4D8AA

Crystal structure of b. anthracis dhps with compound 21
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
263
Chain Sequence
b'KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structure-Based Design of Novel Pyrimido[4,5-c]pyridazine Derivatives as Dihydropteroate Synthase Inhibitors with Increased Affinity.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 263
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4d8aA00
1TX0A 2YCKX 3TYDA 3BOLA 4DAIA 2H9AA 1TWWA 4DJFA 1AD1A 4DAFA 2Y5SA 3H23A 4DJED 4D8AA 4S3FA 4HB7A 3H2EA 4S3CA 1TWSA 1EYEA 2E7FA 4DJDA 2YCIX 4D8ZA 1Q85A 2VP8A 4DB7A 3H24A 3H22A 4NILA 3NOYA 2YCLB 3H21A 4S3AA 4NIRA 2BMBA 3TYCA 3H2MA 3TZFA 1TX2A 1AD4A 2Y5JA 1TWZA 3TYUA 4NL1A 3BOFA 4S3EA 1Q7QA 4O1FA 3H2CA 2H9AB 1AJ2A 1Q8AA 3TYBA 4DJDC 4DJEA 4MWAC 1AJ0A 4S39A 3H2OA 4S38A 3H2FA 1Q7MA 4C1NB 2VEFA 4MWAB 4NHVA 2VEGA 3MCMA 1AJZA 3TYAA 4DJFC 2DZAA 2YCLA 3H2AA 3MCOA 4S3DA 4D9PA 5JQ9A 2Y0FA 1F6YA 4CCZA 4DJEC 3TYEA 3H2NA 4O0QA 3MCNA 4PZVA 4DJDD 4S3BA 2DZBA 4MWAD 3TZNA 2YCJA 4O1EA 4G9PA 3K13A 1Q7ZA 3V5OA 4C1NA 3H26A 1Q8JA 4MWAA 3TYZA 2DQWA 4DJFD 3TR9A 4S23A 2OGYA 4MWAE
chains in the Genus database with same CATH superfamily
4LC8A 1RA5A 3IPWA 1OFOA 5DY2A 2PE4A 3ME3A 5F2GA 2ZX9A 1KBIA 3LENA 2GK1A 1K77A 3W24A 1RP9A 3ZR4A 3UCCA 3NEVA 3VMOA 4I9AA 2DQXA 4IGHA 3HOJA 5CZKA 1DJNA 2ZZ2A 2Y7FA 4UQCA 4UTUA 4CD5A 2R1KA 4G1NA 3VNLA 1R3TA 3A3HA 2IUZA 1LQ0A 3QMRA 3SUWA 3TYUA 2UBPC 3IEBA 2EKGA 4C6DA 4XAYA 2OKTA 1E1FA 1GOMA 1FHDA 6ALDA 5EB8A 1O7AA 3H53A 4KGLA 3CZKA 4DXVA 2YJQA 1WUEA 1TMQA 4DI8A 2CLFA 2YKKA 3CZEA 3W23A 2WBGA 2ADAA 3PZOA 4A8RA 4AC7C 1B3XA 2VWTA 2P8CA 1TVNA 5HMSA 1X7FA 2YR1A 4UCGA 2J7HA 3DHPA 3U4FA 3UJSA 3MCNA 4GG9A 4H2CA 2VC5A 2I5QA 2KX9A 3REQB 3TSMA 4ROPA 4Z2KA 4Q4PA 3PSVA 3RNDA 1FH8A 2HVMA 3WBXA 5FA5A 1Q5MA 1W17A 3TP4A 2J78A 3ARYA 3SCSA 1PIIA 1T0OA 1U30A 4YTTA 3H70A 3CHCA 2FVLA 2YXXA 2BODX 1PYFA 1TWWA 4N6FA 4IPIA 4ZXLA 5CZTA 5A5WA 3DKJA 3GR4A 4B16A 4JS3A 1EYEA 3Q2DA 3AS2A 4QTGA 1OK4A 3H7RA 4C6FA 1YTEA 5FJOA 3JU2A 2XHYA 1MUCA 2JGQA 3ARXA 3UY8A 3M5YA 3CIWA 1AW1A 1MZHA 3BW3A 1X6UA 4GOAA 4A2SA 1NDWA 3U0HA 4NF7A 4O8RA 1ML1A 3E0IA 1E3ZA 1UZ4A 3POCA 2E5CA 3L5LA 1XBZA 3WQWA 3OZYA 2CLIA 4PH6A 4X0VA 4LB3A 1I9CB 1TR9A 2E28A 4P5UA 1Y7VA 4QSHA 2QF7A 1P5BA 3IAPA 4C91A 3WJSA 4WKAA 3S2LA 3R8GA 1ENUA 1R2TA 4DJEC 3WF1A 4CU8A 4Q4QA 1DWGM 2FZNA 3W74A 1ZP4A 2DU2A 2VVSA 5I24A 4FLSA 3OLGA 3VFLA 1CGXA 3WUFA 5GJMA 4O13A 3VMNA 2NXHA 1QPQA 1OT1A 5EMJA 1E40A 4E2OA 2FHBA 2NQ9A 3BLDA 1XYAA 4PTVA 2GQ3A 3N2XA 5FACA 4PRWA 4EF9A 1PO9A 4QE1A 2QPUA 3JVAA 2DSWA 1V3LA 2VI0A 3ITXA 2FH6A 3V0UA 5CLWA 1J18A 1S3HA 4Z2IA 4OGZA 2RKXA 3TK7A 3QFWA 4ZCWA 4NYUA 1HVXA 3RJYA 2ZX5A 1SGJA 2EG8A 1PXGA 1Q7QA 3W1AA 4XSMA 4NXKA 3TU9A 1NP0A 1DHKA 3ZIZA 2VO5A 1Z89A 4F79A 3CUZA 3B8VA 3H2OA 3R1ZA 5FEWA 4UZSA 2X0YA 2OX1A 3E38A 4K38A 1TPB1 2D3NA 5A6JA 3E02A 2RGMA 4LF1A 4H8UA 2WHKA 3A4WA 1R85A 2BXVA 3GXIA 3V36A 2QDEA 2R14A 1V4YA 2INEA 1SW3A 5EY5A 2ZA3A 4AEEA 4ZQOA 2DY3A 5LIWX 3KTXA 3DEQA 3VUPA 1XR2A 4D71A 3ONCA 1DQUA 2GVYA 3EWCA 3OVGA 1FWRA 4FLQA 4B5TA 1F3XA 3ABXA 1H4PA 2PLMA 4US5D 1TJPA 1UH4A 1DTUA 5LXEA 4RDWA 3RK8A 1HFBA 3RU8X 2CHNA 4WOZA 4GVIA 2CBJA 4RK8A 4RPPA 4IMDA 1QW8A 3TXZA 2QAPA 1EGMA 1LWJA 4PTXA 3QR1A 5CEWA 3M4HA 2E25A 5EBAA 3S5ZA 3FJLA 1JQXA 1ADOA 1PDZA 4KCTA 3CEUA 3KLKA 5XIMA 1PBGA 3IJ7A 4JR5A 4GYJA 2WMGA 3H4GA 4KESA 3MUZ1 1J12A 1W8SA 5F4WA 1TRDA 3FY1A 3AMGA 5C55A 1ZP3A 3H2CA 3EDJA 1PZ3A 5HWJA 2NT1A 2PA6A 2YW3A 3N3TA 2WWCA 1I2RA 4W8AA 1XPGA 2J6VA 4W7VA 5AC5A 2OFJA 2FPVA 1E6XM 1W5NA 5LNSA 2GVEA 3GY1A 4P8UA 5AC6A 3PHAA 3NNTA 4BS0A 1WKDA 1J0ZA 1NM9A 4XTDA 4M0XA 2GSEA 4G6CA 3CT7A 1CXLA 1W31A 4WF7A 1HO1A 3AZTA 1HKMA 3EBVA 2X2GA 4Q8UA 3RM4A 1DXEA 3T07A 4PB5A 1LL4A 1LLOA 4QLKA 2YL9A 4EANA 4RZ6A 2W92A 1H5VA 3NSMA 1HGYA 4O53A 2QCFA 4JAWA 4C5YA 3EX2A 1JZ3A 4QG9A 4TTGA 2C8NA 2NX9A 3B8TA 2JKPA 4WKHA 4UOZA 3O1NA 1B3OA 3WDHA 4L65A 5KSWA 2BMBA 3QHOA 4H4IA 4OBRA 4FS9A 4I5UA 2DSVA 4PMXA 3APTA 1FWHC 2PPGA 3N9RA 1XLGA 3TNBA 1W5PA 3O15A 4DO7A 3GUWA 4IFKB 3GXTA 3W22A 1RP8A 1UZ1A 2D0HA 1G4SA 2F6KA 1QW7A 1XC6A 4U10A 2R91A 5LIYX 2QMKA 3AZRA 2VEKA 1J2WA 1Q3NA 2OQHA 1OFPA 2QJGA 2XN0A 3RPTA 3CGTA 1ZJIA 3M0YA 2ZUTA 4C65A 3VNJA 1UH3A 1MXSA 3SCVA 2EJ1A 3UJEA 1HKWA 3P60A 2DP3A 1UP2A 2J77A 4IM4A 2WHMA 3KVLA 3NZPA 2W61A 1FX6A 1O68A 4L4MA 2DSZA 2QUVA 1HL8A 3KHDA 1XCFA 3S2JA 2VGIA 5EMUA 1DXIA 1QNPA 4WX2A 3TDFA 1V6UA 5HK4A 4H1ZA 2HE8A 4Q7NA 1MQPA 4IFKA 4CD8A 3TYDA 3URQA 2R94A 3V5FA 1E1CA 1F3TA 2XGBA 1IEWA 1LG2A 1NARA 3M5VA 4UFHA 1S2VA 4ZSTA 2DJLA 1G0CA 4M7SA 1J8VA 4Q8TA 1GJUA 1W3JA 3R0DA 1H50A 3SY5A 4YCOA 1TVPA 2VKZG 4PMUA 3TCEA 2O9PA 4H6EA 2ESCA 1IXNA 4Q8MA 3PM6A 4FLRA 3PJUA 1XD1A 3L23A 2XSBA 3U5YA 3ZMRA 1WO2A 3HJEA 3TCSA 3N2OA 3KBSA 4QDPA 3S1UA 5FF3A 4HNLA 4A3HA 4PMZA 1E9LA 3DDMA 1XGDA 4IJRA 3RGTA 4MADA 3B4YA 1TIMA 3M0MA 1W3KA 3PJXA 4P8XA 4Z17A 1MMFA 2MNRA 3OIHA 1EA0A 3H2AA 1GCYA 4K1WA 4C60A 3PY2A 2VXNA 3NL2A 1F3WA 1FH9A 2CLOA 1JCNA 3JR2A 3TC3A 3PFMA 4HNOA 2VURA 1YYAA 4BWLC 1GQJA 