4D8AA

Crystal structure of b. anthracis dhps with compound 21
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
263
Chain Sequence
KWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGAHIIDIGKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVRDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydropteroate synthase
publication title Structure-Based Design of Novel Pyrimido[4,5-c]pyridazine Derivatives as Dihydropteroate Synthase Inhibitors with Increased Affinity.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase/transferase inhibitor
total genus 98
structure length 263
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.5.1.15: Dihydropteroate synthase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00809 Pterin_bind Pterin binding enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.20 Alpha Beta Alpha-Beta Barrel TIM Barrel Dihydropteroate synthase-like 4d8aA00
4MWAA 3BOFA 1TWZA 3TYDA 3H2EA 4D8ZA 3TYEA 4S3AA 3H2NA 3BOLA 2VEFA 2Y5SA 3TYUA 3TZFA 3MCOA 3H2FA 4DJED 4CCZA 1Q8JA 2YCLB 2YCIX 5JQ9A 4O1EA 4DB7A 4DJDD 4S23A 4G9PA 1Q7ZA 4NIRA 1Q8AA 3H26A 1Q85A 4DJFD 3H2CA 3TYCA 2YCJA 2H9AA 4D8AA 4S38A 2VP8A 3H22A 4O0QA 1AJ0A 3K13A 3V5OA 1F6YA 3H2OA 4MWAB 4NL1A 2BMBA 4MWAD 3TYZA 4C1NA 4DJEC 4S3FA 4HB7A 4S3EA 3MCMA 4DAFA 2DZAA 4DJDC 2Y5JA 2E7FA 2VEGA 4DAIA 3TR9A 3MCNA 1TWSA 4MWAE 3TYBA 4S3BA 2OGYA 3H23A 1EYEA 3TZNA 1AJZA 3H2AA 4PZVA 4NHVA 3H2MA 4S3DA 2H9AB 1AD1A 4S39A 4DJEA 2YCKX 4O1FA 2Y0FA 3TYAA 2YCLA 1Q7MA 4DJDA 4DJFC 3NOYA 2DQWA 1TX2A 4C1NB 4DJFA 1AD4A 3H24A 1Q7QA 4NILA 4D9PA 3H21A 4MWAC 1TWWA 2DZBA 1TX0A 1AJ2A 4S3CA
chains in the Genus database with same CATH superfamily
1M68A 1IXOA 4K36A 3VILA 4TVDA 5I3KA 2ZUTA 3P67A 2UY2A 3AYSA 2VO5A 4GPNA 3RO6A 3MVTA 2CCRA 2QNEA 1EGMA 5G2WA 3BV4A 2YIHA 1OB0A 2GJXB 4CU8A 4QDMA 2ZOXA 3S6OA 3A4JA 4NG3A 3LHWA 3W24A 1RK6A 3PUDA 3QPEA 1QW8A 5F4SA 4NX0A 3MPGA 1W3JA 2H8ZA 2I9EA 1XR2A 1XQKA 3EWYA 4XB3A 4IT1A 1M7JA 1TPDA 5E6ZA 4JTFA 5G5IA 4MPKA 2W9MA 2CLFA 2I9UA 1V4YA 2QPUA 4INFA 1UD8A 2PP3A 3AHYA 2E40A 3LCHA 4TV5A 3ERPA 3LI1A 4CD6A 1GNXA 3N04A 3AMGA 1FWEC 3G1FA 1CXEA 3IUHA 2ZBTA 2FIQA 4O0ZA 7REQB 3G24A 1KGXA 4HP5A 4JTTA 3L5MA 6PTDA 1PZ1A 3M6DA 1WX0A 3VD9A 2PTDA 5ENLA 1NJJA 1KC7A 1I9CB 3E49A 4Q3MA 4XAPA 2NQ5A 4L6HA 3R8GA 5E09A 4KFNA 2OEKA 1VCFA 2WW5A 2OQHA 2CZVA 1AJ2A 3TCSA 3KUMA 3A4XA 5HWNA 5CH9A 2MUCA 4R34A 2VYOA 2PD5A 3OLIA 4MLRA 3K8LA 5C54A 3PPFA 4XK2A 4NZFA 1W1PA 5F2IA 5BWFA 1QATA 1JDAA 2PMQA 1VBHA 5C7HA 1FFQA 1YYAA 3QW4B 2A6LA 1UP3A 2DSVA 2ABBA 3PP7A 2VEIA 5MKGA 1NF0A 2J6VA 2ZICA 1HF6A 3IJ8A 3VIGA 4IFRA 5CG7A 1WBHA 1EHNA 4HPJA 1ZY9A 4K8EA 4Z0SA 3BGGA 4F0HA 5D02A 3GM8A 3DGBA 3UY7A 4QTGA 3THCA 1RCQA 1OF8A 5I03A 1AMKA 2OSWA 3QVQA 1U22A 2QJGA 3WN6A 1JEZA 1RSCA 3ZOAA 3N17A 1EKOA 2DGAA 3KTXA 3TMLA 1DTNA 2BOFX 1QI2A 2NWRA 1BTCA 3ZR6A 4DXKA 2P3EA 2R9RA 1UWRA 4N6FA 3QV6A 3AALA 4LV9A 4NYUA 3E12A 3W1AA 3LS9A 4JTHA 2B0MA 1HP4A 2BVWA 3HV9A 4F0RA 3CS2A 4L61A 4S3CA 3B8DA 3IV3A 1VPQA 3DDMA 3THQA 4DWSB 2DH2A 3KBJA 1W8GA 2EPHA 4WR3A 2FFIA 1VFLA 4PMDA 5JBFA 3SQMA 1F8MA 2FQIA 4AVNA 4PMOA 1ZP4A 2GUYA 5G4WA 2GGEA 3NTYA 4QLLA 1LRTA 2HVNA 4ADTA 2YDRA 3OZYA 3NPUA 4WY0B 4ERIA 3GZ3A 3NZRA 3W29A 2VCAA 1P0NA 1ZLPA 4RCXA 4QISA 1H7OA 3K2GA 3EWWA 1IF2A 3LLFA 3WNOA 5DEZA 4E8GA 3F2CA 4GYFA 3AMLA 3CZJA 2OG9A 4NYYA 2A3AA 4F9DA 1WYIA 1H0IA 1GGOA 1J0KA 1VAHA 