4D7TA

Structure of the sthk carboxy-terminal region in complex with camp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
198
structure length
197
Chain Sequence
DAAKLLHRERMERVTAFLSYKKISPELQRRILEYFDYLWETRRGYEEREVLKELPHPLRLAVAMEIHGDVIEKVPLFKGAGEDFIRDIILHLEPVIYGPGEYIIRAGELGSDVYFINRGSVEVLSADEKTRYAILSEGQFFGEMALILRAPRTATVRARTFCDLYRLDKETFDRILSRYPEAAQIQELAVRRKEELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the SthK Carboxy-Terminal Region Reveals a Gating Mechanism for Cyclic Nucleotide-Modulated Ion Channels.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords STHK_CNBD_CAMP
total genus 55
structure length 197
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4d7tA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4d7tA02
4ZU7A 3QOPA 3H7JA 5EZWA 4E2SA 2CGPA 5LEKA 5AVPA 3SCHA 4HSJA 1OI6A 2F4PA 4MGIE 3NSTA 4IEOA 3SHRA 4P9GA 1GQHA 2Y0OA 2P17A 3EO6A 5EFUA 1DZRA 1SFNA 2IXCA 1O5UA 1SQ4A 5T3NA 4JV4A 4FAGA 2B5HA 3ROUA 4ONUA 4XF4A 4F8AA 2Z2SB 5D1IA 1O3SA 4N9HA 4CYDA 5FCCA 3ES4A 3LZZA 1OMIA 2EVXA 1X8EA 1O3RA 2QCSB 4MGKE 4I2OA 1J1LA 4EWAA 4PIZA 4META 3N4MA 2XKOA 3BB6A 5JAXA 2Z69A 4HVQA 3I59A 1HW5A 4HSLA 1UD1A 1ZZ6A 3ELNA 2XHKA 1J59A 5FQ0B 4XFCA 5F1RA 2N7GA 2GC1A 5JSOA 5LEJA 3DV8A 1H1MA 1V70A 2XLAA 4K8FA 1ZZCA 4Q0UA 1QWRA 4MZUA 1UCXA 4GULA 4Z82A 5FLIA 4QGNA 1CAWA 4D7TA 3LA7A 2Q1ZB 1YLLA 1GQGA 4KWKA 4IERA 5K8SA 2PAKA 4IEZA 1IPKA 3NL1A 3H1MA 4IEWA 2GZWA 1RGSA 3NVCA 3HT1A 4QX5A 4Z07A 3ST7A 1X7NA 2HKXA 2OPKA 3PVBB 3OD0A 4ORFA 4I0BA 1I6XA 2O8QA 1Y3TA 3H7YA 2I45A 2FQPA 3FWEA 1J3RA 1ZRDA 3CO2A 1LKNA 3QACA 4L11A 4YYOA 1UW8A 4R52A 2OA2A 3IIAA 1DGRA 1CAUB 1NYWA 4MGZE 1XE8A 3UKTA 1VP6A 3BALA 2PA7A 1CX4A 3G7DA 1ZRFA 2XLFA 3LA2A 4O9GA 3M3IA 1CAVA 3E6CC 3CJXA 4IEXA 2ET1A 5KHHA 3KGZA 1ZX5A 3EJKA 4LULA 2HJIA 1Y9QA 4EWEA 3KSCA 4AXOA 4RD7A 2GC3A 4WVZA 5I91A 1YFYA 4N9IA 1ZZBA 4LA3A 2OZ6A 3SCFA 4FAHA 3DN7A 5I8SA 1I5ZA 3KMHA 2QVSB 1RL3A 4HZFA 1WGPA 2BNMA 1YFWA 4MUVA 5J7MA 5KHIA 1XRUA 2VQAA 3NJZA 1H1IA 4MH0E 1QXJA 3S0MA 2CV6A 3VHRA 1G6NA 4JTNA 3PLQA 4A2UA 2EA7A 2UY8A 4BHPA 5BY5A 2BNOA 2GAUA 3MDPA 1UPIA 4BIFA 4XF0A 1UIJA 2B8MA 4QGMA 5FDBA 2XKPA 4YNIA 4IEUA 5KHJA 4PJYA 4ZU4A 3E5QA 5CADA 5LRSA 5J3UA 4D7SA 5JR7B 4MX3A 2BGCA 3TNPB 1ZREA 1UIKA 5BPXA 1L3JA 3RYPA 4BH9A 4R8HA 3DL3A 3HQXA 1YFUA 3EQEA 3D82A 2IXLA 4XFHA 2PAEA 2GH2A 4PIXA 3DKWA 4KU7A 1YWKA 1YHFA 1Q3EA 3FZ3A 3OGJA 3H1WA 4XFFA 1QXRA 4I0AA 2Q4SA 2IXJA 5E16A 1LRHA 3HIFA 4AQ2A 1NE4A 3B02A 1XE7A 4OFGA 2GC0A 3WW4A 3LOIA 2MHFA 4AVCA 2B9UA 5FPZA 1CAXA 1EPZA 3OF1A 2WFPA 4I01A 2BEOA 2PHDA 4H7LA 3LA3A 3SMHA 2VPVA 3H9AA 3FJSA 3NKTA 3RPQA 2H6CA 2D93A 3TNQA 1Q43A 1O4TA 2PTMA 3BU7A 5FLJA 3RYKA 3UKVA 3R6SA 2IC1A 4HN1A 4IEVA 1WA4A 5C8WA 4XFAA 4QMAA 2H0VA 1LB2A 5CU1A 2CAUA 1ZRRA 4KWLA 5CVRA 3U0ZA 5I8YA 1EP0A 3E97A 4HVRA 1RC6A 4UBHA 4IESA 1IPJA 2D5FA 2BNNA 1VJ2A 2GC2A 4Q29A 1ZZ9A 4LEJA 1CAXB 4MV2A 3OTFA 3MPBA 3H3UA 3GBFA 1DZTA 1SEFA 3E6DA 5E1RA 3U11A 4TLFA 1DGWA 2Q30A 4FT8A 4XETA 5I0UA 4YRDA 3S7IA 4DINB 3EBRA 2UY9A 2V09A 2D40A 4J1WA 4YSFA 2ETEA 4EWDA 2PHLA 3CL1A 5I0TA 4JVAA 4XFBA 4WBBA 3LAGA 2MNGA 2XGXA 1CGPA 4J1XA 3FFQA 4LUKA 2K0GA 3I54A 3OCPA 3CEWA 2UYBA 5FPXA 3IBMA 3ZDSA 3IDBB 1YFXA 4LUMA 3RNSA 5FQ0A 3ACLA 4Q0QA 2E9QA 2XL7A 3H8UA 1RUNA 5KBFA 5KHKA 2Q0AA 3RDIA 4NVPA 2OZJA 4HMZA 2PAMA 4KU8A 1NE6A 2H6BA 1J3PA 2ET7A 2XL9A 2D5HA 3H50A 1NXMA 2BYVE 4L2NA 4QXKA 3E5UA 4XF9A 1EY2A 2PYTA 3PNAA 1LR5A 4YARA 1NZCA 1ZZ8A 1O3QA 4E2QA 4O9EA 4QM8A 4Q0VA 4XFGA 1OFNA 2C0ZA 1O5LA 3L2HA 5BXXA 5BV6A 2PFWA 4IEQA 3I59B 1VR3A 5I8TA 3CF6E 4AVBA 3SCGA 4F7ZA 5J48A 1JUHA 3GYDA 3H1YA 3SXWA 4HBNA 4AVAA 3RYRA 3KGLA 3D0SA 2UYAA 1J58A 1YUDA 4PIYA 5HI0A 1TQ5A 1Q5OA 3E5XA 2KXLA 3LWCA 4E2GA 4WZCA 4EV0A 1ZZ7A 4IEYA 2O1QA 4HN0A 3JZVA 2CAVA 3MYXA 3UKNA 1FI2A 4UBGA 4EROA 1CAWB 2VECA 4UXAA 5KHGA 4XF1A 3RZZA 3NW4A 4KL1A 1RTVA 1O3TA 4HLTA 4Q0SA 2ZKLA 3C3VA 3H3ZA 4LTAA 1OD5A 1PM7A 4LA2A 4OLLA 4Q0PA 3BPZA 3WW1A 2ZCWA 2FMYA 4ZU5A 2DCTA 2IXHA 1WLTA 4XEZA 3CLPA 2K9ZA 3D0JA 4IETA 3I7DA 4I02A 1PMIA 5JCTA 5JSPA 1X8MA 4JTOA 2OYZA 4MGYE 3WW2A 1CAVB 2PQQA 4I3PA 3FX3A 5I0SA 3HT2A 4I09A 1U12A 5I0RA 4BYYA 4AQ6A 1O7FA 2MPFA 5I93A 3MZHA 4QGLA 2QNKA 4B29A 3KCCA 4KWJA 1QY4A 3FE5A 2IXIA 1ZRCA 1FT9A 3USSA 3FHIB 1RUOA 1CAUA 4FBFA 5LRRA 1ZVFA 1X82A 1FXZA 3M70A 4XF3A 3U10A 1J3QA 3S7EA 3ES1A 1ZNPA 4HVOA 4XFIA 5BUVA 4X6RB 3EHKA 3ETQA 2IXKA 2WC2A 4LLOA 3IDCB 5C6CA 2QDRA 3E6BA 1EYBA 2EAAA 2QJVA 5JSRA 3BCWA 2XLGA 4IEPA 5FLHA 3WW3A 4QM9A 2ATFA 2GU9A 3IWZA 4X6QB 3O14A
chains in the Genus database with same CATH superfamily