3G2GA 3VXGA 1XLDA 1RLCL 3RO6A 4RV3A 1TE6A 2WMHA 1ZALA 4H9XA 4AD1A 3W37A 4NU7A 4MF4A 1CCWB 4KBXA 3N25A 3U4AA 2EPHA 1EF3A 3GNPA 3BO9A 1GUVA 1H62A 4S3AA 3GTIA 5K7JA 3GNOA 3SRHA 2PF8A 4UOJA 5T8GA 3S4TA 4DNHA 3LXAA 1POJA 3SCQA 4HSNA 5G5IA 4IXHA 1Z48A 1FXPA 3EXSA 3MBFA 4D72A 4WY0B 3OO2A 3RF9A 3VIFA 3W0KA 5A1AA 2CZDA 4QGCA 3QC0A 2FB2A 1VPQA 4Z1YA 3TV8A 4XX6A 4FAMA 3B40A 8A3HA 3KCOA 3SBFA 3GDRA 1XLBA 5HQLA 2ZRYA 1IZJA 4CNOA 4WJXA 2L5HA 1C8YA 2W67A 3MS8A 5CC3A 3WH9A 4R7OA 1EOKA 3M6DA 2E09A 4D1JA 2WZHA 4DY1A 1QVBA 3U3HA 5D9OA 1HIZA 1VC4A 3WLTA 5ENLA 3RG6A 1LOSA 4DJDD 2WW5A 1RBOB 1EEXA 1XLHA 1WNOA 4O50A 1KFEA 1E6SM 1IEXA 1V3MA 2UY4A 3K13A 4HPHA 3RLGA 2Q8XA 2WSQA 3L0NA 1NWTA 1V8EA 1UWTA 1VHNA 4HTYA 2FFCA 5LHFA 4KCWA 4RW5A 4QEHA 5IRPA 3EWWA 1LQAA 4DF0A 4DPQA 1EJVC 2ZYFA 8RUCA 4ICMA 1CB7B 3R43A 1AL7A 4RX0A 5IHSA 3W88A 4MKVA 2RHGA 4GLEA 2V3DA 3IJ9A 2P8BA 2VQUA 1IYXA 5LIUX 1IEVA 1CXFA 3F2CA 4QBXA 1QFEA 1XP3A 4AIOA 3IGHX 3W2LA 3QPZA 2PDLA 3OW1A 4WCJA 3E96A 2AL2B 3WNNA 2IKGA 2BXZA 3L5MA 2XIMA 3QEZA 1FFQA 4HCDA 1KBKA 1NFBA 4MZ1A 5FSEC 4JIEA 2D0FA 2HPMA 3ZT6A 2GPTA 4H00A 1NQ6A 2P1FA 3NXFA 1FCBA 2VFIA 3UZZA 1H7OA 4WGXA 3QQ0A 1RUSA 2QR6A 2WNQA 4S2CA 2E5DA 4HBKA 3N19B 4LV9A 4DYJA 4K7VA 4QJ1A 3KBVA 4W5ZA 3BDKA 3W2MA 3MI2A 4TR9A 4Q8WA 3CV1A 4YXGA 1RQEA 3ANYA 3ZYZA 2PDKA 3TJLA 3SW6A 4MWAE 4B3LA 3E74A 4GZ7A 4HA1A 2ZC1A 5AYXA 4DAIA 3B9EA 5CJ5A 1CTNA 4U31A 1ZUAX 3BTNA 3USZA 2C1GA 1VS1A 2ZA1A 1W56A 5I3IA 4NJJA 1ISXA 3KOFA 3TH6A 5BYWA 3WYZA 4ILSA 3ORWA 1WA3A 1I6NA 1J5SA 1V79A 1VR6A 4EVZA 3EPMA 1KBJA 4GIEA 1BVNP 4JEQA 1W5MA 1Q6DA 3SSZA 2B4GA 2DPEA 2ZX8A 1KNWA 4C6MA 4NAFA 5ECUA 4AHPA 4GNKB 2GJNA 3LMYA 1YE6A 2ISSA 3Q4DA 4GC4A 3GIPA 4XUYA 4P8VA 4RCXA 1SZNA 4KIEA 1XSKA 3GXFA 3CIXA 3H7VA 1WDSA 2WLZA 1JI1A 1XSIA 4ONVA 3BLFA 3UFYA 3WEOA 4B91A 3N2CA 3B8IA 2CKSA 2VUNA 3W2UA 2RJHA 3TJ4A 4L5ZA 3F4CA 3W7EA 1UD6A 5AHMA 4O8AA 3VCRA 4Z1DA 4L6OA 3TTQA 4XUGA 5BMWA 1PKMA 1DIOA 3LTPA 1LJYA 1EJUC 3A5FA 1JAKA 4GQGA 3ELFA 1CDGA 1UB3A 3WLRA 3RN6A 4AWSA 3FLUA 3R58A 1W91A 4WHBA 7CGTA 3TJXA 1VBUA 1W3HA 2J47A 1AD1A 3LS9A 4HCLA 1P4CA 2GQ9A 3UG8A 1DJZA 2Y4SA 1YEYA 2WANA 4A3QA 2BTMA 1TV3A 4KWVA 2YCLB 3WNMA 3NZ1A 1K9TA 5L9FA 3FVDA 4LQ1A 3UXLA 1QWGA 4ML9A 3AIBA 1FXQA 1NDVA 1E43A 1J11A 5J5DA 3M0JA 1LOLA 2H9AB 4CQAA 1IR2A 1ITXA 1HGWA 3CZGA 3PNUA 2ZXBA 2OVLA 2QLYA 1EXBA 3R79A 1VJZA 3A12A 4KWUA 3LZ5A 3EWXA 3HQPA 2W0UA 3WNKA 1US0A 4FNTA 5DANA 1TR1A 3EB2A 2J7CA 1I2NA 1H7XA 1Z41A 3M16A 1E4LA 1RPKA 5CH9A 1JDEA 4FK9A 1IXPA 3TNOA 2E67A 2VDIA 3LCWA 1YDYA 4O12A 1V7AA 3H2NA 3W4RA 4ZR8A 4FR6A 3EWZA 4A6GA 5I3JA 3GG8A 2DZBA 2GZXA 1TPEA 3DFTA 2E9BA 3MMWA 5M17A 2NSXA 2R24A 3VNMA 2QCGA 3BLIA 3O3RA 3W83A 4GJ1A 4KWOA 1R3YA 5HPOA 2QDDA 2PS2A 1PKNA 2DSUA 2H9AA 5CPLA 1SM9A 1N8FA 5DCDA 4JCLA 1XLEA 4TMBA 1ZGDA 3IUIA 2OKOA 2NV2A 3H22A 2BGQA 3WBYA 3W70A 1W1A1 2PWFA 1TUXA 3BV4A 5D05A 3NIYA 3H2MA 6CGTA 1Y5VA 1CXIA 1JCXA 1QASA 3OB8A 1JG9A 2MANA 3DC0A 2J9XA 4O1FA 3AZSA 5LKYA 3NPWA 1P6CA 2XYLA 4JTAA 3M47A 4XAZA 5E70A 8CGTA 5KZDA 1XLLA 4EWJA 1I2QA 1TJ2A 1R0MA 4JDBA 3QJAA 5A2CA 5PTDA 1S2WA 1W9XA 4OWGA 4O11A 3T2PA 3NDZA 1H41A 4PL2A 2QZRA 3OGSA 1FWBC 1GOOA 1JDCA 3R8RA 5DT7A 5HINA 3SRDA 3UP8A 2GL5A 2QCMA 3QY8A 4JDYA 5C7HA 2WPGA 1US3A 1F5ZA 3M07A 4CCZA 4CD7A 1J6OA 1U5VA 2B7QA 3W1PA 5CAHA 4BZYA 4LXFA 4O0QA 5TAOA 1T41A 1LCOA 3RR4A 4EX4A 1A5NC 3FVMA 4J3UA 4K8EA 3K30A 3TJIA 2FKPA 1YBQB 2OQYA 1V93A 5IHRA 2NV1A 2H3BA 1Q6FA 1SYTA 3KOWA 4NX0A 2WPBA 1BQGA 4I9TA 1ICQA 3NTYA 2XGZA 3VOFA 4WSKA 3HGSA 3L65A 1I1WA 3BLOA 1JPIA 3WEMA 7ODCA 4HKPA 3KHJA 2NV9A 3WQ8A 4UUIA 4ZE4A 4Q6JA 3GM8A 4ATWA 1TPUA 4E8GA 2P3ZA 1TTQA 5CZ0A 4OBTA 4NJKA 2VC7A 4DWSA 2GSHA 3ARZA 4H6RA 3DI0A 4NNBA 1SUXA 5EGRA 3PB0A 4L64A 4H6QA 1R3WA 4DBUA 5FSDC 4HYRA 3B97A 3GNNA 5DX7A 2GVGA 4BQ2A 4RXFA 3LU2A 1UKQA 3IJIA 3NQEA 4N4QA 4R85A 4C7GA 4AMAA 2VL4A 3VILA 4DIAA 4O28A 5LIKX 1UC4A 3LPOA 3O05A 1GT8A 1A0DA 3ABQA 2W91A 3HV9A 4GHRA 1KFBA 2IPJA 2I5GA 3QFEA 2VOTA 3LLDA 1VFLA 3CL8A 3OPSA 5ABTA 3W73A 4LS2A 2FGLA 4QFUA 3L4WA 2PWVA 3CNYA 4B5XA 2QJHA 4GX9A 1IQ8A 3N4EA 2I5IA 4E2VA 1S2CA 2V38A 3L2IA 3PPFA 1F4AA 3GU9A 3CLMA 1RVGA 3NQVA 1SQ7A 3TQPA 1WDRA 1XGZA 1K8YA 4R9OA 4GISA 3BJFA 2R82A 3A13A 4Z08A 1XYMA 4MLRA 2DQWA 1JULA 1A0CA 4JQAA 3THQA 4C6OA 4V15A 3TN6A 3F5KA 2SFPA 4AD2A 1OG6A 2REQB 3DERA 3Q67A 2JIEA 2VZOA 4JXCA 3PFRA 4RE4A 1F4HA 4JNYA 1RPXA 4OVXA 3TMLA 4O1CA 1UG6A 5D4YA 2DT3A 2C16A 2WCAA 3RCYA 4KEZA 1VFSA 1L6FA 1NDYA 5E0FA 2XVGA 1DYSA 4AD5A 3PUGA 4Z2HA 1V5XA 1AZ1A 4FXRA 4DJEA 1LT7A 5LA2A 4JTTA 3LV5A 2WZEA 3MJYA 2V5LA 3CMFA 3KDOA 3A4JA 5G4HC 2Y24A 5LA0A 4IQJA 1L0PA 2PZNA 1OM0A 1PV8A 4UQAA 5GNXA 2VELA 1AW5A 3UJ2A 1D2KA 4A4AA 1MRAA 4D1IA 4NUWA 1O1HA 4FX7A 1KM2A 3M7WA 4FXJA 1C9WA 1XXXA 1TZ9A 3RM8A 4FMVA 3U9IA 3S3GA 4HSOA 4RUBA 3UXKA 4CN4A 1ZRQA 4KFNA 2RFGA 2V5JA 2EKCA 2ZX7A 5DFAA 4AZ5A 2QULA 2FPYA 1Z42A 2G37A 2XWDA 3T8QA 1SSDA 3BWWA 1KXQA 3AJ7A 4C5ZA 4W85A 3RX2A 4BCEA 4PMJA 3W2NA 1H11A 5A6BA 5SWUA 2WMKA 3GDTA 3P7YA 1XM3A 1I0BA 3T0BA 1FRBA 3V0TA 3IK2A 2VX4A 4OUEA 3KZPA 1EC7A 4TX9A 