3R4IA 4FSAA 4JHMA 1K1DA 5LGXA 4FX8A 4CCEA 3M16A 4W8BA 2ZXQA 4URIA 5I06A 5CJMA 4YVPA 3SY8A 3OTRA 1R9XA 4GZIA 1B30A 3NDYA 2ZX8A 1A0CA 2FHFA 1G94A 1X38A 3VM5A 3CH9A 1V93A 1VIWA 3NVTA 3EA3A 4LAUA 3EOLA 2FB2A 3VOHA 3WJYA 1R7OA 4XZBA 3GO2A 5BRBA 1X97A 3PBUA 4K68A 3AIUA 3CIXA 1K7FA 1KBJA 3M0YA 2NVDA 2VEFA 5I78A 1LM1A 1V3HA 3GIPA 3DYPA 3KOWA 2SFPA 1E43A 1XLLA 4IP4A 4ZSTA 3CUZA 3VINA 2MNRA 1L6WA 3A9BA 2XIOA 4IG2B 4CVWA 4DJED 3T6CA 1KTCA 3W7KA 3MDUA 3JW7A 2DZWA 2XIJA 3MZNA 4IHCA 3ZSSA 1IGWA 1JPKA 5EA9A 1NM9A 3AI0A 5IHRA 1VQTA 1DE5A 4QDWA 2VR2A 3EWXA 1SFJA 4Q4QA 2OXNA 1S5TA 5C5YA 1KXTA 2R94A 3RO8A 1MFUA 4RUBA 4EPEC 2P50A 3MU7A 4FF7A 2WV8A 1VFFA 1SW0A 2QUNA 4RXFA 7ODCA 4XO7A 3UWUA 1EJTC 1IIGA 2PDHA 1EZWA 2H3BA 2DUXA 2C1IA 3TIMA 5LIKX 4C6MA 3W6LA 1NP0A 2XWDA 1PJ9A 3BAXA 4M51A 3QC3A 4ZL1A 4H6KA 5C2XA 3B0PA 5DFAA 1US3A 2FTYA 4QNWA 2GVEA 3RM9A 3EX3A 4A22A 1H51A 4GQ0A 4MWAA 3U4FA 4A8RA 4ZOEA 4AVFA 2ZUSA 3T4CA 2AMXA 4JYEA 4HOXA 1EBGA 2BBFA 2VURA 2W61A 4B3LA 2X0HA 4Z1CA 4O8AA 1Q6RA 1D8CA 4KW2A 1GOOA 1DWHM 2X30A 3CTTA 4MB3A 4BS0A 1V7AA 2XN0A 4XSLA 3SY5A 4GBDA 4CLMA 4PBFA 1X96A 1G7VA 1OEPA 8XIMA 5BXPA 4GVHA 4D2JA 3FIGA 3TAKA 2CERA 4AD1A 4LALA 3TYZA 4WSHA 5C9UA 1K8XA 2C8NA 2NZLA 1TPB1 1TJPA 3GYCA 3RILA 3D47A 4KGLA 2VEGA 3GVQA 4G56A 1OFDA 4BEUA 2EPOA 1P6WA 3H7UA 1VJSA 1J8VA 4A21A 3PC0A 2QXWA 2GVJA 3W7EA 3RPTA 2GGGA 2D20A 1LBLA 3KVLA 4CU7A 4ACZB 2ZDRA 1LT8A 1Z32X 5HXMA 2IKJA 4CNPA 1E6SM 3B03A 3H4XA 2FDSA 1QI0A 3ZT6A 4DJDA 3LGEA 3STFA 5BWAA 5J5DA 1QASA 1UW9A 4GIEA 4TX8A 2BSLA 2EPKX 2EPLX 2ACUA 1GVOA 3BW4A 3FAWA 2RDTA 3IPWA 2I1OA 1IEXA 1QU4A 2Y6ZA 3EMQA 4KETA 1W9UA 3W3OA 1B3VA 2BTMA 4JQ2A 1HTIA 3PZIA 4DX3A 5D2XA 1E0WA 2V5BA 3C3UA 4HMCA 4IX0A 1S2CA 2GL5A 3AIWA 1FA2A 1R0MA 2PDQA 3M0JA 5ABEA 3I6TA 4J9JA 1W8SA 2G3IA 1LT7A 4FR1A 3N1AA 3H2CA 4HT3A 3LCIA 3FW6A 4OUEA 1UA3A 4DI8A 4DO7A 3UNDA 3U57A 2YA0A 2PZ0A 3A3HA 4HNOA 1DIEA 3SCQA 5T9BG 4AC1X 1UP0A 3HG2A 3LTPA 4H19A 2KAUC 2OT1A 4U33A 3OYXA 4FLQA 3AXHA 3LLXA 4TVCA 1VFTA 4I8YA 2OGYA 1F3TA 1OY0A 2ZYFA 1W9VA 3G1HA 3H2AA 1KGUA 3N2TA 4GNVA 3NYZA 1RVGA 3LZ3A 4ML4A 5E9AA 4EF9A 1GZGA 4JY9A 3THDA 1QNVA 5HATA 3GNRA 1FHVA 1P7TB 4AMCA 1HJQA 4QX4A 5M2FX 2DQWA 1G01A 2VRQA 3ARWA 1XYLA 4IGMA 4ZE4A 3WDRA 1UROA 2GVGA 2VL4A 3LMYA 2YSWA 3HJEA 4NJJA 1TIMA 2E5BA 4PMJA 4O8RA 3WNPA 2Z29A 1AUSL 3ZSTA 1UA7A 1U5JA 4RZBA 5CC7A 2BV9A 1O4UA 3F5LA 3A22A 1BF2A 2AKMA 4RE3A 1TPFA 1VBJA 1H61A 4YYCA 1V02E 4PSRA 4US5D 3P0WA 2QDDA 1W32A 5FF7A 4PA8A 2VGFA 3LBMA 1XIMA 4GZEA 1XLDA 3MSDA 3TJ4A 3GDKA 1Q5MA 7TIMA 3QGKC 4C1NA 2X0YA 5I00A 4EANA 5EBAA 3TN4A 1R7AA 3IACA 2ISDA 3HQOA 4NUWA 3TYBA 4IIEA 2YYTA 1W5NA 1GPFA 4MKSA 3TSMA 4DYJA 4R3UA 2C6QA 4D6DA 2DVTA 3T2OA 2YW3A 4F0MA 3WH5A 1VFUA 3IIVA 3VABA 2QPXA 3KBVA 3OOQA 1V03A 5BOOA 3WFLA 4WD0A 3SRFA 3VNLA 4DRSA 4UOZA 4RPPA 2CESA 1UD2A 2WANA 4ZB0A 3PN8A 1EX1A 5E0FA 3DUGA 4JIQA 3REQA 3H53A 2IMRA 2HJPA 2J8FA 1L2QA 3N25A 3RXZA 3FJNA 4BHYA 3FGCB 1CGWA 4C6EA 5G2IA 3FK4A 3W1UA 3IIPA 3QR1A 3DFNA 3LK6A 3P5ZA 2A3EA 3AMKA 3WQPA 4S3JA 2Z7KA 3RN6A 5BNKA 2QIIA 3BPWA 5KZDA 1ZALA 3CUFA 3G3DA 4KWUA 4NI3A 3TAOA 3EOUA 1ESWA 3VC6A 1V0NA 2PWGA 3SEPA 3WD0A 4AUBA 1TJ1A 4RLIA 3WNKA 4X9SA 1RBAA 4DLMA 4PCSA 4WKFA 3E0IA 3VZXA 1FH8A 3THAA 4IP7A 3GTFA 1LG1A 1VGAA 4UQBA 1VS1A 2O9TA 2G3NA 5CJNA 3VD3A 4NL1A 1OINA 1BPLB 3KRZA 2CKRA 2QV5A 4AWUA 1PIIA 1PAMA 4U4MA 1Q6LA 5HNTA 1C3FA 1DE6A 1KBBA 3RJXA 