3H7JA 4EFBA 5FP8A 3ZO0B 5LEKA 4HSJA 3ASNB 4LP8A 1FOD3 3HBKA 2QE7G 1IS4A 1KKCA 4GKJO 1OUSA 4KUMA 3GJBA 3JSNA 4Q26A 3C90A 1P7BA 4NWWA 5CA3A 4CBCA 3OFNG 3S5QA 5EJ1B 3C7HA 4BAYA 2DTWA 4EN0A 5CA6A 3K3WA 4DR7O 3ES4A 5EHDA 1O3RA 4BMBA 2DVFA 1ZLZA 2UXDB 1KRIA 1XU1A 3G6EV 4PQQA 2W91A 4IV3B 1P8JA 3GDBA 5H9CA 4JI3B 1UF2C 5JAXA 1I94B 1HR0O 5FY5A 4DV3O 3MV01 3JALA 2ZGNA 3B93A 2XHKA 1J59A 3R0RA 5KC5A 2PI5A 1PIV3 2CTRA 4DV0O 4JI2B 1PX3A 2Q1ZB 1TZOA 2IJKA 1XNAA 4FTSA 2G1MA 3UESA 1JVMA 3A0NA 4GH4C 5GJ6A 3CBNA 1V6KA 3W7XA 3HAGA 2I07B 1ZYBA 2JENA 4CS2A 2P4VA 4XUNA 2G9FA 4M4RA 5T5JA 2EINB 4WVMB 1OCZB 1ND3A 1YTFB 1COV2 4L11A 4DR6B 3HMYA 4Q8KA 2X10A 5ABJA 4XCAA 3BY6A 3Q8AA 3QH6A 5A3UA 1QQP2 4AHZA 4KXRA 5C3PA 4MHRA 1VBC3 4ES8A 5FREA 3VD3A 4KWUA 4CU9A 3ACHA 4I0XA 1UOGA 1K34A 4Y5Z0 2GC3A 3T2MA 4HANA 2OZ6A 2R70A 4AFAA 2EJ7A 1BMFG 3FLPA 1WW5A 4NHYA 4ASLA 2FD8A 4TV8B 2JB4A 4QXHA 2BW8A 4W8JA 5HV4A 2X7RB 2RS13 2Y6GA 4OZOA 2LW7A 3VV1A 1K5QA 2WJSA 2WLIA 1VQPV 5FYIA 2WAMA 1QLEC 4DMIA 4QGMA 1ULGA 2IH3C 4ASUG 2VUDA 3PIGA 1I5YA 1WP8A 5DAVA 1PNFA 4LMFA 1KDKA 5B5EZ 4JKMA 4PQ9A 5GLZA 2RMU3 3FB6C 3HKBB 4QQOA 1UJWB 5IY5B 1EN6A 3B02A 4RR3A 4BA6A 1NXD1 2RHPA 3WP3A 1FX5A 1NU1H 3ZYHA 1AR93 2DBNA 4ES9A 3S3XA 3OD4A 1KB9F 4RS5C 5BNPA 2KD7A 1W06A 1D5AA 5JH7B 2HHHB 1N33B 5DUUA 4HG6B 3HR9A 3I8TA 3SJBC 4QX3A 3GJAA 3MFAA 2R0HA 3POYA 1JOPA 2BNNA 1RXFA 1GRJA 2AACA 4P9WA 3GBFA 5LGUA 4DXRA 2JEMA 1VBD3 4FT8A 5IK8A 5I0UA 1RJ8A 2CHHA 3AFKA 3J8F2 4YW4A 4DV4O 5BMVB 1KD1W 5J2TA 4G4FA 1MSWD 4BU2A 2X05A 1ZRIA 3OCPA 5L9VA 4H0LB 2BWCA 4OHYA 3BU0A 5DEDA 4YGDA 3MIHA 1F9KA 3WG3A 2Y48A 4RQPB 4I3GA 5FTTC 3L70H 2YYOA 1YHQV 5FZAA 3OB8A 3JD0A 3LEGA 1QNMA 3K3OA 3KF5A 1GN2A 4GH4A 4QXKA 1P7GA 1QVFU 2VCMA 2NM1A 1ZZ8A 5DAWA 2P3JA 2VS0A 5JPMB 1TMF1 1Q6HA 1OFNA 4DXSA 2VNRA 4QX7A 4AVBA 2WA3A 5IYYA 1I5PA 4AVAA 2HJFC 2VOKA 4PIYA 1TMF3 3CCRV 4COZA 4LHLA 5CEHA 3MW2A 1RUF3 4W65A 1AJNA 5M0TA 3WP4A 5DG2A 5FZOA 5FXXA 1MVEA 5CA1A 5DUXA 1MQTC 5LP6B 4LF8O 3DC5A 3PVNA 1AP6A 4XUQA 5FZ8A 1WW7A 2C1FA 4CEYC 5FYBA 3OT7A 1LNQA 4DK1A 1JZ7A 3RYHA 2K1EA 1HN0A 2ZHNA 3JBG2 2VG9A 1O7FA 5F3IA 5I93A 2ARHA 1ZBE3 5FK7A 4C1XA 1H4GA 4JV5O 3CCSV 3R65A 4QKNA 4OZXA 4KGGA 4M00A 1VRH1 4ASKA 2JG9B 3SYCA 1GOGA 4AEKA 4CDUB 4KMQA 1S76D 2Q7HA 1X82A 4J80A 3O1VA 2BTOA 3AL5A 1RMU2 1ZNPA 1LUVA 5IJ9A 1S72V 3IDCB 4JC1A 4RR3B 3VBHC 5BZBA 4AZZA 2ATFA 4N53B 2O57A 5J2UB 2QQIA 2XHBA 4MGIE 4CP9B 4HYOA 1GQHA 1DZRA 3B3QE 2MK3A 3RYIB 2QQPA 2W0XA 1IX9A 1WZXA 3B00A 1IQAA 3VOUA 3BVCA 5FKBA 3ZXEA 1LOGA 4XHXA 4CPBA 4PIZA 3AP5A 3QCWA 2QQNA 4Q1RA 3IPVB 2E5LO 4OX9B 3BIWE 2W1QA 3JASA 2ZX2A 2EIKC 1YQCA 1M4WA 4LOTA 1PVC1 4FQZA 5T52A 3AC0A 3BA9A 4H3WA 5JSOA 2JS5A 4W4KA 5D21A 4MHUA 3KT7A 2JICA 5HXVA 2LUWA 1JHJA 1N1YA 5LMNB 1XNKA 3LDKA 1J5EO 1XL4A 1EN5A 1DLCA 2VZTA 5FPOA 4H37A 2VW1A 1DYKA 4Y1XA 4K40A 1M1KW 2CYFA 4ZZ5A 3AXDA 5K7PA 4TZDA 1L8DA 5LOVA 5DZFA 5IATA 1UW8A 1TME3 4AI2A 1VMHA 2VUAA 4LK7A 2W46A 1S0JA 4INDA 1WD3A 1C8M3 2HG5C 3GWKC 1XNQO 4JGYC 1PL4A 4G9SB 3F5TA 3SYPA 5AC91 1QJU3 3NMBA 3J80N 3DN7A 1V6JA 1AJKA 4R8CA 5A3LA 2ORZA 3N7KA 3VHNA 4DQAA 1TNRA 3NJYA 1DGSA 3VHRA 5CA1B 2B45X 5LP6A 2Q7GA 2RDQA 4XF0A 5A3MA 5JI7A 5CN0A 3PVOA 4K35A 5CA0B 1WCKA 4YJ3A 2R073 4AL9A 5J3UA 2JKBA 1OLMA 5EIBC 1HNZO 2ZXQA 3E86A 1KFUL 1UWWA 2IJIA 2D6MA 1YFUA 1N34O 5FZ3A 1W9WA 4ZI7B 5GTIZ 2A71A 2ZOEB 1PK6B 2YUAA 1MS0A 3LEIA 3SPGA 4OFGA 2RDNA 4OUMA 4RQPC 5CG8A 2NMOA 4YM1A 1S2BA 1PMJX 5GALA 2QZ2A 3BRCA 4JGSA 1SETA 2RS32 3VQWA 1JYIA 4DR5O 4AR2A 2W08A 2DJVA 3VKOA 1SKVA 2ZPXA 1KKDA 4HVRA 2B1IA 4KG8A 4JYCA 2ZE8A 4F6RA 1VQ8V 4DV6B 4QHOA 5C3SA 3D3QA 1CAXB 4TYSA 4Z2AA 4N53C 1XNRB 3SPCA 1W0KG 3TJTA 2FMLA 2CK3G 4NPRA 3QH7A 3WDTA 2Q30A 4XETA 3N36A 3EB7A 5EQUA 2FDKA 2CTVA 5I0TA 1FXHA 2D6NA 3AP9A 1MABG 1HB4A 4J1XA 4H14A 1E5SA 2LJ2A 3CJIC 4GWJA 5EC1C 1GMGA 4AHCA 4I0WB 2VZSA 2Q4PA 3IBMA 1YC61 2D98A 1JODA 1EV11 4I55A 1XNDA 5A32B 1XBLA 3K04A 3RYIA 5FPBA 4KI5M 2AR6A 4LE3A 2D5HA 3H50A 4G27B 1XNTA 4JI6O 4TOIA 4YG0A 2OIGA 3OEHG 1S0BA 4GWMA 1I7FA 5CISA 3JB8A 3G67A 3AK2A 4GA9A 4QAWA 5FOJB 4N8MA 3C7OA 1SQGA 3RS6A 2BPA2 4PELA 1PKXA 3AX4A 1N3OA 4CSWA 1NCRB 1SLCA 3HWJA 4P5YA 3UKNA 2KKWA 3KD4A 4AFMA 5B4XA 2PMWB 1CPNA 1RUH2 3ZPOA 1PM4A 2DYRB 1COWG 2IWGB 1US2A 2YXHA 1HNWB 4LC1A 2DYSC 3T2QA 1ROPA 2OW4A 4LBEC 4CXWA 4ZIBA 4DEVA 1K7DA 4DV5B 2JJ6A 2MEV2 2W94A 3AYCA 1PVC3 2JDIG 2B5UA 4I02A 4GWIA 5IVCA 5FMOL 2O0OA 3CEIA 4GMP3 4MLOA 1CEZA 4AQYB 5FV3A 5L7OC 5KUMA 1XHXA 4AHXA 4Z1VA 4LBOA 4PDWA 2XHNA 2ZGKA 4C0HA 4ATEA 1WCSA 4PA7A 1R3KC 2IBZH 5KA6A 4QB6A 4QB2A 4ARYA 3ENRA 4X9QA 5LZ6A 3WDVA 1FXZA 4LBQA 1ZL8A 4CCLA 4OX9O 3EHKA 1SQBH 3SDLA 2XLGA 2XWJB 1EBOA 1GSLA 4PBPA 2IFWA 4QM9A 2LO1A 1VE0A 2A5ZA 4XILA 4Y1VA 2RDRA 2VZUA 4B3TB 3KCXA 5ACA2 2CGPA 3QOPA 1Y6XA 4LO5B 3NSTA 3ZR5A 5E6HA 4IV3A 1KUQA 2A3YA 4MOAA 3S3WA 1AROP 4FJCC 2Y33A 1UU6A 4NHLA 1J5EB 4AE2A 2Q69A 1SQXH 5T3NA 1QHTA 3ZX7A 1D2QA 1G4YB 1JZ2A 4X1KA 4ZI7A 1KDMA 1W2AX 5DDJ3 3LF7A 4PHZA 1X8EA 5DUWA 3CC2V 5C3RA 1IBKO 2VMEA 4HK9A 1G6UA 5KAFZ 4META 3QNEA 4IL6Z 3GF6A 3LEMA 1R083 3BFRA 5DDJ1 5A80A 5EZYB 2BOBC 5FZIA 5IHRA 1EZVH 1L0LH 2VZVA 4QQLA 2N7GA 1EUUA 5H9PA 2ZZJA 4RHV3 3ZR6A 3KWVA 1S5JA 4LE4A 1E5HA 1LGCA 4Q1PA 1AHSA 4D7TA 4AFDA 2NMNA 1VBA3 1IGOA 3BHPA 4LKEA 4BWOA 1OKQA 1UX7A 4AI3A 4QPIB 5A1AA 5A1LA 1XJAA 1QKQA 4X66B 5F5IA 4GKKO 1BHBA 3WB1A 1MZ5A 2QQVA 2KQXA 1XDCA 2FQPA 1ZX3A 3UO3A 4I0XB 2SBAA 1R1A2 2GP5A 4NO4A 1IBMO 3ZHSA 5L3FA 1DGRA 2LTNA 2IVJA 1OH3A 1DGRN 4GZ9A 1GWMA 4CH6A 1NA1B 2ET1A 3GXUA 2JEXA 2JGUA 4LULA 4DV7B 1G7YA 3IFXA 4WVZA 4ZS2A 2RDCA 2OTJV 2GHYA 3G80A 4CU8A 2CU5A 5F2SA 3I2KA 4TLGA 2E32A 4CEWB 1CVNA 3ZFGA 5JI9A 