4D86A

Human parp14 (artd8, bal2) - macro domains 1 and 2 in complex with adenosine-5-diphosphate
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
401
structure length
374
Chain Sequence
KCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSLLEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITESLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Recognition of Mono-ADP-Ribosylated ARTD10 Substrates by ARTD8 Macrodomains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Poly [ADP-ribose] polymerase 14
total genus 137
structure length 374
sequence length 401
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4d86A02
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 4d86A01
4TU0A 1TY8A 4JVVA 2XD7A 3EWPA 3GQEA 2FAVA 2L8RA 3JRUA 3VFQA 5CB5A 5E3BA 2ACFA 5CBMA 2FG1A 1SPVA 2BFQA 2DX6A 1ZR3A 4JGKA 2X47A 5HIHA 1LAMA 1HJZA 5D8NA 5FSZA 3KQXA 4KSIA 1LCPA 4X2TA 5FSUA 2J9AA 3GPOA 4GVWA 4J5QA 3GQOA 3SIIA 4J5SA 4ABKA 2FXKA 3Q6ZA 3ETIA 4D86A 4R76A 4ZX8A 3GPQA 4GVVA 3IIDA 3IIFA 3SIJA 3EJFA 5FSVA 4ETJA 4GUAA 3EWOA 3Q71A 4ZY1A 4KYBA 3SIHA 3GPGA 3EW5A 4ETKA 3EWQA 3JZTA 4IQYA 3EJGA 5FSXA 3EKEA 3PEIA 3KR4A 4ESSA 4K3NA 5DUSA 4J5RA 1BPMA 4J4ZA 5FSYA 5HOLA 2EEEA 4ZI6A 3H8EA 1BLLE 1VHUA 3V2BA 1YD9A 3KR5A 2AFCA 1LAPA 3KQZA 1TXZA 4ZX9A 5CMSA 3T8WA 5AILA 2BFRA 4R7MA 4UMLA 4K0CA 3KZWA 3IJ3A 1LANA 4ZY0A 4JLLA 3H8FA 2LGRA 5CB3A 1NJRA 2EWBA 4ZY2A 1ZR5A 3V45A 4R6TA 3EWRA 3H8GA 3SIGA 4JCAA 1GYTA 1BPNA 4ABLA 2VRIA 4ZYQA
chains in the Genus database with same CATH superfamily
4TU0A 1TY8A 4JVVA 2XD7A 3EWPA 3GQEA 2FAVA 2L8RA 2JZEA 3JRUA 3VFQA 5CB5A 5E3BA 2ACFA 5CBMA 2FG1A 1SPVA 2BFQA 2DX6A 2WCTA 1ZR3A 4JGKA 2X47A 5HIHA 1LAMA 1HJZA 5D8NA 5FSZA 3KQXA 4KSIA 1LCPA 4X2TA 5FSUA 2J9AA 3GPOA 4GVWA 4J5QA 3GQOA 3SIIA 4J5SA 4ABKA 2FXKA 3Q6ZA 3ETIA 4D86A 4R76A 4ZX8A 3GPQA 4GVVA 3IIDA 3IIFA 3SIJA 3EJFA 5FSVA 4ETJA 4GUAA 3EWOA 3Q71A 4ZY1A 4KYBA 3SIHA 2KQVA 3GPGA 3EW5A 4ETKA 2RNKA 3EWQA 3JZTA 4IQYA 3EJGA 5FSXA 3EKEA 3PEIA 3KR4A 4ESSA 4K3NA 5DUSA 4J5RA 1BPMA 4J4ZA 5FSYA 5HOLA 2EEEA 4ZI6A 3H8EA 1BLLE 1VHUA 3V2BA 1YD9A 3KR5A 2AFCA 1LAPA 3KQZA 1TXZA 4ZX9A 5CMSA 3T8WA 5AILA 2BFRA 4R7MA 4UMLA 2JZFA 4K0CA 3KZWA 3IJ3A 1LANA 4ZY0A 2W2GA 4JLLA 3H8FA 2LGRA 5CB3A 1NJRA 2EWBA 4ZY2A 1ZR5A 3V45A 4R6TA 2JZDA 3EWRA 3H8GA 3SIGA 4JCAA 1GYTA 1BPNA 4ABLA 2VRIA 4ZYQA