1A3HA 1H60A 4AXKA 3FKKA 3VTRA 5H91A 1SR0A 4WHBA 3CQ0A 4O57A 3NWRA 3MP3A 3DGRA 1M03A 5DMLA 4LS2A 2QCNA 4DIAA 3NEHA 5DXYA 4C6BA 1P6BA 1XBXA 1TWWA 1KWGA 1JIBA 4QSHA 1WKEA 2FMNA 2X2GA 5FJIA 3V16A 4U3AA 4A8NA 2VDGA 2PURA 3N14A 3M0MA 3BCDA 3OIXA 2HCVA 4E5TA 3ZJ8A 3HTWA 5DBUA 3L4UA 3FHQA 2BY1A 2XN1A 4P8UA 4R7JA 2GSJA 3NXLA 1JZ2A 3GDRA 2WSYA 1XYCA 3PPHA 4Q4PA 3EDDA 1A0EA 4ASTA 1W5OA 4UWMA 2WHLA 1W9DM 1U5HA 1DJZA 2OR2A 4M81A 3TOYA 5A6AA 4NZ1A 5A6KA 1VJIA 2DDXA 1SJDA 3FNDA 4JHOA 3OHIA 2Y8UA 3WFAA 5XINA 2XISA 1E15A 3WH8A 2XM1A 4UTHA 1WCGA 3U8GA 3FDGA 4GACA 1SGJA 1CECA 1NFPA 3BE7A 4HJWA 3TZNA 3HQNA 4GRSA 4J3XA 1NQ6A 4XZLX 1XRSA 1R5YA 1F3EA 2ZRVA 1XICA 2ACQA 1RCOB 3R25A 4UOQA 1P1XA 4HU4A 2QDHA 1BFNA 1RBLA 3E6EA 1RJPA 3DH7A 3BZJA 4QE5A 1B3ZA 3KDOA 1XWYA 3VKAA 3TC6A 3HG4A 3SDOA 1HJXA 4X2PA 2J6XA 3T8QA 3U4AA 1U1JA 2OFJA 4MHBA 3UZXA 2ABAA 3CIVA 2HS8A 2P0IA 1TX0A 1FDJA 3WDJA 3AZSA 3ARVA 4AF0B 4UFKA 4GX8A 4Y90A 5H2ZA 3NA8A 4AD5A 3NXFA 3E02A 2HWGA 3EKZA 3UXKA 1D3GA 1HP5A 5K9XA 4V28A 2X1RA 3GHUA 1KCKA 4IIGA 4L80A 4CEXC 4Q4MA 3S5OA 4AZHA 3MB9A 1U2YA 1V08A 2OLHA 2TRSA 3Q4DA 3W2KA 3WF2A 3R0DA 3BLOA 2DZTA 5CSRA 1E73M 2P10A 4ZMGA 5CLWA 2PDLA 4LH8A 1IT0A 1QJWA 3GAKA 2PAJA 4S3FA 1W91A 5AHLA 4MOZA 2WMIB 2ZZ7A 3TQPA 2ZTKA 1KQZA 2QUTA 4Z2IA 4XBJA 2NW0A 3VIJA 1ZTVA 2BHZA 4WLCA 3ZO9A 4QRNA 2G3MA 1GG0A 4CEUC 1KM1A 5AECA 4N7QA 2VD8A 3WKZA 3W2MA 1AVAA 3KWSA 4PBGA 4NJIA 1I60A 4U10A 1MUCA 3K30A 1S5WA 3TA9A 2PDYA 2FPVA 1MSSA 3E74A 4YJ5A 2QMKA 5IOBA 2NV1A 3RGTA 3IRSA 5CSSA 3MKVA 1GWJA 4J3TA 5CG0A 4PMVA 1RQHA 1DIOA 4XIMA 2OCZA 1Q13A 3OVQA 2AQWA 5J5RA 2WSPA 1VD6A 4PTWA 1TWZA 3M5ZA 3H2NA 2GQ3A 1AK5A 4OTKA 3M0XA 2A5HA 3U2EA 4BI7A 3P74A 4BR1A 4DZIA 3LCGA 4RPQA 3CO8A 1XINA 1J9YA 3MJMA 1UJPA 4H04A 1CGVA 2PWEA 1TCMA 4P8WA 4YHEA 5HBFA 1T8XA 4CN6A 4AIUA 4DJFD 4KERA 2X05A 3N15A 1TQJA 1X98A 4AC7C 5DT5A 2GJPA 2XGZA 1IT8A 4UNLA 4N4QA 1W37A 4RK8A 5C0QA 3TWAA 4OWGA 2XN2A 5C2CA 4OBTA 2PODA 3KTSA 5EY5A 2GDUA 3T07A 3DG7A 4QDPA 4MADA 3PUGA 2VOTA 5F7UA 3HPXA 1MNSA 3WQDA 3U3HA 4PMZA 1EF2A 3WK0A 1W9XA 5A8MA 4JTCA 1JCMP 1J79A 1BKSA 1JUKA 2HPIA 3S1WA 2OZ3A 2OQLA 3BXWA 3P8IA 1O5RA 4R27A 2Y85A 4A3QA 4Y6GA 2FPYA 2J4GA 3O1NA 1E0UA 2Y89A 3WJSA 2VRKA 2VFDA 2WAGA 2CBIA 4E2BA 3P84A 1DEDA 8RUCA 3PJUA 1IR1A 5DCEA 4UCFA 3WY1A 2E1DA 3PTDA 1JRCA 3T81A 1CGXA 3MI6A 3SCOA 3N2MA 1AG1O 1F3WA 2A2IA 1NOFA 1OGBA 4FZIA 4W7WA 3UR2A 2FGBA 4PMXA 3UWYA 2YXXA 4P8XA 1GTEA 2XH7A 1UH3A 3H54A 3W75A 1Q7ZA 3VMNA 1HQTA 1HKWA 1NFBA 4HVXA 4UBPC 3HMJG 4B4FA 4DHGA 1JG9A 4NZ3A 3SFKA 1RQBA 4XSMA 2C71A 1C8QA 2ZXDA 5XIMA 1W1VA 2WJZA 2UY4A 1JCLA 1EC8A 4HYRA 4I5RA 1Q6EA 4E3TA 3OZMA 3ZJ7A 1MMFA 3QFEA 1K7EA 2CLMA 5M3WA 5GPRA 3QY8A 3CV7A 4ZQMA 2PLMA 1GJPA 3MS8A 1MW1A 2ZVIA 1P4CA 4WGXA 2OX4A 4YIWA 4H8NA 3M46A 4NQ1A 3E96A 2ZXBA 1R8LA 1YTDA 4J5NA 2XVLA 4ICCX 3BSHA 3N6HA 3R43A 2AQOA 4UCGA 1OADA 2Q8ZA 3E0FA 5K9DA 1CXHA 4DJEA 2R91A 1CCWB 1GQJA 4JTEA 1ZAJA 4M6PA 1XLFA 4BQ2A 1U5VA 3VDCA 1C91A 1K9DA 4RR4A 1QPRA 2NUWA 1H09A 5A6SA 4D8LA 4UR9A 3STEA 1Y7VA 2PDNA 3A5FA 3OGRA 3CUXA 1WDDA 3COTA 2Q3RA 5HNUA 4HQVA 1KXHA 2CLIA 1PDYA 5D9PA 1GCYA 4N2YA 4GD0A 2WVVA 3BOXA 4G2DA 4PODA 3WLRA 4JN6A 2P3ZA 4DELA 3W07A 2YDSA 2DZSA 3LM7A 1MEIA 5DQPA 3T0BA 3HFYA 3TN3A 2W62A 3VNYA 1XCXA 4MY9A 1DWJM 5FF4A 3SCNA 4JGDA 3QQWA 3A5VA 5HUOA 5JXQA 4H41A 3HG5A 2X1IA 4Z1BA 3QSTA 2X7WA 2BLEA 4S3EA 1MNZA 3FN9A 2E7FA 2PU1A 5EGRA 