1G1XB 2YIBD 2DFBA 3S0MA 1H30A 4DXTA 1O8SA 2GAUA 1ASJ2 4ATFA 1Q8PA 5JCOA 1BEV2 3HKBA 2BCCH 4ZPIA 3NV4A 1KMIZ 4F4LA 5EYYA 1Q81W 1ENSA 3F5WC 1H1AA 5LGTA 4A6OA 5BYNA 4MTOA 3BIEA 1KYOF 3W7SA 3H1WA 4GKYA 1GTOA 1WP7A 2DUQA 3JCZA 2B9UA 1V54B 2XQRA 2VMFA 4GB32 1O8PA 2P2KA 3APQA 1FAYA 4LNVA 1DZQA 4P08A 3TNQA 4ZHQA 3THPA 1NCQB 2R062 3K03A 1VQ5V 1XMOO 3JD72 1LB2A 5GM0A 1CX1A 4UCVA 4BISA 3I2JA 1N1TA 1RC6A 1BCCH 4IESA 5EBMC 2GC2A 2ZJCA 1IOAA 3MPBA 1XYOA 1Y76B 4XOGA 3A21A 4HKWA 4MG2A 2VH9A 2YI8A 1W0PA 1GR3A 3SKVA 2PUSA 5HFMA 2UUCO 4IDZA 3E1F1 3L9DA 4TUYB 4AK3A 1CGPA 3L73H 5C7GA 3MIDA 2P37A 2CY6A 4XDKA 3ZDSA 1HLCA 2V4AA 4PDLA 1SBEA 4RFRB 3PTRB 3ZYBA 4QQ2A 3H8UA 3SQOA 1NG0A 1UZ0A 4NVPA 1VRBA 3C3TA 2OZJA 3ZM8A 2ET7A 5F2WA 2P5OA 4XBLA 4YJ2B 4LO4B 4XF9A 4NHMA 3OGRA 5FOBB 3JCIA 1W8TA 4XW3A 3UGHA 1N32B 5FZGA 1KS5A 3ZHUA 3FC0A 2XJRA 3VBHA 2CE4A 3L2HA 4DV1B 1KD7A 1R1BA 3OEBA 3WF0A 2HWE1 2Y0IA 3D0SA 4O4IB 4Y1ZA 1YSCA 4YZ3A 3JD3A 3PDQA 1O9HA 3C7FA 4LBLA 3DSQA 5LBFA 4A3ZA 3INAA 2VQFO 3Q8EA 4KH9A 4DK0A 4NXNO 1JZ5A 2HEPA 5FJHA 4YIPA 2XT9A 3L2YA 2RJKA 4JGZB 5CFCB 3ILRA 4Q0SA 1NTMH 3H3ZA 2GNDA 1Y4WA 2ZCWA 1Z7S3 3CJIB 2ZGUA 3W7UA 4WCEV 4C1WA 3CLPA 1YI2V 2HVKC 1K4DC 4B4RA 2RR11 2NYYA 3SKJE 2Q0OC 2A3WA 2ZE7A 5IW0A 2R071 1MSDA 2C2AA 2HYKA 4NMIA 2HR3A 3KCCA 5B2GB 1NX9A 4IV1C 2BUKA 1JZ8A 1G9DA 1A3KA 5A7OA 5LY1A 1IXMA 4NRQA 3CCEV 4EN8B 3ZFGB 2ZE5A 1M06G 5LGNA 3JAWB 4DPNA 1GMMA 1LECA 3ZMVA 2E76B 3BCWA 4YGEA 3K77A 4AGRA 1VQ9V 5EC2C 3OTOO 2F43G 2EF6A 4DOUA 2HLDG 1QJY2 4ZU7A 3K51A 4E2SA 2OIEA 3SCHA 1RUG3 5ANQA 1RUJ1 2AUYA 3RT3C 2Y0OA 3I3EA 2JKXA 3G71V 1SFNA 2QWRB 3OBRA 3A0KA 2YPJA 5IWFA 2X6AA 1EUTA 1O4YA 4TQDA 2UU8A 1C28A 1UYXA 3VBSB 2ZMNA 3LZZA 4LO6B 3AG3B 4FFBA 2Z69A 1YJNV 4RHV1 1Q8OA 4B3MO 3MBWA 2EIMC 3K75B 2P7TC 3CRCA 2HWC3 3T2TA 3VBFA 4MTGA 1SC5B 3ITQA 2QWPB 1NCQA 5FXZA 3K08A 1V70A 1W8NA 4XJUA 4Q0UA 2YV8A 3TEWA 2DF7A 1VB2A 2JDZA 1FNYA 2IM9A 1GN6A 1EAH3 2Y6HA 4FLUA 5K8SA 2PAKA 1IPKA 4JF3A 3M7MX 2Q68A 4PLOA 4Z07A 1X7NA 5ANNA 1PL0A 3L75H 4UVAA 3DGEA 2O8QA 4ARXA 4B7EA 3FWEA 3JALB 1FV3A 1Q82W 4HONA 1HB2A 2ZGTA 1OQDA 1Q8IA 2WYSA 5HCFA 5DPNA 4QPWA 2JE7A 2F4VB 4DO2A 4JRAA 2D6KA 2BZDA 2WNOA 1HR0B 3K4ZA 2WLLB 2HJIA 3KV5A 4BMEA 1LOEA 1ZSPA 3LDBA 1CIWA 1ULDA 3D5OA 4MVTA 4Q4V1 5C8CA 5HCHA 4LPLA 1L0NH 2BNMA 3ZRXA 3A0HZ 3K46A 4QU1A 5D8AA 1F4AA 4MXWA 4N7UA 2VW0A 2B8MA 2A6XA 4LR3A 4GMP1 2PN5A 4PJYA 2ZR3A 4ZU4A 3OEEG 5JQGA 1AF9A 3WT3A 3ZFFA 4O4IA 3H8XA 5JOZA 1L3JA 5F3CA 3CC7V 5JXIA 1MEC1 1C1FA 1KJRA 4XVHA 1BZWA 1JU4A 1RUE1 2VMDA 2QBXA 3M3EA 4MSWC 1VARA 2ZEZA 4AVCA 3LSSA 1Y67A 4NWVA 4WBNB 1SFPA 3I97A 5IVJA 4L8QA 1OD3A 4GX1A 2JWPA 5IT9N 3ZYIB 3B77A 4B3SB 3HNMA 1L1FA 1JUIA 2H6CA 5CKNA 1Q43A 1IBLO 5ISLA 4V1PA 3WF1A 4LFBO 2VVDA 5B1AC 3R6SA 3O1TA 2VOXA 4IEVA 3VBRC 5J1XA 2WNUB 5CU1A 4CUCA 4KWLA 4AFBA 4UYBA 3RVYA 1IPJA 5A3OA 1CZVA 2OT7A 4WM8B 4G28B 3BCCH 1DCSA 1RB8G 2V09A 2PXJA 4M0HA 3I2IA 2CH7A 2ZGLA 1ZBA2 1XB9A 3LPFA 2QKAA 3BAAA 5CFCC 2RJLA 4JYYA 4R9BA 1QU7A 2JDPA 4GJYA 3RNSA 3T4ZA 3VBFB 4FLZA 2CTWA 2XL7A 2EJRA 3WNOA 1WCDJ 3OEAA 3A0RA 1OJHA 1VQOV 3RRDA 2BYVE 4FP3A 1F23A 4YXWG 1V55C 1LNSA 1JYNA 1GKFA 3Q8CA 3NAPC 1WLEA 4X88A 5FZBA 1GZCA 4H44B 2XAJA 3JSLA 5J36A 3IAYA 1YIPA 2RR13 3ZXKA 3IB3A 1AVMA 3H1IH 1CZSA 3ABTA 1XNBA 2BBVA 2GSMB 5HI0A 3ZHTA 4DV4B 3DYPA 1WLWA 3E5XA 3NKGA 2GMPA 4EV0A 4I4TB 1QJX3 2RJZA 4EROA 4Q27A 3RZZA 5FY1A 4CCNA 1GOHA 1V0AA 2XWBB 3DUIA 1RFYA 1ND2C 3C3VA 5F7UA 2P6HA 3UL2A 4PD4F 3BPZA 2FKXA 4OPHA 5B1BB 1KS4A 4DR6O 3JAKB 4ZU5A 3RG0A 4XEZA 1JMKC 4FLWA 3ZSEA 2O14A 2BDRA 4X8PA 4CS4A 3O1MA 4MSVA 2VTFA 4LF6O 5I0SA 1N36B 4DUYO 3CCLV 3GZEA 4QGLA 2XJVA 5A1FA 4Y1UA 1FT9A 4MVOA 1ZVFA 3VQVA 3VKLA 1CIYA 4S2GA 4Z8BA 3RYHB 4RQEA 3NAPA 3GNEA 3NO8A 3K2OA 4OHXA 5A33A 1XMQO 2HLEA 2YPDA 4Y26A 4DR2O 3ZN1A 4L92A 1OI6A 3W5MA 1RUF2 3I3QA 3PL0A 5LMUO 4ICGA 3HKEB 1N47A 4COWA 2WWUA 3RMXA 2WDBA 4NUBA 1ZBE2 1GLHA 4R6ZA 4CTEA 1CJDA 1X9TA 1A8MA 2AZ0A 5C70A 3DPRC 5D1IA 1SLIA 2K2SA 5IJ9B 1AYN2 2VNOA 2NN4A 2WZPP 3B5LB 4IE4A 2WQ4A 3VHOA 4JV5B 2JDUA 3N4MA 2A3QA 5J2UA 1XHZA 2PLV3 3PVEA 1PPJH 4KP4A 4OI1A 2VZ1A 4QXBA 1XU2A 1HXS3 4M01A 4HSLA 5A6QA 2DDUA 1N8RW 5IYBO 1D2SA 3E8FA 3A8TA 1NZ6A 1V6OA 4RYDA 2XLAA 4OUEA 1AXKA 3QLQA 5K0UB 3MIBA 4NTXA 5FZFA 5JMOA 2XAGA 4MGSA 2XBO2 3UETA 3P5BA 2Q5ZA 1NA1A 3HT1A 1NCRC 2HKXA 2RS53 3E8GA 3PUQA 3ZSMA 3GWOA 3NNGA 1K8AW 3QACA 1QOSA 2CH7B 1HNZB 1A78A 3IT8A 2V4VA 1YQ5A 1RUE3 1WUVA 4DR4B 2WR9A 3IIIA 1JH5A 4YVWC 2WA4A 3T3YA 3U78A 1YDXA 3Q8BA 2C4XA 1ZX5A 3D3AA 3D6EA 2VUJA 3NV3A 4EWEA 3GALA 1SESA 2DV9A 3T4VA 1HRI2 1SFYA 2E31A 5FMDA 1BVVA 3FD9A 2CSGA 5GZCA 1XSQA 5KHIA 3O7OA 1DIWA 1H8TC 2E33A 4Q4X3 2R043 4X1YB 1FXKB 2BNOA 4XDQA 4BIFA 5F9TA 3USUA 4LKFA 3HEIA 3DCQA 1YIJV 2YY1A 2WLMA 4LBMA 4XJAA 1SDWA 1Y74A 2VBPA 3CZUA 3W59A 1STMA 3LQCA 4I30A 4R8HA 1ORQC 2PAEA 2Z79A 2AXTZ 1Y9GA 1DBNA 1S77D 3WQ0A 3A2FA 4ZHQB 4XFFA 2CL2A 3RZHA 3MAQA 4B4QA 4K9SA 5LK7B 3ABZA 1IKQA 2CDYA 4Z2WA 4IE5A 3LDDA 2V5DA 4NIAA 3MIEA 3TOJA 1AI6A 4CU7A 5FPLA 1HB1A 3RJ2X 4L99A 5GONA 2Y64A 1KP2A 1M4UA 1O4TA 4G3YC 1TA8A 4IV3C 5TSWA 5JJEB 2V4DA 2WWWA 1DFQA 