chains in the Genus database with same CATH topology
4TU0A 1TY8A 4JVVA 2XD7A 3EWPA 3GQEA 2FAVA 2L8RA 3JRUA 3VFQA 5CB5A 5E3BA 2ACFA 5CBMA 2FG1A 1SPVA 2BFQA 2DX6A 1ZR3A 4JGKA 2X47A 5HIHA 1LAMA 1HJZA 5D8NA 5FSZA 3KQXA 4KSIA 1LCPA 4X2TA 5FSUA 2J9AA 3GPOA 4GVWA 4J5QA 3GQOA 3SIIA 4J5SA 4ABKA 2FXKA 3Q6ZA 3ETIA 4D86A 4R76A 4ZX8A 3GPQA 4GVVA 3IIDA 3IIFA 3SIJA 3EJFA 5FSVA 4ETJA 4GUAA 3EWOA 3Q71A 4ZY1A 4KYBA 3SIHA 3GPGA 3EW5A 4ETKA 3EWQA 3JZTA 4IQYA 3EJGA 5FSXA 3EKEA 3PEIA 3KR4A 4ESSA 4K3NA 5DUSA 4J5RA 1BPMA 4J4ZA 5FSYA 5HOLA 2EEEA 4ZI6A 3H8EA 1BLLE 1VHUA 3V2BA 1YD9A 3KR5A 2AFCA 1LAPA 3KQZA 1TXZA 4ZX9A 5CMSA 3T8WA 5AILA 2BFRA 4R7MA 4UMLA 4K0CA 3KZWA 3IJ3A 1LANA 4ZY0A 4JLLA 3H8FA 2LGRA 5CB3A 1NJRA 2EWBA 4ZY2A 1ZR5A 3V45A 4R6TA 3EWRA 3H8GA 3SIGA 4JCAA 1GYTA 1BPNA 4ABLA 2VRIA 4ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TU0 A;  1TY8 A;  4JVV A;  2XD7 A;  3EWP A;  3GQE A;  2FAV A;  2L8R A;  3JRU A;  3VFQ A;  5CB5 A;  5E3B A;  2ACF A;  5CBM A;  2FG1 A;  1SPV A;  2BFQ A;  2DX6 A;  1ZR3 A;  4JGK A;  2X47 A;  5HIH A;  1LAM A;  1HJZ A;  5D8N A;  5FSZ A;  3KQX A;  4KSI A;  1LCP A;  4X2T A;  5FSU A;  2J9A A;  3GPO A;  4GVW A;  4J5Q A;  3GQO A;  3SII A;  4J5S A;  4ABK A;  2FXK A;  3Q6Z A;  3ETI A;  4D86 A;  4R76 A;  4ZX8 A;  3GPQ A;  4GVV A;  3IID A;  3IIF A;  3SIJ A;  3EJF A;  5FSV A;  4ETJ A;  4GUA A;  3EWO A;  3Q71 A;  4ZY1 A;  4KYB A;  3SIH A;  3GPG A;  3EW5 A;  4ETK A;  3EWQ A;  3JZT A;  4IQY A;  3EJG A;  5FSX A;  3EKE A;  3PEI A;  3KR4 A;  4ESS A;  4K3N A;  5DUS A;  4J5R A;  1BPM A;  4J4Z A;  5FSY A;  5HOL A;  2EEE A;  4ZI6 A;  3H8E A;  1BLL E;  1VHU A;  3V2B A;  1YD9 A;  3KR5 A;  2AFC A;  1LAP A;  3KQZ A;  1TXZ A;  4ZX9 A;  5CMS A;  3T8W A;  5AIL A;  2BFR A;  4R7M A;  4UML A;  4K0C A;  3KZW A;  3IJ3 A;  1LAN A;  4ZY0 A;  4JLL A;  3H8F A;  2LGR A;  5CB3 A;  1NJR A;  2EWB A;  4ZY2 A;  1ZR5 A;  3V45 A;  4R6T A;  3EWR A;  3H8G A;  3SIG A;  4JCA A;  1GYT A;  1BPN A;  4ABL A;  2VRI A;  4ZYQ A; 
#chains in the Genus database with same CATH topology