4GKLA 3GH4A 1KD0A 3RNDA 4JFTA 2PDXA 2BGQA 1LQAA 4C7GA 4Z42C 3PG9A 1KXVA 1GKRA 1EJSC 2ZRWA 5CPQA 4XAYA 2RJHA 2Z1KA 3QHMA 3VE7A 4AHOA 1JZ8A 1Z8AA 2VZVA 5DO8A 3FA3A 2JIEA 1TV4A 3L4WA 1TREA 1MDLA 1UR2A 1OCQA 1EOMA 1YEYA 1XXXA 3MYOA 1A3XA 1DBTA 4P8VA 2FB3A 5TAOA 5H8UA 1JL8A 3QJAA 1TPVA 4V15A 4NX5A 3GXMA 4LRSA 3ABQA 3KP1A 1ZNNA 4GKTA 4ATLA 2BVTA 3G0XA 1KM6A 2IXUA 5DX7A 3VIOA 2XIQA 3NZPA 3A13A 4M24A 2PTZA 1E6ZA 4DBUA 2ZX6A 1EXBA 3MBFA 1Y5WA 4W89A 4IX2A 3CZKA 4PC8A 2WQPA 3M5XA 3NFUA 4JS3A 4N9DA 3WBAA 3MKKA 3CPGA 4P2VA 3IUIA 3AZRA 3VO0A 1G67A 4GFSA 4OV4A 3RMJA 4N6EA 1BXBA 3UJRA 4ZXLA 3B4UA 3VCNA 4MDOA 4AYGA 1M3UA 1M5WA 4Z0JA 4MJZA 1WZKA 2PU0A 3BTNA 4B5SA 3UYIA 3NGJA 2DJXA 3L9CA 1W2PA 5AHMA 3NIYA 3WH7A 3GRIA 5CPOA 1VC4A 2ZX7A 3KE0A 4DXVA 3PB2A 1UP2A 4X61A 2J25A 1WOAA 2MANA 4ZOAA 3U2ZA 3TTEA 4WSJA 4H6EA 4DM1A 1VB9A 3QYQA 1W3TA 4Q8UA 1TTPA 1KBKA 4H9UA 4CVUA 3W88A 3A23A 4A3RA 2V5KA 3QC0A 3DC8A 1O12A 3RLHA 1DXIA 2XFFA 2WWCA 1LTDA 3OG2A 1FP8A 3B05A 3EBVA 1G9HA 4IMFA 2J7DA 2IUZA 1D9EA 1CYGA 1B3WA 2WM0A 3EX2A 3DBNA 3BJSA 1SFSA 1T40A 4J35A 1VCVA 3IRDA 1K6AA 2CFFA 4J3VA 1LUCB 4IMAA 1IXPA 1NDVA 1ONEA 3PF3A 4NXSA 4XKYB 4EXQA 3N13A 1FKXA 3CWOX 3NVDA 5T8GA 1AFSA 2QAFA 2X2YA 4JEJA 2IPJA 1L6SA 1XUZA 1RVKA 1EBHA 1E1CB 2EEXA 1F3XA 2ISSA 4FXJA 4US5A 3N73A 2PGWA 1PX4A 1W5MA 2HE5A 2ZZ2A 3O16A 3DG3A 3T0TA 3VC5A 3H21A 1YRRA 5LIUX 1PVNA 1WBJA 4Y2WA 1DWIM 5KEZA 4HNLA 1DJHA 3WF0A 4LYRA 3G8RA 3PPCA 3UESA 3K1GA 5AC7A 3EXRA 3WQCA 1PCWA 1FWAC 3UXAA 3GR4A 5DN1A 4WOQA 2X1UA 3W7DA 3OBEA 4MSSA 1XLHA 5JIWA 3WZ0E 3UP8A 3WF1A 3OZOA 5EMLA 2VI0A 2R6OA 3VM7A 4C1KA 3H2FA 4ATWA 2J27A 1YDVA 1QRQA 4UQDA 1F74A 2VXNA 4EX4A 4KF1A 2E9LA 4G9PA 3UG3A 1DWAM 2Z1SA 4LUTA 3S3GA 5A6TC 4C90A 3VDAA 4AISA 4IGNA 1UR3M 2R1LA 4DXXA 3EKGA 4AZGA 4ATDA 3GS6A 5G2HA 3FX4A 2PGRA 9XIMA 4RW3A 1JYNA 2CW6A 2PP1A 5EKYA 4JYDA 1E56A 2WKGA 2OO0A 2Q01A 3ZR4A 2W66A 5FSDC 1E4NA 5CAHA 3LBOA 2G3FA 4I3GA 4MNMA 4EPBC 3KBSA 4DZAA 1PIGA 5GJNA 4PSPA 3UNTA 3RYSA 1YDNA 2TSYA 3O7UA 4NI8A 4DBDA 3UWQA 3C8NA 5HJLA 2WPBA 3IJDA 3OYZA 4DUVA 2F6UA 4TX6A 1MEHA 2J9ZA 4C5ZA 4PTDA 3GX9A 4GOAA 5BOFA 1N8WA 1KKOA 1JZ5A 2RDUA 1PL9A 3Q67A 1EUNA 3NUKA 5C9ZA 2Z2AA 3ORWA 2EJAA 2E3ZA 3UPMA 3EOSA 4JFSA 1KCZA 4MKVA 3RCYA 2B81A 1CXLA 5REQA 3DYOA 1SMDA 3N6JA 1OJXA 1YXDA 4IPNB 4DYEA 3TTSA 2GUBA 2PWHA 2B7NA 2UY5A 4S38A 5KZMA 3D6NA 3GG0A 4F9JA 2J66A 3VD5A 1S5VA 2HPMA 2BFGA 3TEVA 2O9PA 3TR2A 1XDJA 5AY7A 3PSVA 2ISVA 4PBEA 4GUFA 5SWUA 2YBUA 3NSNA 1X1OA 1SSDA 1T99A 3E38A 5CGMA 3A3XA 4H9XA 1GHRA 3MW7A 3ITYA 4HBKA 3G1VA 1AJZA 2DP3A 3UZZA 3VGHA 3L4YA 4R85A 4FOKA 5AC8A 2PEVA 3QV9A 2QS8A 2GJXA 4F4RA 3CC1A 4MUZA 5KZEA 4WUIA 4QS5A 3W71A 1SPQA 1KCXA 1Z44A 1YBQB 2L5HA 2PDJA 3S2LA 4BF9A 3IJ6A 3RK8A 4LJ3A 1FDYA 4X0NA 3HURA 3SZ8A 4MUPA 2XUCA 3AUOA 3WENA 4B90A 2POTA 1REQB 1E4MM 5AHNA 2V63A 1PWLA 5BRPA 4MKNA 3E3HA 2XINA 5FJJA 1FWFC 4D71A 1TTJA 1ZUAX 1JDFA 3GR8A 3KOYA 2H8XA 2J7BA 3W2NA 7REQA 4V2XA 4H1ZA 5GJMA 2VKZG 4F2BA 3TN5A 1IEQA 1XC4A 4Y96A 5A6LA 1RH9A 2FLIA 3O6CA 4W7VA 1OFRA 3XIMA 3WUBA 5G4HC 1JI2A 3LB0A 4DEFA 4CN4A 2D2JA 3F7JA 4UTWA 3N2BA 3UGVA 1EWEA 2NQJA 3ZFHA 2ZCGA 3E5PA 3BLFA 1CEOA 4WJXA 1QPQA 3W38A 4Z1AA 3CV1A 2OB3A 4S2CA 1FH9A 3TXZA 4ICMA 3T7VA 3T78A 4A3HA 4RE4A 3WJWA 2VVSA 1PO9A 1SYTA 1GYMA 1DQWA 1FWGC 2BHYA 2OYMA 5FL0A 3BWWA 4ERGA 3CAWA 3N12A 1H7NA 1UPMB 1RJQA 4UTJA 4AYSA 1OWQA 4QAWA 3ABRA 4MIMA 1C8XA 2F6XA 