1BGYH 5TISZ 1X50A 3UK9A 3WNKA 3ZRSA 3FHAA 2DFCA 4YSFA 5BNOC 5FYTA 2AHYA 2ZS6B 2OXBA 2WIIB 2IW5A 3SH4A 4Y20A 1Y7BA 2WLPA 5IUQA 2MNGA 4LIVA 5A33B 1NQTA 3VL8A 2RS33 3B69A 4RO2A 1IHMA 4V2WA 1U5IA 1W05A 2VZRA 3HKEA 3JARB 4JTAB 4BK5A 3AYEA 1RUF1 4X20A 4HMZA 1H6XA 4DR5B 2AH2A 4W50A 1NXMA 1H8HG 4NYKA 5FZ7A 2DTYA 3GZTB 4LLFA 2QFEA 1XREA 1HV1A 3IN9A 3SJCC 3KT4A 4W6YA 3O65A 1N0NA 3SR2C 4PA9A 2O8OA 2C0ZA 1WPBA 3CE2A 1O5LA 1HV0A 2DU0A 1OA2A 2DYRC 4I55B 4DR3B 4FQ4A 4O4JA 2J1RA 2P4EA 5FZDA 4BB3A 2F17A 1DQ4A 2VECA 4BXSV 4NRMA 3TEXA 3WW1A 4B3TO 4ET7A 4Q4X1 1UY0A 3BA8A 4QPKA 3F2ZA 3N2KA 3D0JA 3DXRB 3K48A 1XNQB 2ZBJA 3USUB 5FY9A 2WO1A 4BR6A 4GIQA 1F2NA 3NNLA 3HT2A 3OGCC 4U3JA 2WN2A 4BJ0A 4UWDA 2RMU1 1QR9A 3W5NA 3FE5A 3H3LA 2RM21 3AP6A 5IJ0B 3SYOA 2P4KA 1UYZA 4QD2A 3T1YO 3GZAA 2ZEWA 1RIRA 2XJQA 2XJTA 1EAH2 2NR5A 4YY3B 1NLRA 1S5LZ 4XUOA 1UXXX 4XFIA 2E53A 3AG4C 4DUZB 2EAAA 1HNWO 1BQ0A 2XJUA 1NT2B 1HW7A 1VLNA 1M57C 4LCUC 3CU7A 4QGPA 1N3PA 2JG8A 1QQP3 4FOQA 1U5ZA 2KG7A 2Q9LA 4X1IA 4DRXA 5EFUA 3ACIA 4JTDB 2WS93 4CCKA 2ORXA 2V73A 1A32A 4AQYO 3FAVA 1VQKV 2GNBA 4CYDA 2WAOA 3B4SA 1O59A 1SBFA 1ZBA1 1NH2D 2DOSA 3OAAG 1SCSA 1VBA2 3GZUC 1WBLA 3I59A 4DR4O 2VAUA 5LXTB 4UV8A 5B3SC 2QM7A 3HNYM 5JDBA 1C8M1 5A9GA 2W1UA 2RVAA 1GN4A 3PURA 4UB6Z 5FWJA 5JIUA 1W8WA 2WSSG 3DTUB 4W4LA 2EINC 2VTXA 2BFUS 1OCZC 1XNRO 4XTMA 3A23A 2HWF2 4IYIA 1Z0HA 3NL1A 5GLUA 4UW4A 1PIV1 2YBPA 3JB4C 5FR3A 4X20B 1BEV3 2OPKA 3OD0A 1F35A 1COV1 3VB9A 1Y3TA 2ILMA 2VRZA 3CO2A 4P30A 3ZCCA 1L7RA 5ACA3 4W6WA 1CESA 2L35A 1VB4A 4N53A 3V0BB 2ENRA 1QJFA 4R50A 1QBZA 4FVVA 1J83A 4OXSA 3OGGA 3EJKA 1RHI1 3ZRWA 1KQRA 4MXWB 3KQRA 3JARA 4AXOA 4RL7A 4UF0A 5BR8O 1GK9A 4PLMA 2HWF3 2EIKB 5C4WC 1I1EA 4FM0A 1XRUA 2ZMLA 2FDHA 1DQ0A 4BZ4A 1RP3B 1R092 4SLIA 5IWAO 4P9XA 4BHPA 3VBOC 1UY3A 5JVVA 3KZ4C 1M56C 4CXXA 2ZGPA 2UWAA 1ZA4A 2Q6AA 2XKPA 2PI4A 4LF9B 5GKAC 1ND2A 1Y66A 4CH3A 3TRSB 1COV3 1YJKA 3O0XA 4J10A 3T4DA 1UIKA 3JQWA 4NJ4A 4WBNA 3RYPA 2WQ8A 4LF4B 3MF6A 5F8PA 4BIZA 1UYPA 5F6LB 4GX0A 3KT1A 3RYCA 1JMUB 1LRHA 5E16A 3HIFA 5ERLA 2TUNA 1GM8A 3WW4A 4FFHA 5FPZA 4UB8Z 4QJFB 2YC2A 2ZGRA 5FKCA 2G9ZA 2VPVA 2WZR2 4YFWA 4LOSA 3RBZA 3PJSK 1BXHA 3ML0A 3KLSA 3UKVA 1SQVH 2IC1A 1G8WA 4QMAA 1RITA 3VZNA 3UKMA 4XZPA 2Q8EA 5D5QA 4LFAO 4WFBV 4XCBA 1PO22 4DXWA 1J1TA 1W8OA 1SG3A 5IJ0A 1TG7A 5T54A 3WY6A 1W9SA 3R66A 4XE9A 2UY9A 3O0VA 1VRH3 1KP3A 2PHLA 5C3OA 4GZRB 1X4TA 1RMU1 4LFCO 2D3SA 3AG2B 1LENA 1W0OA 3HQUA 2XAHA 2VZOA 5FFOC 1S0VA 4WM7C 1OCRC 2N74A 4DV6O 2BTVC 3WINE 4UI9L 5JWPA 3FUQA 3T4HB 1Y76A 1SCRA 4BQYA 1PGW1 2QTOA 2DWRA 4MYEA 2H6BA 2XL9A 1IBKB 4XACA 1T5EA 4GB31 1M90W 2VUCA 2R9AA 3PNAA 1JTZX 3IJ4A 5A6ZA 2JDAA 4E2QA 4TUYA 4PCRA 4IYHA 3N7JA 3LB9A 5BXXA 3I59B 1VR3A 5BNNB 4OPAA 2JDMA 3GYDA 1GNZA 2AEYA 1HJGA 3IMNA 2UUCB 1Q5OA 1URXA 3LWCA 1ZZ7A 1BMV2 1REDA 2CAVA 2ZMKA 1S4CA 2VQTA 4GWNA 1GV9A 3F7VC 2VCAA 2HEWF 3WG1A 2Y60A 3SPIA 2IJJA 4PF1A 3THOA 1V9U3 4ISRA 5FP7A 5C5UA 1FJGB 3WF4A 3VBFC 2A73B 1IBMB 1S1AA 1TMF2 4YVWA 5KXDA 2FMYA 1RUI2 2Q73A 2E26A 1W28A 4AGGA 3PJQA 4CS3A 5SV8A 3QD6A 5LBEA 1CXZB 4AHWA 3LDRA 3K06A 1R6KA 3WW2A 1D0HA 5C71A 2PQQA 1WA8A 3W7WA 1ULCA 5I0RA 2DCZA 1LEDA 4B29A 5DXDA 3QVNA 3VZMA 1WD4A 1HX6A 1V9U1 3T08A 3I49A 1NZIA 4FPPA 3USSA 1CAUA 1LOCA 2GALA 1LGBA 1GM9A 3FB5C 1Q90D 3V64A 4IT5A 1AR1B 4XUPA 5FY7A 1IXBA 5IVVA 5FPAA 5GW7A 1VBE2 2EAKA 3ILFA 3ZHQA 1PO21 3OY8B 1VAVA 3GBWA 2DYSB 1FMD1 5FMOS 5DECA 4QX0A 3H1KH 2A1XA 3ZFEB 1BHGA 1JR9A 3TGUH 3K5MA 1LHWA 5IVBA 3D8CA 4CEYB 3WUCA 2HP8A 1PD3A 3PN1A 1W6QA 1THZA 1F5JA 2WSUA 2LW1A 2ZEYA 1F5FA 3CHXA 3K79A 3IDEA 2XKOA 3T09A 1LGNA 2CGNA 3H1HH 4R9DA 1XYNA 4Z92B 1QNWA 4JI1B 1SACA 2XJPA 4YM3A 5ABJC 1WMFA 4Y4YA 4GJZA 4LNUB 3CX5F 2YB7A 3U14A 1AYN3 1FD9A 4FPYA 2YDEA 1H1MA 3FLRA 5H5NA 2C5DA 2V72A 1UAIA 1ULPA 4QGNA 1YO8A 1S5HC 3E8HA 5CFDC 4KWKA 4JKKA 1TUBA 4LBJA 3ZMUA 1VQ7V 4OYUA 4N23A 1H4HA 1SA0A 2L6LA 5T5LA 5L3EA 2VNGA 2P34A 4J9YB 1IPSA 4RQPA 1GZTA 2VXRA 1YCIA 2A6ZA 2P1BA 1RHI3 4UOJA 3ZDVA 4QKBA 4P02B 2VE1A 1VALA 3E6CC 4LIUA 2WT2A 3OM3B 2EIJC 1K5SA 2PYLA 3KB5A 3BTZA 5LMNO 3N35A 3ASOC 3WG7C 2R1DA 1RL3A 5EP9A 1BSMA 2JIGA 1OQ1A 4XBQA 1DF0A 2ADQB 5LB6A 4E9KA 1CPYA 5JXJA 2XR4A 4YZ5A 3I5DA 2WLLA 2RS51 5JR7B 4D7SA 3NQHA 4MX3A 2FDFA 2IVIB 2JIJA 1JFFB 4XZUG 3LGRA 4KFMA 4FI9A 3I3MA 1VMJA 3PUIA 3VGIA 4PIXA 3DKWA 1OF4A 1YWKA 1YHFA 2W5FA 3RGBA 4RUEA 4ZXKA 3S6PA 3J9SA 1HWYA 1VBC1 1E57A 2RNBA 3WCSA 1K42A 2BTQB 3K0DA 3KZIZ 3RPQA 2D93A 1GUIA 4DZGA 2WN3A 5IT6A 1PP9H 2RS11 1VIWB 2X29A 4HOOA 4N43C 2IJHA 4HN1A 1WA4A 3AFGA 1MQTA 4CCMA 3WDWA 3OY8A 2QQUA 3U07A 3O1PA 2YFUA 4O2AB 4Q29A 5BNNC 4JI2O 4C7UA 1N34B 1HQNA 3WF3A 2HWB3 4YW2A 2UU9B 4CEWA 5IK7A 1O6UA 1PO23 3T1HB 1R091 3RWNA 5FZ1A 2D40A 4HK8A 1FOD1 5FPRA 4QE9A 2R49A 3N9QA 1VRH2 2A6YA 1UZVA 2EIBA 4Q8LA 4QHBA 1QJX2 3M3QA 5JOWA 3FUOA 3N3HA 1AR73 1B35A 1LR1A 1HRI1 5FPXA 1RUC1 3LSDA 1YFXA 5CZKA 3KHBA 1QOTA 2YIAA 4B3SO 5K9YA 2HEYF 2DWEC 1JJOA 2W6IG 1L7LA 1SF9A 3VBUB 5B66Z 1C4RA 1H2MA 5A2QN 1O9GA 2PYTA 1KC8W 4D7YA 4K0KB 1GN3A 3RQ0A 1O3QA 2YGLA 5H9QA 2VTXJ 2MEV3 5EJZB 3MLLA 3SLIA 2PHRA 2YUEA 4A7KA 4BQ5A 5F39A 3RWRD 