4D7TA

Structure of the sthk carboxy-terminal region in complex with camp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
198
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEAAQIQELAVRRKEELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords STHK_CNBD_CAMP
publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
total genus 55
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7tA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7tA02
3FHIB 1ZRFA 3WW1A 3UKNA 3H1WA 5BPXA 3PLQA 5LRRA 1NZCA 2PYTA 2Q4SA 2V09A 2PAMA 5FPZA 3NSTA 2BYVE 1RTVA 1J3PA 3H7JA 2CGPA 4IERA 1RUOA 4I2OA 1ZRDA 4J1XA 3ACLA 4BYYA 3BB6A 1UD1A 1SQ4A 1CAVB 4WBBA 3RZZA 2D40A 4XF1A 4FAGA 2HKXA 4QGNA 2GC1A 4BHPA 2Y0OA 2IXLA 2IXJA 1CAWA 3H1YA 3H50A 4X6RB 4LUMA 3FWEA 1O5LA 1ZNPA 5K8SA 1WGPA 1RC6A 4EWAA 1ZRCA 3DKWA 2XLAA 1J3RA 1UPIA 2IXCA 5BXXA 4Q0UA 2ATFA 3DL3A 2DCTA 1YLLA 4OLLA 2HJIA 5FLHA 3SCFA 4LULA 4DINB 1XRUA 2XKPA 4HN1A 2Q1ZB 4R8HA 3JZVA 2PAEA 5EFUA 4XFAA 3I7DA 2MNGA 1TQ5A 2ET1A 4P9GA 1EYBA 3MYXA 5JAXA 2PHDA 2K0GA 1YFXA 5F1RA 1Q5OA 2XKOA 3HT2A 3IWZA 3FX3A 4HSJA 1I5ZA 3SMHA 4RD7A 4IEYA 4ZU5A 3CEWA 3FJSA 1NYWA 4I0AA 2CAUA 2EA7A 4BIFA 4IEOA 1J1LA 3CF6E 3HIFA 4E2GA 4IEZA 5I0TA 3ELNA 3M3IA 2KXLA 1LKNA 1O3RA 1QWRA 1ZZCA 1O3TA 2XL9A 1O7FA 2O8QA 5JR7B 2PQQA 1FT9A 5I0UA 4PJYA 3ROUA 1GQHA 4UBHA 1Y9QA 1EY2A 3E6BA 3CJXA 4LA3A 3RDIA 3QOPA 1NE6A 1XE7A 3H3ZA 3G7DA 1ZREA 2Z69A 4KWKA 5J7MA 4QXKA 4XFGA 4ORFA 3WW2A 4AVAA 4XF4A 4I01A 3EJKA 4EV0A 3LA2A 1PMIA 4R52A 5BUVA 3EQEA 3U0ZA 4PIYA 3CLPA 5KHGA 3I54A 3D82A 1H1IA 4OFGA 4META 3NW4A 4XETA 3MDPA 3QACA 5FLIA 2D5FA 4IESA 2ZKLA 3CL1A 4JTNA 4LTAA 3KMHA 3E5UA 3OD0A 2O1QA 1XE8A 3E6DA 2IC1A 1OD5A 2BNMA 3RYRA 1L3JA 4IEUA 1IPKA 2OZ6A 4HMZA 4O9EA 4MX3A 5CADA 3MPBA 3UKVA 3NJZA 2BNNA 3IBMA 3KGLA 3BPZA 4ZU7A 2WC2A 1Y3TA 2B9UA 5FQ0A 2XLGA 2QDRA 1YWKA 1PM7A 2H0VA 1CAXA 4KWLA 2CAVA 3NL1A 3RPQA 4PIXA 1QXRA 1LR5A 4YARA 3MZHA 4QGLA 2OYZA 1ZX5A 3N4MA 3SCHA 4HSLA 2ZCWA 4HLTA 4FBFA 1CAXB 4KU7A 1CAWB 2UY9A 1FI2A 5FPXA 4QM8A 3DN7A 3IIAA 5FDBA 5JCTA 4PIZA 5D1IA 2EVXA 1WA4A 2QJVA 3PNAA 2GU9A 2D5HA 3ETQA 3C3VA 3SHRA 4J1WA 1IPJA 1ZRRA 3LA3A 1CAUA 4MGIE 3U11A 2B8MA 1QY4A 3H3UA 4IEWA 3SCGA 4FT8A 4I02A 4XF9A 2MHFA 3M70A 4JTOA 4AQ2A 3TNPB 2H6CA 4MGZE 4IEPA 3KGZA 3OCPA 4WVZA 3USSA 1NXMA 1O3SA 2VPVA 1DZRA 2IXKA 1G6NA 4HVQA 5KHIA 5FLJA 1YFWA 1ZZ9A 4HBNA 5I8SA 3IDBB 3PVBB 3HT1A 2I45A 4GULA 4FAHA 4B29A 3ES4A 2CV6A 1J3QA 2Q0AA 4YRDA 4AQ6A 1YFYA 1VR3A 2FMYA 3H7YA 4LA2A 4XFIA 2BNOA 1EP0A 2OPKA 3E5XA 4Q0PA 1DGWA 4E2SA 4D7SA 2K9ZA 3E6CC 4HN0A 2Q30A 3GYDA 1DZTA 4EWEA 4I09A 4D7TA 3D0SA 4E2QA 4N9IA 1RGSA 1OFNA 4CYDA 3L2HA 4F7ZA 1V70A 1SFNA 3S0MA 4WZCA 2WFPA 2BEOA 5I0RA 3RYKA 2ET7A 2VQAA 1ZZBA 5C8WA 2GZWA 1NE4A 3E97A 2MPFA 2QNKA 1DGRA 3H1MA 3LZZA 4UBGA 4ONUA 1YUDA 4MV2A 1JUHA 1X82A 1OI6A 1ZVFA 2VECA 1UIKA 3E5QA 1I6XA 1UW8A 4ZU4A 1FXZA 5JSOA 1RL3A 2P17A 4HVOA 1UIJA 4XFHA 3B02A 5JSRA 5I8TA 3I59A 5E16A 2GH2A 3OF1A 3LWCA 4KU8A 4XFFA 2E9QA 1Q3EA 5E1RA 3ES1A 5C6CA 2PAKA 1O3QA 4JVAA 3O14A 3EBRA 3H8UA 1O5UA 1VJ2A 2F4PA 3WW4A 3RNSA 1J59A 4KL1A 4HZFA 2UYAA 3RYPA 3OTFA 1HW5A 1H1MA 5LEKA 3ZDSA 3WW3A 1EPZA 1J58A 5J48A 2ETEA 4XF3A 1CAVA 4HVRA 4UXAA 5FQ0B 2H6BA 3DV8A 5JSPA 5J3UA 2IXIA 1X8MA 3OGJA 4MGKE 2D93A 4JV4A 2GC3A 4A2UA 3SXWA 4EROA 2EAAA 1WLTA 4MH0E 5T3NA 2XL7A 1U12A 4MUVA 1X8EA 1VP6A 4YYOA 4AXOA 3GBFA 5KHKA 1UCXA 3BU7A 5KBFA 5AVPA 4IEQA 1LRHA 1ZZ8A 3LOIA 1CAUB 3ST7A 3VHRA 3NKTA 2QVSB 3IDCB 2Z2SB 4MZUA 3FFQA 4NVPA 4MGYE 4XFBA 4QMAA 3LAGA 2B5HA 4QM9A 5HI0A 5I93A 5KHJA 2PFWA 4IETA 4I3PA 3TNQA 2GAUA 2PHLA 3H9AA 1OMIA 1RUNA 4TLFA 4Q0SA 4BH9A 5I8YA 5LRSA 3S7IA 4Q29A 2QCSB 2BGCA 3EO6A 2OZJA 2UYBA 4O9GA 2N7GA 3R6SA 4XF0A 3CO2A 4K8FA 1CGPA 5CU1A 4L2NA 5KHHA 4Q0VA 3BCWA 1YFUA 4H7LA 1SEFA 4LLOA 2XHKA 5CVRA 1ZZ7A 4AVCA 4I0BA 4EWDA 2XLFA 5FCCA 5LEJA 3UKTA 3S7EA 2FQPA 4L11A 4QX5A 5I0SA 3HQXA 4XEZA 4IEXA 1Q43A 1X7NA 4IEVA 4Z82A 1ZZ6A 4F8AA 2XGXA 4KWJA 1LB2A 2PA7A 4Q0QA 3BALA 5I91A 2PTMA 2C0ZA 1CX4A 2UY8A 5BV6A 5EZWA 5BY5A 3U10A 4N9HA 4LEJA 1QXJA 3EHKA 3KSCA 4X6QB 3KCCA 1GQGA 4Z07A 3FZ3A 2GC2A 4QGMA 4XFCA 2IXHA 4YSFA 3FE5A 1O4TA 4YNIA 4LUKA 1YHFA 3NVCA 4AVBA 3I59B 3LA7A 3D0JA 2GC0A 2OA2A
chains in the Genus database with same CATH superfamily
4MTXA 1BMV1 1LOGA 2K2SA 1Z78A 4OPAA 4LOSA 1NZCA 2BCCH 2QUOA 2PYTA 2Q4SA 1D0HA 4IQPA 5FPZA 1FPN3 1WBFA 2BYVE 1WLCA 3H7JA 1H2LA 3AB0A 1L0NH 2PLV2 5J2TB 1WNSA 5J2UB 4OXSA 3NQHA 4GWJA 1AR92 5I0DA 1PK6C 1XL6A 4FFBA 4DY3A 4N53B 1R1A1 4BWAA 1VBB3 5CKNA 3VBUA 4PDLA 1RUH2 3FB6C 1VQLV 2DJVA 3PIJA 3WG1A 2WT1A 2NMNA 4ZS3A 4TZDA 3OW2U 2XHNA 2X5IB 4DXSA 2IVIB 1K45A 1YLLA 2RMU1 5DAPA 4GWMA 2QKSA 4IE5A 3POIA 2A7AA 4XBLA 4GAZA 1LHNA 1VBD1 4TWKA 1Y76B 3AMMA 3AMPA 2WJSA 4XFAA 5EP9A 4H33A 1M90W 1SETA 2VO5A 3SKVA 5CFCC 3B93A 4Z2AA 1OD3A 1POV1 1IS4A 2DCZA 1COV2 2QTSA 5T5PA 3FB7C 1FS0G 1IDSA 2DCJA 4AQSA 3SPJA 2XG3A 1W9YA 2PHRA 4OHYA 5A3OA 4LBEC 3ROUA 3UO2A 4DV5O 3ZM8A 4QJFB 1RITA 5J7MA 2YBKA 1NCRB 4NXMO 1NY72 4LBOA 5F2WA 2Y69C 1WW4A 2LQTA 3BTYA 4QHOA 2FDIA 3S6PA 2DU0A 