3S2NA 2GJPA 4CEUC 1AVAA 3M0KA 4NNCA 1UD5A 2J4GA 3F4NA 3N6JA 5F7UA 3OZMA 2B31A 3SJ3A 1Q6QA 3BXWA 2XFFA 5C6MA 4UTLA 2NSOA 2WM1A 4Q8QA 1D8WA 2D73A 4HU4A 1IWBA 1KCZA 3IVUA 3OLDA 1LM1A 2YL8A 2F38A 3K8KA 1XFCA 5BWFA 5DMYA 2ISFA 3VAVA 4PCNA 3RRXA 3KL5A 3NAVA 5JH2A 4AZ7A 4N0RA 1BYBA 2GDVA 5KEZA 3VX1A 3ARRA 1TJRA 4W87A 2Y7EA 2P88A 4PUNA 4GYPC 3AU2A 1KRMA 3BCJA 3SR7A 2F2HA 4HNVA 4MMWA 3T78A 5I3KA 1KKOA 4AISA 1SJCA 1DJHA 3CBWA 1G9HA 4Y9AA 3M0VA 5BNKA 2P10A 1A0EA 2HK0A 2G3JA 3OODA 5HANA 4DUVA 3BG9A 2YW4A 3GG0A 1FWWA 2PDMA 4GD0A 2TRSA 3PNZA 3LXCA 3T40A 5HMEA 1EJXC 4IZGA 4V28A 4OOZA 4PBGA 1KLYA 2PFHA 3G6LA 3B8SA 5DCBA 3PPGA 5CPQA 2X1IA 2GGHA 1AUSL 4ML4A 4LUTB 4AEOA 4TQTA 4Y90A 5IM51 4ADUA 5C9XA 2NQLA 3NQ8A 3SIZA 1PX8A 2BVTA 4PUEA 4EWND 2VHLA 3QPEA 2CETA 4X61A 3VKDA 5LNWA 5KMYA 2NUYA 3L0KA 3PN8A 1ZJHA 3WLJA 4ZB0A 4NJHA 3TUUA 1J0KA 3VKJA 4JGDA 3SQLA 1YPFA 1XKYA 2D1ZA 1YW1A 3GTHA 3AQUA 1EEPA 3CUGA 3PG9A 4MHBA 3RMJA 3AIWA 1Y5WA 4U3CA 1H0IA 3GH7A 3GB6A 3R0UA 3FN9A 4LPCA 1PHWA 3QTPA 3PG8A 1T99A 5FJTA 5ABGA 5IDIA 1QU4A 3D46A 3BMWA 4BF9A 3HU7A 4LWWA 2CYGA 1GVSA 3VNKA 4MNKA 4EPBC 2FJUB 5J8LA 2WSKA 3ZJKA 4ZGYA 5CCZA 1DJWA 3PULA 1E9IA 4B5NA 1WDDA 1FP8A 5RUBA 1FTXA 4YPJA 1L8NA 1B5TA 4LS0A 4XTIA 2EAWA 3H12A 4UTTC 3I10A 3WQCA 2ZVRA 4XZ9A 2YZRA 4XD5A 4FIQA 1ZJBA 2DGAA 1PTDA 3PZ9A 3WQVA 3WF4A 5CGQA 1J9YA 4AW7A 1QAPA 4MWAA 1UA3A 4GH1A 4O4VA 5M03A 1UQYA 3MO4A 5T91A 1LTDA 3ZJ7A 1GONA 3MMUA 1EJ7L 1AA1B 3N1AA 2DH2A 2YSWA 2FH8A 3MP5A 4HB7A 2O9RA 2X1TA 3PZIA 3PZMA 3QH2A 3S8HA 1FDJA 4BEQA 1XQLA 5DQPA 1FDYA 1H60A 3B0PA 5I06A 1AD4A 1UASA 3UA4A 2JEQA 5AC7A 4HZ7A 3BMXA 4G8TA 3GHTA 2XSXA 2WNNA 2DZTA 3AYTA 3A64A 1B30A 1O95A 5C54A 4Z1CA 3VD7A 4A8LA 2PC4A 4HD5A 4DO4A 2WQPA 3CH9A 3G18A 1RJQA 2V82A 3FKRA 1W6TA 3MCMA 4DM1A 1U22A 1VB9A 3FJ6A 1SZEA 3QV8A 4ACZB 3D5HA 1GGOA 3C2YA 4MYXA 3A21A 3VGFA 2W62A 3UW6A 5BROA 1KO0A 1K3UA 2BOEX 3TAKA 2PBOA 1KQYA 1LL7A 2YBTA 3GC4A 2DZWA 1HKJA 2E68A 4NYYA 4UFKA 2FGZA 1QI4A 4PUUA 1W1PA 1LQ2A 4XZLX 9XIMA 1R2SA 4Q4OA 4HA4A 4HHLA 5LGXA 2WMIB 4JTEA 4XD6A 3VIGA 1GYNA 3L4ZA 2P0IA 2PGEA 3W1NA 1CW2A 4DQWA 1POKA 1EIBA 5EPDA 1JYXA 3A9BA 3BMVA 2ACRA 1GPFA 4AC1X 2QV4A 4ES4A 3QXBA 2RGLA 4UC5A 4LW7A 1K7XA 2D0GA 4LANA 2BP1A 3KOXA 3MW7A 3R11A 3NM1A 4IHCA 2VP8A 1QPRA 1GOKA 2PWDA 1YTKA 1ISZA 1MZRA 2Q02A 3DYPA 3V5CA 4LNYA 1MQQA 4UWMA 4M24A 5CPMA 4MM1A 1SMDA 2WJFA 3PWGA 2Q8LA 3PUDA 1ONWA 1DV7A 1XIMA 3CQ0A 1MYRA 1JXKA 4KEVA 3O0KA 3GBEA 1EDTA 1KA9F 1JGMA 4MZ8A 3LQLA 1MEWA 2YLAA 4DNMA 3MSGA 3W7GA 3O16A 1VFFA 1E73M 3C0JA 4RE0A 1X98A 3HPZA 5A8QA 1C9DA 4K39A 4WR3A 1VRXA 3U2ZA 2Z2BA 3C56A 4J3ZA 1T96A 4AYGA 1E6QM 4UQEA 3LHTA 3OU8A 2ZADA 2TODA 1VCVA 3EZ4A 4LCSA 5KETA 4RKAA 5AZ0A 5DCEA 4JHZA 1N82A 2ZX6A 3ZQ9A 4DUOA 1VEPA 3DFQA 4NI8A 3ZOAA 3IIXA 1DTNA 4QAIA 1SJAA 2J24A 1DJIA 4JTJA 1E15A 4OFCA 3KW3A 3NDOA 5C2XA 4F2BA 1P7TB 1E72M 4IJBA 1CNVA 3ANVA 3E0VA 5HAOA 4GYFA 3S5SA 1EP2A 3MU7A 2QDHA 1IEQA 4TO8A 3T09A 4P61A 1XRFA 3MI3A 3VOGA 1V6VA 3M1ZA 1QRQA 3G1FA 3RPDA 3HV8A 2GJXA 3KVKA 1VIWA 5I6SA 1P0DA 1LORA 3LOTA 3MHUA 1RCOB 3WCZA 5AC4A 3FA3A 1KD0A 2P0OA 3VIPA 2Y2WA 5CLTA 5U4NA 1J93A 2BOGX 2EJAA 5HQMA 1T5AA 5G2HA 4EXQA 2BXYA 5E9XA 2Z29A 3IGSA 4CLMA 2J9ZA 3V1HA 1THFD 1GHRA 2BBFA 3T2OA 3UWWA 1NSJA 5IOBA 3W82A 3RPMA 3GDBA 4LALA 3PAOA 1P7TA 1U2YA 3DU0A 5BZAA 6ENLA 4JQ2A 2I9EA 2ZTKA 4J2MA 4R88A 3HIJA 4BQ4A 3QGKC 3G5EA 3TSBA 2NUXA 4HZ8A 3UD6A 4AIUA 1EKOA 4DF2A 3AMLA 4N9DA 4PFMA 3V1PA 3ZT5A 5FAJA 3T08A 3UNTA 1JCYA 3FJ4A 1EJSC 3GH4A 1YKWA 1V02E 2TMDA 3WH5A 2JGYA 3VCNA 3G1VA 2HNHA 4IPJA 1RHCA 2HE5A 4GA8A 1W9VA 2R1PA 2DIKA 1BVWA 5D02A 1DWIM 1R6WA 4LVDA 1F9CA 1RH9A 5ABFB 4JTRA 3IANA 4MY1A 5AHIA 3W07A 3CAQA 2Z7KA 3CS2A 3PUEA 3LHYA 3N4AA 3URNA 4Q7IA 4FEZA 2INFA 4IPNB 3LCLA 1A53A 5A6TC 4AIBA 2OLHA 3PWAA 1FWTA 3O6YX 1DJXA 1LRTA 2HROA 4MDPA 1EF2A 1JL8A 3RUBL 2VC9A 4NZ1A 4D6EA 1XBXA 4DJDC 5M3WA 3A5VA 3BLKA 1JCTA 3CTTA 1Q6GA 1YDVA 1GVEA 4GXMA 5HUPA 1F73A 2HVNA 2Z4GA 1OFEA 3LYEA 3V75A 3WD2A 1DP0A 2BSLA 1A5SA 1GOQA 1BF2A 2I7GA 4H9UA 4W4QA 2QMJA 3T81A 4BJHA 4HPNA 3E3HA 1TVLA 2E6AA 5BXSA 1KM1A 3CQJA 5A2AA 5E1QA 3TLLA 1XIGA 1TQXA 3R2GA 1ZCCA 7TIMA 2QNEA 2OEJA 4XAGA 3V5OA 2BS9A 3AFBA 3R94A 5FEPA 3EMQA 1XIEA 1VBGA 4OJYA 4I3GA 4MPQA 1AK5A 3BL3A 2PDUA 4F40A 1R8LA 1WQ5A 2V3FA 6REQB 4Z2LA 2Y5SA 4ERIA 5D09A 1CGVA 1W1IE 1V6WA 1QPNA 1VCFA 5AHLA 3CYJA 2J75A 3VFCA 3GW3A 1GVQA 4I7WA 3GNXA 2VX6A 3WNOA 5JXQA 3IJ8A 4JNMA 3AOFA 1RSCA 2FHCA 3SRFA 3VIJA 5AY7A 4PUMA 1UIPA 3N15A 3M44A 5BU6A 4LYRA 2NQ5A 4FB7A 1XRSA 2OZ8A 4N4PA 4DUXA 1W54A 3BLPX 5EYWA 1GVOA 4G56A 5JH1A 3PZQA 3C2OA 4M19A 2CZFA 3IJLA 1XDLA 1TQJA 3TTEA 3E2VA 3BSHA 3R6IA 2J7EA 1EQCA 2HV5A 3TN3A 3LX9A 5CPOA 2ZRWA 4JTQA 1M1BA 4XBKA 3ALFA 2PGRA 4GO9A 4OUIA 1EYWA 4GVFA 3A9IA 3F7JA 5IDZA 2A3CA 4AD0A 1EGVA 4TTUA 1QNSA 1WKEA 4UTHA 2P76A 3LUTA 1R46A 2VTFA 4MY8A 2NW0A 3TQ0A 5CQ1A 3WF2A 5JIWA 3VZXA 2QJIA 4JD4A 2BVYA 3WQGA 2Z1SA 4O1BA 3QW3A 1NOWA 1BXNA 2YCJA 1FVPA 3AALA 4C1NA 1R7OA 1HN1A 3VD4A 4X2PA 2O9TA 2YCEA 1FQ0A 3W25A 3ZLHA 3CAKA 4E2BA 3FS2A 2J13A 1TCDA 