4XKMA 2DZUA 2G97A 3THUA 4CNNA 2WNZA 1M6JA 1KFBA 1ME7A 3APYA 5E0CA 1K8ZA 4TV6A 5B80A 1G69A 5M1TA 3KW3A 4J7RA 1F2JA 3GH5A 2BXZA 3GW3A 4Q7BA 1NOWA 2YCIX 3S9YA 5AVNA 6TIMA 3DFSA 4HMEA 3GG8A 3G5EA 3WLKX 3KDNA 3GUWA 2W5FA 1LLOA 2YA2A 4D8AA 2GPTA 3T44A 1SR9A 1JGMA 2VT0A 3IS4A 3ONCA 3SCPA 1GKQA 3EB3A 2EG6A 2IS7A 1GVYA 4DUXA 2VEPA 3KLLA 4CKQA 1E3XA 3S1GA 3GBEA 3WK3A 1B9BA 3QLDA 4FNQA 4GI8A 4NJHA 1D3HA 4W7UA 1N2VA 1QOPA 4B2DD 2WXDM 2ZRUA 3V36A 5DBTA 2PP0A 5D4YA 3LGGA 1LQ2A 1UWTA 4DWSA 1TA3B 3LBCA 2D2OA 4E4FA 3TSDA 3NDZA 1BVWA 4KIEA 4LCQA 1ELSA 3RG6A 1ZBKA 5ABFB 4E4PA 4MJ4A 4ES4A 6TAAA 2ISFA 3A6OA 2I16A 1IE7C 1EA0A 1V3IA 2Y8VA 3L5AA 4IQJA 3B9AA 4PUJA 2PCQA 2C0AA 1EP2A 2IPFA 1UC5A 4WY0A 2CXGA 4DJFA 2I56A 4OHQA 3D3AA 2J9XA 1P48A 4LNYA 5DMMA 5I07A 1HO4A 3LQGA 1CW2A 4ZVJA 4XZNX 2GOKA 6ALDA 2V5JA 4K1WA 5AFDA 1A47A 2VQTA 3QMRA 1SUXA 4JX6A 2YGYA 3BMVA 4TXEA 4DYKA 3PBWA 2WZIA 2XFWA 1E72M 3CL8A 4QEEA 4A05A 2Y7EA 2J24A 4JTIA 4AZBA 4JQ1A 2VFFA 5CSUA 2P88A 3H7VA 2J7HA 4LVDA 4NZJA 4EXBA 1XH1A 1KFJA 4CQ9A 2R1MA 4ZA0A 2VP8A 4IZGA 4N9BA 4QXIA 3QZAA 2IKIA 2AL1A 2Y4SA 1J4EA 5CLTA 3RLVA 2GJRA 1S39A 1XHGA 4GCXA 1V79A 3O3RA 3VGEA 1C7TA 1ZPTA 3WUGA 3LHUA 5LGZA 2XPKA 1EJUC 1P0DA 1GOWA 3OLDA 5M03A 3F4DA 1AW1A 4LAZA 1A5BA 2P5NA 4IIFA 2A3HA 4L1XA 2QAPA 3P80A 1MXDA 2QUVA 1XUUA 4U5IA 4GC3A 4Z1YA 1K8YA 3ARYA 3NURA 4K1GA 1NDZA 1XW8A 1ISWA 3GR7A 4OE7A 4B92A 1XBYA 4NILA 1WB0A 1WKFA 1ONRA 1V02A 3VOIA 2FZ8A 2QT3A 5ECUA 3W70A 3TW7A 1OT1A 4PN2A 3GFXA 3HPFA 1JD9A 2OYKA 1SJCA 2PC8A 4RXGA 4KEMA 1B5TA 1Q6FA 1K70A 5D37A 2WSQA 3UWEA 3P5YA 3UFYA 2OO6A 2OLSA 2DQXA 1BRLB 3APTA 4HZ8A 3W81A 4IQEA 1IIHA 3OW1A 3SN0A 3MV01 2QIWA 3LCFA 2A7NA 3PTMA 5G4EA 3PY2A 2OWXA 4KGJA 5KTLA 3IIOA 2HS6A 3EKLA 1KFEA 4LBUA 1TSIA 3W27A 3ONBA 3GU1A 4HMNA 3MHUA 4B5XA 4GYKA 1XSJA 4MGGA 5DRIA 1K9EA 3HA1A 3GE7A 1F5ZA 1R9ZA 4C6PA 1R6WA 1T0OA 2ZRZA 4LUYA 5CGQA 2XZ7A 1P5BA 3GWQA 2QQ6A 4NHVA 3ABOA 2F84A 4DZHA 2VTFA 4U28A 1QK2A 5I3IA 4IPPA 1XX1A 3U6WA 3G8EA 5DRCA 3MMWA 4IWWA 4P7QA 4CQDA 3L67A 4ADSA 1PBGA 3GHTA 2PRHA 3VIMA 3DBPA 4DBSA 2YPIA 4PMUA 2PDGA 5IFPA 1ZRQA 2D73A 3VKBA 3AAMA 3I3BA 4G1NA 3IV8A 3PBMA 3URQA 2XH0A 2YXOA 4HHPA 2QR6A 5I3FA 4BJHA 1NSJA 1QWKA 2PTWA 4F0LA 3RCMA 1ALDA 1HZYA 2Z1XA 3O6DA 4IFKB 1OFBA 4ACZA 4K8HA 1GVQA 1DWGM 3F4WA 1W5QA 3R1ZA 2A6NA 2GSEA 4WEVX 1OD0A 3CYJA 2PDMA 5FEWA 1LL4A 5JIPA 4TR9A 2VD9A 2VCBA 3AU2A 3CQJA 4PULA 3MCMA 1W17A 3VVGA 4LBRA 3MUXA 3AU6A 4O16A 4BF7A 1W3KA 1MRQA 3KWXA 2YOCA 3H23A 3BGAA 1KLZA 5HQEA 3CH0A 3AROA 5I77A 1B90A 1X1NA 3ANUA 4DPQA 1QPOA 1J6PA 2A7RA 2QCDB 4GI9A 4ZOBA 2IKGA 1QOQA 1H41A 3CHEA 4GHRA 1E6PA 2CETA 1W1YA 2OQYA 1JUEA 3FCPA 1LWHA 5I3HA 4Q8MA 4N0RA 1Q6QA 3UPBA 4KT2A 1OFQA 2CLKA 3ABSA 1T96A 1UD5A 5FJTA 1E6NA 3HO8A 2V2DA 4O53A 1N8IA 3RMEA 1R30A 2DUZA 3EOOA 4XZIA 2X41A 1B3XA 1PX3A 2CKSA 3HQ1A 1UD4A 2QGYA 2WPGA 2FZBA 4IPJA 4RL3A 4H6QA 2ZA2A 4LWWA 4GH1A 5CCZA 1JULA 4XIAA 2GUUA 2CLEA 3QW3A 1KM2A 1EHAA 2EPMX 1HL2A 4GUHA 4DF2A 3BARA 1E1FA 3DIPA 3O0FA 3LERA 5A6MA 3N2OA 3SO7A 1FRBA 3U7BA 3EDJA 3YPIA 3TUUA 4Q4RA 2Y24A 1ZBCA 3OA3A 2Y1HA 1TWDA 1P7TA 2PWDA 1G6CA 1H50A 4P61A 2V6AA 3MP5A 1GORA 1XDMA 2PTYA 4AWEA 1YNQA 3DEQA 1A5NC 1BVZA 5LYRA 3BICA 2H3DA 1LWIA 2J77A 1WZMA 1G4PA 2HVOA 1S46A 5IDIA 1DV7A 2AAAA 3EB2A 3VKCA 1V3KA 2ZWYA 4QFUA 3HIJA 4F2UA 3GYEA 4NAFB 3SQSA 1E6XM 1GK8A 3VKKA 1ITCA 3L0NA 3VFCA 3NQAA 5FAJA 3B9DA 1O94A 5U4NA 4AIBA 