1LJ7A 1IG0A 2ARAA 1GTOA 2H3OA 3Q4HA 4D69A 4LF4B 4TWTA 4LTAA 5LHIA 1YEWA 3JASA 5GZDA 2UURA 5H2FZ 1NAEA 4U7OA 5LHHA 2Q68A 1QR9A 2F4VB 4L87A 4ZHQB 3PTYA 1VQNV 3SYAA 4TUYB 2BNNA 3IBMA 4XHXA 1NX9A 4Q27A 2A6VA 1VRH1 3KQ4B 1YWKA 4BQ2A 3RYIB 4FFBB 1QJY1 4Q4W1 1GP5A 1AVMA 2UY9A 1K97A 4RL7A 3VBUB 3ZCCA 2WNEA 2XB6C 2D5HA 4DR2B 2A1XA 4Y4YA 3ZKYA 3H3UA 4DXWA 5H6QA 1GZ9A 5J9PC 3MF6A 3TK1A 3M8LA 4XJZA 3ZIWA 4ZXEA 1FNYA 3OCPA 5F5AA 3BTXA 1CXZB 3K2OA 3IN9A 1VEWA 3GDBA 1QJFA 3DEMA 3THPA 5HPOA 2ZAAA 1GNYA 1Y4MA 2YSUB 4ES9A 4JI3O 5DG2A 1VR3A 4CEYC 4NKGB 1O91A 2F4VO 3T1YO 5T5LA 4PDWC 2JDKA 4X1IA 1PL4A 4BU2A 5FZ3A 2Q30A 4I09A 2JDIG 5C93A 5ABJA 2VZ3A 3S0MA 2BEOA 2NNUA 2J1EA 2WA3A 3PUSA 1P49A 2OTLV 2VWJA 2W1QA 5H9SA 4J10A 2O14A 4J80A 4LJHA 4EN7B 3L9JT 1OLMA 1K42A 5JSRA 3Q4HB 3J7HA 5DN2A 4KBBA 4GUNA 1H8EG 2Q1FA 1SKVA 2NLJC 1VJ2A 2F4PA 3OB8A 1J59A 1IPSA 1EN6A 3CCSV 2NZ9A 2CDPA 2QWQB 4CUAA 2VXRA 5JSPA 1Q90D 4MVMA 4JZRA 1RHI2 2GC3A 4DR3B 4AWDA 2R72A 1PX4A 4DIQA 2R041 3WXPA 1BHBA 3K59A 2XWBB 2W91A 1XPWA 3NV2A 4LNUA 1RVF3 1XOYA 2FDGA 4PDRA 5KHKA 3P6BA 5LA2A 3VKMA 1GYKA 5IVJA 3F5TA 2UXBB 4CUBA 2AENA 4JAUA 2VJXA 3BODA 3VHRA 2QVSB 2UXNA 4GB31 1WJZA 4Z1VA 2WFF1 2RVAA 4JI1O 3N9QA 2B5HA 2G19A 3VD5A 3VDBA 2VW1A 1ND2C 3KV6A 4BH9A 1F4MA 4L9BA 4FFGA 2OZJA 2UYBA 3LOBA 3IAYA 4LF9O 4P08A 1V54C 4QU1A 4QX0A 3ZYHA 5FCCA 4X1IB 2P06A 2ARHA 1GP4A 2XBO1 4MW3A 2CE4A 1AR62 5ABJB 4KWJA 2MEV2 2B46X 1RSOB 3K77A 1Q86W 3TB0A 3OEEG 5BV6A 3C7GA 1H30A 3ABMC 1IS3A 4QDSA 1I08A 1OUXA 2CU5A 1QLNA 4KQ7A 3MAQA 4AAPA 3GCWA 4HKLA 2R6QA 3WW1A 1FATA 3TEYA 3OGSA 1PO13 5HCBA 3SKJE 2Y6HA 4RWUA 2FDFA 3OPTA 3THTA 1WMXA 1SLIA 4LNUB 2UU8A 1S4CA 4JI0O 3UL2A 4QX1A 5LGNA 3ZR5A 4DB5A 2VZPA 5T5JA 3CJIA 2BGPA 2PAEA 5LCWL 5JAXA 1RJ7A 1VIWB 3URFA 1LHUA 1HQLA 5GTHZ 2XOKG 1ULOA 5L7OC 1IBLB 4I0AA 2QJ1A 2ZXWB 2BTVC 1DBNA 3FBYA 3ZXKA 3NV1A 4XQWA 2D3OW 2XL9A 1YRZA 2EIJC 5LMUO 3WF0A 1QKQA 2QQUA 2VZVA 4HL0A 4D7YA 1XE7A 3CNAA 2Q8EA 4DR7O 4IUGA 4NIGA 1OCCB 1LGCA 4BIUA 3U0ZA 1Q56A 3IZOA 2VU9A 5EJZB 4TXWA 5JOWA 3THDA 1ST8A 3GWKC 5HV4A 2E51A 2GP3A 1R6NA 2VQFB 3O1RA 2VULA 1OLME 3T3YA 4J41A 5AC92 2DOSA 2IFWA 2WLNA 1BGYH 5C8CC 1K5SA 2LM3A 4I50A 3H8RA 3OR7C 4UT5A 1LEDA 1Q6HA 4CCDA 3W9AA 4AL9A 2HLEA 4P9YA 2AC1A 4CA9A 2A0LA 3ZFGA 2QWPB 4X66B 4RS5A 4Y22A 3ZMOA 4I3GA 5B1OA 3JCZA 1NA1C 1W39A 2WRAA 3C3VA 4B8EA 1W06A 2HWB2 2VY0A 5BR8B 3N7JA 4RHV3 3ZSJA 4NHKA 5CBHA 1NCQC 5A3NA 2YG0A 3CJIB 3VLBB 2ZA9A 5IJ0A 1M57C 3ZXDA 1GR3A 1ULFA 4W4ZA 5CFDC 1RUE1 2J1UA 2P34A 5DAQA 1SS3A 2J1TA 2ZS6B 2V72A 3H7YA 1WB7A 1I0HA 4DR4O 1OA3A 5FMCA 1VQKV 2VR4A 1IBKO 2DCYA 4EWEA 4DRXA 3B2EE 1AR83 5DG1A 5ANQA 3IM0A 1SDWA 4NWWA 1GMMA 2BBAA 1SFNA 3AKQA 4A41A 1XNQO 1W8ZA 1RUG2 3WF3A 1YUDA 1HXS1 1KRIA 4X66O 2XVKA 5CA0A 3WQBA 2HWE3 3MHHC 1ZSPA 2X53S 1URFA 4BIZA 2UUAB 2XWJB 3MDSA 3TGUH 4CH3A 4RA0A 2XJPA 2DWEC 3EXAA 3ABUA 5LBQA 2PN5A 2ZGSA 1HRI1 1M4WA 1GOHA 1E5SA 4PLNA 3RRDA 3WW3A 1FPN2 2VC9A 1I9RA 3HN1A 1NVPD 1DYOA 1CAVA 5KXBA 2ZT9B 4I50B 1VQPV 5DZFA 5ACA3 4C1WA 1XHZA 1AL23 1G1XB 3V0AB 3ZSMA 1VBB2 1GWLA 3FYIB 5A80A 2XL7A 2L9LA 3ZFGB 2V4AA 4RS5B 3FLPA 2HEWF 4Y22B 5KBFA 5EYPA 2ZEWA 1H8TC 3V64A 4I4TA 4AEMA 3ST7A 1IS6A 5IVVA 3QO5A 2CNAA 4YZ5A 1GP6A 5LMNB 4K20A 3NKGA 2VW2A 4LBLA 5IJ0B 2Z5UA 4NPMA 3WHUA 4PI2A 4MLOA 1MOFA 4CUGA 3MIEA 3WQ7A 1OH4A 2BGCA 2XAHA 2PXJA 5CU1A 3STLC 2EICA 2QQMA 4H7LA 2HJDA 2XLFA 1DP0A 2E74B 2NLRA 1Y9GA 1ZYBA 1G9BA 2JDYA 5FYHA 1VMJA 2HWC2 3ZRXA 1DQ1A 5SV8A 1HB1A 4ZXKA 2EJ7A 2BOJA 3IC9A 2R32A 4AVTA 2WNOA 5CA0B 3O1TA 4YVWA 5FV3A 3ZN4A 2IXHA 4DRVA 4HYOA 1YHFA 1V9PA 3E1F1 3LA7A 1W8UA 4X20A 1M06G 1XYOA 2Q8DA 2IZWA 5C3SA 4LT5A 1EN4A 4U3FH 2WA4A 2JD4A 3K57A 3ASOC 1EUUA 2ZGTA 3JATA 1CAVB 2ZGOA 1F23A 4TTGA 4AQYO 1OCZC 4FO9A 2GC1A 2HWF2 2Y0OA 3B8MA 3ON7A 1ZNPA 4URAA 1QXPA 4FOYA 1BLZA 3I2KA 3CS5A 5BMVA 5EYPB 1JYVA 5FZ0A 1FD9A 1UU6A 3DL3A 4IV1A 4I4TB 3E86A 2DWDC 1CZVA 3PJYA 3AJZA 2TBVA 4DINB 1W3VA 4FPKA 4IV3C 2Q1ZB 2E5LO 3ETDA 4LFAO 1TQ5A 2ADPA 2K0GA 3J81N 3FX3A 3CCRV 2LO1A 5JJNB 1V00A 3MIDA 2YIDA 4GH4C 1ZA7A 1VF6C 5ANNA 4C8DA 2PHWA 3DTUB 5D2AA 1FOD1 1J1TA 1NT0A 5EPAA 3A2FA 2QWOB 1FMD1 4HETA 4TYSA 4J6GA 4UBHA 3AYEA 4WVVA 3HR9A 3ETEA 3LDRA 4P30A 3SISA 3JD72 2WL1A 1J5EO 2WR9A 1BQZA 2RJ2A 4CU8A 1ZL8B 4Y3OA 3PVNA 2SLIA 4Q4Y3 2HVKC 4LMFA 1KB9F 3U1XA 1SF9A 5KHGA 1MEC3 4YVWB 3G4SV 4META 2R30A 4I0XA 5D5QA 4S2DA 4UFZA 4X20B 5DDJ1 1UMZA 2HP8A 1OOPB 1RXFA 1RUC1 2OIIA 1F4NA 1Q8IA 2RJZA 1FXKA 5A6XA 1LECA 1Z7S1 5KXDA 2HWD3 1XSQA 1GZWA 4JZGA 5FIXA 2C24A 3JATB 1PM7A 4R9CA 5EBLC 1JHJA 3RN4A 2JX9A 4GJYA 4SLIA 4JQRA 2VG9A 1NTZH 3A21A 1DGSA 4F6RA 5FDBA 3NXSA 3VZMA 2QJVA 3OMAB 1WW6A 4PQ9A 4JDOA 3SHRA 3APBA 4OI0A 1IPJA 4IV1B 2OWOA 1GNHA 2P5OA 2BDRA 5C9AA 3MGUA 4PCRA 2LRPA 3A4UA 1NTMH 1R1A3 3I3MA 5IVEA 1G9DA 5IAXA 2WS91 3LSUA 3QH7A 5DUUA 4WCEV 3MHZA 4N90A 2RMU3 4YJ3B 1YFYA 2W95A 1VBD3 5DAVA 3WT3A 4CCJA 4XFIA 2BNOA 5F9TA 5E79Z 2L35A 2DDUA 4NHMA 3RG0A 4P9OA 1MS3A 1POV3 1NR7A 3E83A 2DUPA 1OFNA 4QKBA 1MNGA 1B35A 2IBZH 3MW2A 4QGPA 2E33A 4PELA 4OVEA 2FMDA 4WM8C 4MT8A 3T4DA 5D8AC 1JODA 1SLCA 