2DTWA 1QJU2 1DQ1A 1NBMG 2W1WA 2CAVA 1WJZA 2C0ZA 1UCXA 5CISA 4ES9A 1S5LZ 1IPSA 3K9AA 3OBRA 4B3MO 4JI0O 1W0JG 1YFXA 1XNRB 3ZSJA 2QJ1A 4DS0A 2V7QG 1KGYA 2QNKA 2WT1A 1TZOA 4UFLA 3ACFA 3BTAA 2BFUL 2RHPA 4DRRA 3MV01 4FZ0A 1H2NA 1DYKA 1SQPH 3VKLA 1W6NB 5FUIA 2YMZA 4RS5B 4JTNA 4JI3B 2H0BA 3M99B 2IXCA 5E8AA 2OCHA 5F32A 2BBAA 4Y1ZA 2D3SA 2EIKC 5LMNB 3GZTB 3C7HA 4N53C 1ENQA 2Y48A 2UXCO 4J9YB 5FPZA 2XASA 5GONA 1PGSA 4N9HA 4UFMA 2X6BA 4KNCA 1DBNA 5HCAA 5JXGA 4WZCA 4QKFA 4MXVA 1HNWO 3HT2A 1O91A 3ZMSA 2UWCA 3BGAA 3LNNA 1WKYA 1GK9A 1VQ4V 4AEKA 2OXBA 3ZRSA 3IM0A 4B3SB 1OCOB 4PIYA 1E79G 3ZO0B 1XOYA 4CCJA 4MH0E 3VL8A 1JMKC 1SDWA 4C0HA 2PI5A 4BU2A 1W04A 2ZR3A 1N1VA 4A44A 5D2AA 3ZRXA 2WNVB 1FT9A 5L19A 2ZE5A 3CEIA 1HJFA 4KH9A 4XAEA 3K4DA 4DEQA 1GQPA 3HJRA 4ZXEA 2HH9A 1KBHA 1F7YA 2QTSA 2R32A 3VOUA 4LC1A 1Q6IA 4JZ2A 5A3NA 5FZHA 1AXZA 4BIUA 2UXBO 2BBVA 2QQLA 3FUQA 5DZFA 5TSWA 4F6RB 1RUJ3 2DUQA 4X20A 4MGTA 1QGLA 3M8AA 1FMD3 1W6QA 1UL9A 1RIRA 1RUD1 2XL9A 4WF9V 1AB3A 5FZ4A 5IATA 4XUTA 3I3EA 4LF6B 4QB1A 3OJBA 1IXMA 4JVAA 3B5LB 1ULFA 4W50A 2YIBD 2JEUA 3ACIA 2VTFA 2N05A 2HWF3 2WIIB 3AZWA 1HX6A 4H14A 4X1IA 1JODA 3J7AU 4DR5O 2PQSA 1SKVA 1QWRA 1BK1A 4XMAA 5GLTA 2VJXA 4H7LA 3VDDA 5GLWA 5IVFA 1DLLA 4FLYA 2P4VA 2UYAA 2BOCC 1H4GA 2IJHA 4EZ4A 2RM21 1CAWB 5HFLA 4CP9A 2B45X 3VDDC 1IQDC 5FZ1A 4I9WA 2PHFA 4KG0A 3ACHA 5CN0A 1MZEA 5A7SA 2VU9A 3ZYJB 2WO3A 3OMIB 3WEZA 4RR3B 4INDA 3OEEG 1DQ4A 3KZIZ 1JOJA 4FOWA 3VD3A 4Q4X1 2YS8A 2VG9A 4DXRA 3VKOA 3ZHQA 4CDUC 3E97A 3T1MA 2R7EB 3FBYA 2Y6JA 2OZJA 4J1XA 2E5LB 2SLIA 4DW1A 4LA2A 3VZKA 1JZ4A 1MEC2 5J2TB 3UESA 5LOVB 1AL23 4Y3OA 4LF5O 5I8TA 4NXMO 3D3IA 2VMEA 4OI2A 3ZN1A 2Q1FA 3U78A 2V4DA 4JF3A 4NHYA 1RUJ2 2Y60A 3IAYA 2JG8B 3AG3B 1AR63 3G71V 3ZVXA 4YPJA 1NR1A 1FMD2 4B29A 3WDYA 1ZA7A 3L2YA 2TBVA 1XMOO 3S7IA 2W0XA 2XTAA 2QQPA 1OV9A 1JTZX 3BA8A 3T2OA 4LFCO 2ZCWA 2A3QA 4B4PA 1UY1A 2Y4TA 4RN5A 4XTMA 5EIYB 2WJSA 2RE9A 3QH7A 2YIDA 4DO0A 1FOD1 2HWD3 1TMF3 1VB4A 1NVPD 2Q8DA 4Z1MG 1FYJA 3OCPA 4MG2A 2V4VA 5LYJB 2IU3A 3K79A 5J09A 1GOGA 1TQ5A 4P9PA 1CQ9A 4NIIA 1HB1A 2HHHB 2HWE2 1AJPA 1W6OB 5DG2A 4X9QA 3KF3A 4UCUA 1R081 4DV2O 2P17A 4NOTA 2XUEA 1SEFA 3RRDA 3AFKA 2XAQA 1Q7YW 1C8M3 1AYM1 3UT0A 3J7LA 2Q73A 4RYDA 3K5MA 2PHLA 3PUIA 3WOGA 1X8MA 4ES8A 2VQAA 3AP5A 3RBZA 1L0NH 4J25A 3V0BB 1FJGO 1BZWA 4XAAA 3WF3A 2ETNA 1LGBA 4YWAA 5CA6A 1KMIZ 1GM7A 4HVQA 3ASOB 2XKOA 4CE8A 3W58A 2GAUA 3T09A 4MZUA 5DUVA 3BU0A 1AR62 4YW4A 4BXSV 5LASA 2VVFA 4X62O 2PHDA 2FTKA 1BS3A 2DCJA 5KAFZ 5C93A 1GZTA 2ZD9A 2EILC 1GP5A 1XPWA 1KYOF 2K0GA 4JC1A 5DAQA 4HZ3A 1SFNA 3RI8A 4EN8B 1FD9A 4ZHNA 1CXZB 5F8PA 5KC6A 1UYXA 1OMIA 4E8CA 3VV1A 4W4KA 5APAA 2NN4A 1QEXA 2HWD2 1WP7A 1VP6A 3ZKYA 2XR4A 3MDSA 5F37A 1VB2A 4I30A 4QXBA 1E1QG 1UNBA 1DF4A 3AVRA 1R3IC 4PDRA 3DPRB 5FK8A 5JVDB 2WZ8A 3WW1A 4ZS3A 5FUPA 4R8HA 1ZZ9A 4XCAA 2BWAA 3VQWA 4AR2A 1QJFA 1RYYA 2ZMKA 1FXZA 1C8M2 2WYSA 4HANA 3CD6V 2VQTA 1JVMA 1ZBE2 1O4TA 3JCIA 1K8AW 4LBKA 2LQTA 4RQPB 1GSLA 1HNXO 4CDQA 4DR6B 1WUVA 2V5DA 4DUYO 4AAPA 4TWKA 4DR1O 1PO21 4G3YC 2EJRA 2FCUA 5F9TA 1KITA 1K5JA 3GWKC 2DU0A 2RS11 1O5UA 3OR7C 3IKWA 1BSMA 1YXWA 1K9MW 1LNSA 5A32A 4XDPA 3OTOB 1WD3A 3BVCA 1UY2A 3LIHA 4L99A 4PDMA 3K3WA 1IURA 2XQRA 5T5OA 1IX9A 1DDLA 2X53S 3ZXFA 4XBNA 3HKEA 1AJQA 1CAVB 2B5UA 2YI8A 4PD4F 3LGRA 1QU7A 3E86A 2BNNA 4QT6A 4I02A 5B66Z 1ULGA 2W87A 5FPXA 5LMUB 4AK3A 5AC91 3IT8A 4QX1A 2WSUA 2HVKC 1R3KC 2VOTA 3BOPA 4QX0A 5FP3A 4S2GA 