1C8VA 3WL0A 2BHUA 4OU1A 3W7HA 2QCFA 1XIEA 1Q3NA 1E55A 1EA9C 1PCKA 4D6HA 1S1RA 1YNPA 1CZ1A 3BH4A 2ZC8A 3FSTA 3WNMA 4AD0A 2V30A 3UCDA 1ZSXA 2XYLA 1GQIA 3PFMA 3B4YA 2A1YA 3WK1A 1IEVA 4XG1A 4QJ1A 3N3MA 4QE4A 3AHXA 1E5JA 4X3ZA 4D1JA 2RKXA 4EP8C 3SJ3A 4LS0A 5HMFA 4BWLA 3NQFA 1NDYA 1X6LA 3AXKA 2CLHA 3N34A 1KM4A 4YMZA 1XRVA 3SJNA 3WEZA 2KZHA 2BASA 1V8EA 3M0IA 1TV8A 1K6WA 3FGCA 4K3ZA 4C6IA 4GY1A 4K6AA 2PUZA 2AGKA 3S1VA 1XSKA 2YXGA 2AOSA 2H9AB 1W1IE 3W7CA 2O9OA 1T8QA 4J1OA 2DIEA 4HA0A 3HOJA 1RCXB 1PHWA 3UY8A 4J4KA 1MYRA 4AZIA 1LQ0A 3NOYA 3BK0A 3FA5A 1A49A 4BCEA 5FIPA 2RUSA 1B0IA 1HGWA 4A3YA 4LUJA 4JTUA 3SRKA 4A6GA 1F8IA 1JDCA 2D0HA 2NV9A 1A5SA 4Q33A 4CD5A 1TO3A 2XDFA 1W54A 4WX2A 3SCSA 4JAWA 1R2TA 3ZLHA 1H62A 2QJMA 4Q8QA 3RDKA 1EOKA 3CPUA 1XBZA 2KX9A 1BF6A 3SCWA 3WNNA 2NLIA 3LGDA 1MUMA 4JYFA 2FVKA 3VU2A 4HZ6A 3CQKA 1LLWA 4GY0A 1B57A 1RLDA 3PFRA 1VFHA 4QJ4B 3W76A 4R33A 1XSIA 1OQFA 2NXHA 4E38A 2X1TA 3W7QA 2GGHA 2VX4A 2Z1BA 2DIKA 2F38A 2QULA 3C4UA 4JN7A 3EPNA 4ZTXA 2DSWA 4GUGA 4JPGA 1XLEA 3AISA 3I7RA 4UB9A 1V6VA 3T9PA 4UQCA 1MVYA 1FCQA 1WXJA 1TUXA 1WO2A 4EVZA 2YX0A 2DT0A 4AEOA 1OIFA 3BQ6A 1SO3A 1CTNA 1LOLA 2ON3A 1AD1A 2VFHA 3GB6A 4FP1A 3WJZA 1XYBA 3N11A 4JQAA 2WK2A 2OELA 3CM4A 4AHQA 4L4PA 4XZ9A 1AD4A 4KBXA 3RUBL 3ID7A 1F6PA 1PXGA 4J3SA 3H4GA 4K39A 1S5MA 5CZJA 2D23A 3QEZA 4TTGA 4IGHA 3STCA 1SJAA 2J78A 3M0VA 1OX4A 2OT0A 1Y0EA 4GVIA 1A4LA 2Y7GA 5AKQA 2FZDA 4YS1A 5AN7A 1WAUA 1FX6A 2DFAA 2XGIA 3SCRA 3V5CA 4Q6XA 1Q6DA 3C0JA 3ZLFA 5C6MA 1DJWA 5HOSA 4KRUA 5BMXA 2E9MA 3IJ9A 3P14A 3MC5A 1TWIA 3GVWA 3PBVA 3DHUA 2XJ7A 3VMPA 2Z7GA 3NGFA 3W2UA 1B2YA 3VI2A 1W3IA 1UZDA 3B8UA 2O7QA 1ISZA 2QCCA 4XAFA 4KFOA 3GC4A 2QV4A 2DT2A 2I17A 4RDYA 3G1SA 3I10A 1K4GA 2QZRA 4CGTA 2YFNA 1B4EA 1SZNA 2VOMA 1MFVA 1E9LA 1GQNA 2FH8A 2VFIA 1AH0A 6CGTA 5CEWA 3GFYA 4CU6A 4CNOA 3M5YA 3SCVA 1O5QA 4JXCA 2DEPA 5I3GA 3M07A 3SADA 4E8DA 3MYPA 2C18A 3W02A 3RM4A 1GVIA 1TV3A 3ZJKA 1QFEA 3GXFA 5A8OA 1QHPA 4YVXA 3DKLA 4GUIA 3ZT7A 2CBJA 4A3UA 2WMIA 4ORMA 3LM3A 1EJXC 4HCHA 1PKYA 3PK7A 2ZA1A 2CZ5A 2O4QA 4RW5A 2VX5A 5JQ9A 1DHPA 1M7PA 4TUFA 4B16A 3QY6A 3PWIA 1SO4A 1XFBA 5I02A 2JEQA 2YCJA 2DW6A 3GKAA 5EBUA 3S2JA 4NKCA 1JCYA 4DVOA 1IXNA 4NNBA 2FGZA 1ICQA 1EL3A 3G1DA 3RHGA 3W6YA 4JTAA 1JCTA 4NZ5A 4E6MA 2WZEA 3UR8A 4Q8NA 4DF0A 1Q66A 4PGLA 2WBGA 3W25A 3W1TA 4PEKA 1UKSA 4HN4A 2Z4GA 4HYVA 4HZ7A 5CXPA 2C13A 3CL6A 4XV0A 3MUZ1 1FY6A 2FZ9A 4HIBA 4HPGA 5E6YA 3TVAA 4L9XA 3M0HA 1L9WA 1ZCOA 1Y5VA 1KA9F 3PS7A 1QW7A 3TW9A 4ERAA 3BAIA 2OGJA 2TAAA 3UZ5A 4YLWA 4B91A 4ROPA 3KZPA 1KW1A 2NWSA 3H24A 3E2SA 3RPMA 4AZCA 5H8PA 4TTUA 1DQXA 2P53A 5CC5A 4H3DA 1TMHA 4KCWA 1IEWA 2CHNA 5K9CA 3GDBA 5AZ0A 4KS0A 4B2DA 4I5XA 1ISVA 4LVAA 2WMFA 2XFYA 1IWAA 3TQKA 4L5ZA 4WOZA 3ICJA 4H01A 3WELA 1KBLA 3O2LA 4PTMA 1QPKA 3WBXA 1QVBA 4R7WA 5LNUA 4AWTA 3H26A 4TVUA 1U30A 3U2OA 4J2PA 3KOZA 1UCWA 4JY8A 2V5DA 5I0DA 3C5QA 3PSWA 4Q22A 4O18A 2WCAA 3DHDA 1EJWC 3HU7A 3VOCA 3SM0A 1MW3A 1SO5A 1R46A 3W7IA 3EGJA 3A24A 3C8FA 1GJUA 3LDVA 3OHMB 3BJFA 1W9PA 4XTIA 4BQ4A 1EXPA 1QHZA 3TR9A 4MWAE 3N9RA 3HPZA 3IAPA 3GTNA 4K37A 3W28A 3KEHA 5EYWA 2V5LA 3FAXA 4ZODA 2ALDA 4WVXA 3QF0A 1JPDX 2Z6JA 3BG3A 4JQ4A 3RLUA 4CCDA 3BURA 1GOXA 4AAJA 1PZ3A 2ZX5A 1NEYA 3T42A 3AO0A 4CNSA 4XD4A 1GZJA 2DZVA 4I5UA 4WZHA 1RD5A 4GK8A 1YMYA 3B0VC 3UQNA 4MWAC 3W22A 5FF2A 3AYRA 3GDLA 4GABA 4D8ZA 2X7VA 1WDPA 3PZMA 3RX4A 4A8IA 2CZDA 3NCOA 3RITA 