4J1OA 2I17A 4YVVA 4QROA 5MKGB 2QUTA 5GQBA 3HPFA 4IGSA 3CIVA 5A6AA 4TVCA 3WLPA 2BLEA 4K36A 4DX3A 4AZIA 3GFZA 1RK5A 4QISA 1SJBA 3KRSA 3BANA 3NYDA 3VC5A 1MNSA 1MFUA 5FESA 3WBWA 3DX5A 5A8OA 5HQEA 3ABOA 1U5JA 2PD5A 4C6QA 1BWKA 4AY7A 4GQQA 4GI9A 5HATA 4AWEA 1US2A 4I9MA 5I07A 3E6EA 1HJVA 5D38A 4RW3A 3NQ7A 1PIGA 4FF5A 3VZZA 4N42A 5FD0A 1M9HA 2ACQA 4Q8OA 1EO5A 1EFZA 1R3SA 3LCFA 1F61A 4CVUA 4W89A 2Y70A 5F4XA 3PJWA 3VDAA 2AGTA 5MKGA 5GJPA 1JUBA 2E9LA 2XIBA 4JICA 3LV6A 4ERGA 4J35A 1K70A 4XD3A 5D30A 1TMHA 3LI1A 5D9MA 4YCPA 4IL0A 1B9ZA 1GG1A 1W32A 1NJJA 3OG2A 4JPGA 3EDDA 1BTMA 5HA7A 3GFXA 4X60A 4Y7EA 4IIBA 2CW6A 2X30A 1SVDA 2CZEA 3KAOA 4KWSA 1AMKA 3MKVA 2P50A 3NQBA 4IUOA 4NI3A 4ZFCA 4JIPA 1P1XA 1OINA 4XQ6A 1PUDA 2Z25A 1A50A 2WV8A 2F6XA 5CSSA 3FOKA 2P3EA 1FCQA 3HGOA 4NRRA 4XO7A 2PF0A 5CBIA 4PC8A 3W1RA 1QTWA 1GWJA 2Q8ZA 4HPJA 1XIHA 1KTBA 2VFGA 4D6GA 3G0XA 2VNCA 1DE6A 1OIFA 3NXLA 4FA3A 2Y85A 5A6KA 4PCFA 1LOQA 3NSXA 4OBSA 1PEZA 4B15A 1A5MC 4FO4A 4LVBA 2ZOXA 1ECEA 5CKSA 2Q09A 3DFPA 4Y8EA 1EUNA 4R9XA 3MUCA 4UMBA 2ZUVA 2VFFA 1LZOA 4O14A 1D7KA 2VCAA 1EDGA 4S2BA 3S46A 2GVJA 4ICCX 1RJPA 2W3ZA 2A6NA 2VX7A 2PTWA 3MY9A 4W5UA 3W6MA 1H51A 1E56A 2YFNA 2WM0A 1DJQA 3ICJA 3XISA 3M6YA 1NOUA 3S0CA 2J88A 3P74A 1OGSA 1SW0A 3O8AA 3W1UA 1OCBA 1UWSA 5IBXA 2G3FA 3LM7A 1JZ4A 3HPAA 1BVZA 1E6ZA 3GVQA 1KGWA 4FOJA 2XN2A 2D2OA 3MMDA 3TTSA 3T55A 2ZZ5A 2A85A 2WZMA 4C6NA 4S3FA 4CQ9A 2VD9A 1TELA 3ERPA 4E8DA 3WLSA 2QXWA 5I78A 1PIFA 3FHQA 3N04A 4R33A 3W7LA 3W2KA 1E4NA 4YIWA 3MA8A 4ZENA 1RQBA 1AQMA 3NZRA 1XBVA 4UQDA 1A4MA 4C6CA 1M5WA 1X39A 3AO0A 4Z1BA 3WD1A 5C5YA 4P7QA 5DMNA 4D6FA 2VT0A 3M5XA 2QCLA 4B3KA 1XLAA 3EYPA 1WP6A 4AUBA 1GZ1A 1WCGA 4XVDA 1ISYA 4TV5A 3VC6A 4XAFA 3BK0A 4HHHA 1V3JA 1TCMA 4I5RA 3ZJ6A 3FEMA 1V6YA 4IP4A 3WQEA 1L6YA 4QHRA 3GE7A 3LHWA 2UZ9A 4GGBA 3VGEA 4BI5A 4V1XA 1Q6RA 3LRKA 1BD0A 2CXEA 4B5SA 1JPDX 1KFJA 4NNAA 5D2XA 4ICNA 4LVFA 2OCZA 1ITUA 1KCXA 3KCJA 1EJWC 1YE4A 3G3DA 3RIKA 3DN5A 1V3IA 4GY1A 4J4KA 4JTIA 1UR2A 3S6OA 1CXEA 3GXNA 1OFRA 5IFTA 5I3DA 3A3WA 4LFYA 4UFIA 3VTRA 1UWIA 3VK5A 4L6DA 4ASTA 3LD5A 1M03A 2A0NA 3OJGA 1SFSA 3FK4A 1P0KA 4PA8A 4ZTXA 3WDQA 4NILA 3PTMA 3QOKA 4WDUA 3DHDA 2Y7DA 3SJNA 1EJTC 1IWPA 2ZTJA 3KS6A 4OV4A 5JIPA 5K3VA 4TX6A 3SUVA 2BHUA 1EZ2A 3PPCA 1NAL1 1SO4A 3MZNA 4N6EA 2WJEA 1OX6A 4PMYA 4DI9A 1I4NA 1RY0A 2PTXA 2A5HA 1JNEA 1B9BA 3TA9A 5AKQA 3W02A 2ZWYA 3DG3A 3WJWA 1HF6A 1GQIA 3QMTA 2V81A 9XIAA 4IOTA 2OGJA 3S83A 1JXJA 4H7ZA 4QE5A 3LCGA 2Y0FA 1JPMA 1GVYA 4KEUA 5KITA 2XIIA 4PUDA 3QR3A 5CXPA 1F74A 4DLFA 1CYGA 2WB5A 3TQKA 3AHZA 4N9BA 1FFRA 3OVPA 2HNEA 2O4QA 1O94A 4YVXA 3T1GA 5CZJA 5B7YA 2G96A 2PTYA 4YVPA 3C3UA 2IKJA 1BYDA 3TR9A 3GXPA 4WRHA 4NJIA 1PX4A 4F0HA 4RJEA 2ZUNA 4B5UA 2Y62A 3DFOA 1X7IA 1RR2A 1J96A 3MB9A 4A22A 1PAMA 4KFOA 4L9ZA 2DZXA 3KX6A 1TSIA 4LEQA 1UMLA 4LVGA 4GBDA 2C6QA 3EPOA 2A2IA 3ZJ8A 4QAWA 1ELSA 1E4MM 3F2DA 2WMFA 1M6JA 4MG4A 3W00A 1KM4A 3B03A 1G5AA 4GYPA 4HZ6A 1PKLA 1UP0A 1WXJA 3VOCA 1GEQA 2FB3A 4Q8VA 1JCJA 3IJ6A 4K8GA 1BTCA 3LNMA 5DMMA 4LGXA 3QGVA 1UBPC 4PMQA 4D6HA 3TOPA 1F6YA 3BSGA 1UKPA 3USBA 1IWAA 4M6PA 1HKVA 3K4WA 3GZAA 1TPFA 3BC9A 4QQUA 4F66A 3W7DA 3QLLA 3IJQA 4AY8A 4PTNA 2CLLA 4F0MA 3ABSA 1MRQA 1G69A 4NAEA 1J4EA 3JW7A 2WSYA 3GU1A 4PTWA 2D3LA 4HNTA 3HN3A 4QE4A 3E12A 3U48A 3GTXA 4DBDA 2FQIA 1SO5A 1HJXA 3WBEA 4IMAA 2OWWA 4JN7A 1O5RA 4WDXA 4KF1A 2X1SA 3VDGA 2IQ0A 4CCCA 4JIRA 1KFCA 3XINA 2OYMA 1MEIA 2WZTA 1V77A 2ZICA 3QV7A 1AFSA 3QN3A 1GTEA 3WQPA 5FJIA 1AW2A 1QNRA 2GGIA 2ZBTA 1IIGA 3BE7A 2VM8A 4UR9A 4GJIA 2W79A 1XKJA 3ITLA 3ONBA 3QVQA 4LCRA 3O7UA 2YB1A 2Z1XA 1M7XA 1IHIA 1J5TA 3SO7A 3ZLGA 1CX9A 3ISIX 1C90A 3ZR6A 3HG2A 3G8EA 2AAAA 2XUCA 5HWMA 4U5KA 4QDWA 1RQHA 3APYA 7XIMA 4MFEA 2PRLA 2WKJA 4KRZA 3VZYA 2XZ7A 1DXFA 4FZIA 2J74A 2Z6IA 1XD0A 4W86A 3VNZA 4KS0A 1UWAA 1ODUA 4R34A 3O63A 2HMCA 3GUGA 3LBCA 3TMQA 3W7IA 4P2VA 3UWYA 3RMEA 5CPSA 3EXTA 2DT0A 4ZQRA 3NQAA 3LTYA 3W84A 4AD4A 1H1NA 4HP5A 4G5DA 3I7SA 3DYOA 4AVFA 3POHA 1QDSA 1ZSXA 2OWXA 3N11A 4ADTA 1HNYA 2X8RA 2E40A 3ARWA 4LSBA 1Y8BA 4TXEA 5FKYA 5FJJA 4AU0A 4DBEA 2GLKA 2CZVA 3EGJA 3FYYA 3H55A 4GUGA 3WMLA 5J04A 4MJ2A 4TVDA 3WUEA 4YNGA 2F2KA 3P5YA 5C9RA 2VRJA 4PSRA 3ZZ1A 2P5NA 5HOSA 4JL2A 4DWSD 1S5VA 1QI5A 5C2CA 1A5OC 1DOSA 3SRKA 5DEZA 5I2UA 3N3MA 4ZB5A 2VR2A 3DG7A 2BB0A 1TJ1A 4YTUA 3S9ZA 3MQTA 3QRHA 4NZ3A 4GI8A 3E0FA 5ABEA 4JHOA 2NX1A 3UQNA 3N2MA 4P7NA 1SW7A 1S1RA 5DLCA 4S3KA 5HPCA 4TVUA 5DMLA 3FYOA 4RV8A 3T4WA 2ZRXA 1UKOA 2CPUA 3S6DA 1EL3A 3CWHA 5I00A 3BCFA 4QJ5B 1K4HA 3F5JA 1R5YA 3VO0A 4B90A 3B05A 2OT1A 2EPOA 4ZO9A 1YPIA 3NSNA 3GDLA 4EXAA 3MV11 2J66A 4PRTA 4GZEA 1TTJA 1UPPA 1YNPA 3I6RA 2VRQA 2PLKA 1JPKA 2BV9A 2CWXA 3GR8A 3SCWA 4CQ8A 1QPKA 3ARVA 2E7FA 4MY9A 4M8UA 3BW2A 1N8WA 2Y7GA 1OIMA 4UNKA 2E0PA 5E5CA 3TLQA 5B7ZA 1WDQA 5FI8A 4M80A 2Y8VA 1M7OA 1O5KA 1JCLA 5REQB 3D47A 2QHAA 4Y2WA 3BOFA 3BW4A 4RXGA 1XLJA 2JF7A 3CM4A 3PBMA 3NO5A 2ZXDA 1AODA 4ZSUA 4FXSA 5A6SA 2PDCA 2PLJA 4LY4A 4LAZA 4BY3A 4H01A 4IMEA 3LB0A 4H8NA 2FTPA 3E1F1 2TAAA 3DXIA 3CC1A 4CU6A 4ECLA 2PGFA 3S9IA 2X16A 3V7PA 1C8QA 