4G28B 3K48A 2RV9A 1ULCA 1VMFA 3M2MA 1HP8A 1ENRA 3LA2A 4RHV3 4MVUA 1L7LA 4QU2A 5L3GA 5KMGA 2GMMA 2BOBC 5JMOA 4FM2A 1EAH1 3VBRB 1DGSA 4I0AA 4QPYA 1QHTA 4NPMA 3Q4HB 1LUVA 1X36A 4YLZA 2XQXA 4L2NA 3S3WA 4O9GA 4GMP1 1S0DA 1PMIA 3MPBA 1N4CA 1THZA 4ONUA 2FL4A 2J1TA 1ROPA 5DAPA 3NQHA 3VBOB 3ZXKA 4PF1A 1XI1A 3S0MA 1X9PA 1AF9A 2B42B 2Q30A 5A6QA 4UWDA 1BGYH 1YI9A 4LNVA 1IXBA 2WT0A 1N8RW 3ZYGA 5CB4B 4LHLA 1S0VA 2J42A 3ZR5A 3L72H 3H1JH 3FAVA 1QNYA 2AXTZ 4FPOB 4GD4A 4DRXB 4N7IA 2KG7B 3WNXA 3I56V 3ZHVA 2BOIA 1RUC3 3JXSA 5GZGA 1MS1A 4UBGA 1WMFA 1WZXA 1GTOA 1BBT1 5FZCA 1NR7A 3T2MA 3CP1A 1UYZA 1XQNA 5H9QA 1UPSA 4JAAA 3OGCC 3IAPA 2Q7GA 4NTXA 5LL6Y 5FWEA 2LW8A 1IKPA 1OBNA 2KD7A 1QJU1 2W1UA 1W6NA 4TSFG 4RS5A 4RHV2 5GZEA 4M4RA 1XHXA 4AFAA 5FP4A 3VHPA 1LU1A 3FLPA 1N3PA 4RS5C 4Y1UA 3T1YB 1N34O 2UXXA 2P5OA 3ASIA 4E4DX 5HV0A 2WO7A 4Q4Y1 1X59A 3I2JA 1NA1B 3UKVA 3SH4A 2Y6FA 1W6PB 4ATFA 2ZHLA 1OZ0A 4K8FA 3AP9A 1MQTB 2IXHA 4DV3B 4DW0A 1K4DC 1G9CA 5C8WA 3MBWA 3CRAA 4HG6B 4DUWA 4EN6B 3EHBB 2EZOA 2W91A 1UWWA 1OPOA 5I0RA 4LKSA 2BV4A 3AMNA 4CCOA 1YJNV 2A6ZA 3ZCCA 1DK1A 1OCOC 2WRAA 1VBA2 2R72A 1EM1A 2BJSA 1AI7A 1XMQO 1UFIA 4I4TB 5FZ7A 2V72A 2UUBO 1O9GA 3K46A 2WNVA 2JGUA 4AEJA 4W8JA 2EX3A 3PL0A 4E2SA 3ZMOA 1V6IA 1RUC2 4UBHA 1QY4A 4MGYE 4HLTA 1ZYBA 1RXGA 3BAAA 1OCCB 3OGGA 5FP9A 2P4KA 2WNVC 4KWLA 3C3VA 3S5QA 4JI2O 3OMAB 1AX2A 3WT3A 3WNPA 4EWAA 3ES4A 3BN6A 4L8QA 3CNAA 4JI6O 2QKSA 3AX4A 4XF0A 4X64O 3TCUA 4XURA 4F6RA 4DR4B 3BI3A 4Q20A 1YQ5A 3RWKX 3IPVB 3D0SA 1Y4WA 3J7HA 4XTPA 1R093 2NLRA 3N9LA 3BTXA 5HFMA 1NYWA 1VBB3 3CC4V 5FZFA 1SESA 1SG3A 4DUZO 4KFMA 3QO8A 4U3JB 5FY5A 2J7MA 3F7VC 2BPA2 2ZE7A 1VQ5V 2Y69B 4ICGA 5JSRA 2FDIA 1PZ8A 4NE9A 3ZN6B 2PAEA 1CAWA 4XFBA 3UNPA 1PKXA 5FLJA 4XYXA 3R05A 4Z8BA 3POJA 3PHMA 4XW3A 5IK5A 1AR5A 3O1RA 3H3UA 3MD0A 4OCTA 3MLJA 5BNOB 2UUAB 4DY3A 1WCUA 3NKTA 5FYIA 4RR3A 4FFKA 1W8UA 4XMIA 2HFEC 4DR2B 1PPJH 1JHJA 5EBMC 2JDAA 1C1FA 4ASMB 4JV4A 1WLCA 2QTOA 4LK6A 4IUGA 1PNMA 1XNKA 1FI2A 1NY71 3CPWU 3T30A 4WFAV 5J2TA 5D8AC 5F2SA 5KA6A 2KA3A 2Y33A 4AHWA 3LQCA 2WZR3 3HPNA 3E35A 4IGGA 4ZXKA 3RMYA 5KXBA 4FAGA 3ABMC 1UYYA 1WN7A 4C1WA 3H8RA 3GDBA 2OQ7A 2G38A 3HQXA 1YFWA 2JG8A 5L73A 4FPCA 2QDOA 2GUZB 4XBFA 1R092 3ACLA 4L0PA 4MHUA 4K40A 4CXYA 3AKSA 4X66O 1A6CA 5LK5A 3BRCA 2JG8C 2HG5C 3AG3C 1PMHX 1KFXL 4CBCA 4NRQA 2ZMNA 3N9PA 4PIZA 4AVBA 5LK7B 1KS5A 4AFDA 1RUJ1 3ELNA 3FJSA 2ZX0A 4TN7A 4DFSA 3WNKA 1FMD1 3RZZA 1W2BU 4UB6Z 5LYJA 4P9YA 3T4VA 1O5LA 3ZMZA 3TETA 4LO4B 2DCTA 1QJY2 4E4SA 2AC1A 2ZGLA 1BMFG 1CGPA 2HWF1 1PM9A 4QE9A 1VQKV 2CHHA 1W6OA 2A5ZA 3TNQA 1GMGA 3U1XA 1IS6A 5FPUA 2GZWA 3RDIA 3BYWA 4YW6A 1V6KA 4BW5A 2OPWA 3UK9A 4AVTA 3BB6A 4DV5B 2O8QA 4TTGA 5FFOC 1AI6A 1U96A 2G4IA 4LIVA 1ZLZA 1Q5OA 2WLMA 4KI5M 3S5AA 4U7OA 4B3TO 4Q4W3 3HQUA 5A7OA 3CJIC 2JG9C 5T5PA 4YIPA 4CCCA 4ARXA 3BIWE 4UYBA 3WF1A 2D2CB 4IL7A 3V0BA 2WZR2 3ME2A 4GZ9A 3DKWA 5LB6A 5KUMA 3WDXA 3DC5A 1ND2B 2R9AA 4Y5TA 3BPZA 4CH4A 2CGOA 3JYCA 3NRUA 5J2UB 2HJDA 3I3QA 2A7AA 2FZ2A 4GKYA 2BSKB 2Z5UA 3AYDA 4CZSA 3CC7V 1AL21 2W95A 3BTZA 3FC0A 4R9CA 5EQUA 5J96B 5H5NA 2YXHA 2GHYA 4RSUA 2DF7A 4JGYC 1PM4A 3TEZA 4AEMA 2GSYA 3OGSA 4UFHA 3B3QE 2W68A 1AR61 4B1MA 3DPRA 4YVWB 1ZUQA 3CL1A 2Q5TA 5KHIA 3PJSK 3MZHA 2P3IA 1X33A 4DMIA 5LP6A 1Q8SA 4F4LA 5JVDA 4Q6GA 4LLOA 2ZBJA 1Y74B 3ZFFC 3LEKA 1Q82W 2LRPA 5FO9B 5J3UA 3GHMA 1VMGA 5LP6C 5JZGB 1MVQA 5FPRA 4QXHA 5H9RA 2VMGA 1US6A 2HWD1 1TMF1 2WQ4A 3PN1A 