4AX6A 4O17A 4R9XA 3GNDA 3RU8X 3GQYA 3IVTA 1Q8AA 3R89A 1TPEA 3ZT5A 4M6VA 1XBVA 1W9BM 3SURA 3TMQA 4D6IA 1GG1A 3KS6A 2A7PA 2CBUA 5FF3A 5DT7A 4N4PA 1XPYA 3EX6A 2X1SA 4H9VA 1MI3A 4LQ1A 5B7ZA 3PANA 1LRNA 1NP2A 1BGAA 3G6LA 4HNTA 1RV8A 2W0UA 4C5YA 4PMNA 4I6KA 3WDPP 3EX1A 3KCLA 3DFTA 3BDKA 4LEFA 1SW7A 3S5NA 3W7RA 4N9CA 3S2MA 3UZJA 5IFTA 4LYQA 4H6RA 2XFRA 1VBRA 3T0CA 3LXCA 5CBBA 2VR5A 1A4MA 4M82A 3M7WA 1TVPA 1E4IA 2BVDA 4EXAA 2E0PA 4PTVA 1R2SA 1TTIA 1EH9A 2V5CA 1J96A 2EAWA 3MTWA 3N2XA 3PTQA 3AC0A 1K4HA 1JZ6A 4ZO9A 2EXOA 4D6GA 5CC6A 5JH1A 1GOMA 3CO4A 4LYPA 2PLCA 2WNWA 3USBA 3RR1A 3B8VA 1PKMA 4XO6A 1WPCA 1AQMA 3VD4A 4CQCA 4XX6A 2DZPA 3CHCA 2VZUA 3CK5A 1B3OA 1OABA 4Z2LA 1UG6A 1O1HA 2QGHA 3BW2A 2RFGA 4NZCA 1ZHAA 2W79A 1FWDC 4KRTA 1FHUA 3C52A 2GYIA 3VX0A 1CB2A 1UQYA 3S1XA 4KCTA 1WKYA 4X60A 4PCTA 4QEHA 3NPWA 2Z1WA 1OF6A 3W82A 4O1AA 3MBDA 1BEUA 3IK4A 3POHA 4UTKA 4FXSA 2Q09A 2E9BA 5AC6A 1KFLA 1FWSA 3CZGA 4ZFCA 4G7FA 3UYCA 4H7VA 1XIFA 1VJZA 4ZQRA 3QLLA 4FB7A 5A2BA 3M64A 2ZZ4A 4RDZA 1KTNA 1QBAA 4AZ5A 5JVLA 1H1NA 3O9NA 1BAGA 3MP4A 2CLPA 2I7GA 1NTHA 1O60A 1JDEA 4QBXA 5E1QA 1PB0A 4L1GA 3TC3A 5BROA 1TB3A 1XQLA 5BXTA 1MZRA 3MO4A 2D2GA 3C0QA 3EEZA 4QM1A 3BOFA 4E2DA 3PBGA 4L1WA 3CIWA 2J7FA 1PDZA 2G5WA 2CNCA 3PJWA 3OPSA 1L8PA 3BLKA 3UR5A 1CBGA 1Q8JA 3ITLA 3DESA 1BYAA 4X9YA 3Q37A 4IFOA 5AHIA 2NVAA 1W31A 3E1F1 1FVPA 3UXIA 3HV8A 3PNZA 4EKJA 4H9MA 1UWUA 4MZ1A 3V5OA 3AMDA 2QUUA 4C6QA 1XL9A 5IBXA 1TVLA 5D9MA 1CDGA 5PTDA 4FMVA 5DF0A 1EO5A 2G50A 1F4AA 2PGEA 1B31A 2DY3A 5EMMA 4DAIA 1F4HA 3G1AA 4XBKA 1CWYA 4Z08A 3ITGA 2GJLA 4S3BA 1IZKA 1RPXA 3BAKA 1KR0A 3R0UA 3C0SA 1XISA 3O8AA 1U33A 1XC6A 1V6UA 1XI3A 4MPQA 3NDOA 2FTWA 1Y65A 1RY8A 1BKHA 5FACA 3I4KA 3KFTA 5BYWA 3GXIA 3QTGA 2PI6A 1P0KA 1WP6A 5D8WA 2V3EA 4NXKA 2PD9A 1X7FA 4UQ9A 2V2CA 2F7FA 3VGGA 4G6CA 2YB4A 5HDRA 1T6MA 3C2EA 4AG0A 1WAWA 1XRTA 2C16A 4FPSA 2YDAA 5TD4A 5A6JA 5BXSA 1LUCA 3WLQA 1DXEA 1G4SA 4XKYA 5FD0A 1EEPA 2W6RA 2DVXA 3I6RA 1EDQA 1T41A 2JALA 3VCCA 3ALGA 1S3TC 3FVMA 9CGTA 3ZQ9A 5HMSA 1IZJA 2Z24A 1AW5A 3SSJA 3TK7A 3M0LA 3EDKA 3EA1A 1ODZA 5MF5A 4ZO8A 3WEMA 3NQ2A 3TTQA 4AIEA 1XLAA 5JBDA 1XLIA 1E1CA 3TTOA 3LD5A 1BWLA 2OOGA 1V51A 4UTFA 3H8AA 1H5VA 3A64A 3N4FA 3QXBA 3OQ8A 3PJXA 2OSYA 1ENUA 2GDQA 1L6YA 2A79A 4H00A 5LA2A 1FBAA 5HWMA 2ZIDA 3R8RA 1XDLA 5IHSA 1F07A 4ZB5A 2G0WA 3ZLGA 3B8IA 3H70A 1TE1A 3M5VA 1QO5A 3BLPX 3NQCA 5GNYA 3CYVA 1DQUA 3QOKA 2XTKA 4MB5A 3GVGA 4MLJA 3G22A 3LXAA 4B3KA 1DOSA 4N42A 4YTRA 2XWEA 3DU0A 4CQBA 2PB1A 3W6MA 5BCAA 3ABXA 4I6VA 1FCVA 4O12A 3VNMA 4QLKA 1X7IA 5M17A 1K8CA 2OEJA 3D46A 3QYSA 1YTKA 3EA2A 1W3HA 4JCLA 4JFVA 3CJPA 4IGSA 4OFCA 3WLTA 4E0CA 4FF5A 3HM7A 3HPAA 5A8GA 8XIAA 3S5ZA 3TA6A 4YN5A 1J12A 2DVUA 2YL9A 3KRBA 5C70A 2C19A 4P7OA 4RE2A 5D38A 1OSEA 3B9EA 1EJ7L 5RUBA 1XM3A 1VPXA 2YLAA 3MT1A 2OVLA 3LHYA 1BYBA 1CLVA 1CENA 3UJSA 3CMGA 2Y63A 4Y8EA 1SO6A 3FJ6A 1EYEA 3LRLA 2Z0IA 3ZWTA 5I3JA 3W2JA 4OQVA 5D09A 2HMCA 4L4LA 4JL2A 3GK0A 1VIZA 3LU2A 2WMJA 1WDWA 3AIBA 2WB5A 4UUIA 3AFBA 2D3LA 2BZNA 3WJXA 5BRQA 4MAZA 3S42A 3BAJA 1JXKA 4HTYA 1LWJA 4LFYA 1O95A 2CC0A 4E2VA 5IM51 4ZTYA 2ZA3A 3NAVA 2ZZ5A 3NQVA 2BNJA 1K9FA 4WXZA 4HCDA 5I24A 3JVAA 3UVIA 3AMCA 4XZHA 1YE6A 1MQPA 4K7YA 4DPPA 2WZTA 3N4AA 1P0BA 2E5CA 4P7RA 3FV9A 1KM0A 3PAJA 4Q32A 3T40A 1ME9A 4ZQCA 4K8GA 2BY3A 3ELFA 3TYCA 3TWBA 1DJXA 3BL3A 2W4XA 6A3HA 5KSWA 5B7YA 3NQDA 3QH2A 3M9YA 4MF4A 1V6YA 1A50A 4JIIX 