3COTA 4J3WA 3GXDA 2CC0A 3HTWA 7REQB 4GCXA 4J3XA 1J0YA 2DFAA 2JE8A 2ALRA 1UCWA 3CLWA 2FDSA 2TSYA 4GIAA 1JF5A 2GGJA 1DIDA 1QOPA 4JX5A 4G7EB 2J6XA 2XJ7A 3VD9A 4QLLA 1GW1A 3QPYA 3GHSA 4JTUA 3NQCA 3SQSA 4R3UA 2FTWA 4ATLA 1OYCA 3LGDA 3EX4A 1E9ZB 2OX4A 1SFTA 3GHUA 2CERA 3LCHA 1ZHAA 1VFOA 3CL6A 4I5XA 5A6BD 2VWSA 3PK7A 5REQA 3RHGA 4F0RA 5BXPA 8TIMA 3THDA 2QT3A 1UQZA 3WDIA 1SZFA 3RO8A 4U2ZA 3GDMA 4XV0A 3RFAA 4GNJA 2JK2A 1A5LC 1CZ1A 1J6PA 3TR2A 3REQA 5I7GA 5I23A 1C7SA 2I57A 3HPXA 4GXPA 1KCKA 3NGJA 2YXGA 1ZAHA 4C6LA 2GOUA 7REQA 3OTRA 3W3OA 7TAAA 2GJRA 1XCXA 3QC3A 3BVJA 1GHSA 1OADA 1UW9A 4G7EA 2IQDA 5HULA 4BI6A 3W29A 3CHVA 3FIGA 1MQRA 1CLVA 3NQFA 1KRCC 4MVAA 4HN8A 1BEUA 4HJFA 5XIAA 1O60A 3B8WA 1NF7A 1S38A 2W9MA 2BHZA 2V3EA 1BLIA 3IGUA 4AVNA 2UY5A 3PTQA 4AVOA 1VP5A 1A3HA 1A5UA 3GLCA 4KFPA 4S3BA 2H90A 1QXLA 2D2GA 2XH2A 1B57A 2RDWA 2ZA2A 2D2HA 2OG9A 1DWAM 4G9PA 5CPTA 1GZJA 4CUCA 3L7RA 2YPIA 1LDCA 3STCA 3E0WA 1V0MA 1Z69A 3VKCA 3C52A 4L9YA 3W1QA 1MW1A 1GK8A 4YLWA 1F8MA 3UJRA 4WJ8A 2FMOA 1M68A 4DJDA 2NQZA 1JZ6A 2G95A 4YWSA 3DIPA 4JFTA 3WH7A 2ATMA 3AJXA 4IP7A 3LPPA 4NZ4A 4GVHA 7PTDA 1AL8A 4LCQA 3CAVA 3K4AA 3E2RA 3OHMB 1RY8A 1QHOA 1W1TA 4AX7A 3MPGA 4C6BA 2BOFX 2AAMA 4ROQA 2XZ9A 1PCKA 1WOAA 4J5NA 3DG6A 2VR4A 5FJRA 3AHTA 3EMZA 4NHVA 4O15A 4NASA 3WJXA 3C2VA 5HNRA 3WF3A 2PODA 3RILA 4EF8A 3VMPA 5D9PA 1E5NA 1VFHA 4BR1A 3M46A 2CESA 2VX5A 3K1DA 4HNNA 5G1TA 1UJPA 1TFVA 1F07A 1FUYA 2DUZA 3W27A 4E8CA 1O6IA 4FNRA 2V8ZA 5AFDA 1OFDA 2YA1A 2E6YA 4FSAA 4Q4RA 4OT7A 1XLMA 5F2IA 4CN1A 2KZHA 5F2MA 4MWAD 3VGHA 1TV2A 2DZVA 3UJFA 2CXGA 5I79A 2DZPA 2Y8KA 3CHFA 3WLKX 1Z7AA 1K02A 2O4MA 1FWFC 1KC7A 4PCPA 3PBGA 3APGA 1U1UA 3UZYA 2O7SA 3WQ4A 4DJFA 2EQDA 3B9OA 2PSNA 3KBMA 4LUJA 2QJNA 4BKNA 4ZODA 3W71A 3IACA 3HQNA 4OIFA 4IPLA 2JQXA 5EMKA 4GFSA 1B3ZA 3QQWA 4F0LA 3VA8A 2GQAA 3GC2A 4DB7A 1DJGA 5H8UA 3NOYA 3SY8A 5JU6A 1PB0A 2YFOA 3HA1A 3TTOA 2DVTA 5EKYA 3N6HA 2V5BA 2DT2A 4JIQA 5DRIA 1PVNA 2PDNA 5DRCA 1XJBA 2ZC8A 3WLNA 1K1DA 3S1XA 3HG4A 2OJPA 1VHCA 2ZKMX 3FFSA 1ITQA 2C14A 4WXYA 3EWDA 3W7HA 3NOEA 1E4IA 3TYAA 1IZCA 5BRPA 1YDNA 4GPNA 2FZMA 5G1MA 1OFQA 1T7LA 4IF2A 5DN1A 4FNQA 1R7AA 3B8UA 3P93A 1EQPA 3VDCA 3RXZA 1MDRA 1PL9A 2CZ5A 1W1VA 1PSCA 3SADA 1YMYA 5D32A 2HZGA 2Z1BA 1UKTA 1UZHA 3RDKA 3TN5A 4GC3A 1HJQA 3GRIA 1R9YA 4A3UA 4Y9OA 4LY8A 3C2EA 5A69A 3LMZA 1EC8A 3FX4A 1YXDA 4KCUA 2OSYA 4JY9A 3HO8A 1UOZA 4HNUA 4QS6A 3W9ZA 1KM5A 2EPNA 3EOSA 2JFEX 2ALDA 3BAIA 5F1VA 4F0KA 1P0BA 2BZNA 1AZ2A 3BV7A 3MHFA 3WIJA 4ADSA 1UYQA 3HQOA 4CN6A 4DZIA 1E6NA 1QHPA 4M6VA 2DT1A 4M82A 1J0JA 3VOJA 4MSSA 2V9DA 1GQNA 1FWDC 5T26A 1D7FA 3EA1A 3L4VA 1C8VA 3ARPA 4K2SA 4MGGA 1J01A 1QO2A 5C0QA 3I65A 4WEVX 4O4WA 4LV4A 1PHQA 2W63A 2JKEA 3AWNA 1OZQA 4S3DA 6PTDA 1S5TA 4GIRA 2VDGA 1ONRA 4CCDA 2WNWA 3UR7A 1D8CA 1S39A 2MUCA 2NLYA 3SCUA 1F7BA 1N7KA 4MTVA 3IVSA 2IXUA 3UXDA 4B5VA 1FWJC 1A5BA 1QI2A 3AYRA 3K1GA 3UWUA 4IWWA 3AHYA 2IKIA 3E5BA 1A5CA 1VPYA 3EDEA 2WC3A 2V3GA 4XKYB 1OYBA 3LN3A 1NP2A 3VU2A 4IFOA 5EFFA 1AMYA 4DAFA 5TD4A 4K68A 1IT7A 1VGAA 2QYGA 1AH0A 2BY3A 1H7RA 4XBSA 3TWBA 5G4EA 2FGBA 4F9JA 4WY0F 2CCRA 3QGAC 4L56A 3B3DA 4Z0JA 4Z0SA 1KBBA 1IXOA 1X1ZA 1UROA 4NIRA 3WQFA 4LX4A 3TYCA 1LG1A 3S1GA 1EC9A 1OZMA 3L68A 3VDHA 2WVVB 1DVJA 1WX0A 2E3ZA 1TWZA 3L12A 3P80A 3ABRA 3V3WA 4Q4SA 2VC6A 1VYRA 2HCVA 1UMYA 3TKFA 2CLEA 3EA3A 2ZUWA 4JYDA 5G2WA 4TMCA 1AJ0A 4E0CA 1XRTA 3NQ6A 2XVLA 1JD9A 1MO0A 1UR1A 1HW6A 1RVKA 3I6EA 3UR5A 4WDWA 2DH3A 2HK1A 1VLIA 4XKYA 2GFTA 4B2DD 3AU6A 2JBMA 3MVTA 4MPKA 3IUDA 2YA2A 4O1AA 1HZYA 4HT3A 1CB2A 5A94A 5C9ZA 4TUFA 5E9AA 3QM3A 4F2UA 1LLZA 4KCVA 4LJ3A 3W75A 1KV8A 2X0SA 4O1DA 3VKAA 4OV9A 2V69A 2BX7A 2LLEA 3UVIA 2PBGA 5E0CA 3I68A 1PZ1A 4D8AA 1MDLA 5CBJA 1LP6A 3G1RA 4IICA 4HMEA 3ZT7A 2EO7A 2VOMA 1Q13A 5A2BA 5M1TA 3A23A 3R25A 4H7CA 1W9BM 3BICA 2O0TA 3MI6A 1EGZA 3MUIA 3MZ2A 3SCRA 2PD9A 4UMCA 3ZM8A 3U2EA 4S3EA 4EAYA 4ZQMA 2PDXA 5K9DA 2ZIDA 1AJ2A 3SGGA 4HQVA 3WDPP 2EPKX 3KEHA 4I7UA 4DF1A 1WZKA 1XF0A 2ZE3A 3LLXA 4DVOA 1F3EA 5HMFA 3SZ8A 1UA7A 3JUGA 1FP9A 4C6JA 2V5KA 2AMXA 2X09A 1SU5A 2WHJA 1EOMA 5C9UA 2ZUMA 1ZB5A 4A35A 2FZ8A 1OHLA 2EHHA 3ITVA 5IFPA 2Z26A 2ZZ6A 4WY0A 4QIUA 3PP7A 3L4UA 1WXYA 4BK9A 2VCBA 3W7MA 2PEVA 4GIYA 3D0CA 1E0UA 3PBYA 3L21A 2G97A 5A8GA 1XLKA 3UETA 2VVNA 4JNZA 4BI7A 4XZIA 2QUMA 3UR8A 3FXGA 4R5EA 1G4TA 4I8YA 3P62A 3MSYA 3F2BA 1JD7A 2WCGA 1K9FA 2Z28A 2VYOA 5LGZA 2EF9A 3S47A 4X0NA 3EMCA 3E0LA 4MKSA 3TXVA 2NWSA 3ARQA 4US6A 1RV8A 4OTKA 2PB1A 2FMNA 3F4VA 4K7YA 2NZLA 2XGIA 5EMLA 4JTSA 4ZO7A 2VZTA 2P53A 4PB3A 2ZZ1A 2ZXAA 4LC6A 3LPGA 4GBUA 4Y96A 1JDAA 1S5NA 4GVGA 3S5OA 4LVAA 4V27A 3P8IA 5HNNA 4UXDA 4KQNA 4YHEA 4IMCA 2JF6A 3MSDA 3WFZA 1VPXA 2J8FA 1LROA 3L67A 4X2RA 4E5TA 3OBAA 1U83A 3M0XA 5U7SA 1FKWA 3SUTA 1ME9A 4GO8A 3KRUA 3BJTA 4K8HA 3QR0A 2H8ZA 1MSSA 3IIPA 1HJSA 2CWNA 2AL2A 1DWFM 2W66A 2O7QA 1DPMA 1XH2A 4JL1A 4AZCB 2DZSA 3V35A 1MXGA 3G24A 3CHDA 1FHVA 1ONEA 3HBLA 4NZCA 4K6AA 1RJRA 5G1YA 4PCSA 3E9AA 1K8ZA 3K5XA 4E3VA 3GAKA 1FA2A 5JBEA 1JZ7A 3FYPA 1IR1A 2J7DA 2HTMA 4ZFMA 5HJLA 3PC0A 2J7FA 4UBPC 3SN1A 