2KQXA 3H7YA 4ISRA 1IOAA 4GCZA 3E8FA 4RQPA 4JDMA 1Y9MA 3GCWA 1P84F 4Q4W2 1TGOA 1JUIA 2WLNA 3SCHA 4RQPC 3GZUC 4Z82A 2AYHA 3WB2A 3QOPA 5CFCB 4YRDA 1W8TA 1SZBA 5FRAA 1C8M1 4E4HA 2E63A 2KB1A 5BXZA 3KCYA 3RZHA 5IWAO 1CAVA 2L35A 4NXNB 1E5IA 2DVGA 1PIV3 4J6GA 3VHRA 4JI7B 3QVNA 2PYLA 4AG4A 1AILA 3GBFA 3WG1A 2FMLA 4XZUG 3IFXA 4W4ZA 3W21A 1NTKH 5FP8A 2NM1A 1LRHA 1PVC2 4OI0A 4HT1T 1UPGA 3KSCA 3WX5A 5F5CA 1F5FA 2YU1A 5FUNA 3VUOA 4R52A 2B8MA 4L97A 4FT8A 3A2FA 4JI0B 3M3IA 1LGCA 4LH6A 4WVMB 5B4XA 4ZU5A 1UXXX 3PIJA 1MZFA 3MLLA 2DYRB 4NAMA 4YW5A 2JEMA 3U14A 5LBFA 4LR4A 1JHNA 4YVSC 4QD2A 3VBRA 3SKVA 1WB7A 2XKPA 2W94A 2DU1A 3RZLA 3Q4HA 4R9AA 4JZGA 5DQ0A 5F5IA 2OYQA 1KP3A 3VBRC 3O1PA 5LZ6A 4FTSA 1A78A 3VBOA 4M01A 4FM1A 2XMLA 3L9JT 1KS4A 4ITCA 4LFAB 1XL4A 1UU4A 1J3QA 5I0SA 5CFDB 3K77A 1JYNA 2DQ0A 4P5YA 3VBOC 5BNPB 1HNWB 4Q1RA 4KUMA 3UO3A 4CP0A 4QAWA 1K5MB 5FJKA 3QF7A 3NKGA 3UL2A 3IIAA 1RUNA 3ZN4A 2QBXA 5CB4A 3FX7A 3K59A 3C7OA 1CZVA 1U5YA 2JB4A 1U5ZA 1PIV2 2VBDA 3AG1C 1YTFD 5EIBC 4DRXA 1H2GA 3LSEA 3S7EA 2NNUA 3WW2A 4QKBA 4ISQA 4Q0PA 4JI1O 1GN2A 1GBGA 4I01A 2XHKA 2B1GA 5KC5A 2F43G 5IVVA 4EROA 1VJ2A 5F3EA 4YM2A 1VLNA 2CYFA 1CPNA 5JPNB 4XEZA 1JQ0A 1UXZA 1BL8A 2LTNA 2UU8A 4RGKA 4ZKTB 4DV4O 3BCWA 4WFGA 2PFWA 1VMJA 2FMYA 4CC6A 4FPJA 4Y24A 1NA1A 1COWG 1GRJA 4FBFA 1W6PA 2VNGA 2OTJV 1MQTA 3DGEA 1NKGA 4JTCB 1J58A 2VWJA 3SGIA 1K42A 4RHV1 4HPKB 4FFHA 3HNBM 3JUUA 4BE3A 4DR5B 1MQTC 3H7JA 3DXRB 1Y43B 1VE0A 4F7ZA 4D7YA 3AG2B 2EVXA 3OGJA 1RSOB 1DGRA 3AP4A 2E7TA 2Z42A 2VE1A 3SEEA 3OUHA 1J5EB 4I4TA 1KU9A 3ZHSA 4ZKIA 5AG2A 1PX3A 1W2AX 2J1EA 2ZZQA 3U07A 1S2KA 3V64A 4W6WA 1LOFC 1XRUA 2C1FA 3M70A 5LHGA 5FY7A 3IB3A 2RDCA 3I2GA 1HLCA 2GP5A 1AJKA 1NTMH 2GDSA 4O9EA 4MXWB 1ZX3A 4JAUA 4N21A 2BTVC 3N9MA 3LPGA 5A3LA 3ORJA 3IC9A 4BCUA 5B1AC 4PF5A 2NN8A 1NZ6A 3FMGA 1G7YA 3KT4A 5FZBA 4AI3A 3IPVA 1HDKA 4X1KA 3RFRA 4AHYA 1RUC1 4N43C 4YM0A 3ZDSA 3CMGA 1AUYA 1AX1A 1EP0A 3O65A 5D21A 5CBFA 4N9IA 1DYOA 3FYIB 3OPTA 5C3RA 4GJYA 4U3JA 3BFRA 4CC5A 4B8EA 4IGPA 2DVAA 3U4XA 1WW5A 3H0OA 4EYUA 4LBLA 4NB5A 4LE4A 3KQRA 4OX9O 1POV0 4JYCA 4YJ3B 5L7OB 4DIQA 4EFEA 2AZ2A 2ZIOA 3PVEA 5KX5B 4FOQA 4K7JA 5BNOA 5JWPA 3BY6A 2QSAA 5DN6G 5A1AA 1AXKA 4CDXC 1XYOA 2UWAA 5BNOC 1DZTA 4IEOA 5A7NA 5FZDA 3VQXA 1C4RA 1F5JA 4H7MA 1AR83 5DDJ3 4BQYA 5SV8A 4C1XA 2G19A 5I0DA 3HKDB 3WG4A 2VMIA 3I2FA 4UV9A 4RQEA 2BGOA 2ZGMA 2ZKNA 3KHCA 1Q8IA 5A3PA 5GZFA 4GH4B 4RWUA 3LPFA 1WMXA 5JR7B 3O1VA 4KXRA 2J1RA 1GOFA 3F5TA 1RUOA 4K9SA 3HKCB 1UMZA 5A7WB 2AZ5A 2ETEA 2RNBA 1CVNA 3D3AA 4JYYA 2B39A 1L7QA 5EYXA 4YJ2B 1SLAA 1S5HC 4HVOA 1IZ3A 1RINA 4GKKB 4RGAA 4BPZA 3SPJA 2F95B 3OPZA 4HNAA 4MW3A 1LJ7A 4OULA 3SPHA 1KECA 2GNBA 1QH6A 4CUAA 4B1LA 2EIGA 2JS5A 3H3LA 4I2OA 4YGCA 3KVBA 3AM2A 1GOHA 1DTOA 4W6YA 3E2EA 2VY0A 3JU9A 4XXAA 4FSJA 2P1BA 3LDDA 2ZGUA 3M3OA 3ABLC 4QWNA 1FFXB 2ZX4A 2ITDC 2ZGQA 1R091 1FV2A 1PNLA 3VL9A 3IDEA 2IU0A 1VBB1 3OOXA 3DCQA 5DG1A 1SQXH 2ZABA 1W0PA 1D4M3 1ZBA3 4D69A 3ABUA 4TOIA 3L74H 3NAPB 1P4RA 4CXWA 5C4WC 4G9SB 2EZPA 5DDJ2 1VQMV 2RR13 2A6WA 4CS4A 1HB3A 1VIWB 4U2AA 1ALYA 3I97A 3ZS8C 2P3JA 2A73B 4CEWB 3B93A 3NNMA 1HRI2 1SQVH 2IBZH 5FOBB 4NHXA 5FLXN 3LA7A 3O1OA 1LHUA 1YHFA 1H8VA 3VBSC 1Q8OA 1NCQC 2E74B 1HNXB 2HJIA 4KWJA 5K1PA 3ZXGA 4DUYB 4QGPA 1ND2A 2D5FA 4I0XB 1X50A 4I50A 4DR1B 4HK8A 2VS0A 4LE3A 5FYTA 5IK4A 4FLUA 5A3OA 5B1NA 5J2UA 2VXRA 2VZTA 2BSKA 3ST7A 4DUVA 2B9ZA 2WZR1 3KT7A 3GXUA 3CXHF 4AHZA 1LR1A 4KU7A 