1WMEA 1Q8SA 3LPFA 2EIGA 1RUJ1 2EIEA 2H8PC 1PZ8A 3I8TA 4HVOA 4X65B 4A6SA 4X8PA 2PELA 5I8TA 4QPWA 4FLXA 2HVJC 3ZO0B 3OF1A 4BPZA 4I0XB 5GONB 4DR1O 3W21A 2VUDA 4JGSA 4OGQB 3OUFA 3PIGA 3BUCA 2QKAA 1PO12 2P3KA 1FXKB 2Y6LA 2RDRA 1J58A 1GZWB 2XTAA 1TAEA 4K8XA 3ORJA 5J3UA 4JASA 3OGJA 2Z3YA 1QH7A 1SBFA 3M2MA 2V7QG 4CCKA 4FLYA 5E8AA 4FPJA 3CCEV 4F6RB 1I94O 2WZ8A 2W87A 3TXSA 4BE3A 1VRH3 4RFRB 3BFRA 2TUNA 2HEYF 1XMQB 1GMGA 1T6GC 1QJY3 1RYYA 5C9AB 1BK0A 2YGLA 2LROA 2DF7A 3GBGA 3UK9A 2GAUA 4M4RA 3WG4A 2I2SA 3UGFA 1W9TA 4X65O 1KKDA 5H9PA 4ATFA 5KC5A 1XU2A 3U14A 4X1YA 1LOFC 4LBJA 4L2NA 2OT5A 2ZHNA 2W08A 1ZZ7A 3UKTA 1PVC2 4L11A 5FPVA 3C7EA 4CCNA 3KB5A 1MVQA 1VAVA 4Y1YA 5L3DA 1CR7A 3HNBM 5A3PA 1NU1H 3LGRA 1B35B 1HLCA 4MGTA 1GRJA 1CX4A 4FPCA 2J1SA 4CDWC 5H9RA 5A3UA 1V6KA 4UFHA 2OUHA 3THOA 3GZEA 3ITQA 1KITA 4QX2A 4QE7A 4W6WA 2R9RB 3TOJA 4LE4A 4NROA 1QJX2 3QBQA 5JI9A 3OTOB 1NI8A 3AXDA 3D8CA 4YW5A 3S3WA 1PK6B 3X29B 2WUHA 2QTWB 2JE7A 1KKCA 1YITV 1CPYA 1HR0O 4NPRA 3SYPA 1AR71 2YYOA 1ZRFA 3JAWA 2KG7A 2YXSA 2F17A 3H1HH 5KAFZ 4JRAA 1XMOO 3PTRB 4WF9V 2PAMA 4G3YC 1N32B 4PF1A 4P2ZA 2WO2A 2RQ6A 3BA8A 1P7BA 4UCUA 1E5IA 4JKMA 4X6RB 3ZDVA 4LUMA 4R4XA 1QQCA 1WW7A 1MA1A 5CFCB 3SNMA 1D2QA 2CWMA 4MG2A 4P9IA 3I4IA 2NMOA 5FYSA 5EYXA 4CEYA 1HB4A 2OX0A 2R043 2XKPA 2BV4A 4PDWA 1XC6A 2E75B 4P14A 5IDJA 3I55V 4W6XA 2DVFA 3I2OA 2MNGA 3LDKA 1OQEA 3SITA 4TT3G 1W90A 1WPXA 1Q5OA 3RWKX 3HT2A 2AYHA 3JD1A 1OV9A 4X1YB 4GB33 3N9MA 2R071 2EA7A 2WFF3 1N1SA 1X36A 3PJSK 3AMHA 2VAUA 2WLKA 4KMQA 5CBFA 4GX2A 1QWRA 2Y69B 3SQOA 1O7FA 2O8QA 3B9CA 2A3WA 4YHHO 1F9KA 2E7QA 2D3RA 3OUHA 5C5TA 4LFCB 3A0BZ 1SG3A 2Z69A 5FKBA 4XFGA 1XHXA 2DUOA 3RYFA 4R9DA 2XBO3 3INAA 4QXBA 2JECA 1BQ0A 3WNOA 4B4PA 5B1AC 2HWE2 5FPOA 1X9PA 1ZTEA 3D82A 3GCXA 2Y4UA 1BCCH 1UKRA 4COZA 5FPAA 3QACA 1NVPB 4HXCA 5B3SC 2A6WA 4J42A 4MTFA 4AHWA 2JENA 3JAWB 4LLFA 4FPGA 4DK0A 2IC1A 2ENRA 2O8OA 1ORQC 2BNMA 3K3NA 1IPKA 4UFKA 5FP9A 1KJRA 3VOUA 4IE0A 5ACA2 4EN6B 3W5NA 1CAXB 4KU7A 5DMYA 1FI2A 3AMQA 1O9HA 4KGQA 3LDEA 1ND2A 3ASNC 1RJ8A 2LS6A 4JTDB 3H1KH 2X6CA 3U11A 1DQ6A 2W2IA 4LK6A 2DBNA 1H6YA 5FP8A 5F39A 3U75A 3K51A 4PDWB 1ZBA1 4W4KA 2RDNA 2G9ZA 4NHXA 1CIYA 2VPVA 2LFRA 3N3HA 4RAIA 1YFWA 3VD3A 1XI1A 4XJAA 4GULA 1PL0A 4FAHA 3WDTA 1WMDA 5KXEA 2GDSA 1E5RA 2VNVA 4FPEA 1CONA 1QQP1 2FMYA 4MHRA 5ISLA 3ZMZA 1AP5A 1ZBE2 2BGOA 2ZCEA 1FKAO 4Z8BA 3L2HA 4AGRA 4OPHA 5FLXN 3WX5A 2ET7A 3J8F1 3L9DA 3SR2C 3LFMA 2R9IA 4CDUC 1OI6A 4OCTA 4K40A 1UIKA 3PMEA 1Z0HA 4H3WA 1RUF1 2ZHLA 2BP6A 2PI5A 2FDKA 3FX7A 4HKWA 4KU8A 5EQUA 3GHMA 2LJ2A 5FZ6A 1IX9A 2PAKA 2VGDA 4J9ZB 1UOBA 1Q8PA 1O3QA 2GMMA 3TRSB 1K7DA 4DV1B 2QDNA 1DG6A 1UYZA 2BSKA 3CMAV 2QQWA 3RYHB 4IL6Z 1Y66A 1FYUA 4V2VA 3OFNG 5IYYA 2ARXA 3WUCA 4WFHA 3MIBA 1UYYA 2JB4A 4UW4A 3JBG1 3D36C 2RV9A 4J7ZA 1ND2B 3BYWA 3J26N 3CE2A 5L7OA 4IXLA 4WVWA 1V54B 3T1CA 5K9YA 5JLVA 3WF1A 4CSWA 5A70A 5FJKA 3N9PA 2FCVA 5I8YA 2WLMA 1I7FA 5A1LA 4D6RA 3KWVA 2YC4A 1HDJA 3AG3C 1BBT1 4FFFA 4Q0VA 3TEXA 4Y1UA 1SEFA 2OTJV 3BA9A 1QHDA 5JOXA 4DR5B 3ABMB 1KDKA 2Z42A 2DQ3A 1RUE3 1K73W 1AJOA 4UW5A 5A6YA 2PA7A 4ZIBA 1UX7A 4LF5B 4LQRA 1N34O 5B5EZ 5I91A 4I0WB 1JZ3A 4PI0A 3T0BA 4HT1T 1C8NA 5LB6A 3LQCA 1GK9A 1HNXB 5DUVA 1ASJ1 4AFBA 2RJKA 4Z07A 3I3DA 5C8CA 3OEHG 2Q73A 2R70A 3QTCA 2CGOA 3AK3A 4LUKA 2ZE7A 3UT5A 5J09A 4Q4V1 2V73A 2F4LA 4XXAA 2KQXA 1HXS3 3FN9A 2ZTNA 3UKNA 4B3RB 1TVGA 3HAGA 4UCTA 1NZ6A 1K5JA 2ID4A 1WUVA 4IIJB 3NSTA 1NA1A 2HWD2 2QE3A 4UV9A 2BSKB 2CTQA 3KS7A 5JXGA 2VZOA 2Q7EA 3BB6A 4MYEA 4OHZA 2RDSA 3T1HB 1NCQA 4NHYA 2JEUA 1IQDC 1HRI3 3C3TA 1BMV2 3ACIA 3H1YA 5FXVA 3MIHA 1FJGB 2ZIMA 1ZRCA 1J3RA 1UPIA 5CFDA 3QCWA 4YGEA 1NKGA 5B4NA 5L7OB 3CZJA 4YZ4A 4O4HA 4E2LA 4JTCB 1N47A 4K8ZA 3VB9A 4LULA 3RI8A 4GKJO 4ZI7A 4Y33A 4Y1XA 2EIJB 2YXHA 4QNHB 1ODMA 2PHDA 4LP8A 4JYAO 3WQ1A 1Y6XA 1I5ZA 1WCUA 2RMU2 4KH9A 2RR11 3H8OA 4A4AA 1ZLZA 4B3RO 4XDJA 4W65A 2Y4TA 1K92A 4JYBA 3POEA 3QO8A 5FZIA 3GVMA 1W8HA 4KI5M 3J9SA 3WB2A 2W1UA 4LF6O 2A6ZA 3UT0A 1G6UA 5FXXA 1GOFA 1R3JC 1UZYA 4MVSA 2UXDB 4M01A 3AX4A 5KAIZ 3G7DA 2XAFA 3LD8A 1DCSA 3WU2Z 4AVAA 4CDXB 2XJSA 4QPGB 3O1VA 3AKSA 4CPBD 2ZACA 2XNDG 2KKWA 4X88A 4H2AA 5C8CB 2VVDA 1GKFA 1BVVA 1H6XA 5JPMB 2RM21 3A8TA 2FZ1A 1IGOA 1BEV1 1R092 1MQTB 2P22C 3BVOA 3OUJA 4DUYO 2XT9A 3NJZA 1NA1B 1H8TA 4UVAA 4IHJA 2WC2A 1R3IC 2CWSA 1I5XA 1STMA 2CAVA 2WSVA 1NCQB 3UGGA 3VBRC 5FZ7A 3K79A 1M57B 4QM8A 4EZHA 4YFZA 3ZXAC 3AC0A 5IJRA 3TCUA 4DV6B 2Y48A 1S0CA 2OQ6A 3KVAA 2GU9A 5CFDB 2JIZG 4MVOA 3A0HZ 3UJQA 4WFFA 1ROPA 4CTEA 5K1PA 5FZKA 3ZHRA 1QJY2 3OYWB 3LE0A 4IEWA 4Q4W2 4Q26A 4PT6A 4UI9L 3T4VA 4O4HB 3FUOA 4BQ5A 3TNPB 3PMSA 4ZI7B 4JI4O 4M0HA 1SQPH 1AX1A 2VCMA 2YEVA 1NXMA 2QSAA 1A8DA 3N2GA 1OBNA 1G6NA 4KHPB 4DY5A 2EXHA 1HB3A 2YPJA 4UUJC 1VMFA 1ZZ9A 2EIDA 5I8SA 5LK5A 4JI6B 2VRZA 4E4EA 3ES4A 1JYXA 2MW2B 3JALA 1MPXA 1FAYA 1YXBA 4JZ2A 5BYNA 4K7JA 2K9ZA 4M3CB 3ABTA 5FYCA 1GICA 1B6QA 1RGSA 1PIV1 1GAXA 4QDRA 4X1KA 3SLIA 1POV0 4FFHA 1H2MA 1DU3D 3LZZA 1EZJA 1QBZA 2OXBA 4RGKA 5L9RA 2P4VA 1FOD3 5DEDA 3WG3A 1OCOC 2Z79A 3AVRA 1OKQA 5FJHA 4D0QA 4KP4A 1M93A 3B02A 