5BXRA 4GUJA 1SZRA 1VENA 1WAWA 2FYMA 4N9CA 4H9MA 4U3AA 1KCLA 1MUMA 2XSAA 1UR9A 2D23A 3WEZA 4BEUA 1PWLA 3H4WA 4FX8A 4BHYA 3INPA 3SFKA 1CEOA 3W86A 2VDHA 1ZLPA 4AIEA 3TX9A 3CJPA 5FIPA 2PRHA 2O56A 5FEZA 5BRQA 4QRNA 3BURA 4AD3A 4JKKA 1FH7A 1NTHA 2AKZA 2Q6ZA 3G0UA 4GINA 1HP5A 4AXNA 3SUUA 4KGJA 3H4XA 2IQTA 3PPHA 2QGHA 1UC5A 4JFUA 5I77A 1XG3A 1XQKA 1Q66A 2YYUA 4HNCA 1XLIA 2G5WA 5AVHA 3KZSA 3MUXA 2C19A 4GQRA 4N2YA 4G7FA 1TTIA 3E49A 1P0NA 4R7WA 2OEMA 3UZJA 1VLWA 4JTHA 4J3SA 4KIRA 5HXMA 1K4GA 1KR1A 3PB2A 1RCQA 3SM0A 4XWUA 3GSMA 4QM1A 4NY2A 2HS8A 3H23A 4NSBA 2JEPA 3SI9A 3WY1A 2NUWA 4MB5A 1WZAA 1E6RA 4HHMA 4QR6A 1X38A 1ZZMA 4Z1AA 1E0XA 1I1XA 4QDMA 6XIMA 1OEPA 3GK0A 4IIDA 4L4LA 1SR9A 3WQ5A 3P14A 2WMJA 1TRIA 2YDRA 1DBTA 2YXOA 3AHVA 2EGZA 3Q58A 4HU0A 5DBUA 4JZ5A 1UD8A 1NH6A 1BYCA 3P0XA 1L6GA 1DJYA 1VH7A 4L4PA 4K37A 1WZMA 2V2CA 2Q71A 3EEZA 2DEPA 1YTDA 4ZOEA 3QHNA 1FWNA 2IPWA 1RXOB 1M04A 1AJZA 3MUAA 4ATDA 2HXTA 2ABAA 3ABZA 3U6WA 3UYIA 4OU1A 4UTMA 2IPGA 4LF2A 2YCLA 1MW0A 1Y0EA 3AUJA 1K6AA 1ZS2A 3PTDA 3IARA 2G8ZA 1A47A 2GK1B 2YDQA 2WJZA 4JEJA 1LLWA 3N9KA 4FNUA 3SURA 4E38A 1QR7A 4XD4A 4CGTA 2HBXA 1Q6CA 4P7LA 4AZBA 1TPC1 3KDNA 3DAQA 3S2CA 2A6LA 4X3ZA 3WN6A 3OEXA 3VM5A 1KRBC 3WMBA 3QMSA 2PCQA 3VIMA 3UCQA 3O9NA 1BSLA 1UHVA 3FHAA 3WLHA 3R10A 3D6NA 3CZJA 2V5CA 1V3KA 2CBVA 4DHGA 2QEZA 4FPSA 1MUWA 3W1LA 3LM3A 1TWDA 1WDWA 2OLSA 3ZVIA 3STFA 5AB3A 4RL3A 3MP3A 4GY0A 4KKXA 3QKZA 3KVMA 4GCAA 3DH7A 3CQKA 1I45A 2POZA 4TX8A 3RRAA 3C2RA 2CBUA 4UTJA 5C70A 5HDRA 3YPIA 3NPXA 4MLJA 2V63A 1AQHA 4ZOBA 1TPDA 4NX5A 4QITA 2AQOA 3I4EA 1LWIA 3GO2A 2YA0A 4H04A 2PI6A 3L4TA 5CZSA 4YL2A 5CAKA 3UBPC 4QNWA 2XISA 4IG2B 2CLHA 5AHNA 4JBRA 4YS1A 5CPNA 1QWKA 3BQ6A 2RAGA 1ZY9A 1GZGA 3GWQA 1HQTA 2OEKA 5H1WA 5M5DA 1OFBA 2PGWA 2QF8A 5CJNA 5CC6A 4DWSC 1OF8A 4HZMA 1NWSA 4DBWA 3K8MA 2B7OA 4Y9NA 1Q4NX 2BGNE 4FOUA 2HJPA 3AXHA 4P7OA 1KGXA 4A8NA 3BLLA 5I3HA 1NOFA 4ZOAA 4ZQCA 1LRNA 4JQ4A 3SN4A 3IK4A 1JGIA 1NELA 1ZQ5A 2WNZA 4RZBA 1DIEA 3SECA 1ZNNA 3H21A 3TWAA 4A8IA 3AWOA 4AFYA 3NO3A 5JMUA 1NWRA 3G1HA 1WE5A 1YBQA 2XN1A 1E55A 2R8WA 2DIJA 4IG2A 3EWYA 3U8GA 4D8LA 4GY7A 1OGBA 4NXSA 5BRBA 4ZTYA 1LRQA 1KR0A 5EFDA 3RU6A 1RBLA 1DWHM 2DUXA 2PTDA 1DHPA 1AQFA 4AAJA 3VIHA 3NQMA 1BPLB 4A21A 4AHOA 4AH7A 3LG3A 5KZ6A 4MAZA 1GOWA 4HMCA 4PMDA 3KS5A 3GBDA 4KRUA 4PZVA 2C1HA 1LBLA 5LA1A 2Q3OA 4MUZA 4WXZA 1I0DA 2VZVA 3IIZA 4RNHA 3ARTA 3EEGA 1UD4A 3T44A 1ZBKA 1OD8A 4QLJA 2JIWA 4ORIA 4RLIA 4ZO8A 4A3YA 2QCEA 3STEA 3VIOA 1TV4A 1W5OA 1TX0A 4LH8A 4QCFA 1GKQA 1ONXA 3HPSA 2OQLA 3EX1A 4CD6A 1BAGA 1CGYA 1QI3A 2J7BA 4LYPA 4XSLA 3M64A 4O57A 1Z9AA 2ATSA 1X1NA 1E0TA 4E4UA 4ZA0A 3URAA 5EL1A 2DORA 4WK9A 2DUAA 4CNUA 4BA0A 4GZIA 1L2QA 2G4JA 1HG3A 2ZFAA 2CIPA 1ZJAA 2TPSA 2ZWZA 5ECVA 1VYSX 3RJXA 2EPLX 3ITCA 3T0AA 1WDPA 1JQVA 1MI3A 3R12A 4MYAA 4HK6A 2D22A 2REQA 4DRSA 3FA4A 3S42A 3UPBA 1V6XA 3CEPA 1D3CA 5EA9A 4JYEA 1R9XA 3GNDA 3GYEA 3P61A 5I3GA 5TF0A 4E4PA 1I2PA 3STPA 1XFBA 2YIHA 2IKHA 2OMAA 3UERA 3CAWA 2BASA 2ON3A 4PTDA 4Q33A 4C90A 1R2RA 1JZ2A 1L6WA 3T0TA 4WDTA 2VMFA 1W3LA 1EPVA 1JIBA 3DC8A 1REQB 5FCZA 1Q8JA 4H8VA 4B5WA 4MFDA 2EG6A 3IGXA 4DUWA 4NT0A 4MDOA 2AOSA 4YHGA 2WO5A 2DZUA 3LY0A 3G8RA 4C6EA 1U1HA 3C0SA 5EU9A 3GTFA 3DHFA 3B9DA 3WO8A 3KP1A 3QYSA 3NR0A 3S1VA 1GG0A 3I7RA 2PDFA 1TWSA 4DN1A 1UUOA 3CPRA 5LYRA 5AOUA 2RDXA 1NVMA 3NL6A 4GZJA 1W2VA 3SGUA 1H1ZA 1GVFA 3DYMA 1S2TA 2CFFA 4DYEA 3HJZA 4M51A 4MJMA 1J2BA 3L4YA 4QX4A 4NJGA 1UPMB 1EP3A 1Q8AA 1V08A 3UG4A 1AG1O 4ZVJA 1NDZA 1CXHA 2NT0A 1MXDA 4MNMA 1QW9A 2OYKA 4Y9MA 4JFVA 4WVXA 1IXQA 4NQ1A 5TIMA 1REQA 4FR1A 1EHAA 3UZWA 1Z44A 3PZNA 1UD3A 3EWUA 5BMXA 3MVIA 5D2VA 3VDBA 3GVGA 2POTA 1Q45A 1ZBWA 4DBSA 3SSJA 5BOEA 1K7EA 4CQDA 2AMGA 3VX0A 1PJ9A 1RZMA 1D3GA 3H54A 4XZWA 2A79A 4JFWA 1VFMA 3WSUA 3SY1A 3R89A 1OF6A 2XU2A 1Q7ZA 3K4DA 4YTSA 5CC7A 4PUJA 4HJWA 3BSMA 3B4UA 3W01A 3MJMA 2X1RA 4FXFA 1XYFA 4XAPA 3LXBA 5BOFA 1TV5A 3CL7A 4S3JA 2XH0A 3URBA 3IRDA 1XL9A 2F61A 1M01A 3MTWA 1F76A 4FNPA 4M6UA 3H2EA 3OP2A 1TB3A 2D2JA 4TU1A 4GGHA 5FAGA 3N2TA 1KV5A 3R7MA 3AC0A 3DENA 5AN7A 1YIXA 3MBDA 1UD2A 3IV8A 1XS2A 2PDPA 3RX4A 3S1WA 4MIMA 1K8XA 4RDZA 1JI2A 3AXXA 1PE1A 3AIEA 2Y1HA 2Z0IA 2EPMX 4MWAC 4C7DA 1BG4A 1GJWA 1ZENA 1O5XA 1G01A 3DGBA 2NVCA 4LUTA 1E1EA 3MKKA 4HMNA 1WV2A 4CKQA 1E1CB 4H9TA 1S5MA 4UQ9A 2I56A 3PZTA 3ANUA 4YYCA 2VEIA 3TYEA 3WL1A 3OZPA 2Z2UA 2HWGA 1UWUA 4CEXC 1SO6A 2VGGA 1B31A 1XPYA 1B4KA 1ZCOA 1NFPA 3GKAA 4FLOA 3VIKA 1B3WA 3LHUA 3W87A 4H83A 4N9EA 2XDFA 3BZJA 3CO8A 1JYNA 4FP1A 5K9CA 4Q4KA 1CT5A 1JRBA 6XIAA 1NQKA 4DO6A 3U5UA 4IJCA 3OA5A 1Y5XA 4UFLA 3IS4A 4CNNA 4XZMX 4GX8A 3H24A 3ARSA 2YGYA 3W7NA 4GQBA 5L6UA 1TX2A 1QK0A 3FW6A 4HU3A 2KAUC 2G50A 2ISVA 3HMCA 3BCDA 3UF9A 3VE9A 4IUGA 3EKLA 2PMQA 3HG3A 2YDAA 2X05A 5F4SA 4CQBA 3HB9A 3LTSA 3TFCA 2WWDA 4X9YA 5A8NA 2G0WA 3ITGA 3U7VA 4W8BA 2YLLA 5E93A 4PUWA 3CUXA 1SZGA 1G94A 4PCTA 5A6MA 1OVDA 1Z6KA 3LRMA 3CUHA 1ISWA 3T0DA 5LXXA 2QGYA 2ICSA 1W1B1 1S3TC 2PU0A 5FL1A 4JX4A 1HL2A 3T42A 2VENA 1TYGA 3AMCA 4ZL1A 1Q2RA 4GK8A 3H8AA 4ACZA 3Q65A 2DDXA 2VUYA 4UZUA 3I3BA 2ISWA 