3T0DA 3L9DA 2QCSB 4NRPA 1VBD3 2VTXA 2R70A 2LJ2A 2H6CA 1TME3 4YVWA 2JKXA 1DZQA 2GNDA 4K3UA 4IEPA 1N36O 3VN4A 1Y74A 1YF2A 4DXWA 4N90A 1NLQA 1OLME 3C2UA 1D4M2 1MABG 4IXLA 1REDA 2DN9A 2DJVA 2LGWA 1RITA 4OHZA 1LR5A 2WLLB 2VCMA 2WUHA 2RR12 1HW7A 3MEPA 5JH7B 3T4HB 2PI4A 5EP9A 2AEZA 1UY3A 4EN0A 2WPDG 5FXXA 1AZDA 1D7PM 3RMXA 1NH2D 4BR6A 1OHHG 4GYCB 1S77D 4YFZA 5CFCA 4LBEC 5LGUA 2GP3A 5EHDA 1UX7A 5IVYA 1FXKB 1QOOA 4RFT0 2P37A 3UKMA 5KBFA 1FAYA 5C5TA 4YHHO 2Z2SB 3MW4A 1T5EA 2AREA 4CEYB 2O8OA 2PGGA 5JVVA 2EA7A 3S6PA 4Q4W1 2QA4V 4E2LA 1XC6A 3U11A 2D97A 2WA4A 2WFPA 2D5HA 2ZDIC 4CTEA 1WWYA 1H9WA 1H1IA 5FYSA 3O7OA 4YG0A 3N35A 4LXLA 4UAPA 1CX1A 4TSVA 1QJEA 3RZGA 5JI9A 3HOBA 2UU9O 1QIQA 3SYOA 2GV9A 3CCMV 1BKZA 1H8TA 1VBD2 2QKCA 4M00A 4WVMA 3H1YA 1UMIA 1TME2 4A45A 2ZJCA 4LBOA 2EICA 2CGNA 1RC6A 4IQPA 1H8TC 5KHGA 3H1IH 4DV0O 2Z0AA 2WS92 5EYPB 5FYCA 2JX9A 3TRSB 1T2XA 3CCJV 2J1VA 4AQ6A 3WINE 4FO9A 1HRV2 3JD73 2XG3A 4ASKA 5KHHA 3VZOA 1S0BA 1S72V 1SQGA 3AB0A 4JI8O 3I8TA 4Q0QA 5LBBA 4EEQA 1O9HA 2EINB 1IS3A 3AKPA 5A70A 1ORQC 5T52A 2V5YA 4GKJO 4UT5A 5FZ0A 5EPAA 4FCAA 1N34B 4A6SA 5A9GA 1SQQH 5B4NA 3LOIA 3AXDA 1BXHA 2WAOA 5FK7A 4CH6A 4M0NA 4D6QA 4FIPC 3AEIA 5CFDA 3KG2A 5FZMA 5KXCA 2VQEO 1VAVA 3FHAA 1K5MA 5GLUA 2TUNA 1IKQA 1YC61 1SFYA 3RN4A 3ASNB 3PUQA 5CFDC 5ISLA 2CTVA 4YM3A 1JU3A 1P7GA 2FDFA 1FS0G 2JDNA 2D3RA 1ENSA 2QWQB 2OUHA 4B7KA 1SLIA 2VBPA 5FY0A 4IE7A 5IY5B 4Q26A 1ULPA 3LUTB 2WLHA 1XMQB 5IE9A 2UWBA 4GT1A 2UUBB 1D2DA 1U97A 4NROA 4PV1B 2VC9A 1T6BX 2I2SA 2WLKA 4CUCA 1QBZA 3NSTA 1UN1A 1LESA 3S57A 1S0EA 1H0BA 3KWVA 1PIV1 1W99A 4L8JA 4NMIA 1OT5A 3TOJA 3CB2A 4RFRB 2WA3A 1RGSA 1OD3A 3WB1A 5LEKA 3QTCA 1XNDA 1F4MA 1GUIA 4NYKA 3VQVA 5C6CA 1OVPA 4JYAB 4X64B 2JIZG 4O4HB 4UW3A 2IC1A 3JD72 4DNYA 3PNAA 1V70A 3E5UA 4IHJA 3WZ1A 2WSSG 5LA6A 3VBHB 4WFEA 4WM7C 3JASB 1JZ3A 3URFA 4XFAA 2ZKLA 1K5QA 1PNFA 4CRQA 4PBOA 2HVJC 4MVRA 4OFGA 4DV7B 4HPKA 4L87A 2X10A 1GICA 4HOOA 1WD4A 2JDYA 4DUZB 5J98B 5B2GB 3MF9A 5FMOL 4AI8A 4O7XA 4NVPA 3WLUA 1UAIA 3DXRA 3UT5B 4BISA 5JSPA 4QHBA 1RSOA 4P9JA 2HEYF 1RHI3 3ZFEC 4JZRA 1W2TA 2G9FA 1W0KG 4HFSA 3BPSA 5CB7A 2BTQB 3O12A 1LULA 2WSVA 3KQ4B 1F51A 4LWSB 3T08A 4IGQA 4RAIA 2P3KA 1PD3A 3C8XA 3EFFK 4YW2A 2ES3A 1GAXA 4V2WA 1BCCH 3BKZA 3ENRA 1W6MB 4IE5A 4L92A 1UJWB 4MXWA 5BR8O 2WC2A 4DR7O 2JVDA 2BOJA 2ERFA 1MVEA 1SACA 2VZQA 1K97A 1YLLA 3X29B 4GALA 5F7UA 1ZL8A 2OWOA 1RXFA 4Z1VA 4V1PA 2PA7A 1V6OA 1GWLA 4JDOA 1NQTA 1R3JC 1YYNA 1YJWV 3JARB 2JKBA 2XJSA 2WWUA 3AL6A 2GMEA 1PV0A 2RCVA 3T2QA 2QWRB 5EZWA 1SLBA 2NPIA 3MGUA 3EO6A 3NVCA 3EJKA 3LA3A 3M3QA 4LF8B 4QX5A 2FDHA 2ITCC 2YC4A 1JN2P 1V9U3 1STMA 3RVHA 3BA9A 3TJTA 1UX6A 2XJUA 2JEXA 5JOZA 4YJ3A 3B69A 4KWKA 1RM1B 5D5QA 5L7OA 2WLQA 4JKMA 4CXXA 4CU6A 3B40A 4DK1A 1QNWA 2VMFA 4QX3A 4NIDA 5L7OC 3EB7A 2ET1A 1RHI2 1DHKB 3GYDA 4CP1A 1VBC3 3JAKB 1ASJ3 1L0LH 4HN0A 3OY8A 2JDZA 3EVKA 4JV5B 1MS9A 3WG7B 1JYVA 3JD0A 3NV4A 1ST8A 5E1RA 2JENA 2VTXJ 4GH4A 4XFFA 5FY1A 1C8NA 1EPWA 2NZ9A 5A7WA 2Q0OC 3ZPYA 1BE3H 4PBPA 1H4HA 4L11A 4YJ2A 4AEDB 2PQQA 3S30A 1V6MA 3RSJA 3A22A 1YHQV 3MW3A 1OLQA 3I2KA 4G2KA 4YG6A 1CZTA 1NXD1 1BLZA 1LHNA 3T4DA 3N9NA 2H0VA 4OGQB 2E6VA 1G1XB 4BH9A 5JJJB 2VBBA 4NIHA 3VZJA 4TLGA 3OEHG 1OI6A 2UY9A 1V9U2 4AILC 2G1MA 1LAJA 3G4SV 3UKTA 2JS3A 1FFXA 1IBLO 3CO2A 1MR5A 1HNZO 2VR4A 4IGOA 5ERLA 1HQLA 2BRTA 1CIWA 3OEAA 4YIOA 1XL6A 2ZX2A 3KZ4C 3WDWA 1TVGA 1OXCA 3G6JB 1SCSA 3LEIA 3WDUA 1ASJ2 1QF3A 2XHNA 