4BR6A 2ZGRA 1KJLA 3LWCA 2JIJA 1OQ1A 3EVKA 3RMYA 3JXSA 3O65A 5LWBA 1PGW1 3HOBA 3BPSA 4AW7A 2ZNJA 2A06H 3RVZA 1ZA4A 4XZPA 1CZSA 5FY5A 4JI6O 1H8TB 4IHJB 4M4PA 4EN8B 3RGBA 5FZAA 3VBSC 1D4M1 2XR4A 4IV3A 1F4HA 1RUC3 4X8NA 3MEPA 1Z7S3 1GQPA 3VV1A 3LEMA 1UZVA 2J1AA 1VP6A 2Y6KA 3GBFA 2BOBC 1LRHA 4GH4A 1GO3F 1XQ8A 2R042 1VF6A 2WWJA 5EJ1B 3ETPA 1K9MW 4XUPA 3OGCC 2PYJA 2RDQA 3CCVV 2OKXA 4K21A 2YEVB 4R4ZA 4TLFA 3O1MA 4X62B 3N2GB 1R64A 3MIGA 3THCA 3IMNA 2N7GA 5FWEA 4K8FA 3IC7A 4GB32 5JMOA 5CB7A 2UUCB 2BFUS 1YIPA 3JALB 1AXZA 2BW8A 2WS93 4LR3A 3S7EA 4QX5A 1L1FA 2FL4A 3UQ8A 1C3HA 4MVQA 2VMDA 1V9U1 3T1LA 4X1KB 1JYNA 2ZR3A 4M3CE 4A7ZA 3OR6C 3BEHA 3F7VC 2Y64A 4YW1A 3AVSA 4HG6B 2VQ0A 2RN9A 1LUWA 2RHPA 4OI1A 1BZKA 3MICA 2R1BA 4GKXA 3ASOB 2X09A 3LFIA 4NTXA 4NAOA 1OCZB 3OBZA 2WIIB 1MSWD 4YGDA 1WB8A 4JI2O 3U78A 2VQEO 4ES8A 1RUJ3 4IGOA 4PBOA 4K0KB 1AJNA 3ZN1A 5LBBA 5CA1A 1A32A 5KUKA 2JEMA 3P5BA 2QQVA 1O8SA 1PMJX 3HQUA 1VQ8V 4FAGA 1VIBA 2EULA 3N9OA 3ZFEC 1KBHA 4IV3B 3TWIA 1WBLA 1LGBA 4QKNA 2GH8A 3L72H 3APOA 3DKWA 2XLAA 3W7TA 5LOVA 3R05A 4NE9A 1GNZA 1NKDA 3NO8A 4GH4B 3FAVA 3SCFA 4BW5A 5KX5A 5FO9B 3ML0A 2PHXA 2W1WA 1ACCA 1CX1A 3S5QA 2BOCC 3HMYA 1B06A 2ZXQA 4B3SO 2QQJA 2XHBA 3WF2A 4FLTA 2RS51 4U36A 1SPPB 4DV2B 1A78A 4WM8A 1SQFA 4GALA 5EK0A 5D8AA 3QLQA 4BIFA 1SQGA 5IWAB 3WP5A 5D5PA 3RZGA 1WMFA 3AEIA 5JIUA 5FBJA 4KXRA 5JUVA 2PQQA 1QU7A 5IVYA 1GANA 4LIVA 3ZN6B 4YXWG 2AEZA 2GTAA 4FIPC 1BE3H 1AUYA 3PL0A 1YTFD 4QHBA 4AF9A 1ENVA 1U96A 3CQOA 4XF4A 4LXLA 3EJKA 3CHXA 2G38A 4N21A 3LA2A 4R52A 2F23A 3HVDA 2G4IA 2P2KA 3M99B 2WLPA 4LF7B 4BK5A 2BPA2 1GWKA 5BNNC 1TG7A 1R1ZA 1VE0A 1SLTA 1OHHG 2DVAA 4AEDC 5C5UA 4BLJA 1XE8A 1RUH1 4LFBO 1OD5A 1PO21 3R4DB 2VZSA 4IEUA 4GYCB 4F4LA 3MPBA 5CA1B 4XDOA 2YMZA 2DFCA 4WM7C 1K5MC 4UF0A 1Y3TA 3CZUA 4DUZB 3LNMB 3GXUA 1PKXA 4Y24A 1TME1 1AR73 2ZOEB 4DK1A 3MW4A 3LF7A 3MIFA 5A32A 5TSWA 3LSEA 4XE9A 3ENRA 1QGLA 2LGQA 3DN7A 5JCTA 3E22B 4FOQA 3K58A 5FBZA 4OX9B 1DQ5A 2OPWA 3BRCA 4XDLA 1GM9A 1COV1 5LOVB 1LOFA 4J1WA 1XE0A 5L19A 3IT8A 4HZ3A 1JYTA 3MO4A 4FT8A 4JI8O 1AI4A 3PVOA 4JHTA 5KX5B 3CIHA 1XNRO 5C8YA 1W2UA 3WEZA 4LF7O 1IOAA 3SH4A 2YROA 1PNKA 5L3BA 5FLJA 1I3HA 3RJ2X 1UWWA 4NIIA 1W8NA 3J7AU 2YB7A 1MS1A 4C0BA 4B29A 4WM8B 3LSQA 3V65A 5D8AB 3STZC 4BQ3A 4CDWA 4FLWA 4LA2A 3E2EA 2OPKA 3E5XA 5J37A 4CPBA 2RNBA 2WAMA 4E9KA 3RZMA 2R073 1UZ0A 1N3QA 1LULA 3I49A 5C8WA 1S3JA 3WNMA 1OH3A 1F4AA 2RS31 1WCKA 5EBMC 4PD4F 2VMIA 4OX9O 5DAWA 5JSOA 1PM9A 1N33B 4CBCA 3UKMA 3OEBA 4CCMA 4B3TB 4DFSA 1GUIA 1O59A 1E57A 4MTOA 2JDMA 1C8M1 4XW3A 2DYRC 1GN2A 1GN3A 2KB1A 4PA6A 4KUMA 4ZHNA 1XYNA 4FPOB 2R7EB 1JCHA 5GLTA 1B3QA 4UF0B 5FZCA 3N9NA 1X8MA 3JU9A 5ERLA 1K4CC 4GKKO 1HRI2 4DV0O 5A32B 5FY0A 1DLLA 5L3FA 1U5YA 4H7MA 3FLTA 1V6JA 4LBNA 3ZSKA 4JGZC 4FLVA 3JD2A 4CS4A 4MHUA 2WNVB 5FY7A 5C8YB 4GIQA 1RPRA 3GALA 2P67A 1MACA 3DKQA 1VBC1 3H9AA 4XAEA 4K35A 4Y1VA 1YF2A 1YJWV 2WBKA 1ZBA3 4DV7B 4AOCA 4CDWB 4QB2A 5CVRA 5GALA 4IE6A 4AFDA 4MVRA 2A3XA 2Q5TA 3BHPA 4D6QA 5BXZA 1ZAUA 1SZXA 1LESA 3SJQC 4BCUA 5GM0A 2C2AA 1YQCA 1QQP3 1JHNA 3WG7C 2FDJA 2Q7GA 2C0ZA 1D4VB 1AYM2 2D43A 1QXJA 1YJLA 1MZ5A 4DV4O 4LOTA 3EB7A 2JEXA 2ORZA 5CISA 1RUD1 1TUBA 3TAYA 4A7YA 3J8F3 2IJKA 3F5WC 3HKEA 3AYAA 2C6SA 5FYUA 4LF8B 1DQ2A 2JE8A 1J83A 1RUF3 1N36B 1AVBA 1FAFA 1UD1A 3CD6V 3HN3A 2D40A 5JH7A 1PGSA 2BERA 3CRRA 3AYDA 5JPNB 1ODNA 1NH2B 4CU9A 1R082 4XBFA 1ENXA 2KD7A 3B4SA 2Y60A 1NBMG 5FLHA 3CMEV 4IYIA 3JBG3 4AVVA 3O1SA 3ZOIA 3I7DA 2B5UA 1GWMA 3T4ZA 3AFKA 5F1RA 4FXGB 3OM3B 4E4HA 3ECQA 3OJBA 4ZU5A 2RE9A 3ZPOA 2WNUC 4CDUA 2KA3A 1UX6A 5LXTA 5B1AB 1N36O 4TSFG 1Q82W 1GN4A 1HRV2 4YY3O 2GV9A 2VL4A 3MFAA 2EIMC 2YI9A 5B3SB 4QPYA 1BBT3 1NLSA 2WLHA 2DMXA 2DFBA 3AZVA 1S76D 2QKDA 2ATKC 1FOD2 3OPZA 1FMD2 3TBDA 5KLVH 1H1IA 4P5HA 2ZKNA 4HANA 1JPXA 1AXKA 5F2VO 2QQPA 3L73H 4EFEA 4BK4A 3CL1A 4R7CA 5A3WA 1TUBB 1V6MA 3LDCA 5CG9A 5GZGA 3HKEB 3E6DA 3D36A 3IB3A 4MSVA 4LBMA 1ASJ3 5LYJA 2P3IA 3Q8EA 1MMMA 3DPRC 5IYDO 4GJZA 3ASNB 4XIKA 4AK3A 3UKVA 2XASA 2F95B 4Q4V3 3H9VA 2ORXA 4KWLA 1BVP1 5JH7B 5DDJ2 1WN7A 4Q4X2 1ZX5A 1RUC2 3F2ZA 1S5JA 3HD8B 2P5BA 4FBFA 3AZZA 1UO9A 2RJLA 4LR4A 3A22A 4YW6A 4CP0A 1C57A 3ETQA 3JCIA 3VDDC 2JG9A 3H1JH 4XF9A 1C5IA 3M70A 4Q5OA 5FP7A 5IJ9B 3JD3A 3USSA 3GJAA 3K5NA 2WZR1 4C91A 5FUNA 3QO7A 1QF3A 2RCVA 1J3QA 1MVEA 2ZIOA 2AUYA 3ZXLA 1RB8G 2WS92 3ACGA 4Q0PA 3MUY1 1KXGA 1YZBA 4HN0A 5LXTB 1UU4A 2AGSA 2B9VA 3KCYA 3K5OA 1OQDA 2RR13 3BGAA 2VM9A 2WFPA 4DXTA 2QQIA 4AFMA 2ZR2A 1IHMA 1XU1A 2JDZA 2Q8VA 4ONUA 1JXNA 1X82A 3A23A 5AC91 3RBZA 2E32A 1KGYA 5M0TA 4DR6B 4IE7A 4XOGA 3ETGA 2WAAA 1L7QA 1UIJA 3SJAC 1JYCA 4MS2A 1OURA 3K4ZA 2E9QA 2ZPXA 1Q3EA 2F43G 2C5DA 4HNAA 4XJ8A 3P32A 1ALYA 1YQ6A 1O5UA 1LCLA 3N9LA 4X64O 3WW4A 5FOJB 4HZFA 5LYJB 1RUJ2 5IWFA 3QF7A 4BDVB 4IGQA 1GN6A 2HWB1 2DURA 1PVXA 5FR3A 4RQFA 4BZ4A 3T2PA 2CL2A 4AHCA 4HVRA 2RM23 5LA6A 1EBOA 4A2UA 3TJTA 5SV5A 5J96B 3AZXA 1BEV3 2KR2A 5CIRA 2XJRA 3CXCU 2A7WA 1BCXA 4NUBA 1UY3A 5C33A 5FMBA 4JHZA 2PGGA 3AG3B 4AHXA 3IDCB 1W99A 3Q8AA 3FFQA 2XONA 1JZ4A 5KHJA 4XIOA 2QEXV 1OMIA 4CXXA 1MS8A 1RUNA 2J22A 