3CF6E 4L0PA 5J09A 5J48A 2XBO1 4V2VA 1C57A 2KXLA 4JGYA 4E2GA 3IGAC 4IEYA 1FI2A 3UCSC 2ZE6A 1EM1A 1OCCC 5LYJA 3DXRA 2R9RB 3KV9A 1NAEA 3E89A 5DDJ2 3M8AA 2KR2A 2B39A 1ZA7A 1PM7A 3SGIA 4LF5B 3ETGA 2B46X 5B1NA 1DLBA 2C24A 3CIHA 1MZEA 1R73A 5LMUB 3SH5A 3FLTA 2JGDB 4O4HA 4IHJB 1NTKH 2YXSA 1MS5A 3CMAV 3MV11 2OYZA 4NXNB 4GB33 1PGW2 2DUOA 4CPBD 1YYNA 3LUTB 5E1AC 4NR1A 3POBA 2JE9A 4MVRA 4EE2A 1O91A 1AR61 1UMHA 4CE8A 3E83A 4CDWC 3RFRA 4DNYA 1P84F 5CKQA 4JAAA 5ABJB 4P9PA 4A7YA 4DRXB 1HRV2 3E22B 1J3QA 1UU5A 3S7EA 5BUVA 3CS5A 2VJXA 3PUHA 3RVHA 4MVQA 1W9YA 5T55A 5JR2A 2VM9A 3ZYJB 2QQJA 1D4M3 1W04A 3I3DA 3STLC 1E5RA 2BVVA 2ITDC 1DYOA 2BTQA 1LHOA 4TT3G 1PK6A 1NKGA 5FUNA 2VOTA 1RUH1 3RVZA 5AVPA 2F4PA 1D5NA 1GZ9A 3WQ1A 4B4PA 2QQWA 4GMP0 1JFFA 1UY2A 2IXCA 3B8MA 1UKRA 3NAPB 5H9RA 2WFF2 3WG4A 1LHVA 3J7LA 1HJFA 2WO7A 4XHBA 1LCLA 3MUZ1 4TTGA 2B1GA 1SQFA 1DQ5A 4DYLA 1YQ2A 4A3XA 4F6RB 1JOYA 2Q8OA 4HVQA 4UVBA 2AREA 1US3A 4Q4V2 3DF0A 1PNLA 2UURA 1IS6A 5FQ0B 5BNQA 2QGNA 1AR62 3FFZA 1GBGA 5FL7G 4JX0A 5JZGB 1OF3A 4U7NA 1MQTB 3AKRA 3JD71 3LA7A 4D6TH 5LATA 3LDEA 1AR83 4X62B 4ZKIA 5B3SB 4JYAB 3NVCA 3GHMA 3TETA 3JBG3 3OE7G 4DUXA 2X5IA 3D36A 2DMXA 1MZ6A 1KU9A 3AZVA 4JI7B 3T2PA 1VF5B 4IGQA 1WPXA 3BALA 2KSDA 1XXNA 4XYXA 2DE0X 4FFFA 4ITCA 4O9GA 1NR1A 4OVEA 4CUBA 2JJ2G 5EYPB 4CXYA 5JVDB 2DQ0A 1AX0A 2ARXA 4RD7A 2JS3A 2YBKA 1C5IA 2RS12 4E4DX 1S0IA 3LSUA 1H2GA 3VBUA 3VQXA 2J1VA 4MVMA 2R72A 1QJEA 4FCAA 4AI0A 1H1IA 3AEIA 2E3CA 3ETDA 2WWSA 2A0LA 1OCOB 3X2QC 2JG9C 4IEUA 1DQ1A 3LDCA 5CADA 5KXEA 1SZBA 4YM2A 3T0DA 4BQ1A 3AVSA 1OBNA 5APAA 1VPHA 2WAAA 1N3QA 3HQXA 2EIDA 4YIOA 3U75A 2WQZC 2QQMA 2RS52 2W1SA 1TGOA 4X1YA 3FZ3A 3OGJA 3N7MA 2F95B 3P3PA 1NA1C 3J4UH 1RUJ3 3WU2Z 1QU0A 4NPLA 3CWBH 3LOIA 1TUEB 3KQ4B 2QZ3A 2HWC1 5FP4A 4FO9A 3CYOA 1Y74B 4I01A 2XDVA 1GH6A 4L97A 2HWE3 1V9U2 3ABLB 1LULA 1MG1A 4R4XA 5CB4B 3RYKA 4QDQA 3JD4A 3WCRA 1FPOA 3OMNB 3ZHVA 5CVRA 3P3NA 2OPWA 2BFUL 4BW5A 3EFFK 4RAIA 2WZR3 1DZTA 2EBOA 2Z0AA 1RINA 3GBGA 3I2OA 3T0BA 1SPPB 2D3OW 1QQCA 4FPLA 2D6LX 4JDMA 4LK6A 5C33A 1V00A 4HAMA 5D8AB 5HFLA 3POFA 2OQ7A 1HRV1 1Z7S2 5IJRA 4YW5A 4JI6B 1XNCA 3MICA 4GALA 5JJJB 5IVYA 5JQGB 1RSOA 3OGVA 4MVUA 4CDUA 1JW6A 3A4UA 2XB6C 5FQ0A 1W8FA 3KCYA 3FKSG 1BBT2 3RDIA 3VDBA 4UVCA 4KU8A 4L9BA 4Y20B 2Y34A 3IC7A 2ZGOA 1Q8VA 1LOFA 1UYYA 1NZCA 4YVSC 2CGOA 4QM8A 4FVMA 4XBNA 3RW0A 1VBB2 5L36A 4P2ZA 4F7ZA 1EFRG 3H1YA 5H6QA 4YHHO 1G8MA 1TQ5A 3ICXA 3H1JH 5GLVA 1NH2B 5JZGA 1WW6A 4B8EA 1GP6A 3TXQA 2W1WA 3ZN6B 4JI0O 3WLUA 3U4XA 1AXZA 4LA2A 4LT5A 3QF7A 2BE3A 3APOA 1I3HA 3O12A 2OX0A 4FFIA 2W6JG 2LW8A 3T30A 4YPJA 1V9PA 5FP3A 4UCTA 2ZD9A 3J7NA 2Q67A 1W2BU 4IETA 5FZ4A 3I7DA 3K3NA 1X8MA 3VQYA 4JTOA 4DV1O 2RM23 4S2HA 1K97A 3H1LH 4OCTA 3MZHA 4UW6A 3MIFA 1D2DA 4DR3O 3AZWA 2DBIA 3DYOA 1B04A 2RDSA 3ZN0A 2E75B 1RUOA 5FJKA 1MA1A 4BQ4A 1SZTA 4L8JA 4K21A 1JYVA 4AEDB 2ZHLA 4JYBA 3ZFEA 2FDJA 3O1UA 3WG7B 2IU0A 4MTFA 1US6A 4XABA 3IWZA 4E27A 4RA0A 4WM8C 3AMHA 3C3SA 1GANA 2Y69B 1R1ZA 4U3JB 2XVKA 4YVSA 5K1XA 1QJU1 3SHRA 1R6TA 2VQEB 1XC6A 4LH7A 3ZN4A 5IYZA 3K57A 1GZWB 1TVKB 2GTSA 1AX2A 2H3OA 4FAGA 1BVP1 2B5HA 5LBCA 1HDJA 4F8AA 1FMD3 4CDXC 4URAA 5FMBA 2EVXA 4JAUA 1WB8A 4PA4A 1JS9A 4DR2B 1S0EA 2WT1A 3BB6A 3ZSJA 2KG7B 2CWMA 2QWOB 4NPMA 2A7WA 1UPSA 2EXJA 1OQEA 4B7KA 3ZMNA 3LOBA 4JKLA 4QU2A 3VBSC 2XOMA 4JZRA 2B4KA 1CD3G 3OTOB 3VZJA 5LEJA 2R7EB 4L87A 1QWRA 1SS3A 3AK3A 5FLIA 2LM3A 5JOYA 5F2VO 2C9KA 4IEZA 4GCZA 4AVTA 4Q4W1 4IEWA 4QPYA 4CCEA 2GZWA 1BL8A 5KC6A 4I0BA 2E63A 1FS0G 1R1A1 1VBA1 5IK4A 4DEQA 1OCRB 5FYMA 1AZDA 3J8F1 2XPJA 1ZRDA 4QNHB 4EYUA 4YG6A 5FYZA 2BSKB 2OIIA 3M7AA 3K9AA 3UKTA 1ODNA 2W47A 5JUVA 2XLFA 2WFF1 4Y3OA 1F4HA 2JD9A 2PHTA 1XPWA 3LSEA 3OR7C 1VQLV 4JAVA 4JI4O 3KSCA 1OUXA 2ZAHA 2DW4A 4O2BB 1D4M2 4DUWA 5IYDO 4JDOA 2VO5A 3VBRB 4HZFA 3CB2A 1SQPH 4MUVA 3QBQA 2RE9A 2OUHA 4MH0E 2FZ1A 2P3IA 2EA7A 2DU1A 4NIDA 3V0BA 4LITA 2UXBO 3AYDA 1W2TA 3ACGA 5C5TA 1LU1A 4NAOA 3M99B 2QDOA 3JQXA 2BGCA 4PA6A 4RR3C 1BQZA 1A34A 2XMLA 5KXCA 1BT8A 2AEZA 4PBOA 1VQMV 3PMSA 2VCBA 4A44A 3VD7A 5CBHA 3QTCA 2IXJA 2D3RA 1BK1A 1H8TA 4AQ2A 3HPNA 4P9JA 3D4KA 3ETEA 4RHV2 5B1AB 2FDIA 3KKYA 3OMAB 1ND2B 3H9AA 3UT5A 4ISQA 1YJLA 2ARBA 2X0LA 2RMKB 3EHBB 4B3RO 5FLJA 1AR71 3TYJA 3DEMA 4WVVA 1J95A 2RN9A 4YVSB 3EYPA 2GNTA 1PVC2 2D5FA 4M4PA 2ITCC 2HWD1 2WNEA 2VW2A 3SPHA 4LF4O 3BGAA 1VP7A 5IVEA 4Y5SA 5K0UC 3AVRA 4Q20A 3CL1A 3POSA 4XDPA 5L73A 4PDWB 1FXKA 4WBBA 1UZZA 3TCUA 1WB7A 1VBD1 2F93B 3GHNA 2WO3A 1DQ6A 4YHHB 3HR0A 3V0AA 5F32A 3VBSA 4BK4A 2I2SA 1S0CA 2UYBA 2F4LA 3AYAA 1PZ7A 5JLVA 1ZM1A 2E9QA 3I2DA 1TNFA 3ZYPA 1YEWA 3SJAC 3CRQA 2FTKA 1X36A 1QJY1 2D6PA 3SISA 1AR91 3EVKA 1YJ9V 1R3IC 4X65O 4U2AA 1H0BA 2JRIA 2PGGA 4Q0VA 2YXYA 1HRV3 5EYXA 4K8ZA 2CNAA 3JATA 1BZKA 5T5PA 1AR92 2BOIA 4XC9A 3RN4A 5GONB 4X64O 3ZFGC 4CDUC 3SXWA 3VKMA 3N2GA 4KQ7A 4Y5TA 4X1KB 1YQ8A 4COVA 3J7AU 3LKJA 2P22C 4QDRA 1GNHA 5IDJA 5KHGA 2CTPA 1O3TA 4HNAB 1C3HA 1DQ2A 4JI5B 2YHJA 5KX5B 1YXWA 1E79G 3SEPA 2YGMA 5DABA 2R063 4TWTA 2BGOA 3OJBA 3ZMSA 2QKDA 1NCQC 1JYXA 1Q8SA 1POQA 3RSJA 1WLTA 2OQ6A 3NNMA 4OMDA 4Y1YA 4EN7B 1C5HA 2UWCA 2ZGMA 3AMNA 5JSPA 