 4TU0 A;  1TY8 A;  4JVV A;  2XD7 A;  3EWP A;  3GQE A;  2FAV A;  2L8R A;  2JZE A;  3JRU A;  3VFQ A;  5CB5 A;  5E3B A;  2ACF A;  5CBM A;  2FG1 A;  1SPV A;  2BFQ A;  2DX6 A;  2WCT A;  1ZR3 A;  4JGK A;  2X47 A;  5HIH A;  1LAM A;  1HJZ A;  5D8N A;  5FSZ A;  3KQX A;  4KSI A;  1LCP A;  4X2T A;  5FSU A;  2J9A A;  3GPO A;  4GVW A;  4J5Q A;  3GQO A;  3SII A;  4J5S A;  4ABK A;  2FXK A;  3Q6Z A;  3ETI A;  4D86 A;  4R76 A;  4ZX8 A;  3GPQ A;  4GVV A;  3IID A;  3IIF A;  3SIJ A;  3EJF A;  5FSV A;  4ETJ A;  4GUA A;  3EWO A;  3Q71 A;  4ZY1 A;  4KYB A;  3SIH A;  2KQV A;  3GPG A;  3EW5 A;  4ETK A;  2RNK A;  3EWQ A;  3JZT A;  4IQY A;  3EJG A;  5FSX A;  3EKE A;  3PEI A;  3KR4 A;  4ESS A;  4K3N A;  5DUS A;  4J5R A;  1BPM A;  4J4Z A;  5FSY A;  5HOL A;  2EEE A;  4ZI6 A;  3H8E A;  1BLL E;  1VHU A;  3V2B A;  1YD9 A;  3KR5 A;  2AFC A;  1LAP A;  3KQZ A;  1TXZ A;  4ZX9 A;  5CMS A;  3T8W A;  5AIL A;  2BFR A;  4R7M A;  4UML A;  2JZF A;  4K0C A;  3KZW A;  3IJ3 A;  1LAN A;  4ZY0 A;  2W2G A;  4JLL A;  3H8F A;  2LGR A;  5CB3 A;  1NJR A;  2EWB A;  4ZY2 A;  1ZR5 A;  3V45 A;  4R6T A;  2JZD A;  3EWR A;  3H8G A;  3SIG A;  4JCA A;  1GYT A;  1BPN A;  4ABL A;  2VRI A;  4ZYQ A; 
#chains in the Genus database with same CATH homology
 4TU0 A;  1TY8 A;  4JVV A;  2XD7 A;  3EWP A;  3GQE A;  2FAV A;  2L8R A;  3JRU A;  3VFQ A;  5CB5 A;  5E3B A;  2ACF A;  5CBM A;  2FG1 A;  1SPV A;  2BFQ A;  2DX6 A;  1ZR3 A;  4JGK A;  2X47 A;  5HIH A;  1LAM A;  1HJZ A;  5D8N A;  5FSZ A;  3KQX A;  4KSI A;  1LCP A;  4X2T A;  5FSU A;  2J9A A;  3GPO A;  4GVW A;  4J5Q A;  3GQO A;  3SII A;  4J5S A;  4ABK A;  2FXK A;  3Q6Z A;  3ETI A;  4D86 A;  4R76 A;  4ZX8 A;  3GPQ A;  4GVV A;  3IID A;  3IIF A;  3SIJ A;  3EJF A;  5FSV A;  4ETJ A;  4GUA A;  3EWO A;  3Q71 A;  4ZY1 A;  4KYB A;  3SIH A;  3GPG A;  3EW5 A;  4ETK A;  3EWQ A;  3JZT A;  4IQY A;  3EJG A;  5FSX A;  3EKE A;  3PEI A;  3KR4 A;  4ESS A;  4K3N A;  5DUS A;  4J5R A;  1BPM A;  4J4Z A;  5FSY A;  5HOL A;  2EEE A;  4ZI6 A;  3H8E A;  1BLL E;  1VHU A;  3V2B A;  1YD9 A;  3KR5 A;  2AFC A;  1LAP A;  3KQZ A;  1TXZ A;  4ZX9 A;  5CMS A;  3T8W A;  5AIL A;  2BFR A;  4R7M A;  4UML A;  4K0C A;  3KZW A;  3IJ3 A;  1LAN A;  4ZY0 A;  4JLL A;  3H8F A;  2LGR A;  5CB3 A;  1NJR A;  2EWB A;  4ZY2 A;  1ZR5 A;  3V45 A;  4R6T A;  3EWR A;  3H8G A;  3SIG A;  4JCA A;  1GYT A;  1BPN A;  4ABL A;  2VRI A;  4ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...