3FYEB 1GKBA 4ASKA 2P37A 4JI7O 1V0AA 2EJRA 2XH6A 1RUG1 1YI7A 5BNPC 1K12A 1YTFB 1XNAA 4QQHA 4EWDA 3K9AA 5IY5C 1Q8VA 5FY8A 1W0NA 2FQPA 1VQ5V 1UAIA 4IEVA 4F8AA 4ZOLA 4N7IA 3USUA 1G4YB 4CS2A 1BKZA 4JGYC 1HNWB 1WZXA 2YDEA 3JQXA 4LKEA 2HFEC 2JB8A 4NIHA 1JU4A 2DTYA 2ZX3A 2AZ5A 1Y9MA 2UUBB 2NM1A 1SQQH 3FZ3A 1PIV3 2XQXA 4YNIA 1F8VA 1RM1C 2W46A 4QKDA 4AVBA 3VBRA 3CEIA 4GLXA 5K1XA 4HNAB 4ITCA 5CKMA 4QT6A 1UZWA 2B42B 3ILFA 3WV6A 1VQ9V 3C90A 1W8FA 2ZEXA 3GZTB 1S0VA 2GBOA 1VLNA 4I2OA 5FWJA 1YIFA 1IBMB 3RZZA 4XF1A 1AR72 1ENQA 1MSDA 2K46A 5LBFA 1JBCA 3VKNA 2VNOA 3HWJA 4JCKA 1HV1A 1NXD1 3VQVA 4COWA 4O7XA 2WO3A 4N43A 4EEQA 2J7MA 4LO8A 2X10A 1HNWO 1D4M3 1UPGA 4GWIA 3MLKA 4D6SA 4R8HA 4LITA 1CJDA 1W9FA 2UUBO 1YO8A 4S2GA 1DF5A 4D94A 1VARA 1KC8W 2HWC1 5LASA 5A7NA 5B1NA 3O0VA 4F3JA 2GTSA 1ENSA 4LF4O 3JSNA 1FYJA 5FY4A 4NIAA 3CF6E 4IE4A 1WP7A 4JV5B 3M3IA 1LKNA 3POJA 4P9LA 1EV12 4CDQC 3IIIA 4ZOLB 4PDVA 3USUB 3D3AA 1DQ0A 3ZIAG 3RVYA 4I9WA 2CSGA 2PF4E 3RDIA 2A71A 4XQ4A 1BXHA 2H94A 4EQVA 2Y8KA 3O12A 1CP9A 1S5LZ 4L92A 3LPGA 4XUTA 1P8JA 3M3EA 2P6JA 2ZZQA 1DIWA 1V9U3 4UWDA 4QPIC 5JVVA 1HNZB 4U3JA 2Y6FA 2D5FA 2A3YA 4DR2O 3VBSA 4AGVA 4Y26A 3J80N 2HWF1 5GZCA 1ZWIC 3VBRB 2ZGNA 3SH5A 3FB8C 3SYCA 3JASB 2QQLA 2SBAA 5CADA 5ITZA 1EZVH 1QVFU 3KGLA 3ZHUA 3ZYIB 3H42B 3WDXA 5F3GA 4PIXA 2ITDC 4LHNA 3ZRSA 1XDCA 1HJFA 1XNKA 5FPXA 4ZY9A 4FZ1A 1VB4A 3PUHA 3CCMV 3BABA 5HFLA 1POQA 2P4KA 1OC1A 1JYIA 1GH6A 2F66C 2BTOA 3RWRD 5EIYB 3LA3A 1ZRRA 5FZ9A 1QY4A 4O2BA 1QJU1 3LB9A 2FTKA 1BHAA 1C28A 1DFQA 1DHKB 5CYYA 4HBNA 2I45A 5EXOA 1H2NA 3JD71 1IKPA 5FY1A 1G9AA 1ZBA2 3OAAG 1U5XA 1OCOB 4D7SA 1JZ5A 4CCOA 2GUZA 3AK1A 3P1IA 3S30A 4AI9A 2RS53 2ZKOA 4C90A 1PGL1 1E1QG 3NR7A 1UXXX 5JXJA 1MG1A 5I0RA 1FV2A 1QQP2 4AI0A 4YLZA 1NE4A 4Q8LA 3WNXA 4DR3O 2QE7G 3VBBA 2WN3A 1VBA3 1KFXL 1N4CA 1HQNA 2UWAA 4TQDA 1YQ2A 4EFBA 3I3QA 3UESA 3KVBA 4U3JB 2WWWA 4JAAA 3I59A 4BQ4A 5A3TA 3VBSB 2UXBO 3ZFEA 4BXSV 3Q9OA 2VNRA 5FYBA 3EBRA 2V1DA 4PF5A 4NIDA 2PHUA 2YFUA 1RUF2 4FVMA 5ITZB 1EPZA 2W6JG 3WDYA 2AZ0A 4FLUA 1RUH3 5HCHA 1G8WA 1AI7A 3B3QE 1PO23 3LSSA 4Q2FA 1F5JA 4XCAA 4A3ZA 4NR1A 5F5QA 3SC7X 4XILA 2QZ2A 2UXXA 2YGMA 1R73A 3EFFK 1TME3 3HKDA 4DQAA 4QKFA 4UFIA 4O2BB 1MABG 4G27B 1KEXA 4BISA 3AFGA 2XJQA 4QX7A 1COV3 1CJPA 2IUWA 4DV3B 3LUTB 3ZLIA 1QJZA 1P4RA 4CEWC 1UOGA 2NQYA 3KT1A 5CG8A 4ISRA 3HEIA 2ZGMA 2GUZB 5BNNA 4RUEA 1YJ9V 3DUIA 4QPKA 1EAH1 4D8MA 1LB2A 4BWOA 3K5LA 1T5EA 3RJRA 4Q0QA 3CU7A 1BBT2 3NAPC 4AEDA 2OIGA 3MUZ1 4AI8A 3JAMN 1DQ4A 1M1KW 1D5NA 4X6QB 2GN3A 3KCCA 3E8GA 3N7MA 2GC2A 5LY2A 4WM7A 1JVMA 1K5MA 4QGMA 3OMNB 4LCUC 1G8MA 3KM5A 4GD4A 3I59B 2JGUA 3ZFEB 2RS33 2ZGLA 1VF5B 5A7QA 5B66Z 2VNGA 3WP6A 5F8PA 3M7MX 2Y34A 1ZX3A 4YG6A 4UW6A 1ULEA 3FL7A 3I2GA 4Q4V2 1UU5A 2GSYA 1C8M3 1SQ4A 4E4ZA 1IBLO 2RS11 3NNLA 5LA9A 5IVFA 1O5LA 4EWAA 3NRUA 3ZX6A 4UB6Z 3BTAA 3JUUA 5LATA 1UQXA 4WBNA 5DZGA 4DRRA 1ZUQA 4YM2A 3HKDB 4A6OA 3CYOA 1CD3G 2KM2A 5J36A 1W0PA 1AX2A 3P3NA 2JG8C 1PVC1 3VBOC 3T1MA 4CS3A 5IUQA 2HKOA 1UKGA 3NV3A 4XABA 4OUSA 2EZPA 4I7ZB 2XKOA 2PHTA 5K7PA 3SMHA 4K1ZA 2CYFA 1UFIA 2EAKA 1NLQA 1AI6A 2VMCA 3MLLA 5E6HA 3ELNA 3WVJA 1VBC3 4YM0A 2VQFO 2ZGUA 3RWNA 1QJX1 1URXA 5FZOA 5JR7B 1BK1A 2HYKA 4LO7A 4FFIA 4K1YA 2JS5A 5BNNB 3CDZB 3CBNA 2RR12 1EY2A 3O7OA 4LA3A 2Q67A 4MVUA 2WQ8A 4AEDB 5IE9A 1S0FA 4XUQA 2BVBA 3CLPA 1OKOA 1F31A 3C3SA 4NRMA 4QWNA 3IAPA 4P9PA 1K5MB 5BNOC 2N04A 1A6CA 2VUJA 2YHJA 5BR8O 3UM7A 3VL8A 4Z92B 2MK3A 2BJSA 3RVHA 3Q8CA 4E8DA 5F32A 4XAAA 3B7MA 5L36A 3SPGA 2W3JA 4DEVA 2C9KA 4JGZA 1XBLA 4MXVA 2N74A 4R8CA 1RUD3 4X8AA 2JICA 4FPYA 1QJEA 3CRMA 2H0VA 3MV11 5DUWA 4MXWA 2H0BA 2OYZA 1BEV2 4EYUA 5F6KA 1TGOA 3BAAA 4LC1A 4P5YA 3S57A 4NRPA 1UYPA 5GZEA 4YW4A 4DUXA 5D1IA 1WA4A 5H5NA 2YICA 2A5ZA 4WBNB 3M3CA 2R16A 4AE2A 3VD7A 2VVFA 4K6BA 2XJVA 4FTEA 2Y26A 1TMF1 1OT5A 4UCRA 4MGZE 2VD7A 1H38A 4GCZA 3T30A 3L74H 4UYBA 1Q6IA 2GNDA 1W6QA 3AKTA 1SMVA 1L7LA 2UUAO 3WQ0A 5FZHA 4N23A 3O1UA 3ZXEA 1DGWA 3OUIA 3V0BA 5HFMA 2ZZJA 4YG0A 4LO6B 1JOPA 2QGNA 5FZOB 3GYDA 2X0LA 4COVA 5C4WC 4WZFA 3SEEA 2W6IG 4DRXB 3U07A 2DYRB 4AQTA 1QNWA 2QNKA 1DGRA 4AI2A 4XTPA 5FUPA 1E79G 2D2CB 2UXCB 5AVAA 1Y67A 2EX3A 3I3BA 3NMBA 5G05L 5IW0A 5JZGC 4TSVA 4QB1A 2QQNA 4EJRA 2P17A 1H0BA 2ZM6B 1H2SB 1KS5A 3VD4A 3AMNA 2ZJCA 4NXNB 4XUOA 5IT6A 1RMU1 1GSLA 5LMNO 1KS4A 2CHHA 4JDMA 4JVAA 3POBA 3H8UA 2EIBA 2CDYA 4FJCC 3ZFFC 1X9TA 4JGZB 2JDAA 3ZR6A 3R66A 4UXAA 1AR4A 2E6VA 1S2EA 5EJ3A 1MR5A 3NJYA 1OOPC 3EHBB 3JD0A 4EB6A 3VUOA 4B3MB 4MXWB 2HLDG 3K75B 1NUKA 3W7XA 3POSA 1JJ2U 1PX3A 4XZUG 1EM1A 1QOOA 1US3A 3PUAA 4YYOA 1OUSA 5FO7B 5LL6Y 4HAMA 1D4M2 1UYXA 2WNUA 1N3PA 2WLIA 4NVPA 4QMAA 1OXCA 4AR2A 3LAGA 5L9VA 3E35A 2VS0A 4K9SA 3AZYA 3AG7A 4F83A 5BZBA 2VBPA 4MTGA 5TISZ 4FP3A 2IH3C 3G67A 3WG7B 2ES3A 2Z0AA 2VUCA 4P02B 4AVCA 3LNNA 4CC6A 2Q7HA 2A6XA 4XQDA 3UETA 4ARYA 2WZR3 1VAMA 3V0BB 1CESA 3QG5A 2WZPP 1W8OA 4DO2A 3ACFA 5A7WA 2XDVA 3G6JB 1N3OA 5FYYA 4YZ1A 4FXKB 3FLRA 2DBIA 4QQOA 4DW0A 5EZWA 1YCIA 1O8PA 2YY1A 3DPRA 1NR1A 2VZUA 2N05A 1V9U2 5CBGA 2B9ZA 1NQJA 4QQ2A 4XFCA 3TN91 4DUWA 3FE5A 2LGWA 2VE1A 1YXWA 