1HNXO 3ZYRA 3RZLA 2D97A 3AMQA 1B3QA 4GAZA 2LRPA 3PU3A 5FZ9A 4BPZA 1W0JG 3TBDA 4XJ8A 3UGFA 4HKOA 1HXS1 2YU2A 3J7MA 2VZPA 4U7OA 3ZS8C 2VWKA 4QKFA 5C9AB 1JYCA 4YVWB 4FBFA 4JI1O 4J11A 3ZYFA 5IWAB 1ODMA 2IXKA 4XDLA 4TV9A 1DF5A 1VMGA 4DUVA 1HB3A 2ERFA 1FJGO 3K4DA 4D0QA 5EBLC 4IXLA 1ST8A 4ZOLA 1QJY3 1N4CA 1XEQA 4YY3O 3GVMA 2HJDA 4KGQA 2EZPA 4DUYB 4CH4A 1I08A 4J9ZB 1FXVA 1XBFA 1UKGA 3VD4A 3I4IA 3L72H 2EIJB 4XUTA 4KBZA 1V6MA 3RJRA 1HQWA 4DV2O 3J7HA 1L7QA 1I0HA 3OUHA 3OOXA 4I50A 3WZ1A 1QH6A 3HN3A 1CQ9A 4BOWA 1HN1A 2BOCC 4LBQD 2EILC 2E7TA 1PZ8A 2WNVB 1F4MA 1W6QB 4IERA 1GOFA 2Q5TA 2NPIA 2XTAA 2YC4A 1WMXA 3JYCA 1PO11 3ZPYA 5FMCA 4ORFA 1SZXA 4XMAA 2OYQA 4ZONA 3CCUV 4LFCB 4MADA 1DHKB 1QGLA 3MFCA 2UUAO 2QEXV 1FPN1 2WRAA 4EZ4A 4YM0A 4MGZE 1LOAA 1FV2A 2PA7A 4MGQA 1FFXB 2DVGA 1ZRFA 3M3IA 3JATB 2P67A 1FAFA 3M3OA 4B08A 1AYM3 4YFZA 5C4WB 2AYHA 1Y9QA 4CVUA 5FY4A 5I91A 3AXEA 3LSQA 1RUC2 1RM1C 1FXKC 5FBZA 4A41A 2NN8A 4LORA 2QVSB 4FZ0A 3ZN5A 4XXPA 4FIPC 1ASJ1 3AMMA 2EALA 5DN2A 2UY8A 2J1AA 4AVSA 1OV9A 4XAEA 3I3BA 3VD9A 3VHPA 4OUSA 4OI2A 1NKDA 2CDPA 4W4ZA 2WZEA 1DU3D 1C1LA 1GWLA 2Y38A 1VEWA 3TNPB 1D4VB 3RI9A 2PY5A 3JAKA 1URFA 1JOBA 1AL22 3ZRVA 3M8LA 2ODMA 4DRRA 4H13B 2AENA 2VVEA 1GP4A 5HBAA 4QX8A 2HEVF 4HNAA 2VU9A 5KX5A 3I2GA 2QSAA 1OC1A 1XE7A 5C9AA 3POIA 1OT5A 4XQ4A 1UO9A 5L3GA 4FFKA 1NLSA 5HCBA 4UFJA 1HDKA 2BEOA 4CCOA 1JXNA 4H7LA 3WFVA 5C93A 3N7LA 4B3MB 3JUUA 4H55A 2FCUA 2W39A 4EB6B 3WDUA 4DXZA 1GO3F 1VBB3 4XFAA 2H0VA 4JGZA 3OPWA 4PLNA 1ZRRA 2Q8CA 3U0ZA 5I8YA 2AZ2A 4M3CB 4DR1B 2UUBB 2ZM6O 5IVFA 3WDYA 1F51A 2R072 1YI7A 4QKDA 1VBE1 5IE9A 1K3IA 1Z78A 4UF0B 4QPGB 3LFMA 3OTFA 3CDZB 4X89A 3E6DA 3U11A 1V6NA 4WFGA 4MW8A 1SBDA 5GTHZ 1GU3A 4OQ9A 1LU2A 2VBBA 2JECA 4COUA 3UM7A 3N9MA 3APBA 1AR81 1ENQA 2GDFA 5KXBA 5EK0A 1MEC3 5T5OA 1AJOA 2YG0A 1W9TA 3NNFA 1YZBA 1S55A 3SPJA 4ZY9A 2LFRA 3G6BA 4O2AA 4I5SA 3RYFA 3DPRB 5B1BC 2A6WA 3WB2A 2XOKG 3Q4HA 5FNVB 1RUNA 4ZOLB 1QXPA 2Q0AA 4CDQA 4UFHA 5GZEA 3Q8FA 1W3VA 2DCYA 3ASNC 4I9WA 5L19A 2WNVA 3VBBA 3HNBM 3RYCB 5CB7A 3MHZA 1FOD2 5FZLA 1LR5A 3Q9OA 5A3NA 3HKCB 2WKKA 1IVSA 4CDQC 2P90A 3LEKA 1B35B 4DV3B 1PV0A 2X5IC 2X6CA 2NP0A 2TNFA 1Z5VA 4Q4Y2 4WFAV 3W7TA 1OPMA 1TVGA 5FY0A 5LW9A 1MS1A 2J1TA 3TK1A 2ARCA 4MTXA 1J58A 2ZZQA 1H2LA 4WZCA 3E8BA 1GKBA 4EN6B 4NN0A 2Y4TA 4HN0A 5D8AC 5LL6Y 2VWJA 4ZXEA 4UXAA 4FFBB 3R4SA 3LIGA 1WN7A 4LTAA 4OLLA 2PQSA 3SEEA 2XXZA 3H01A 3RMYA 1NS1A 2CUGA 1XOYA 4YW6A 1H9PA 1PMIA 3FYEB 3A0BZ 4FSJA 5F6KA 2JX9A 4E4EA 5IYCO 1QF3A 5A6YA 1PNKA 4GLXA 5HXMA 2ZX4A 1U12A 4AHYA 4D6RA 4AQ6A 1REFA 2WS92 2IXIA 3BOPA 2ZDIA 2WLQA 1ZRCA 2F6BA 1UXZA 1PVXA 3VDCA 5JOXA 1R082 4IHJA 1PMHX 3M70A 3MGUA 5CYYA 1OA3A 2BOJA 4PA3A 3BI3A 1EYBA 3QG5A 4E4SA 4IEPA 2PHWA 3S57A 1MACA 3T2OA 4X62O 5AC93 4IEOA 1ALYA 5C8CB 4A4AA 3SH3A 3E22A 1FMD2 4JZGA 2JDYA 4YZ2A 2QTSA 4O4LB 4P9OA 1JA8A 4K7JA 3VDDB 1MPXA 4NHXA 1P49A 3ZFEC 4EJRA 3T1MA 1F8VA 4PJ0Z 4GKXA 2Y6KA 1MVQA 1CPMA 4DUZO 2GDSA 1UD1A 4QQHA 3ELNA 3TB0A 5CFDB 4E8CA 1NY71 4AILC 3ZYGA 2C6SA 2GC1A 2WYFA 5C9AC 3CC4V 4R7CA 1ZZCA 2EXHA 2ZTNA 4MGTA 4FLYA 3Q4HB 2XVGA 1GQGA 2R061 2UXDO 3U37A 1R6NA 4GT1A 3C7GA 4JI8O 5GLWA 1Z7S1 3E35A 1RGSA 1QJZA 4Q4Y1 1BHAA 3T1HO 4RGKA 1OXCA 3OPTA 1ZWIC 2XAFA 1W90A 4QQPA 2HWD3 2PHUA 1GP5A 1WBFA 2OCCB 1LKNA 4AG4A 2WNUA 1DF4A 4AI9A 4KHPO 4QE7A 2GN3A 1SLTA 1JYTA 1WWYA 3RWKX 1OHHG 3AG2C 3KGZA 1NQJA 1WAZA 2HYXA 5A3TA 3HD8B 5LA9A 5LWBA 4RS5B 1ZZBA 4LA3A 3N9PA 1M56B 2X5IB 2VNVA 3CQOA 1IG0A 1R64A 4LWSA 4O4JB 2BWAA 4NB5A 4FPJA 3CCJV 2NZ9A 5JJNB 5FYUA 3NV1A 2FB5A 3LD8A 4GUNA 3HKCA 4E2LA 1G6NA 2GBOA 5JXHA 3WNLA 4HZ3A 1XL6A 1CWPA 5I0DA 4C0BA 4UW5A 3H0OA 1EZJA 3NV2A 4DRVA 1T6GC 5KHJA 1QOOA 4CDXA 2ZX0A 4LNUA 1QMJA 3CZJA 3B09A 5BPXA 3I56V 4TWKA 4HL0A 4WVWA 3N2KB 4XFHA 4Q5OA 4OQ8A 3VLBB 3BTAA 2Q7EA 1G9BA 2FCVA 1TUBB 2RR12 3DECA 3DYMA 1QXRA 4I0AA 4YZ4A 2W52A 1NE4A 2EIEA 4LJHA 4M3CF 3WOGA 4CP1A 4AAPA 1AR4A 3W20A 2R30A 2AW9A 1EPZA 2QQOA 2J22A 5L9RA 3OF1A 3GCWA 2QKSA 2WFPA 1QCEA 2E7AA 4TQFA 3LA3A 3VZOA 4I4TA 3FJSA 3AG3C 4LH6A 1UMIA 4J25A 2D43A 5C8WA 1Q6IA 4HPKA 4F3JA 2YZ4A 4DIQA 3PU8A 2R32A 4MS2A 4CRQA 1A8DA 3UYJA 3LNMB 3QO8A 5FBJA 3LE0A 3MPPG 2JG8B 3V0AB 3G6JB 2QQLA 1IKPA 5E1RA 4X1IB 1Q56A 3F95A 3F7YC 1AXYA 3ZIWA 4YWAA 3ABMB 1AL0G 2QWNB 1R081 2XVLA 2QKCA 2XGXA 5E79Z 1AUYA 3B2EE 1WMDA 1D4M1 3I2HA 1YI9A 3ZIAG 1V54C 2VY0A 5HPOA 1OLRA 4BWAA 4WVMA 4WZFA 1XI1A 5KBFA 4HT1T 1XILA 3A22A 4XDOA 4X8AA 3ZHRA 1J3PA 3ZKYA 4Y4RA 4L2NA 3E5UA 4AWDA 2WSVA 3ZFFC 4YARA 3WHUA 1PGSA 2Y6JA 5A7SA 3V56A 1RSOB 4CDWB 5LHGA 4CZSA 1JU3A 4H2AA 4XFGA 5AVAA 2Q8DA 5SV5A 3K58A 3UT0A 5I8TA 3RZJA 2W2IA 2JVDA 1DYPA 2Y4UA 1Q86W 5EXOA 2UYAA 1YUDA 5A7QA 2PLV2 1B6QA 3WEZA 4NIIA 1W39A 3VKNA 3LFIA 4XMIA 5FZ6A 2MW2B 3POEA 2J7MA 4MO3M 2D2CB 4RS5A 5BNPC 2ZKLA 3FN9A 4JHTA 5LHHA 4OI4A 1LOFC 2FYUH 3J26N 1NBMG 3BOWA 2F1MA 1IQDC 2DYCA 3GM8A 1OFSA 4GKJB 2A3XA 1FYUA 3AJYA 2WL1A 3KHCA 1OOPB 2MPFA 5EIYB 4EKWA 4LF8B 1QHDA 3AG4B 4J6GA 2WO2A 4AVVA 3FHIB 4QDSA 3ZIXA 3O9OA 1W99A 3ZVXA 1PM9A 2VC9A 2VR4A 5A32A 2HWC2 1YF2A 5EPAA 1GICA 2W3JA 3ETQA 4LLOA 2B9ZA 2QDRA 2WLNA 3OBZA 4XTPA 2B9VA 1JQ0A 