3NAPA 4CU9A 3B7MA 5HXMA 1FATA 3SJQC 3DXUA 3HEIA 3RZJA 1OA4A 3HN3A 1Q81W 3NAPC 1GZWA 4BZ4A 1ZRFA 4CEWA 2YDEA 3ZSKA 4PA3A 1CX4A 2VZRA 1JZ8A 3POSA 3LSQA 4UCRA 3FHIB 5BXXA 5B1BB 1M4UA 3RYCB 2BCCH 1GWKA 1AR73 3JSLA 1H1MA 1SPPB 1ZZ6A 2YI9A 1PNGA 1AR81 5DDJ1 4I0XA 1WMDA 3N9OA 1Q43A 5DXDA 5ABJB 1I0HA 3ILNA 3Q8CA 3WCRA 1HRI1 5CVRA 3N4MA 1LEMA 1UQXA 4Q27A 1E1RG 5M0TA 2X5IC 5LBEA 3NR7A 3I2DA 1OH4A 1WLDA 2HYKA 2VZSA 5IWAB 2PF4E 5A6ZA 5J9PC 1HQWA 2HYXA 3E1F1 1CAUB 2YROA 5JLVA 3O1TA 1JOYA 3D0JA 4AWDA 4AFMA 3ZR6A 3TYJA 1YQ6A 2Q8CA 4UW6A 1UZVA 2FCVA 2XT9A 4P9WA 2YXLA 2ZHNA 2ZTNA 2R043 2WLLA 4AVAA 2DW4A 5JH7A 1RUF3 3H1HH 3NW4A 2YICA 4BDVB 4X8NA 4TQFA 3Q8FA 5B5EZ 2PHTA 2VQFO 2UURA 4BLIA 1TG7A 3H1LH 5G05L 1D5AA 3EXUA 3WHTA 1VRH3 4GAZA 4RD7A 1P8JA 1D4M1 1ZBA1 2BW8A 4I55B 4PJ0Z 1PM7A 1AR72 1TEIA 3CRCA 4QQPA 4J42A 3K57A 1FXKA 3FX3A 3F2ZA 2RR11 1XSQA 3AYEA 4BB3A 2RDNA 3GJAA 1DP0A 4MX3A 4CEYA 1DGWX 1QQCA 5FLHA 3DV8A 1MNGA 1M57B 4KHPO 3J7NA 4FPLA 4GLXA 1HB4A 3VBBA 2Y0PA 4BA6A 1Z78A 5IFPA 2MHFA 1XNRO 5EK0A 3N2GB 4PT6A 2CY6A 1ZWIC 4PDWC 2YXYA 3LSSA 1GR3A 1Z5WA 4LR3A 2R30A 3ZMUA 3NV1A 3Q8EA 4JI5O 2ZEYA 3N2KB 1UO9A 2MK3A 5FWJA 5CMUA 2VO5A 4JI3O 4WFFA 2R073 4M4PA 2IZWA 3O14A 4SLIA 1GN6A 5EYPA 1B35B 4IV1B 3VD9A 2CE4A 2LS6A 4QPIC 1EAH2 2EIEA 2R042 1ENVA 5JOWA 4XUOA 1O59A 3JB4C 1BHAA 4Z07A 1RUF2 1RL3A 1VBD1 2EIJC 5A3UA 4RUEA 3POFA 1TME1 2FDJA 2A6YA 5GALA 1OKOA 2XAHA 1XJAA 4XF9A 2CK3G 4XFHA 4UUJC 2C24A 3O9OA 4MS2A 5GTHZ 2ZM6B 1K33A 2WS91 3M7MX 3ZLIA 3SPGA 1MPXA 2B1IA 2K1EA 3EXAA 1O3QA 4WBNB 3D5OA 2VW1A 1PVXA 2DWRA 5BYNA 1G9FA 1JJOA 1F23A 1M1KW 4MGSA 3K5LA 2VNRA 3I3DA 1D4VB 3RWRD 4IYHA 3JSNA 4JAVA 1OQEA 1MACA 3UCSC 3C7FA 1BQ0A 4FFGA 3DGTA 1SDDB 5GJ6A 5T55A 1I9RA 1W8ZA 1VBE3 1SFPA 1O3RA 5B3SC 2TNFA 5KXDA 1LTEA 2EIMB 2GALA 2UXDB 2CU5A 5IFTA 3IC7A 4FM0A 3G67A 3E8GA 3VBUC 2R072 4DINB 3H8UA 5GZDA 3APBA 3CF6E 4BQ5A 1AR1B 1JXNA 1JOPA 5C9AC 3LFIA 4Y20B 1A8DA 3CSXA 1DLBA 2FYUH 3AG4B 4O4HA 1DGWA 2E7AA 2J1AA 1GNHA 1H8HG 3VBHA 4LMFA 1P7BA 4Q4Y2 3JASA 3DKQA 4AYUA 3HNMA 2C9AA 1V54B 1DIWA 1EZVH 2RG4A 4LO7A 3BODA 4KL1A 1NTZH 1AVMA 3CS5A 4K8XA 2W52A 3UT5A 1ACCA 2XJTA 4JRAA 2VCAA 5FP7A 3KKYA 4QX7A 1FNYA 4OZXA 3QD6A 3JD71 2BTQA 2N7GA 4OX9B 4YGDA 2VL4A 1PHMA 4PA9A 4LWSA 1Q6HA 4GQ7A 4JQTA 3K4AA 1V00A 2W2IA 4UVBA 1VMHA 5HCHA 2LGQA 1RPOA 4QM9A 1W6MA 4C8DA 2NYYA 4JHTA 3SYCA 1FKAO 3G7DA 1AROP 2JE8A 5L36A 2GMPA 3I59B 1LOEA 3SJBC 2YY1A 4A3XA 2EIDA 1VBE2 4LTAA 5FPLA 4LA3A 4ZZ5A 3ZMTA 3NJXA 1AYN3 4I09A 1MOFA 4LORA 3JARA 2BNOA 5FOJB 4JPRA 1AP5A 4NIGA 3AP6A 4OHVA 3M8LA 3PVNA 1BCXA 4XJAA 3RNSA 2DQ3A 4MVOA 2Y6KA 3LE0A 3PIGA 4CZZA 1HKDA 3RG0A 3LZZA 2PTMA 2DBNA 4ZPIA 4DXSA 3CRRA 4GXLA 1J83A 5DECA 4D6TH 5F3IA 4MGKE 1DYPA 3PJYA 3R65A 1GV9A 1WLEA 3WUDA 4CCEA 5AFBA 3W5MA 5LA0A 3UQ8A 4LJHA 1WA6X 1H6YA 3ABKB 3JAKA 1M90W 4J7ZA 1XNCA 2HHHO 2VZPA 3SYQA 1X8EA 2YGMA 4OQ9A 2GN7A 4FPGA 3AZVA 3HMYA 4R8CA 5BV6A 1QVFU 4LFBO 3SPIA 4HXCA 5FZ8A 5K0UB 4CDWB 3AJYA 5A7QA 3APOA 2XLAA 1WW4A 2VGDA 2ZR2A 4CCKA 5DAXA 2Q67A 4H3WA 2FB5A 1SLTA 5LWBA 1NY72 5CKQA 1RHI1 2YSUB 1U5IA 1Q6UA 4AEDA 4IEUA 1H8EG 3PVBB 4LBQB 2WZPP 1OJHA 1AYN2 5CKMA 1QVGU 4LF7O 5DAVA 1M56B 1RUH3 4PQ9A 1F8VA 1NH2B 1Q8QA 1W2UA 3A0KA 3OB8A 1N1TA 5FV3A 2KR2A 1SRYA 5FY4A 4AZZA 3ZM8A 4XIKA 4XQWA 3LD8A 1JYTA 1WCSA 1OCRB 4BQ4A 3CMAV 3A7QA 3WW3A 4NHMA 1I1EA 3A0NA 5K9YA 5FZ9A 2XBO3 3H1KH 3THCA 3OPWA 1V55B 4R4ZA 1HV1A 5CAZA 5FXVA 2W1QA 