1BT8A 4QQLA 2OA2A 3Q8BA 5AC93 3GZUC 4UAPA 5HXMA 2XVLA 1XQNA 1TE1B 5T55A 4AFCA 4MVZA 4AGGA 3J7NA 1M5IA 2BE3A 5CN0A 3I56V 1PD3A 2XQRA 1RUOA 1AL0G 3VKFC 3VDDA 1ZRDA 1VF7A 2WAOA 3I3EA 3JSLA 4EB6B 4BMBA 4OYUA 2IXJA 1CAWA 1P84F 1NOVA 3FWEA 4CE8A 2HWB3 2JRIA 2X5IA 2ZE8A 2VZTA 3GB7C 1RVF2 4RUFA 4DMIA 5BMVB 1UOFA 3ASIA 5EBWC 2WNUB 1SLAA 4D3WA 1EPWA 1Y7BA 2WLIB 2XVGA 1EYBA 3N7KA 3NNMA 3RMXA 3Q8FA 5CMUA 2EIMB 1EN5A 4R9AA 2VH9A 2EIKC 4NOTA 1NYWA 1XNBA 2CAUA 2IJJA 3ZHQA 1CIWA 1BMFG 1J1LA 3C7HA 3C7FA 5I0TA 3VZJA 2KXLA 2G1MA 3WCSA 5C7GA 2E7TA 1XILA 2VQTA 1FT9A 4MOAA 4PJYA 4LO5B 3EXUA 1QCEA 1Q81W 1Y9QA 1RUG3 1SERA 5A1AA 1NCRA 1VRBA 5GJ6A 1JFFA 2QBXA 5B2GB 5L73A 4ISQA 2Z4FA 2GP5A 2WWUA 4QPJA 2WKKA 3DPRB 1JMKC 5LZ6A 3IKWA 5FLIA 3M1HA 1A8MA 3D3QA 2W0XA 5H9CA 4ZHQA 1VBE1 3B00A 2PYLA 3BY6A 3KV4A 3HKCA 4H0LB 5H6RA 1RXGA 4PA3A 3KF5A 4TUYA 3DF0A 3SPHA 1L3JA 2BTQA 4HMZA 3HNYM 4LORA 4Q6GA 1M56B 3RYIA 3G80A 4DV5B 5FZBA 1S0BA 4OI2A 3VDDB 2XLGA 5JXHA 1YHQV 4M3CF 1TA8A 2BRTA 1CVNA 1TEIA 3O1OA 2CTWA 4NXMB 2GDFA 3SCHA 1PO22 2ZCWA 4HLTA 1CAWB 2ADEA 2VCCA 5T50A 2QWRB 3LIGA 4PBPA 1TME2 3O5SA 1S2KA 2W0FC 1FFXA 2CY6A 2XOMA 3A0KA 2B8MA 5BNPA 1REFA 2WDBA 3E89A 2MHFA 2E53A 3ZYPA 3NNJA 2VMEA 4B1MA 2R061 2FDHA 1W2TA 5FKCA 3OGRA 4BQWA 5KHIA 2LFSA 1WAZA 2Q8CA 2QQKA 4JGYA 3HT1A 3MHSC 5IYBO 4MADA 5A9GA 2EXIA 1SQXH 3VQYA 3WB1A 2JE9A 5FTTC 4DNYA 3AJYA 1MS9A 3AK0A 4PA4A 2OT7A 1EP0A 4NMIA 1SCRA 4B7KA 2HWC3 2JDNA 5JJEB 3JB8A 3SYOA 4TV9A 1HN1A 4FLZA 3S5AA 2JJ1G 3RYKA 4UW3A 1SHWB 1JFFB 5GLVA 4FPHA 4A5UB 1R091 3DXUA 3VL9A 3MD0A 1W9SA 1UL9A 3OOXA 3H1LH 4OMCA 3AP4A 3BVCA 3DSQA 3AKRA 2W47A 4QQPA 5E16A 4JI3B 1XMQO 4JDNA 4XFFA 4Y5SA 3O1PA 2CAZC 4X89A 1J84A 3T2TA 2RS32 3T1YB 5LBEA 1KP2A 3HKCB 2YIAA 4PDMA 1F35A 3T0AA 1SRYA 1RUI1 3E8HA 5LEKA 2BTQB 3ZDSA 3ZYJB 5IK7A 3OY8A 4FM1A 2HWF3 2VOTA 1C8M2 5BNQA 2WSUA 4MGKE 1FFTB 2EAAA 4QX3A 3RZKA 3BTZA 5EC1C 3OGVA 4DW1A 2EBOA 4AXOA 5B1BC 5GKAC 1SFPA 4IL7A 2XUEA 2ZINA 1FFXB 4OHVA 5BNPB 4Z2WA 1EUTA 4QXHA 3VBFC 3H3LA 1S1AA 4RHV2 5IY5B 5HI0A 3LSDA 4I3PA 4CDQA 2VZ1A 5LRSA 1YDXA 3OTOO 1GZCA 4JGYB 4BB3A 1QJU3 4XF0A 3R6SA 4GZRB 2FB5A 2BUKA 4COUA 1AJQA 3BCWA 3VKOA 1A34A 4K3UA 1OA2A 4BOWA 1VBC2 1UZZA 3ABLC 3ZPYA 4QPIA 3WINE 5D21A 1RSOA 5CA6A 5KXCA 1OLRA 4DUVA 4PQQA 1N32O 2VCBA 1RM1B 4TV9B 3JD73 1T2XA 1AR82 3BALA 1K5QA 3C7OA 3B40A 2YU2A 4JI1B 1F7YA 2WT2A 4GMP1 1N1YA 3NWKA 5IYZA 5FMDA 2PZSA 4HK9A 4B7EA 4QB6A 2WINB 3GBWA 1GQGA 2VWKA 1AF9A 5HCAA 2A3QA 4DS0A 4LF9B 3BKZA 3VHPA 2P6HA 1AJPA 3NVCA 1DYPA 3U37A 1W0KG 2E63A 4S2HA 4RFT0 1AI5A 5EWSA 5BPXA 1Y4WA 4M0NA 2KG7B 2ERFA 2ZX0A 4IERA 5JQGA 3OY8B 2LW1A 1RUD2 3K9SA 3ACLA 2BZDA 2WN2A 3OPWA 4BHPA 3OBTA 3LIHA 4YW2A 5CNAA 3BIWE 3H50A 4C0HA 4FOVA 3AP7A 3OT7A 1AL22 4KG0A 5BXXA 1YC61 1NQTA 2LP7A 5T5OA 4OLLA 2BVVA 2IJIA 2HYXA 1G9FA 4LFCO 5FOBB 4JYYA 3EYPA 3D5OA 4CEYB 3L75H 3E8BA 2JXAA 2ADQB 3TETA 5G04L 4A42A 4CDQB 1SBEA 4IEYA 1AR1B 1H4HA 5FYVA 5K4LA 4YW7A 1HDKA 1W8WA 3SPIA 4LKDA 4IDZA 4XPVA 4F6EA 2WLJA 4QPIB 3OSDA 1GQHA 4JI0B 1YQ5A 1OSGA 2QWNB 2WYSA 1G9CA 3H3ZA 1H9PA 4KWKA 1GU3A 4XDKA 3L2YA 3WW2A 5JMCA 5IYZB 3K46A 1MZ6A 1X50A 4FI9A 3ZXJA 2XJUA 4EN0A 3RYFB 4D6TH 1EAH3 3RSJA 3NW4A 3MDPA 2P1BA 4CXWA 4IESA 3IDAA 3WFVA 4K3AA 3E5UA 4PHZA 2K9PA 4OUEA 4TOIA 3M3OA 5LMUB 3AG1C 2DYSC 4OMDA 4GX0A 2VMGA 1B04A 2GNBA 5JQGB 2QDRA 1LU2A 3L70H 3WNLA 4NRQA 3TEWA 3HR0A 1NLRA 5FPBA 1D5AA 4DR7B 4RYDA 3JQWA 2ZX4A 3HBKA 1LTEA 1WCDJ 1N0NA 1H8HG 4XMAA 2WWSA 1L8DA 3RQ0A 3ABZA 1SFYA 1F15A 4CEWA 3SCGA 1RPOA 4YIOA 3K5MA 2RS13 4JTOA 2W9XA 1V6NA 1AHSA 1WKYA 3PUQA 2OW4A 4WVZA 2D3PA 2JJ2G 1U0AA 2IXKA 1S0JA 3UO3A 3T0DA 5A2QN 5CKQA 3B8NA 5JWPA 3NAPA 1OZ0A 4BIOA 4Q8KA 2DTWA 3VQWA 2CV6A 2LALA 3FFZA 3KLSA 1O4ZA 1PVC3 1OFSA 3VGIA 2OCCC 1VMGA 2JG9C 4Y4RA 2WZR2 3R0RA 2IM9A 1DZTA 4DV1O 4NB5A 1SA0A 4B3NA 4Q1PA 1W28A 4Z1MG 5LHGA 3T09A 5FO8B 1W2OA 1VAKA 1QJX3 1I6XA 3ZMVA 2O0OA 2X29A 1THZA 4Q4Y2 4XDPA 4ZZ8A 3APQA 5FZ8A 1DF4A 2IFRA 2YXYA 1MEC2 3DCQA 4CDXC 2BU9A 3B9IA 4QPGC 1N8RW 1K34A 3KZ4C 4QE9A 5C6CA 2BQPA 4DR4B 3O14A 1UF2C 3KQRA 1IBKB 5A7PA 3OTFA 1WP8A 3GGLA 3UNPA 4OZOA 4XF3A 1V6OA 3CJHA 5K0UC 3CWBH 1XNQB 4ZPIA 1SACA 3V0AA 4JKLA 4JV4A 2JG8A 3VBOA 1MQTC 4MH0E 3WUDA 1DF0A 4ZBMA 4OQ8A 4DR5O 3FKSG 2FCTA 4JC1A 1TUEB 4RQPC 4QX8A 4M00A 4TLGA 4PLOA 3T2QA 2Q69A 1DLCA 3NKTA 1WCQA 3VHOA 4LF5O 4CEWB 5AFEA 2IWGB 4CCLA 2Z2SB 4UFJA 4MGYE 4FM0A 3AP9A 3KG2A 2X6AA 1R1A2 2D6NA 4Q0SA 1HNXO 4PJ0Z 1OF4A 3O0XA 2QCSB 4MO3M 5A3LA 4O9GA 4A3XA 3A7QA 4B08A 3NAPB 5F5IA 1US2A 5EV7A 1TMF3 2D6MA 3RZLA 4LO4B 1DGLA 1OVSA 1VBD2 1YJKA 1NS1A 5I0SA 1W6NA 2XAJA 4HOOA 2CDOA 1SA0B 5BNOA 1DYKA 1T6BX 1ZRIA 1UOJA 4XJ9A 1AXYA 1H1AA 3WP4A 4JX0A 2PTMA 5EC2C 2HHHB 3T1HO 5FP4A 3F7YC 3VBHC 1QLEC 3EHKA 3KSCA 2A75A 3IDEA 1FJGO 1XOUA 1AYN1 2DWRA 1W2NA 1SQBH 4BM8A 1BQPA 4G9SB 5LP6C 3UT5B 3CSXA 3FHIB 3N36A 2ITCC 4JF3A 3MLJA 1SBDA 2F1MA 5LRRA 3LCPA 2DN9A 4DYLA 3SH3A 2V09A 2ZEYA 3GHNA 1J3PA 1WD3A 1AB3A 5FPRA 4EZ4A 1PHMA 5IK4A 3CJHB 5DAXA 3GNEA 1W6OA 4CUCA 3WOGA 4ZKTB 1RMU3 1QNYA 2JG8B 3VBOB 2YC0A 4DZGA 1WGPA 1XNDA 2ZE6A 5HBAA 