1HRI3 4XAAA 2JD4A 2YC0A 3AL6A 1OCCB 2WABA 3WNXA 5EBWC 3JD2A 2PF4E 3AKSA 3AKTA 1LHUA 1JBCA 2K46A 4CDXB 3KV6A 1RHI2 1NOVA 4P9GA 3TEYA 2P17A 1HQLA 1RUJ2 4AQTA 5KLVH 2FDGA 3R4UA 1U5XA 4KNCA 4HPKB 4FFGA 2JDNA 3ROUA 1WCUA 5J2TB 4AEDA 1ZAUA 1DGLA 4U3FH 2OT5A 2RJ2A 2ZKNA 1OMIA 1PO13 4IW3A 4S2FA 2QCSB 1AB3A 1AL23 2IH1C 1LHNA 4EN9B 3TEZA 4IIJB 4JHZA 3ZMOA 2ZX1A 1UY4A 2HWF1 1ZZ6A 1GZWA 2J1EA 5IYZB 3DV8A 4AF9A 4FOYA 4Q4Y3 1UCXA 2QDNA 2R041 4R9AA 4HKLA 2EIMB 4IV1A 2PZSA 4MVZA 1FFXA 2E5LB 2Y6FA 5CIRA 3HOBA 5DAPA 1DGWX 3WB0A 2ZIOA 5C4WA 3MW3A 3W21A 2R16A 1S3JA 3AG1C 2A06H 4QT6A 5F5CA 4B1MA 1XE8A 5EWSA 2BERA 1QR8A 4R4ZA 1IZ3A 2VBDA 4P9IA 2OS2A 3OGIB 2TEPA 5IY5C 4JYAO 4IEXA 1IDSA 1CN1A 3FX7A 3K59A 1H8VA 2FL4A 1JI6A 2ADPA 5BNNA 4CH5A 1O4ZA 4M3CE 1QDOA 4WM7A 3O1RA 1YFWA 2FZ2A 2VQAA 5DM6V 2QJ1A 1UL9A 4JQRA 5FAXA 4A2UA 1ZBA3 1HP8A 3THDA 4FK5C 2HWB1 2XG3A 4QXCA 2WPDG 1GAXA 5CMUA 4YGBA 1H9WA 4UFMA 1TE1B 4OGQB 5FIXA 2WS91 1KXGA 1LEMA 4X8NA 4LF7O 4IE0A 5D5PA 3ZX6A 2FHRA 5DAQA 4DB5A 1XYPA 4WFEA 1WKYA 4JI0B 2IXLA 2H8PC 2ZHKA 2RG4A 1BYHA 1W6MB 1QQP1 1EN4A 3QO7A 2HWB2 1WA8B 4YGCA 1K4CC 4WFHA 2YROA 4LFAB 4CP9A 1W6OA 3OUFA 1AYN1 2P06A 4FM1A 1KECA 4WV8A 5A7WA 3NKTA 1U96A 2PTMA 1K5MC 3ZKUA 3J81N 4CEWC 5EYPA 3IPVA 4UBHA 5FZEA 4W6XA 1REEA 1BK0A 3VDAA 1ZTEA 5LA6A 4FLVA 3NWKA 1DGWA 4P14A 4LO8A 1TME1 1J84A 3EBRA 1ENVA 1AR82 2F23A 5FNVA 1WCQA 1UMZA 3VBOA 5LHIA 2NLRA 2VOVA 4CEYA 2VGDA 2XH6A 5A70A 4RSUA 1H8EG 2K0GA 3CEWA 3AZYA 1G9AA 3P1IA 4YLZA 5GZFA 4K8RB 3ACLA 4Q0QA 3CJHB 4ABMA 3BTXA 1VQ4V 2LALA 4EEQA 5FO9B 2W87A 3B8NA 3LPGA 5FZ0A 2BQPA 2YSUB 3AKQA 3THTA 3JAMN 5BR8B 3N9LA 3CXCU 2WBKA 1EY2A 4MVSA 2QM4A 1Q7YW 1R3LC 3B7MA 3SYQA 1XQ8A 2VMCA 3DC6A 4QPJA 3PUSA 2PFWA 5L7OA 3K0GA 4QX1A 5JXGA 2LGWA 1BJQA 1QEXA 3MIGA 4LF9O 1EV12 1MMMA 1VMFA 3JBG1 3PMEA 4XF1A 1AR72 1VF6A 3AG1B 5C8YA 4AQSA 2ZQMA 4GKKB 4YJ3B 2WT0A 3TN93 4FPEA 1U0AA 3QO5A 1SLAA 1KITA 4K0KO 4LXLA 1TAEA 3ZSLA 1FATA 4N90A 4A42A 4BQ2A 4U36A 3VBUC 5JIAA 2E51A 4O7XA 5E8AA 3FMGA 3K5OA 2JG8C 4DV7O 5A3WA 2G9GA 1WA6X 1QY4A 4X64B 1UQXA 1FNZA 4HETA 1BKZA 4HXCA 1VBB1 1W6MA 1OA4A 1VQNV 2VQUA 3U10A 4WM7B 3M3CA 1QVGU 1RUI1 4BIUA 2WC2A 1GNYA 2W92A 2UXBB 1EAH1 5BXZA 4DR7B 2HWD2 3ZRWB 4BLIA 3NR7A 3O14A 1DP0A 2X53S 4B1LA 3RZMA 1AJPA 2RMU2 2XBO3 1FPN3 1W6PB 1AVBA 5LBBA 4JV4A 5DQ0A 4ONUA 2UUAB 2ZEXA 5CFDA 4UT5A 3ZN6A 3N9OA 3I2FA 3STZC 1DG6A 4PDVA 1N1SA 3ZJZA 1ULFA 3ATGA 2VQEO 5KUKA 2A70A 5LY2A 4B3RB 2LFSA 5KMGB 5FWEA 3CJIA 1ASJ3 5DG1A 1RUC3 4MZUA 4TN7A 1RUI3 3OYWA 5AFBA 1X33A 3KF3A 2ZXWB 4QB1A 5F5QA 2G19A 3CJHA 3KV4A 3PHMA 3CKHA 4ZBMA 4Q4V3 1K12A 2XJSA 3PVBB 2UXNA 4EQVA 3E2EA 1XSRA 2I45A 1FKAO 2KA3A 5CBLA 4YYOA 3ZXJA 4R52A 2OA2A 4BE3A 4OULA 1WLDA 2PHFA 2H94A 1VAKA 3IC9A 1CX4A 3G7DA 5BNPB 3ASOB 5LA0A 1IG3A 2H0BA 4B3NA 3ASIA 3CJXA 1MS9A 3W58A 5HV0A 2KM2A 1TVKA 1YFYA 4N9IA 4A45A 4F6EA 1MNGA 3AKPA 1R093 3R05A 1NVPD 5C8YB 1QXJA 3KVAA 3BYWA 3ZMZA 3L71H 4JTNA 2ADEA 3ME2A 5AG2A 2D7FA 4LBKA 3CMGA 1YNAA 4NXMB 1AI7A 3VD5A 2VOWA 4JI4B 1JCHA 2BVBA 2HH9A 4JGZC 4PV1B 4FTEA 3JXSA 1ZREA 2HVJC 1ZL8B 2DUPA 2ZCEA 1E1RG 3DL3A 4Y33A 2JGDA 1QJU2 3MF9A 4JI5O 1Q3EA 4I7ZB 3VN4A 3P30A 4K6BA 1BBT3 3K4AA 3OUSA 4ZHNA 1QDCA 2VMIA 4N7IA 1I5XA 1LJ7A 4CUGA 4OHWA 2FCTA 2ZHMA 1PZ9A 4DW1A 4JCKA 2UU9O 1I94O 4URTA 2OTLV 2J1SA 3AG7A 3HN1A 3WUDA 3BU7A 2OWOA 3NRUA 2CAUA 2JEUA 1UY1A 3E97A 2W0FC 1NQDA 2ATKC 4LEJA 2ZACA 4O2BA 3C2UA 5EZYA 4N43B 3H3UA 1SEFA 4XJWA 3OPZA 1OSGA 3HJRA 1UN1A 1AI5A 2ZXWC 5H2FZ 4PI0A 2A6VA 2ETEA 4EWDA 4Q4X2 4J7JA 3R4DB 4XFBA 4AI1A 3PUAA 5IK5A 2IFRA 4AEDC 5J96B 1E5IA 1BQPA 3I54A 3GB7C 5B4NA 2RQ6A 2WLKA 1BBT1 4LUMA 3ABMC 4JQTA 1NJIW 1M57B 4G2KA 5KHKA 3WR0A 2OCHA 4M0NA 4UAPA 5K4LA 2BJSA 3HKDA 2PAMA 2JG9A 3ZXGA 2BRTA 4AGVA 3OMIB 5H9SA 5IFPA 3V65A 4KBBA 2ZM6B 1B06A 4DV5O 1DTOA 2PHXA 4PDRA 3ZXFA 3WHTA 1LESA 4PT6A 1PNGA 3KVBA 5BV6A 4IEQA 2QUOA 3UT5B 3SC7X 3H8OA 2BU9A 1Y4MA 3VUOA 4BIOA 3RYRA 4AI8A 5FZHA 4CDQB 1AP5A 5J9PC 1YITV 2O1QA 3CP1A 1F31A 1QH7A 1AILA 3OYWB 5FYCA 4FTBA 2OCCC 1RTVA 2YMZA 4AAXA 3UQ8A 2JXAA 1NR7A 3C8XA 4OHZA 3VZKA 4QWNA 2DCTA 2IXHA 2EZOA 4WM8A 2WWJA 4C90A 3NJVA 5K1PA 2ZAAA 1SA0B 2HHHO 1N33O 3AZXA 3G4SV 1T2XA 3B01A 5KA5A 4JI3O 3SJQC 3BODA 5F37A 4XPVA 3AK1A 4O61A 5F3EA 1KJLA 2QWQB 1GFF2 3O0WA 2EILB 5LOVB 1UU4A 3E6BA 1K3EA 5JSRA 1VBE3 2E74B 1RUD1 4RQFA 2NNUA 1EPWA 4IE6A 4DV0B 2DCKA 3POJA 2AZ5A 4D94A 3OR6C 3DGTA 1MS4A 5FZCA 1ULOA 2OVUA 3EO6A 1JX9A 1O5UA 1SQ4A 5GZDA 2ETNA 4LHKA 4FLXA 4K3AA 2Z2SB 4Q4W3 4E4HA 1MS3A 4FPOB 5CB4A 4LKDA 2WFF3 4MGKE 4N43A 1J1LA 2WNUC 4ZZ8A 5JZGC 3WVJA 4IV1B 3IDAA 1F15A 2CDOA 1IBLB 2EXKA 2WNVC 4YW7A 3NJXA 2XQXA 4E8DA 5F1RA 3BTYA 2G38A 3L9JT 3SITA 3CCVV 1AI4A 1LOBA 4JI7O 4GULA 3WNPA 5IAVA 1CAWA 1RVF1 5G05L 1PX4A 1DLLA 3ZSKA 3ON7A 4NTWA 5DZGA 3H1MA 2AC1A 4QX5A 3HKDB 2YEVB 1Y9MA 1SDDB 1RVF3 1POV0 2ZT9B 2ES3A 3H7YA 3M2MA 2B7YA 2JE8A 1F7YA 1WMEA 4LF5O 2E7QA 4TV9B 2CTQA 3IIAA 5FXVA 2X8KA 5CAZA 3LCPA 1VP6A 4CZZA 2WLIB 2YFZA 3LA2A 1CAVA 3O1OA 1K33A 4MXVA 3ABKC 5FYSA 5T50A 3HB3B 3OUJA 2VMGA 4H33A 5DZEA 4FAHA 3EXAA 2Z42A 2BV4A 1OLQA 3NXSA 2GV9A 4QHZA 3OW2U 5J7MA 3J8F3 