3A6OA 3CV2A 4JTDA 2G3MA 1JZ5A 3F5LA 4H6KA 2I16A 3UA3A 3WUGA 1HTIA 4DWDA 4ENLA 3WLOA 4LYKA 1TPH1 2PDQA 3G1YA 1XINA 3ITTA 1QOQA 4B3ZA 2WMIA 5JBFA 1RD5A 1YX1A 1T8QA 4BWLA 5LNRA 1GQKA 1XIJA 1PDYA 3HFTA 4U4MA 2F8QA 1TA3B 2QPXA 3EX3A 4LRTA 3TYBA 4GE8A 1DEDA 3VPLA 3WK1A 3MV01 2WHLA 1H5YA 2OXNA 1DORA 5CG0A 4DO5A 3GVRA 5C9WA 4DELA 1ZAJA 1M53A 4NZJA 3CB8A 3W7CA 4LEFA 5I0DA 2E9MA 1TPWA 3D3AA 3W7KA 2J8GA 2XPKA 2CLPA 3E2SA 1DKWA 1VKFA 1H61A 1N2VA 5LIXX 2E4TA 3HM7A 4GYKA 3IVTA 1S1PA 3Q37A 1DQXA 8XIAA 1FHLA 2NXGA 4PSPA 2HQAA 3WJZA 3NFUA 2BNJA 3G0SA 3BQ5A 3BPWA 3BARA 5GJNA 4LB4A 4U28A 3DHUA 1M3UA 3O6CA 3THUA 5BW6A 4XZBA 1FCVA 1TA3A 4QQ3A 1P0EA 4FALA 1TUFA 4GFIA 1AH3A 2XFWA 3FJNA 1EO7A 3EB3A 3FDKA 3T9PA 1PS9A 1NY1A 3T8LA 4B9ZA 1I2OA 4QJ3B 2ZE0A 4XO6A 4H7VA 3V16A 4NZFA 2IMRA 2ZUSA 4OKDA 1XH1A 2V0TA 1LF1A 1JFXA 4WQ6A 2OT0A 4E3TA 3ZSTA 3GZ3A 3N13A 1GW9A 3GR7A 1UR8A 2XINA 1KFKA 4OE7A 1ZBCA 5K4ZA 3UGVA 4AXKA 1HKIA 3CU2A 4H8HA 3SAZA 3Q45A 3U57A 3VUSA 2PDJA 2E6DA 1XDJA 3K2GA 2NQHA 3E2QA 1EJRC 3W7JA 4I8DA 3UU0A 3WENA 4MJ4A 1BYAA 1QNQA 3KOZA 3DFHA 2PLCA 3LPFA 3ALGA 2Y5EA 4TIMA 4UNLA 4HSHA 3LDVA 3AMDA 3BGAA 1TJ0A 4M3PA 4O54A 2A7PA 4NG3A 4GI6A 4AZ6A 4Y8FA 1WKYA 4W88A 3EKGA 3KBJA 3KTCA 1W2PA 3T0CA 4DJFD 3FDGA 3LLFA 2R1NA 2H8XA 4G1KA 3VM7A 3ZXWA 4NAFB 4C6IA 3WX7A 4ZB2A 3S5YA 3DFSA 1J79A 4UTWC 3CPUA 2ZRZA 5LNUA 1T8XA 1L2UA 1VAHA 6A3HA 3TW7A 4PE8A 1CENA 5AYYA 4UB9A 1ESWA 1JDFA 2XFRA 3PZUA 2Q01A 2CHOA 3ATYA 3W28A 3DFYA 4GMEA 4HGXA 4CCEA 2Y5JA 1ADSA 2ZZ7A 2V6AA 1W3IA 3EPNA 2C15A 4Y9PA 4RPQA 1TV8A 4UTIA 3QBUA 2ZDRA 4AYSA 4TOQA 4I9JA 2ISDA 2HISA 4Z42C 5ABFA 4S38A 1PZ2A 1CBGA 2VEFA 2XVPA 3GKFA 4ZEPA 1SFJA 1R9ZA 2QCCA 4KERA 3M0HA 1WBHA 2FVMA 1EA9C 1TO3A 3GS6A 2WXDM 5TBOA 4UTFA 4EPEC 3NDYA 3B0XA 1QJWA 4E2DA 1PX3A 9CGTA 1KM6A 3PVFA 2HPIA 3ES7A 4L9XA 4UCFA 3VVGA 1FKXA 4CQCA 4GJJA 4C1KA 2PZ0A 3WNPA 5I09A 5DO8A 3T2QA 1XWYA 3MANA 4V2XA 1KW1A 3VD3A 3WQOA 3W81A 1XIFA 3C0LA 1E9YB 3TZNA 3HGRA 3PZGA 2ANUA 3SFWA 3ZFHA 3DUGA 2IW0A 3SIMA 4IGMA 3DESA 3BOLA 4MB1A 5HNUA 3CQIA 4U33A 4QS5A 4PFHA 3PANA 2J62A 1P1MA 1QBAA 1S46A 2OZTA 3CV6A 5G2IA 1QBBA 3WDJA 2HBVA 1GTHA 4O16A 1MFVA 1LWHA 3VD5A 1TZZA 2NWRA 5FF7A 1CGUA 1PCWA 4IQEA 5AHEA 1M65A 4D2JA 2J8TA 1JFHA 3GU2A 4AZHA 4XB3A 3VNYA 6REQA 3AAMA 4M1RA 1BGGA 5I3FA 5LSMA 1VBHA 1YNQA 1VIZA 2F9RA 5C2GA 3CQHA 3NA8A 2PRMA 2Z7GA 5CG7A 4R53A 3WMSA 4AZGA 3W6YA 3W85A 2QIIA 1PTAA 1E6PA 5A8MA 4O0KA 3DZ1A 1VRDA 2EEXA 3M0ZA 4HPGA 3CWNA 4EAMA 3W2JA 2R1MA 1HO4A 3B8DA 4UNIA 3BAJA 2PAJA 4OZOA 2OYLA 5E09A 1ZTVA 1XRVA 3C0QA 4MJZA 3PBUA 4S3GA 1JJKA 4GABA 2NXIA 3BUVA 4RE3A 4YMZA 4F0SA 2C3ZA 4L6HA 4ALDA 3TW9A 2RH9A 2R9RA 2ZDSA 3CMJA 3JRKA 2OODA 4NRSA 1DWJM 4I6KA 3RAOA 1QT1A 1A5AA 2QKFA 2WQDA 3WK3A 3MUY1 1FWIC 1OFAA 1DE5A 3CV7A 2JKAA 3O0FA 3AXMA 4W9TA 3FSUA 3MYPA 3OGRA 3LK6A 2XIQA 3OLEA 3WG6A 3WZ0E 3A24A 4O18A 3QYQA 3LZ3A 5TQLA 2BY0A 1BRLB 4GXWA 4L4OA 3AXIA 3N18A 4O10A 1XV8A 3BJSA 3II1A 1UBSA 5TNVA 3KLLA 1EIXA 1CIUA 3FA5A 5FOOA 4OQVA 2XH7A 4GQ0A 1KTCA 4P7RA 4UR7A 2OSWA 5C71A 1X6LA 2BHYA 3OLIA 2FTYA 2O92A 4KRTA 4TV6A 4A29A 2A21A 3OA3A 4DZAA 4HYVA 1R3QA 3GH5A 2YX0A 2QS8A 2XVNA 4FNSA 3B04A 1SPQA 4RNJA 4IMGA 2WJDA 1IE7C 4LBUA 4KWWA 4KMQA 4EOUA 1EWDA 1G4EA 4DWSB 3T4CA 4WKFA 3WFLA 1WBJA 3BG3A 3B0UX 4Q6XA 3SCTA 3I3EA 3OG3A 2C7FA 4KEMA 4AEFA 2GUBA 4YN5A 3R8HA 1BRLA 1TG7A 3KM8A 3TEVA 2GSJA 4JTCA 2DJXA 1XUZA 3M0LA 2ASHA 4JTKA 2JALA 3I7QA 2GGGA 1KQZA 4MB4A 1FDZA 3M9YA 1XYBA 2WSPA 2YL5A 3WH8A 1UIOA 3UZ5A 2X1UA 2Y61A 2CHRA 1A4LA 3BAXA 2WK2A 3LGGA 5DT5A 1JUEA 2QCHA 5K2ZA 4DPPA 2ACUA 4JOMA 1T40A 4M6QA 4NZ5A 1QK2A 1ITCA 3TTYA 5IBXC 5T9CE 1ZL1A 3IJDA 3N14A 2WZIA 1GPWA 4IMFA 1K03A 3DECA 5B80A 5HUOA 1D9EA 1QCWA 3RLUA 2WOQA 1OC6A 1AQ0A 5CSYA 3OZOA 4D9PA 1IT8A 3LQGA 3QW4B 4WD0A 3T7VA 1Q4WA 3WD3A 5FJPA 2HRWA 2CKRA 2GUUA 1K9DA 4N02A 5M2FX 1CLXA 3GVVA 3GXMA 2D24A 4ERAA 2DVXA 1UWQA 4A05A 4GUHA 1R3VA 3W7QA 1B54A 3C3NA 1H1YA 4Z2JA 1H63A 2QDGA 4W84A 3JZUA 5AYIA 1QI0A 4HA3A 2I1OA 2PCEA 3BOXA 2VZSA 5GNYA 4GACA 2VEPA 3KFTA 3K46A 1ICPA 3I6TA 1U33A 2DSKA 4X9SA 4WSHA 3LEPA 1G7UA 4KPLA 3L2LA 2A7RA 4QCEA 1E5JA 3HGJA 1XIBA 1QOXA 1F2JA 4PEEA 2BWGA 1XLCA 3TA6A 2OR2A 1JZ8A 1BXBA 3N2BA 2OO6A 1R38A 3ITYA 4WGHA 1TIWA 4ZMGA 1JPHA 3NQGA 3LA4A 2WLYA 2Y89A 4RNFA 1H09A 4UOQA 2VFHA 2E8ZA 1RBAA 4POCA 3H2FA 1XBYA 4OHQA 4M56A 3QSRA 2A7NA 4PULA 2HVOA 2B7NA 5CGMA 3OBKA 4PRRA 1GKRA 1BGAA 3FXYA 3N4FA 3ENLA 3LBMA 1OGGA 1C3FA 1ME8A 3O6AA 5AZ1A 4EPKA 1A3XA 5BU9A 2XIJA 3LHZA 1O12A 1BWVA 2Z00A 5FF2A 2A3EA 3U2CA 4XISA 1V0LA 3OYXA 3C6CA 1E3XA 5I5RA 4UTKA 3CZLA 1V0KA 5JVLA 5MHBA 1HKKA 5KZMA 4S3CA 3I3DA 5AHFA 1BQCA 4GH3A 4ZXOA 1H7PA 4IP5A 2X7VA 4HK7A 4LU0A 1W1YA 1X97A 4HCHA 3MSRA 3EAUA 2WVUA 1MW3A 3UG3A 2OO0A 5H2ZA 1NEYA 3BAWA 3SCNA 2QJJA 4AWTA 4FHAA 4HIBA 2BY2A 1EX5A 1EX1A 2ZUUA 4CNPA 5AYBA 1KM3A 1XX1A 2C18A 1BSIA 4MOZA 2VEMA 1YXYA 4NKCA 4PR4A 2VFEA 3OVRA 1MW2A 1FBAA 3ZWTA 2YYTA 3TVAA 1V03A 4IX0A 1XUUA 4UFJA 5HR6A 3QOMA 3WK0A 2XG9A 2WSRA 2BGSA 3RX3A 4LUYA 4RZ4A 2FZBA 2CITA 2E1WA 4PTMA 4H9ZA 4JHMA 1VQTA 1YQ2A 