2I74A 3CKHA 1RIRA 2IXCA 4QU2A 1GV9A 1PPJH 1IVSA 1ONAA 2HHHO 1VRH2 2UXDO 3HQRA 2R9AA 1XRUA 3SYQA 2VOVA 2WQZC 4DEQA 5A6QA 2ET1A 4OHWA 3MYXA 3A0RA 3W20A 5C4WA 3IWZA 5F3EA 4CVUA 4AQYB 2BWCA 4N43C 2AW9A 4SBVA 1REEA 3K0DA 1AYM1 4UB8Z 2AACA 1LENA 1ZBE3 5JZGA 2K1EA 5CEHA 2NP0A 3GWOA 1W6NB 5I0UA 1MS4A 3W58A 5FNVA 4OZXA 5IFPA 3BOPA 3E6BA 1UY4A 5BNOB 1ZL8A 2YUAA 1PM4A 1ZREA 3AG4C 2E5LB 4RR3C 4OI4A 4GX5A 3ZN5A 4EN9B 4LFAB 4MSWC 4XJWA 3JD4A 2JVDA 1QVGU 5T52A 3ZFFA 3PU8A 2WYFA 4DV6O 4YM1A 2PQSA 3K0GA 1REDA 4J7KA 2JDPA 2VBBA 5IK5A 2RDCA 5JDBA 3ZMUA 1S77D 1K8AW 1OOPA 2OS2A 4R9BA 2YFZA 1R081 2OZ6A 4MX3A 3TN93 1FX5A 1AJKA 3BPZA 4KHPO 3W5MA 2B9UA 5FQ0A 2IU0A 1W6OB 3VKLA 3FHQA 3CPWU 1J5EB 2VUAA 2NR5A 2DQ0A 4OHXA 2M7WA 3CCUV 3VN4A 3CXHF 3N27A 2PY5A 3IIAA 2ZMNA 5A3MA 4MW8A 3VQXA 4GZ9A 4RO2A 2JJ6A 3UJOA 4JQTA 4I02A 1F51A 4BQYA 3ZYFA 3KGZA 5FYTA 4Y1ZA 1HRV1 3BU0A 5GLZA 1DLBA 3I2IA 4YJ3A 2AR6A 5C4WB 3PVBB 1QJU2 4RGGA 2WLLA 2R0HA 1QIQA 4AQ6A 1CPNA 1BZWA 1VQOV 4I9QA 2WFF2 5F3CA 4GKYA 5JZGB 3E6CC 1V6LA 4YGBA 1JX9A 1JS9A 1NJIW 1I5YA 4N9IA 5FNVB 4LPLA 4WZCA 3WCRA 4AEKA 3ZYBA 3E97A 4FK5C 4UBGA 2FYUH 2X6BA 3CRCA 1ZVFA 5IAVA 2A73B 2IJHA 3ZFFB 2XBO2 5GONA 4XDQA 5FREA 1PGL2 1S0DA 1XEQA 3ZMSA 1ZM1A 4Q4X1 4Q1RA 4ARXA 4DOUA 4XACA 4G2KA 5FZEA 3VDAA 1FXVA 1FXHA 5L3EA 4LBKA 3MF9A 4GT1A 1KU9A 1YYNA 2EINC 5FMOS 1WPBA 4UOJA 4X62O 3KT7A 5FPUA 5FQ0B 5FZ4A 2H6BA 5CA3A 4U2AA 3ABKC 1VBE3 2UWBA 4YPJA 2UUCO 2QM8A 1GBGA 1I1EA 1WD4A 1U12A 1YJNV 1UCXA 5AVPA 4IEQA 4DR1B 3ATGA 4ASLA 2B39A 2EXKA 2WT0A 4I5SA 4O4IA 5LA0A 2Q0OC 1N0JA 2JD9A 3CRQA 3EO6A 4YIPA 4LH7A 3CO2A 1CGPA 2WLLB 1MZEA 4BMEA 5FZMA 2R063 3B5LB 1C1LA 1YVWA 2VVEA 2QQOA 2EILC 1I94B 1HKDA 1Q43A 2W68A 4Z82A 4K0KO 1VBA1 5EYYA 4H13B 3AL6A 1QOTA 4YZ2A 3KHBA 1IG3A 4FCAA 3EMRA 3U10A 3QD6A 4FTBA 2LTNA 5C70A 1EAH2 1PK6A 4ZZ5A 4CH6A 2Q5ZA 1O4TA 2PLV1 3NV4A 1AR91 5FP3A 1R093 1UMHA 3H1WA 2W39A 5L9BA 4XTMA 2VZQA 3AL5A 4LIUA 3O0WA 2ZMLA 4XHBA 4BAYA 4QD2A 3WNKA 2HKXA 4DV2O 5FZ1A 4ET7A 3T2OA 3ZSEA 4HPKA 4B4RA 5CFCA 5IWAO 1JI6A 1RUI3 2E76B 4CZZA 3IAQA 4Q4W3 4NJ4A 4LNVA 1YNAA 2ATFA 2EIKB 1HR0B 2RS12 4GQ7A 5T54A 3DYMA 2D6KA 2PI4A 1XMOB 3AG2C 3FAVB 4O4JA 4O4IB 3OUSA 2ADDA 1KDMA 2OYQA 2VQUA 4BW9A 3WP3A 2JKBA 2ZAHA 4WVMA 2WNVC 4RD7A 3CEWA 3FJSA 1NG0A 1D2SA 1LAJA 2CTPA 1CN1A 5GW7A 3X2QC 4IEZA 2OIEA 3IMMA 1NY71 4AILC 1LHWA 2RMKB 4CH4A 3PURA 1RUE2 3I2FA 1NQDA 4DUZO 1W0OA 2OUJA 1D2DA 2O57A 4NTYA 1XYPA 1UY2A 3AXEA 1APNA 4V1PA 4UCOA 2ZBJA 1X4TA 1XUQA 1JOYA 2FZ2A 1XSRA 2PHFA 5A7OA 4AYUA 4OFGA 3WNNA 4URTA 2ZKLA 4JTNA 4PV1B 4AI3A 1W04A 4GMP3 3OD0A 4AHZA 2O1QA 2P7TC 4DXZA 1HXS2 4O4LA 3AM2A 4LBQD 4YHHB 3BN6A 2QZ3A 2ZGPA 1S0IA 3ZRVA 3DC6A 1H8VA 1FPOA 4BA6A 1CAXA 1H4GA 3UGHA 3VBFA 4YARA 4HPKB 4Y20A 2YV8A 4CCCA 4HSLA 1RP3B 2RG4A 2IU3A 1Q8QA 1ULDA 4XCBA 1XJAA 3PNAA 5EIBC 2GMPA 5HCFA 4AI1A 4E27A 5DECA 3NJVA 2D44A 1TNFA 4DO0A 1W9WA 1F2NA 4YM3A 2ARCA 1JN2P 1GFF2 4O61A 2UU9B 3WZ1A 4O4JB 1EV11 2VMHA 2VTXA 1O3SA 2ZABA 2YBSA 1N33O 4WVMB 1JR9A 2ZEZA 4B3TO 3N7LA 4YRDA 1TMF2 1YI9A 4ZS2A 2Q6AA 1JZ7A 1MS0A 4R6ZA 1JJOA 1Z5WA 1CQ9A 5DXDA 1YIJV 1V55C 4C7UA 5FYIA 4QXCA 1SZTA 1OJHA 2VQAA 3PU3A 1JZ8A 1JUHA 4JI5B 2VECA 5FL7G 2LW8A 3B09A 2AZ2A 3J4UH 4NHLA 1FXZA 3M7AA 2B1GA 5FK7A 3U4XA 5DN6G 4UVCA 2EXJA 3KF3A 2J1RA 1ND3C 5A6ZA 4OULA 5E1RA 3MBWA 3KV5A 1DK1A 2UU9O 1RHI1 3RNSA 3RYHA 4KL1A 3RYPA 3D3IA 1VP7A 5B1BB 3AYCA 4O4LB 5LY1A 2AEYA 3DGTA 5J48A 1SESA 4XMIA 4CXYA 3DV8A 2IXIA 2FBEA 2D93A 5IVBA 2E3CA 1RMU2 1VQMV 3VBFB 5IATA 1LHOA 1OCRC 4EROA 4DV7O 4Y20B 4CP1A 3RZJA 1K3IA 2XUMA 3NNFA 2M6YA 3G6BA 5JVDA 5C3PA 4UCSA 3MPPG 2C1FA 5E89A 5EZYA 1ZZ8A 3LOIA 1GLHA 1LHVA 1V6IA 4ZONA 5APAA 4AFAA 3I2HA 4MZUA 4CC5A 4UCVA 4YVSC 4JI5O 5J1XA 1W3XA 1BHGA 1YQ8A 4WFEA 1OVPA 4HKOA 4QM9A 3IPVA 2DVBA 3AP5A 2PHLA 3ABLB 1HB2A 5KC6A 1S2BA 5FZGA 5H9QA 2NPIA 3B77A 3I2JA 1CPMA 1AR61 3OMIB 2MEV1 2JWPA 2VW0A 4BQXA 1YFUA 4FPFA 3VZLA 2VTFA 2XHKA 2G9FA 4LF8O 4IGGA 1W2AX 3HBZA 1R3KC 3ZXFA 3T08A 1HP8A 1LNSA 1U97A 4PA9A 5LA1A 4KNCA 1TVKA 2C4XA 3DYOA 2ZDIC 1QDCA 5JI7A 3ZMTA 4FQ4A 4LEJA 3ZHTA 1HQWA 3CP1A 4JKKA 3WNPA 4YSFA 3VZNA 2Y6JA 2WO1A 2GC0A 2Q1MA 4JRLA 3BCCH 1OPMA 4IIJA 4O2AA 4INDA 1LEMA 2W5FA 5E88A 3TN92 3WHTA 1QMJA 1XREA 2ILMA 2CGPA 4RN5A 3WLUA 2B7YA 1N34B 4J1XA 4BYYA 3M3QA 3OG2A 5LBCA 4FVVA 4WBBA 1WWYA 4AZZA 5GTIZ 3ACHA 3RYCA 3K06A 5JCOC 5K8SA 2P3YA 1GZTA 3KHCA 3I97A 5JVDB 4YWAA 1JTZX 1Z7S2 1XL4A 3T4HB 5EZYB 2DCTA 1AZDA 2D98A 5JJJB 1IXMA 2HJIA 1XNCA 4N53C 4HN1A 4X9QA 2ZMKA 1S0EA 3IPVB 3RI9A 3ZS8C 3WY6A 3PHMA 2BOIA 4HSJA 3H8XA 2X5IC 1PMHX 2E26A 5JIAA 4E2GA 1UY0A 2EF6A 3FB5C 4CDUB 2B4KA 1XXNA 2FCUA 2VZRA 5C3QA 1K3EA 3CJXA 4NPLA 4CDXA 4QPGA 1TVKB 4GKJB 3WF4A 1PNMA 1R3LC 4AG4A 3AG1B 2DYSB 3OGIB 4JYAB 2DU1A 5K0UA 2VXJA 3KCXA 4JTAB 2OVUA 1KUQA 2VMFA 2DVGA 1VMHA 1LUVA 1MQTA 5FXWA 1PZ7A 1NCRC 4O2AB 3ZHSA 3CC2V 4LF6B 1UY1A 5LK7B 1AYN3 4XBNA 1G7YA 3WSOA 4RQPA 1SC5B 2PUSA 3HB3B 3B69A 3ZYGA 1H2KA 1ENRA 5CBLA 1R6TA 1P7GA 3W59A 3ZSLA 4DPNA 4AHYA 1VBE2 3NL1A 3RPQA 3K04A 1LR5A 3M8AA 3MZHA 3RYCB 2NN4A 5FYZA 4LK7A 2DVDA 2EVXA 1FV3A 