2NLJC 2H94A 2HWF2 1WGPA 1JX9A 1V9U1 1R6TA 1OOPB 4H13B 2ET7A 1FPN3 3WR0A 2BP6A 3B00A 2QZ2A 1N36B 4DXTA 5GLVA 2LW1A 1H2LA 4YY3O 3T0AA 4Y1VA 3FZ3A 2RN9A 1TUBB 4DR6O 5AFEA 1IGOA 5CIRA 2BWCA 3STZC 4TZDA 3KT1A 5T3NA 4GX0A 5J48A 2BTOA 4RQFA 1Z0HA 1GU3A 1ASJ1 2ORZA 2QQNA 3OTOO 3VHOA 2VWKA 5B1BC 4MTGA 1G8MA 1QLEB 2O1QA 3LFMA 1O3SA 4BQXA 4Y4YA 2Q68A 5CNAA 5ABJA 2HEPA 1QQP3 4GKXA 1MZ5A 3WQ0A 2ZX1A 4Y4RA 1RUH2 1GN4A 3W7SA 4F6EA 4OI4A 4M3CB 4HN1A 4MVTA 1AL22 5FZ3A 4YHHB 2O14A 1Q8VA 2Q9LA 2IJIA 4DEVA 3N7LA 4YG3A 2HWC3 2WYFA 1OD5A 1LEDA 3SH3A 2RQ6A 3LNMB 3SHRA 4JKKA 3MW2A 4XUPA 3VKMA 5LBQA 1CAUA 1QDOA 1W39A 3V65A 4Q0VA 3T2PA 1CAXB 1D0GA 2VVDA 2UU9B 5JJEB 4DOUA 4NHKA 4OVEA 2W6JG 1WW6A 3AJZA 1JPXA 1FPN2 5FYUA 4PLNA 1PGL2 2PMWB 2EIKB 3ECQA 4OHWA 4AQ2A 1TMF2 4N53B 1I3HA 4FAHA 3CHXA 2A6VA 4DV0B 2ZGKA 3ZYIB 5BZBA 1XE0A 5A33B 1WBLA 4XJ9A 5FQ0B 3K5NA 2QKDA 4I55A 4QDRA 4JI8B 2OUJA 3J8F3 4G4FA 3RWNA 1KKCA 5FYMA 1NCRB 4GKJB 1W3VA 2NMOA 4FVVA 1PZ9A 4X8AA 2ZXWC 1IS5A 4M0HA 3ABZA 1QQP2 3TEXA 5C5UA 4PHZA 4MADA 3FLRA 3PUHA 2PHXA 3AFGA 2R16A 3NNJA 3A23A 2HWB3 1ZRCA 4J7KA 5C3QA 3JATB 3M3CA 1HIXA 1M57C 3AVSA 3N2GA 1AR71 2XOKG 2J22A 4CDQC 4SBVA 5LY2A 2HWC2 1SMVA 3IZOA 5KXEA 3EBRA 4ZIBA 3K2OA 2WBKA 2XAFA 5F5QA 4JYBA 5KUKA 1QDCA 1NZCA 3N7JA 4Y33A 2A1XA 3N2KA 4RGGA 3UKNA 1IBKO 4FJCC 4LNUB 4UXAA 1I94B 3J80N 4AF9A 3IMMA 1BYHA 5JSOA 4COUA 1B35A 4IV1A 2EXJA 3JBG3 1HV0A 1RUI3 5AVAA 4JHZA 1ZZ7A 3T1YO 4NPLA 2QM4A 2B5HA 3EHKA 1VAKA 1I5YA 2ZHMA 1K3EA 5L3BA 4GULA 1GQGA 5H6RA 4A41A 1SF9A 4HAMA 4UXNA 1BQZA 4IV1C 3MYXA 3FB5C 3E83A 1EYBA 4UCSA 1R6KA 3ZXEA 1JR9A 5FZAA 4DQAA 1D5NA 4LKFA 2A9HA 2WT2A 2PHUA 2VNOA 2DYSC 4WFBV 1F2NA 3MFAA 3FUOA 5EIBD 2R1DA 4QKNA 4META 3O1SA 5FYHA 2D6NA 3CZJA 1PO13 3RYKA 1V0AA 1W06A 2R041 1IPKA 5DAWA 4GX5A 1RUF1 3MO4A 1C57A 1S3JA 1KQSU 2B46X 3K51A 2YIAA 2Z4FA 3GBGA 3ZXJA 1S1AA 4LBJA 4IEZA 4YXWG 4FOVA 4Q4V3 5LXTB 1VRH1 4HVRA 4CDUB 2HWB2 2ZIMA 3ETQA 3PUSA 1SZXA 1WPXA 3FL7A 4OHXA 3AKTA 3RYIB 3DECA 3SNMA 5EJ3A 3H8XA 4JKLA 1E57A 1QOSA 2G9ZA 3GGLA 4IETA 1XOUA 2IWGB 4XVHA 3USUB 4CU8A 5A6XA 1HXS3 1YWKA 2J1UA 5BR8B 2VQ0A 2ARCA 2HR3A 2BQPA 3WQBA 3ZYBA 3K58A 3UYJA 4ET7A 2GSMB 4Y20A 3WCSA 1SLCA 1W2OA 1UU6A 2P2KA 3WNOA 1X4TA 2JDMA 1SCRA 4NTYA 3WNMA 1K92A 3T1LA 2Y26A 4LOTA 5DN2A 3A0BZ 3THDA 3ZYHA 2ZA9A 4LK7A 1NI8A 2YV8A 5GZCA 4J1WA 3AC0A 1V54C 2R071 3J4UH 4MHRA 1VEWA 1EUTA 2VQUA 4COWA 1ZZBA 2WO1A 3AXEA 4QGLA 3T0BA 3K75B 1PO12 3DYPA 3OGVA 4AE2A 2QQVA 2PHRA 4DR2O 5LHIA 1HJGA 1OQ1A 1IS4A 2RMU3 1OFNA 2WQ8A 2FBEA 3F7YC 1AL0G 1YRZA 3ZMNA 3ZFGB 4HKLA 4ATEA 2XAGA 5CZKA 3LDRA 4WVVA 2AACA 2XWBB 5FZOB 4FXKB 1DZRA 2CDPA 3FB6C 1BZKA 1LOBA 4IL6Z 1TUEB 2ZGRA 2VOVA 1H30A 2D6MA 4LLFA 1N33B 2BGCA 3AK0A 4QE7A 2VZVA 5JIUA 3ZIAG 4XF3A 1PMJX 2OZ6A 1Q8PA 1O7FA 3CX5F 4OXSA 3A0HZ 2RVAA 1JCHA 3CU7A 2ZT9B 4E9KA 4C7UA 4OMCA 1OUSA 2EILB 4WBBA 1KD7A 3ZYRA 3MIEA 2PHWA 4B3RB 4U3FH 2JJ6A 1UKGA 4GB33 1VBE1 5J37A 5FY8A 3ZN0A 1KB9F 5HCFA 2OA2A 1WP8A 3OBAA 1D2SA 2MW2B 2RJLA 1G86A 4K21A 1BHBA 2DBIA 4UFJA 4EV0A 4BMEA 4J80A 2HJFC 4XUQA 2WN2A 3U4SA 1P49A 1IBLB 3AMPA 5K1XA 2RMU2 1UOFA 2YHJA 1XE7A 4S2DA 3E22B 2IM9A 1QXRA 4B4RA 1QR8A 2Y0OA 2YUEA 3FLTA 5IHRA 3J81N 2CWMA 4CDWA 1POV3 1IBMO 2IH3C 4XHXA 4NJ4A 3E5XA 4NO4A 2V09A 3CDZB 4NR1A 3L71H 4J41A 1TE1B 1VQNV 4AGGA 3BU7A 4A42A 2QJVA 1YIJV 1Z5VA 4H2AA 1MSWD 1R1A3 2W92A 3MAQA 3EQEA 4LBQA 5HV4A 3Q9OA 1ZREA 4RR3C 4LULA 5FZ6A 2DCKA 1CPMA 3KF5A 