3U7BA 4IX2A 1C92A 2PP3A 4YTRA 1W8GA 2QVNA 4ZQPA 3AISA 4RDYA 3LGEA 3BH4A 4LT9A 3C8FA 1P6BA 5A95A 1MWOA 4FI4A 1KXTA 5IXEA 4F2TA 3TC7A 1KB3A 1GYLA 1FWCC 3S2MA 3A47A 3L5AA 3P84A 3F1QA 1OC5A 3EOUA 1LBMA 2C0HA 2PWUA 3KRZA 1UWRA 3ES8A 1OC7A 4A3RA 3ZWSA 3KRBA 3NJ3A 4O19A 4ORMA 1SJDA 4XZNX 3PBWA 3L9CA 3R4IA 3OHIA 1XDMA 4MNJA 5KINA 2C71A 1PKYA 4D6IA 1SFLA 4L61A 4HN4A 3RLHA 1UR0A 1RCXB 4FOKA 3C8NA 2YB4A 2C13A 3BG5A 4MWAB 5FJUA 4QJ4B 1CECA 3W26A 1UZDA 1YXCA 2OSXA 2BG5A 1TTPA 1HVQA 2ONEA 2PWHA 1B4EA 4LNCA 2GOKA 1XC4A 3UWZA 2OU4A 5D03A 4AY1A 1MVYA 4UMAA 6TIMA 1Z32X 5HNTA 5CSRA 2C91A 3GX9A 3UT0A 3STGA 2V2DA 3H6OA 1EBGA 4AF0B 1KGUA 3PS7A 3MT1A 2OOGA 1EP1A 2D20A 4H9VA 3SGZA 3LSBA 2ZVIA 4CNTA 4QP0A 2PDBA 4Q7BA 3G1SA 4OOUA 3P8JA 4LYQA 5D33A 1GVRA 1XW8A 3TYZA 1RLDA 3SUSA 3GFYA 1LUCB 2BVDA 5DBTA 5AECA 3MDUA 1CI1A 2B7PA 4US5A 1D3HA 3KL0A 5A3HA 1IIHA 2X41A 3QZEA 2UWFA 3MP4A 1S5WA 4JYFA 2C0AA 2PDWA 2YOCA 4EK7A 4I6VA 3EX6A 4INFA 3HMJG 4UQBA 4UTTA 1CGWA 1GQLA 4I90A 3GDKA 1EH9A 3WLMA 3UXIA 1WPCA 1R86A 5DELA 3NURA 2C79A 1XG4A 3TONA 3AHXA 3CK5A 1F6PA 4AF0A 1Z8AA 3HQ1A 2TYSA 4S1FA 4GUIA 4WIWA 3KTSA 1OK6A 1LYXA 2VEGA 2B81A 2Z24A 1VEMA 3PWIA 1PWMA 2VRKA 3WMCA 1SSGA 4F8XA 1V51A 4UIOA 5CSUA 1LUCA 2FIQA 1EZWA 1IT0A 4QSFA 2J25A 4FX6M 4QG8A 1HJUA 3TFXA 3LI0A 1TZ7A 3OIXA 3A4AA 2NLIA 3WH6A 1U1JA 2YL6A 2QW5A 3KBWA 4DZHA 3FKKA 3GQYA 2Z1VA 3TROA 2PUZA 3UXAA 3WDRA 4ACYA 3LERA 2FJKA 3AIRA 2Y63A 5GNZA 3KCLA 3KUMA 4D6CA 3ZO9A 3LRLA 1EBHA 1M7PA 4WSJA 1RA0A 2NQJA 1NU5A 3QTGA 4DZ5A 1FWEC 1ZBVA 2J7GA 3ITOA 3G77A 2UV8G 2RDTA 3R5EA 4RNIA 6TAAA 1G7VA 3NG3A 4PL1A 5FF0A 3WJYA 3CYVA 3GC5A 4J28A 1WUFA 4DM2A 4XVEA 3FCPA 2YBVA 5F2LA 2PDIA 2X2YA 2FHFA 2G41A 1JNDA 3C61A 4N7QA 3PAJA 3OVQA 1QNVA 3GNRA 4JX6A 4B4FA 4H9YA 5D9NA 2DIEA 3V0SA 3P2VA 4QNEA 4PODA 1Q7MA 3SCPA 2IXVA 4AHQA 5FL0A 2HEJA 4CNSA 2Z1KA 3N12A 3VOHA 3AIUA 1W1ZA 3M7SA 2DZAA 1HXJA 3B0VC 1OCNA 2J79A 4LRSA 3WD4A 3QY6A 1XISA 3IRSA 4HYWA 3CWOX 3NPVA 5D2YA 1JYVA 3BLEA 1H7NA 3PJTA 3AMKA 1IF2A 3P82A 4NVTA 1M7JA 3EB4A 4U5IA 3RCNA 1HUVA 2GJXB 1BF6A 3GG1A 3THCA 3PR2A 4O1EA 3MYOA 3QKEA 7ENLA 3ARUA 1Q6LA 1I60A 3MDWA 1GOXA 2ABBA 3FGCB 1B3VA 1YNYA 5HMDA 3GAYA 4ZE5A 1XIIA 1BFNA 4P8WA 4PMNA 3CZ8A 2PDHA 1HJWA 4PMVA 4DJED 1B0IA 1OX4B 3VKKA 3NGFA 2YCIX 1E0WA 2A3LA 3ID7A 5I02A 1BHGA 1GEHA 1OD0A 1BKSA 2CLKA 3RR1A 1VEOA 2VJXA 3DCPA 2GYIA 2Y6ZA 1KTNA 3DGRA 3PTKA 1H0GA 3WBAA 1H49A 3AYSA 4IL2A 3C4UA 3WLQA 3NCOA 3JS3A 3P67A 4Q8NA 3NEHA 1O5QA 1FWGC 1OCJA 2PC8A 1R3RA 1JDDA 1R87A 3RITA 3G3MA 1Q63A 3HFYA 1C29A 1YRRA 3AIVA 5JUVA 4JN8A 3QQ1A 3LCIA 3CH0A 3EKZA 3PUOA 3I4KA 3EA2A 3FV9A 2G3IA 4JIIX 3S9YA 3BGGA 3B0YA 3FGCA 2GDUA 1EDQA 3BGJA 4JKMA 3O06A 1GJPA 3WFAA 4JN6A 1OX4A 3ZS4A 1SR0A 3MWAA 3QV9A 4CVWA 3DI1A 2XWEA 3KXQA 1ZAIA 3N73A 3U2OA 3AS0A 1XCWA 1ZU8A 1TWIA 2BFGA 1XYCA 4B2DA 5AC8A 3O07A 3GTNA 2ZQ0A 1GOIA 4QEEA 4AB4A 1UH2A 1KRAC 5EMYA 3B9NA 3NL3A 2IPFA 1WAUA 1NWUA 1ZFJA 4PYSA 3WQ6A 3W6LA 2AQWA 3GG7A 2BVWA 3LNPA 4JTGA 3TSDA 1O4UA 3DBPA 4PUKA 1W9DM 1OJXA 3CB3A 1L9WA 4LOCA 1EXPA 3FEQA 1RK6A 1WXZA 2PDYA 3QSTA 1JF6A 3IIOA 2H3DA 4XIAA 4HK5A 4E4FA 4BQ5A 1B3YA 4PEKA 3AROA 3AIQA 1N55A 2X42A 5E0KA 3F03K 1C8XA 1KWKA 5DXXA 3E5PA 4EE9A 4HOXA 3WUBA 4H41A 3M41A 3C5QA 1SMAA 4WJEA 1C7TA 2VGBA 3KL3A 1Q65A 3W1MA 5I03A 2OELA 4Q22A 1EUAA 2NX3A 4QG6A 2HSAA 4CD4A 3UWEA 4UTWA 3SQMA 3D3FA 4YTQA 4IIEA 1Q6EA 4G2DA 2VFDA 4R27A 4ZZ9A 2E8YA 4REQB 3AXKA 3GVWA 3KE0A 2VCCA 4J2PA 3EOLA 4S23A 5H8PA 3SB0A 1UKSA 1WZLA 3VYLA 1ECQA 2OLAA 4RR4A 4JCMA 2G4FA 1H3GA 2E6FA 1LBFA 3TQVA 3VE7A 3TIMA 2J27A 3UCDA 4L1WA 4AX6A 4EKJA 5KZEA 3FAXA 1KFLA 4YWIA 4F48A 3CPGA 4IT1A 4IH3A 3K8LA 4HHPA 3MHGA 2Z27A 5AVNA 1FOBA 1C93A 3LCXA 4I7VA 2UY3A 3MWCA 4JTLA 3NWRA 3M5ZA 1UP3A 2OPJA 4JFSA 3OOQA 4C1NB 4EPDC 3UPWA 4REQA 2VZUA 4C6KA 4DJFC 4J27A 3SCOA 1VFUA 3EOOA 1WB0A 3QF0A 4LAMA 2WVSA 5D37A 1PYMA 3BZGA 1FY6A 3AYVA 1YLVA 4PBFA 1QPOA 4MAVA 5A6LA 3CO4A 1W37A 2Z6JA 4IQDA 2F6UA 2F84A 3M43A 4DXXA 1DL3A 3DBNA 1YPXA 3NQDA 2DW6A 3W7RA 1R47A 2X7WA 4WZHA 4LAUA 1F6KA 3H7UA 2DVUA 1OBAA 2YZ5A 3S6TA 1TREA 2RDUA 4DLMA 2I14A 2WC4A 3LHVA 1V6TA 3ZLFA 1VYPX 4YYFA 2WCSA 3ZVHB 2HDJA 2GVLA 1OX5A 4HVXA 3TW6A 1DIKA 2E77A 4HA0A 4D8ZA 1OYAA 1Q85A 2X0HA 3T6CA 5HBFA 2AQVA 4WOQA 3L4XA 3AICA 4YJ5A 4Y6GA 2B0MA 3QV6A 3ZR5A 1XGEA 3MO7A 5HJXA 5G4WA 4HOZA 3OGVA 3N34A 4BF5A 5T9BG 1TPVA 4C7FA 1G4PA 3W7OA 3NZQA 2ODOA 1A5KC 3WLIA 1CGTA 4ZOCA 4AMCA 4EP8C 4ZQNA 1A80A 2EXOA 4IIHA 1QUMA 2QVHA 3UG5A 3N29A 1KXVA 3N17A 4WUIA 1OY0A 1W3NA 4LAOA 2PTZA 3J7HA 2RUSA 1E70M 1S2AA 2W4XA 1B2YA 1NFGA 1TMLA 1ICSA 4Q32A 3ZVHA 1CWYA 4LBRA 2AGKA 1XH0A 3IAQA 4XIMA 4O52A 4W7UA 4M29A 1JVNA 3QHMA 2PDGA 4J3TA 4GUFA 4C6PA 4H2HA 5GVJA 5DY3A 2Q3RA 3PSWA 4F9DA 1VCGA 1X8FA 4A2RA 1V7YA 1E71M 2AKMA 3CXOA 3W76A 2E1DA 3CUFA 4Z2GA 1PTGA 3UZXA 1XYLA 4D6JA 1S2UA 3KOYA 1A49A 4DEFA 2FFIA 2ZRUA 3SEPA 1IGWA 2PP0A 3N9SA 3L66A 4IQLA 3SN0A 3GHRA 2WVTA 1O1ZA 1P6WA 4J3VA 4J9JA 4XZHA 5CGTA 3EXRA 3THAA 4IPPA 4MZYA 1KFWA 3UYCA 2QQ6A 2QJMA 5H6HA 2A3BA 2CBIA 5BWAA 1UR4A 2QUUA 2F7FA 3UY7A 2GWNA 5LNVA