1VQ4V 3OYWA 3G71V 5JOYA 3WG2A 2D6LX 2QM4A 1CAUA 1KQRA 1S0GA 2V4VA 4AQ2A 2OCCB 3O9OA 2JG9B 4EE2A 1TNRA 4DUYB 1D7PM 3VBUC 3DECA 4G28B 1W05A 4DR6O 4XBQA 2ZQMA 3CRAA 1UN1A 5IHRA 3MFCA 4NTWA 3BIEA 4M3CA 4BJ0A 2R062 3VBHA 4XC9A 3JCUZ 1JH5A 4CP9A 5FFOC 4N7UA 5E1AC 1IXBA 3HKBA 3KKYA 3KV9A 3D0SA 1K33A 5FZFA 1AYM3 5LP6A 4FMTA 4JI4B 4W50A 1KECA 1UW8A 1VPHA 4R50A 4LBQA 5GLUA 5FPLA 5K0UB 1FPN1 1FNZA 4XFHA 3ALQA 2TNFA 4C1XA 2PMWB 4HFSA 3IJ4A 1LOBA 1QOSA 3T2MA 2Y38A 2JGDA 5F2SA 2ZHKA 3CX5F 1VBB1 4B4QA 2AGAA 1R1BA 2UYAA 3H0OA 3VZOA 5F7UA 2ZE5A 1JW6A 4RQPB 4FQZA 2NYYA 3ZRWA 2HEPA 1WW5A 5F3IA 1U5IA 1EFRG 2CUGA 1R083 3JB4C 5DZEA 5LA6B 1RUI2 5FRAA 4PLMA 1HN0A 5EIBD 5F37A 3IGAC 4KBZA 3LDBA 1PP9H 2GSMB 4L8JA 1QH6A 2VOWA 3K3WA 1O6UA 5DABA 1PNGA 1NH2D 2VCAA 1CAUB 2C26A 5IVCA 1O4YA 5BY1A 3R4SA 3K4DA 3TNQA 4P9WA 2C9AA 2FKXA 4W4LA 3S7IA 4Q29A 5FAXA 3FBMA 4H37A 1KQSU 3KT4A 1LOEA 2IW5A 1S55A 3QVNA 4RR3A 3ZVXA 3LDDA 1I5PA 1Y74A 1VALA 4HONA 3VBHB 4OUMA 1HRV3 1QLEB 1W59A 1JOJA 5LEJA 1WA6X 4CP9B 2NN8A 3HQXA 2DW4A 4XEZA 1X7NA 3GF6A 2Y0PA 3HKBB 1ZZ6A 2ETNA 3TXQA 2XGXA 1M9NA 4W6YA 5C3RA 3POWA 4AEJA 4GA9A 2YIBD 1IBMO 5LP6B 1M4UA 4FP2A 1FMD3 2X7RB 2R072 4CZSA 1KYOF 1IZ3A 4N9HA 2XAQA 3IFXA 4P9XA 1SLBA 5LGUA 1SLLA 5F6LB 4LBQB 3AK2A 3R65A 5ABJC 1LGNA 1WA8A 2XAGA 1HJGA 2CTVA 3SGIA 3D0JA 3VDCA 2D7FA 4GXLA 3ZMNA 4LKSA 2JGDB 4H44B 3G6EV 2HG5C 3P30A 2WQ4A 3ZKUA 3UV9A 4P00B 3RS6A 1RTVA 4ASUG 5DDJ3 3K4AA 3ZRWB 2W94A 4Q4X3 4E8CA 3AKPA 3HNMA 2QDOA 2IXLA 4GX1A 1W6PA 1WLWA 4NAMA 1YSCA 3C2UA 4JV5O 4I30A 1RC6A 1E5HA 4UVBA 4A45A 1WCSA 2GNTA 2AXTZ 2L6LA 4N43B 1BS3A 1AILA 1UJWB 4JI2B 4IW3A 3K03A 3WDWA 2VQEB 4YJ2A 3CMGA 2VTXJ 1LODA 5KA6A 1SPPA 1YFXA 1C4RA 3RW0A 1HNZO 2JDUA 2TEPA 5FK8A 2LW7A 5DUXA 4GWNA 2ZHMA 3AG4B 4WFBV 1PNLA 4RR3B 4IEOA 2QTOA 3HIFA 3H1IH 4RQEA 1Y74B 1W0JG 2D97A 3CC7V 1JU3A 2AHZA 1O3RA 1O3TA 5A33A 3ZN6A 1NT2B 2HBTA 3NNGA 1H9WA 5FZDA 2Z5WA 1R6KA 4E4DX 4BLIA 1NE6A 2OCHA 4UXNA 2DE0X 2ZXWC 4QXKA 5GZFA 1D0GA 3SPCA 2B1IA 4EV0A 4L97A 2DUQA 3EQEA 3ZHVA 4B3SB 5CZKA 4ABMA 2WABA 1MZFA 2LUWA 5AG2A 2CGNA 1QEXA 1WA8B 4JAVA 3KMHA 3QH6A 2HBUA 3FC0A 2DV9A 2ODMA 2X8KA 3J8F2 4GMP0 3ILRA 3W7UA 3TEZA 3RYRA 1OCCC 4CP2A 2QFEA 5FYMA 1QR8A 1RVF1 4J11A 4TV8A 2PLV3 4FSJA 3CC4V 4MGQA 2JS3A 2F6BA 1ULCA 3ILNA 1AR93 4IGPA 1OLQA 2YS8A 2CH7A 3RFRA 5IK8A 1AP6A 1QXRA 1SDDB 1AR5A 3RT3C 5L3CA 3OEAA 3E22A 1JOBA 5JR2A 1W6PB 1COWG 4I55A 5B4XA 3L71H 5AFBA 4J25A 3ZX7A 1SCSA 4PIZA 2DYCA 2YUEA 2Y33A 5HXVA 5IYCO 1VQ7V 2JIGA 1J95A 3DXRA 3V56A 2ZX2A 4LFBB 2YXLA 4IEPA 1C1FA 1OF3A 2E7AA 4YJ2B 1E1RG 2Q4PA 3JBG2 3N35A 1DZRA 1IS5A 1KMIZ 1XNTA 2IVJA 3MI8A 4YFWA 2A6YA 2CK3G 1XB9A 3FD9A 4LH6A 2W92A 3OGGA 3ZN0A 4EKWA 3KZIZ 4J9YB 3CJIC 4LWSA 2ARBA 2OQ7A 5A33B 1A3KA 2P4EA 3HPNA 4MVTA 2P90A 4F7ZA 4Y5TA 1DGWX 1V70A 4JI8B 4UV8A 2R1DA 1ZZBA 1XNRB 3H1MA 2ZD9A 1BJQA 4O65A 1IKQA 1U5ZA 1PZ9A 2VBDA 1BYHA 3E5QA 2EINB 1G86A 4ZU4A 1VQ6V 5JOZA 1RL3A 3K3OA 3MV01 1PO11 3CCLV 5CAZA 1QU0A 3DGEA 3ABKB 3M4FA 1KD7A 1QHTA 4TN7A 1CEZA 1W03A 3UCSC 1L7RA 3ES1A 5J98B 3WD5A 5KR7A 1S72V 4LHKA 1LNQA 3C8XA 3WB0A 1H1MA 1LR1A 1JZ6A 2JKXA 3VHNA 1ASJ2 4ASMB 2FMLA 2XXZA 2ETEA 4TV8B 2D6PA 5KMGA 1NTKH 5LW9A 3LEIA 4L8QA 1KP3A 4N8MA 4DV3O 1DGRN 2CH7B 1S5HC 2A70A 3SXWA 2AH2A 4MGSA 4CH5A 4I55B 5T3NA 1JMUB 3CCQV 1X8EA 3F95A 2WNVA 1F5FA 4UFLA 1L0LH 1JYWA 5KWRA 3DXRB 3HJRA 4E4SA 4FFKA 5I93A 2PFWA 2EILB 2YPDA 4XUNA 3ZFGC 4RS5C 1TZOA 4W8JA 1QDOA 1SZBA 4GKKB 2QA4V 4DV0B 5EHDA 1BSMA 4IT5A 4DXRA 2QM7A 1EV13 3JYCA 5DQ0A 4LWSB 4J7JA 4IYHA 4YW3A 4KFMA 2YC2A 2YU1A 1PNFA 3PN1A 1CZTA 3JAKA 2GHYA 3RZHA 3UYJA 5A7SA 2UY8A 4UFMA 1BL8A 2GNMA 4LKFA 3BOWA 1Q7YW 3E8FA 1Q6UA 4BXFA 3ZYRA 1IQAA 3CB2A 3N2KA 4WM7B 3D4KA 3FHAA 2UWCA 2I07B 5DM6V 3OD4A 1HW7A 3PLQA 4XJUA 3R4UA 1AYN2 1GM7A 2D3SA 3DC5A 4QIWF 4WFAV 3I5DA 3B94A 3PVEA 5KMGB 4QGNA 2AREA 1RHI3 3VZKA 4RHV1 2RM22 5JXIA 3BI3A 3AG2B 4PA7A 4DV4B 2W52A 1IURA 3SJBC 4QHZA 4Q0UA 2WLQA 4P9JA 2A9HA 1X33A 3WDVA 3X2QB 2V5DA 1UMIA 5A1FA 3JZVA 5EFUA 3DYPA 4Q20A 4P9GA 1UNBA 3WR0A 3ZXGA 1AR81 4RGAA 3OBRA 2YIBA 3W7WA 1JUIA 3ZJZA 2JDHA 2YZ4A 4LE3A 1HIXA 2J42A 4AAXA 4XYXA 2VOXA 1ZZCA 2J1VA 2XPJA 2G9GA 1W2BU 2A79B 1AR63 2HWE1 3ZIXA 2R0FA 4ATEA 1RINA 2MEV3 5HV0A 1ND3A 3SEPA 3QOPA 4NN0A 3JAKB 2ZNIA 4FM2A 4ORFA 2YBPA 3POGA 2JK5C 2EALA 4I01A 3J7LA 1PMIA 1JZ2A 5BUVA 3K48A 4ZKIA 4PIYA 3I54A 4XXPA 4XETA 4BQ1A 4JPRA 4HK8A 5C71A 3AZWA 4NWVA 1PIV2 1AX0A 4FOWA 3N2KB 1KFUL 2E31A 2ZGQA 3PUIA 4Y5Z0 2X05A 5ACA1 1GOGA 3LKJA 1UXZA 3S3XA 1AL21 5FY9A 2CTRA 2BWAA 4YY3B 4O9EA 3SDLA 4ZU7A 1Z2GA 4YVWC 5CB4A 3WDUA 4U7NA 4H14A 3ME2A 2GN7A 1HV0A 4YVSA 1AROP 4OQ9A 4QGLA 3N4MA 3A0NA 1X59A 1PGW2 2D6OX 2FHRA 1C5HA 5C3OA 2V5YA 4AVSA 2GALA 4MGIE 1QNMA 3OE7G 3ZEDA 4B1LA 4WFGA 5IJ9A 3TYJA 5L3GA 4CU6A 3KD4A 2FD8A 2H6CA 3P3PA 4V2WA 2UXCO 4KG8A 3JARA 2P6CA 4FZ0A 1LOAA 1PV0A 1V55B 1WLDA 1W6MA 1VB2A 4HVQA 1ZBE1 1HX6A 2WO7A 3IDBB 2ZM6O 2ZGKA 4IV1C 3FMGA 1OA4A 2Q0AA 1W6QB 2ZDIA 4NYKA 1H2GA 4NXNO 4A7KA 4QDQA 3ZBHA 4LHSA 2AHYA 4E2SA 2ZX1A 1LOCA 1Q8OA 3POYA 5FZLA 4D7TA 4E2QA 4YGCA 4FPLA 4CYDA 3W7SA