4XFCA 2FMDA 1PGW2 1DCSA 5J7MA 1QOTA 2CTQA 2YPDA 2DVFA 3K06A 5C7GA 2MEV3 4X65O 2RS53 4LF9B 5FZKA 1Y4MA 3WU2Z 3AMHA 3CCLV 5LOVA 4X6QB 3M4FA 4Q0UA 5BNNB 3LB9A 3H1WA 1UIKA 1G9DA 1CIYA 4PDVA 1K7DA 3L73H 3SR2C 4GB32 3WP3A 1E5RA 1YZBA 4EB6B 1K3IA 4TLFA 2UY8A 2AR6A 1XBLA 1L7RA 1AYN1 4XC9A 4WM8B 3ZBHA 2BERA 4XZPA 5EJ1B 1PL4A 4PELA 2XONA 1PK6B 4AI1A 2VH9A 4OUSA 2Y34A 2P90A 2E75B 1N1YA 5EZYB 5L3CA 1ZRDA 5CKNA 2QQIA 1VBB2 2WLPA 2FCTA 4K20A 3OD4A 2ZACA 1OOPA 1CN1A 1YSCA 1M9NA 3CCUV 3ZYPA 3VZMA 3SYAA 5FKCA 2YC2A 4DV1O 2YU2A 2ZGNA 4Z92B 2HBTA 2XLGA 1QNMA 2QQOA 3ZX7A 3QH6A 2IJJA 1TUBA 4XQDA 5IW0A 3G80A 3VZNA 2P5BA 1ENXA 1TNRA 4P9XA 1Y9GA 1SZTA 3P1IA 1VPHA 2A3XA 2CSGA 3WV6A 2A6XA 1R1A2 3EMRA 4BIOA 4NTWA 2VQFB 4MGZE 3B4SA 5H9SA 1LGNA 4YARA 2HBUA 2LUWA 4P9OA 1DF0A 2VCCA 1JI6A 2BNMA 1S2EA 4F83A 1QLEC 2MEV2 4XDQA 1AP6A 2VOKA 1ZZ8A 4M3CA 5EBWC 2V4AA 2V1DA 3OMNB 1UU5A 4EWEA 3WY6A 3WSOA 4FP3A 5K7PA 3ETGA 1CZSA 4XFGA 1VQ8V 3B9CA 4FQZA 4A7ZA 1SQFA 1AHSA 3OAAG 5IYDO 3FAVB 1X9TA 4KHPB 4W4LA 1NLSA 3AZYA 4XBQA 3ZOIA 3ASOC 1CAXA 1VR3A 2NQYA 1RUH1 4NWWA 3E89A 1XXNA 2Y6HA 2RJ2A 2WDBA 4FZ1A 1APNA 4LO5B 1N3OA 4JDNA 2WN3A 3MIGA 5ACA3 4JI5B 4XJZA 4RUFA 5CYYA 1JYWA 4N53A 1QXJA 4TYSA 5FKBA 2Q8EA 4AW7A 4CA9A 2DCZA 2JB8A 3PU8A 2XBO1 5A33A 4TV8B 4ZHQB 4FXGB 3WDTA 1W9SA 4Q8LA 2DWEC 2WFF3 5FQ0A 5I0UA 2FQPA 4LFAO 4CYDA 3ZRWB 3L2HA 1J3RA 3DPRC 1OCZB 1ULOA 5FCCA 4AI9A 1NCRA 1FPN1 3DL3A 3INAA 2XXZA 3L75H 4XPVA 1PGL1 4ZI7B 1WB8A 1MG1A 1SC5B 2QM7A 1YCIA 1YI7A 1NCRC 2E33A 4LHSA 3BCCH 3KV9A 5EFUA 4HSJA 3ACGA 3JATA 3A21A 2Q6AA 2GH2A 1G9BA 1XBFA 1J3PA 2J1SA 3CWBH 4Y5SA 2DVBA 3JAMN 3LF7A 3PMSA 2JDPA 1OQDA 2W3JA 1QQP1 5JXHA 3J7MA 3RVZA 2OW4A 1DGRN 1CP9A 4LNUA 2PELA 4HSLA 2XVGA 1MEC3 3TWIA 3UGHA 3IDCB 2Z3YA 4O2AB 1RMU3 1BMV1 5JCOA 3ICXA 4CP2A 1FX5A 3HB3B 3UETA 3TGUH 5ACA2 2HWC1 2LFRA 1SBEA 1Q3EA 2ADQB 2QDNA 5JCOC 5BUVA 4LO8A 5IDJA 3J9SA 4AAXA 3THPA 1DF5A 4B3MB 2WABA 1BQPA 3RJRA 2E53A 2D6PA 1N3QA 2WFF2 2IFWA 3GM8A 5FXWA 3T1HO 3OUFA 3RGBA 3I2IA 3BUCA 5F1RA 3WP4A 1V6JA 3VGIA 4UI9L 4IEWA 2BEOA 3R66A 3ROUA 4K8RB 1GKBA 3O1UA 1J5EO 4AQTA 3LDEA 3HQRA 2PY5A 3FB7C 1DFQA 2HEVF 4JGSA 1MS0A 1C5IA 1NQJA 2KM2A 3BHPA 4MVZA 1JBCA 3OR6C 5LXTA 3CCVV 4CDUA 2HWE3 1I5XA 4QKDA 2G9GA 1US2A 1ZVFA 2YFUA 2UXCB 4P5HA 5I91A 4C90A 1Y9QA 4IERA 3QO7A 3NJVA 3J8F1 2VMCA 3RYIA 4TXWA 1GO3F 3GB7C 2K46A 4D6SA 5FMCA 3HKBB 1LHWA 5D8AB 1C1LA 4L9BA 2AEYA 2NR5A 2XVLA 3USUA 1COV3 2CWSA 2ZINA 5IAVA 2ARXA 3ABMB 2KG7A 3BALA 5L9VA 1OPMA 2D98A 4GJZA 2HWB1 4Y5Z0 1SA0B 1RMU2 2XWJB 4ASLA 5GW7A 3RT3C 2D44A 1DU3D 3E8HA 1DQ2A 4AFBA 3OYWB 4QXCA 3RW0A 4UCVA 3ZIWA 3SYPA 5D5PA 1QKQA 1O6UA 3WQ1A 3MIHA 1G8WA 3ZSEA 5I93A 2LM3A 4CS2A 4Z2AA 1I08A 1LUWA 4QHZA 1C3HA 3SLIA 4XDKA 3JBG1 5DMYA 1RUI1 1GM8A 2QKAA 4PIXA 2Y4UA 3CZUA 2PZSA 2UXBB 2JXAA 5A1LA 4BIZA 2Z5WA 1OLMA 3A8TA 2D3OW 4EKWA 2ID4A 5EV7A 5FTTC 1Y6XA 1AVBA 2RDQA 5JJNB 5ANNA 4KGGA 4QGNA 1EY2A 1Y67A 1NA1C 3VD4A 4PDLA 3CCSV 2XL7A 3GF6A 3ZFGA 5L3DA 3USSA 4JTDB 2Q1MA 1PNKA 2DFBA 2QGNA 4D94A 5FZOA 3C90A 1E5HA 1W3XA 2YBPA 1PO11 1S76D 2CV6A 3JQWA 4O65A 3ZFGC 4LFBB 4KBZA 1ZBE3 2WNEA 3CJIB 2JG9B 5A80A 5D1IA 4A7KA 1COV2 1S55A 5L3FA 4HKWA 3IMNA 4AGVA 4GKKO 3OUIA 1EBOA 5F6KA 2CDYA 1O8SA 3SXWA 3WFVA 4X1YB 3E6DA 1NVPB 5LRSA 4XDJA 3B77A 4Q4V1 2KXLA 3ZXDA 2ZEZA 3W5NA 2K9ZA 5LHHA 3CRMA 5JI7A 4XJWA 3T3YA 2QQMA 2UUCO 4UV8A 3PDQA 4I0BA 3WP5A 1OCCC 3APQA 2ZQMA 1IG3A 4XOGA 2QUOA 1HWYA 3WVJA 