1FPN2 1VIBA 3PLQA 1BE3H 1Z5WA 1AR63 1KFXL 3MDPA 1OURA 1W8UA 3THCA 3KM5A 2BBAA 2AGAA 3VKFC 2XUMA 2JJ1G 2P3KA 3MHSC 4CCJA 1M9NA 2K9PA 1X9PA 4I50B 1PHMA 5L3BA 3BUCA 2M7WA 3ZMTA 4K8XA 1FFTB 1W6OB 1W2NA 3JAWA 4BH9A 2ZNIA 3RI8A 1OH4A 1NY72 3D82A 1P4RA 4KU7A 5JH7A 4NOTA 2ZDIC 1MZFA 5LK5A 3MI8A 1VBD2 3TXSA 5L3CA 3ABLC 2Q4SA 1IS5A 5K0UA 3FHQA 2MHFA 2MEV1 2Q1MA 3CRAA 1AYM1 2QQKA 1CZTA 3POGA 2NLJC 3TN91 1PGL1 4JGYB 3GCXA 3CXHF 1JZ6A 1S0GA 5LYJB 2PYJA 1NUKA 3LIHA 4QPGC 4RN5A 4XBFA 1YTFD 3FBMA 3HVDA 1B35C 4XURA 1W3XA 1RXGA 4UCOA 2DVAA 3WXPA 2P5BA 3PTYA 4WFFA 1YQ6A 4JRLA 2N04A 4UCSA 4ZKTB 3BEHA 4O4HB 1H6YA 1QLNA 5FO7B 2FBEA 4JVAA 5JPNB 1XMQB 2Y0PA 4ZS3A 4GH4B 4S2DA 3IAPA 1M93A 1AR5A 5FZMA 5EV7A 5LBQA 5BNOA 4EFEA 2ZX3A 2JB8A 4XXAA 5IFTA 3URFA 3D36C 4K1YA 5FXWA 4BXFA 4UFZA 1W8ZA 2VMHA 4BQXA 1W03A 5L7OB 1NE6A 4LR4A 1NT0A 2WZR1 4DFSA 1D0GA 2C26A 1SMVA 2XNDG 4LBQB 2ZINA 3FB8C 1H2SB 1RPRA 2YIBA 1RJ7A 3WD5A 2WLJA 4O9EA 3GGLA 4YZ1A 4A6SA 2M6YA 4BQ3A 4UV9A 2V5YA 3MW4A 2Z3YA 2DVDA 5L3DA 1K92A 1E1QG 1UZYA 1Z2GA 4Y22A 4HFSA 5LP6C 1CAWB 4JI8B 3K5NA 1C8NA 4M3CA 3NW4A 4KL1A 4FZ1A 3MHHC 1MR5A 1K5MA 3CSXA 4QPGA 5C8CC 1SRYA 2YEVA 3PJYA 1VAMA 4J7ZA 1EV13 4GQ7A 3MDSA 3UO2A 2YI9A 1RUG2 2ID4A 3DXUA 4GD4A 3U4SA 5ITZA 2K9ZA 2JK5C 1NVPB 1V55B 3S5AA 2DN9A 4MGYE 1CAVB 1CJPA 1HXS2 5FYVA 3FX3A 4LBNA 2QM8A 3WP5A 1XOUA 4LO7A 3BABA 3WSOA 3UGGA 3N9NA 4KWJA 2DWDC 2RV9A 1YVWA 1HIXA 2QE3A 1TEIA 4UFKA 3ILNA 5LRRA 2X09A 2DQ3A 4J7KA 1UOBA 4NE9A 3HPLC 2XAQA 4GX5A 1W6PA 3MEPA 2GMMA 4OI0A 3M1HA 5FLHA 1N36O 2GMEA 2ZNJA 5JVDA 5A3PA 1H8TB 2KB1A 3U1XA 4PF5A 4IGGA 2AGSA 3KS7A 1OCOC 4IGOA 2CWSA 2Y8KA 4NROA 2E6VA 1M5IA 3T0AA 1QJX1 2Z4FA 5FYHA 4XF4A 1O3SA 2J1UA 4XDJA 4FOWA 1CP9A 5FCCA 2FMDA 1GYKA 1Y43B 2W9XA 1K9MW 4EWAA 3S30A 1TME2 4RGGA 2IU3A 1WJZA 1G9CA 3UV9A 2GP3A 2F4VO 1RYYA 1WLCA 3AB0A 5C3QA 3AMPA 2N05A 2HKOA 1W59A 2EIGA 4K3UA 3FBYA 4D6QA 4K8FA 3B9IA 3X2QB 5BNOB 1YLLA 3BVOA 2LQTA 2HWE2 4RFT0 1G86A 4EZHA 1XUQA 1WW4A 3SYAA 2UWBA 3ST7A 1IURA 3EMRA 5E89A 4IIJA 2EXIA 3OBAA 3O1SA 1B09A 4IGPA 2A75A 1NYWA 3ZBHA 3VZLA 2HFEC 1SLBA 2EX3A 2ZGSA 4AW7A 5CG9A 5G04L 3BKZA 2A9HA 4LHNA 5E88A 1I9RA 3OBTA 3N27A 2NQYA 3AM2A 2ARAA 3ALQA 5CA0A 1V6IA 5BY1A 3BN6A 3D3IA 3P32A 3ZXLA 5EIBD 2W95A 3L74H 1SPPA 2XUEA 5I8SA 1I5ZA 4O4LA 5CNAA 1F4NA 2VZ3A 2WINB 2TBVA 3N2GB 4CC6A 1JOJA 3CRRA 1RUD3 5GLTA 4YG3A 4FPCA 1K5MB 4CUAA 2CV6A 3FAVB 5FPVA 3MUY1 5BY5A 4YW1A 2YICA 3P6BA 4NKGB 1OZ0A 1UPIA 4P00B 2R1BA 4Q6GA 5FDBA 4YNIA 3O5SA 1Q6UA 1UNBA 5ITZB 4GXLA 2VZQA 1MEC2 1GQPA 1OHFA 5B1OA 3EXUA 3FL7A 2JIZG 2ADDA 3MLJA 2ZABA 3EQEA 1D7PM 5A7PA 1C8M2 3WG2A 1W2UA 1XMOB 4D3WA 2Y69C 4D6SA 3ZOIA 4IUGA 3T1CA 1S2KA 4NTYA 2L9LA 5L9BA 4BM8A 3IAQA 3HBZA 2Y6LA 1CAXA 1ENXA 1OOPC 1UX6A 4PI2A 1OKOA 2PHDA 3SMHA 1LAJA 3ABUA 3IM0A 3ZXDA 5JMCA 1RVF2 4DO0A 4XIOA 1EP0A 3ZEDA 1V6LA 4RUFA 2Y26A 1VJ2A 2GTAA 1VF6C 5GZGA 4MV2A 2ZKOA 4LF7B 4TXWA 4TLFA 2R9IA 4LWSB 5KR7A 1WNSA 4YRDA 3S7IA 3OG2A 1RUD2 1W2OA 3W9AA 1ACCA 1ONAA 3ECQA 3WF2A 1A6CA 5A7WB 1VBC2 1FYJA 4P9YA 1S0FA 4CCDA 3CD6V 3WDXA 4X65B 3ETPA 1R1A3 1G9FA 3AK0A 2EULA 3IDBB 4NHKA 4PDWC 5LCWL 2EICA 3ZLIA 5LA6B 4JASA 4MW3A 2V1DA 5BMVA 3VBOB 2GNMA 3WQ7A 1NCRA 1VF7A 2B42B 2VQFB 4J41A 4AYUA 3RZGA 2VVFA 1PIV2 1T6BX 4LKSA 1JYWA 3K9SA 2JDKA 2OUJA 1W6NB 1YIFA 4CC5A 1POV1 3I55V 4C8DA 2R6QA 1K5JA 4C91A 4NAMA 3JZVA 4YW3A 3MYXA 4RGAA 2VXJA 4UBGA 1NLQA 2P6CA 4N21A 4JPRA 4HLTA 3UJQA 1OD5A 1RUG1 4FPHA 2G4IA 4BLJA 1H2KA 4Q0PA 4ASMB 3DXTA 2GH8A 5FUIA 4TSFG 1UZWA 4UCRA 1PK6C 1U5YA 1R3JC 5CBFA 3MLKA 5DAXA 4Z1MG 2J42A 5FZOB 4RWUA 1YRZA 5AC92 3UJOA 1JZ3A 1S2EA 2PLV1 5H6RA 1OVSA 3WP6A 1OLME 2ZIMA 2QNKA 4UFIA 3ZXAC 4DY3A 2DURA 2D3PA 1AX1A 2BSKA 5HCAA 4KG0A 3DKQA 5F3GA 3TN92 1PGL2 5FLXN 4FMTA 4HVOA 4X6RB 2P3YA 2GUZB 4AOCA 5FZKA 5C6CA 4CDWA 4XIKA 5KAIZ 5KWRA 2GU9A 1XQNA 2UXCO 2QTWB 4BQWA 1ENRA 2VULA 3H9VA 2P6JA 2Q1FA 3TAYA 5EZWA 1CR7A 4DV2B 1KEXA 4Y24A 5D2AA 3VBRA 4BCUA 5FY8A 1MS8A 4UFLA 5LA1A 2GSYA 5ACA1 5A7NA 2UXXA 4N9HA 4O65A 3JCUZ 4EB6A 1KBHA 4GX2A 1BEV1 3WX5A 4I2OA 2RCVA 4QPIA 3TWIA 3B94A 4FOVA 1CONA 1POV3 1GM7A 5A6XA 1DK1A 1HW5A 3ACFA 4BDVB 2CAZC 2XASA 1RM1B 2GN7A 2YBSA 4XFCA 1SLLA 3ZFFB 1UOFA 5FP9A 4GYCB 4COYA 3OUIA 1N0JA 2JDHA 1QLEB 4Z82A 1OOPA 4BW9A 3WNNA 1JHNA 2LROA 2YU1A 1ND3C 2IUWA 2BP6A 4P9LA 3ORJA 3JASB 3RYFB 4NXMO 2QR4A 3DPRA 1DDLA 4UXNA 2C9AA 2WUHA 4CU6A 4QX2A 1I6XA 5KMGA 4JZ2A 1J3RA 1JN2P 1W0NA 1QIQA 3IKWA 1CAUB 4DW0A 4FPFA 1VQ6V 3LNNA 1HNXB 2R042 1QNYA 5KHHA 1W6NA 4Q2FA 2X6BA 2A79B 1AL21 1LUWA 4XQDA 3A7QA 4AEJA 1JPXA 3SCFA 5LASA 2AHZA 4UCUA 3KMHA 1WGPA 1YJWV 1NI8A 3NJZA 3X29B 5J98B 3C7EA 2VD7A 3T1LA 3FB7C 5J37A 3IZOA 5DUVA 1UIJA 2Q8VA 4X66O 2Z5WA 1K45A 3JD1A 4P5HA 4KHPB 3E5QA 1W9FA 5LRSA 2WZ8A 5FO8B 4QPIC 1KQSU 1OVPA 5AFEA 4R9CA 4XJZA 1N1VA 2GH2A 3IMMA 2RS31 2A7AA 2IZWA 2LS6A 2HBTA 1SERA 3OSDA 4DR1O 2UUBO 2GC0A 1JJ2U 1H38A 4MT8A 3ABKB 3VDDC 4OHVA 1JZ4A 4AFCA 4TSVA 1KGYA 5LA2A 1W8HA 3CCMV 1ZUQA 2D6OX 4IQPA 1RUE2 5FRAA 3B9CA 4FXKB 4CCCA 1BCXA 2ZR2A 1Q8QA 5DN6G 3CPWU 3PIJA 3AP7A 4UUJC 3AZZA 1ZZ9A 3CNAA 4AEMA 5EJ3A 3MD0A 5LXTA 3UNPA 3FYIB 3AP4A 4NIGA