3I49A 4LF7B 3C3SA 1UZZA 2OCCB 3P3NA 1HXS1 1QU0A 2GC1A 1F9KA 2A79B 2HEWF 4JGYB 2JWPA 1C5HA 1HN1A 4MUVA 3MIFA 4LF5B 4YW7A 4NXMB 4BMBA 4A7YA 1JYIA 3LDCA 4LOSA 3KV6A 1PL0A 3SDLA 3HVDA 1F31A 4CUGA 2ZPXA 2QDRA 4AQYO 3E22A 4YFWA 4GMP0 3WP6A 4AVSA 2WLIB 3ZFFB 5FREA 1IHMA 5E79Z 3P5BA 1ZSPA 3I4IA 1VQPV 2JDUA 1W8NA 3ZN6A 1XMOB 5BY5A 2Y64A 5LP6B 1QJX3 5FYVA 2JECA 1ZAUA 4OPHA 1NE6A 1EN6A 2Y69C 4LFCB 1S0CA 4J7JA 2A70A 1JZ2A 3C7EA 1J1TA 2QQKA 1WCDJ 4WVZA 5FZIA 2RMU1 4YY3B 4FK5C 1XEQA 1MS5A 3CIHA 4GWMA 3UGFA 2ZEWA 3MDPA 2QFEA 2O57A 2C5DA 4BQ3A 2P4EA 3IGAC 2Q7EA 2LALA 3HN1A 2EF6A 4DY5A 1K4CC 4IV3B 4B3NA 4DV2B 5BNNA 4FQ4A 5IK7A 1KJRA 2YUAA 2AUYA 3RYRA 3NV3A 1JZ7A 4EB6A 4OHYA 1XYPA 4D6RA 1MMMA 5BNNC 3KGLA 1WNSA 4WM8A 3ITQA 5ITZB 5J1XA 5LATA 2N04A 1PK6A 4P9LA 3IAQA 2GUZA 3H8OA 1PGW1 2XDVA 4D3WA 2RS33 5EZYA 1I5PA 2JICA 4FP2A 1N32O 4WM8C 4NHLA 2WLJA 1FJGB 4YW1A 3RZMA 1PK6C 1NT0A 3AP7A 3KV4A 4DK0A 2GU9A 2D7FA 4GB31 5E6HA 2LO1A 1JJ2U 2XJQA 3UJQA 2ZMLA 4X62B 1NAEA 4DPNA 1OA3A 4YVSB 1W8FA 4DB5A 1QCEA 4JX0A 2BDRA 3ML0A 4BW9A 1QJX2 2A3WA 2P6CA 3E6BA 4GX1A 4BJ0A 2OIGA 3MHZA 1CD3G 5FLIA 2OIIA 3ZMVA 3W9AA 5BMVB 1H2SB 4EN7B 3B09A 2JDKA 3RVYA 4LKDA 2YG0A 3AK3A 1RB8G 1AR82 3X2QB 1POV1 4IT5A 3D6EA 3PVOA 3CJXA 2ZCEA 4XXPA 3SC7X 4QJFB 3QACA 1HN0A 4CPBA 1EZJA 1W9TA 4AHCA 1EPZA 1VBA3 4E27A 3AG1B 4IYIA 3POWA 5LA9A 3F5WC 1GP6A 1WCQA 1R1A1 2GTAA 2WNUB 2RJZA 1SS3A 1YVWA 1BK0A 1AXYA 1IPJA 5E89A 4QM8A 4PCRA 2K9PA 2RS32 5JAXA 2MEV1 2RS51 1ND2C 1IVSA 5CG8A 2X7RB 3MV11 2A75A 4B7EA 2JIJA 3AMMA 3GZAA 4QB6A 2AGAA 1IBKB 4DR3O 3OFNG 1PX4A 1K45A 2ENRA 4OPAA 1NU1H 3CXCU 3MICA 3A0RA 5EJZB 4TV8A 4ZHQA 3FHQA 3IDBB 1FV3A 2D6KA 2M7WA 4KG8A 2M6YA 2JDIG 3ZRWA 5IYZB 3LSDA 4MVQA 4YVWC 2R063 2Q4PA 1ZBA2 2I07B 2VUJA 4A5UB 4KP4A 2PAMA 5JZGA 3ZIXA 4AVCA 4ZI7A 3ABTA 3IDAA 1OCZC 4C91A 1TVKB 3P3PA 1Q56A 1ULDA 1UOJA 4MSWC 5JZGC 3ALQA 3M3EA 4OUMA 2HLEA 3IN9A 3SCGA 4PA4A 2BYVE 4EQVA 3RJ2X 5F39A 4XCBA 4BQ2A 2C26A 4NN0A 1RUG3 2QZ3A 3THOA 1VF5B 4IE0A 3RZKA 2VW2A 2CAUA 1LU2A 1LENA 1Q86W 5C8YB 1LKNA 1REFA 5CFCC 1W2NA 3PTYA 5EBLC 3DSQA 4LO6B 2ZE8A 5B1AB 1K12A 2VCBA 3N7KA 1PP9H 3SKJE 4O2AA 1GM9A 3FFQA 3JAWB 1VARA 2B9VA 4D8MA 4N43B 5EC2C 4JYAO 2CGPA 1XNQO 1QXPA 4P9IA 2AHYA 3U37A 1RFYA 2DV9A 1VQLV 4MO3M 1OA2A 3LKJA 1XNTA 3UO2A 1H2MA 3WF4A 4X1KB 3K0GA 2ZGPA 2TEPA 4LEJA 2ZZJA 4LBNA 4I3GA 2F4LA 4E8DA 5JQGB 4G27B 3CCQV 2P22C 4DV7O 4BQWA 3LEGA 3R4SA 3SJCC 1S4CA 3NL1A 5CA3A 4OUEA 1J95A 2PYJA 5C8CB 4JCKA 3JALB 2R062 2LROA 4CUBA 2Y0IA 5ACA1 2VM9A 2DYRC 4O2BB 1N0JA 1G4YB 4EJRA 4H33A 3RQ0A 2IUWA 1AJOA 3RYHB 1YQCA 4CDXB 3LEMA 2EAAA 5JIAA 2VULA 1R1BA 4HETA 1QJY3 3ZN5A 5JOYA 3CLPA 2RDSA 5A6YA 2RMKB 1V6NA 2WFF1 4JI4O 1ZRRA 2WKKA 3H9AA 2CNAA 1RUG2 1BJQA 4JASA 4Y22B 4QQLA 1Y7BA 1JFFB 5BNPA 1R1ZA 2YIBA 3HKBA 5D8AA 4LHNA 3ZHTA 3TXQA 2PAKA 3WQ7A 3JB8A 2W6IG 5TISZ 3PLQA 5BNPC 3CE2A 1K5MC 4LQRA 3TEYA 2PN5A 1W9WA 2DUPA 3B8MA 1SA0A 4ASUG 4IESA 1LHOA 2IVJA 3WF2A 3OW2U 4AGRA 3TN93 3SMHA 4K0KO 1W0NA 2B4KA 2I74A 4PLMA 1GYKA 3OYWA 4HBNA 4IEQA 2ADDA 5LA1A 5FDBA 3D3QA 3B01A 4FPYA 4LF8O 3MHSC 4JTOA 2Q8OA 3MIBA 2EALA 2CTRA 1MZ6A 3UGGA 2DTYA 4HNAB 2CDOA 1I6XA 4Y26A 1XSRA 2JJ2G 4K35A 1CR7A 5FMOS 5FO8B 1U12A 1MEC1 5BY1A 1RP3B 3SQOA 4JI2B 1D0HA 1S2BA 3GNEA 5LGTA 3ABLB 2ZHKA 3AYCA 3O0XA 4BK5A 1RMU1 3HD8B 1NLRA 4WZFA 5FIXA 1XU1A 2ZS6B 4KMQA 1LNQA 4JI6B 1YQ8A 3LAGA 5C3OA 4J9ZB 2LFSA 1FXVA 4JV5O 5JOXA 1DGLA 4LF4O 3JCZA <