1UBPC 5H8MA 5F4XA 3T4WA 7PTDA 1YBQA 3IK2A 4W87A 2HRWA 4NSBA 3K4DA 3TC7A 4IXHA 1XYAA 4WDWA 3UGRA 3LZ5A 3IANA 1LG2A 5HPOA 3TJXA 3BLEA 2YKKA 5LNRA 1REQA 5C71A 1MW0A 1XH2A 4PMYA 4AHPA 3AS0A 4BI6A 1TPC1 4UR7A 1XYZA 3CWNA 1UR9A 5K7JA 5FJUA 1OGGA 3R0KA 4RNFA 5A69A 3GNNA 2O4MA 1O7AA 1XLKA 1R9YA 5HJYA 1UMLA 4U5KA 2VVNA 1EEXA 2WLYA 3KBMA 1QTWA 1P0EA 4AWSA 3UWWA 4HA4A 1Z6KA 3LEPA 2VELA 1HFBA 3WLJA 2FHBA 1BWVA 2QMJA 3P7YA 4Q8TA 1F61A 3W7JA 3SUSA 2BP1A 4ZSUA 4Z2KA 4DO4A 4DNMA 1CNVA 1JNDA 1OFEA 2Y5EA 4OT7A 3WDHA 2CXEA 3F4NA 2CHOA 3WNLA 2Y61A 2AGTA 2J7CA 4NRSA 1VFOA 4FNUA 3PZ9A 1TCDA 2QJNA 4YWSA 2ZQ0A 3C61A 2DUAA 3UXLA 3V4BA 1F6YA 3TONA 4NAEB 1BLIA 3NQ6A 3E5BA 2W91A 1N8FA 1EDGA 1JGIA 3LCXA 1TYGA 3AIQA 4EWJA 1TFVA 1I1XA 1Q45A 4LAOA 2ZXAA 3FLUA 5CSYA 1O66A 4BK9A 4JIHA 3DI1A 3RPDA 3DYMA 3N9SA 3K8MA 2DSZA 1V3LA 1OC6A 1VYSX 2E25A 4WKHA 3TFXA 1W3LA 3AS2A 3CAKA 3GXPA 3R13A 3IJ7A 4MMWA 4N9EA 1SJBA 2ZZ3A 4QIUA 4ZENA 4B5VA 1I2PA 4LF1A 1GKPA 2RAGA 4PYSA 3OVGA 3STPA 3WQ5A 1L8NA 1RY0A 2WCSA 2PC4A 4AD2A 3QGVA 4OJYA 4FR6A 1R86A 3R58A 1JF5A 5LSMA 1OFAA 3F4VA 2BODX 2GOUA 4XAGA 5F4WA 3O6YX 2VZTA 1OX4B 1UUQA 2XVNA 2VENA 1RP9A 4OV9A 1TA3A 5T26A 3MMTA 5I2UA 2FKPA 2NSOA 1S2AA 1W2VA 1SSGA 5ABFA 4F0SA 4FXRA 3LQLA 1AJ0A 4JL1A 5LKYA 3W4RA 1VENA 4XQ6A 4GYPC 2NXIA 3P81A 3VPLA 3WQ6A 1MWOA 2G96A 5E5CA 3ZS4A 2VRJA 3RIKA 2RGMA 3VGFA 5L6UA 1J18A 2PGFA 6REQA 4JNYA 1ISXA 2TODA 3GY1A 5DELA 2BGSA 2A21A 5IRPA 3TJIA 3NOEA 2ZWZA 1A80A 3JZEA 2XH2A 1RA5A 1W0MA 1XYFA 2NX3A 1H7RA 5CBIA 1VEOA 5D04C 3WH9A 3VAVA 2B7QA 3SGGA 1EWDA 2WHKA 3MI2A 2PZNA 2CPUA 3CQHA 2V82A 7TAAA 3KS5A 4HA1A 4J2MA 5JMUA 2X09A 1UB3A 2FVLA 3IWPA 4AD3A 3TLQA 1RQEA 1Y5XA 1VRXA 1LJYA 4ZO7A 3NZQA 2CZFA 3ITXA 3LPFA 2R1PA 1Z48A 3G3MA 3C2FA 1JR1A 3F4CA 1WKDA 3GVRA 3NQMA 4UFIA 1J10A 4XUGA 3SB0A 4DQWA 1B4KA 1ZS2A 2ATSA 3H6OA 5JU6A 2F6KA 4HSHA 3PZOA 2OKTA 4JKMA 1ONWA 1UWIA 3CHDA 4GIRA 2GZXA 3K13A 3O06A 3C3NA 3LHTA 4X22A 4DUWA 4Q4SA 3H7RA 5E0KA 3M47A 2OLAA 4QNEA 2C14A 2VC5A 5AYZA 2VZSA 1TE6A 3S5SA 4TU1A 3EXTA 3QV7A 3BO9A 3QHNA 2O92A 2WOQA 4W5UA 1OX6A 1HL8A 4GA8A 4FLOA 3V1PA 1I4NA 5LHFA 3VK5A 2QCHA 4QE1A 1R38A 4S3DA 1VLIA 1EDTA 3HBLA 1GOIA 3T55A 3A12A 1UOKA 1W3NA 2WNQA 2Q8XA 1JYXA 1XKYA 1BRLA 1US2A 1MW2A 1C9WA 4M1RA 3WH6A 5AYXA 4O4WA 3LNMA 1OX5A 1ADSA 1GPWA 6XIAA 1AL8A 2YL5A 4G5DA 1G7UA 4YL2A 2AQVA 1OYAA 3OVPA 5TIMA 3QZ6A 1KBIA 2PDPA 1Q6GA 1R3YA 1LL7A 4AZCB 1BYCA 4NP7A 1IWBA 2RDWA 3EWCA 4Y9MA 3VDGA 2XGBA 3WDQA 5I09A 2Z26A 1G5AA 3ARZA 5HQMA 3MHFA 5I79A 1NWTA 4FNRA 4O1DA 3W1MA 3CGTA 4JX5A 4F48A 5U7SA 3DG6A 3CMFA 3AJXA 1XGDA 2OODA 1H5YA 3LNPA 3GW0A 3T2QA 3H55A 3ABZA 4JIEA 3VDBA 1E0TA 4JN8A 2HE8A 2EKGA 4YTQA 1HW6A 3WBYA 4B3ZA 4RNJA 4AEFA 4C7DA 2PWFA 4LRTA 3UPWA 4E4UA 3TDFA 2HBXA 4HNCA 2D2HA 4M6QA 2OSXA 4YPJA 3H4WA 3W87A 4UMAA 2JF7A 1K03A 5T91A 1LL6A 3QPYA 1LDCA 1BG9A 1BXNA 1JZ4A 4PUUA 1CLKA 1TV5A 2IKHA 4HYWA 2D0GA 3BJTA 4IFKA 1H0GA 4PEEA 3IJLA 1L0PA 1XIBA 3QHOA 4TMBA 1UC4A 4J27A 4HU3A 3CXOA 2F2KA 1J2BA 3VIPA 1ZAIA 2WYSA 2PWVA 4YXGA 5CPMA 3IJQA 4QG8A 1AH3A 3IGHX 2YJQA 3CPRA 2PRLA 4O19A 1QCWA 5DY2A 3O0KA 9RUBA 3W37A 4AVOA 1RP8A 1CXKA 3STGA 4GXPA 1TELA 3GVVA 5EFFA 2VEKA 1JD7A 1AL7A 3FOKA 3M6YA 2QCDA 5J04A 4HKPA 2OZ8A 1A5AA 3HB9A 4LS1A 1M1BA 3FS2A 3NEVA 1TZ7A 2FPTA 1UPPA 1J0ZA 4NU7A 4ONVA 2WQDA 4LW7A 2X16A 2PPGA 4I8DA 3N4EA 5LNVA 5CZTA 1EF3A 4IMDA 4ZR8A 3MMDA 3W72A 3D5HA 2I5QA 3XINA 2J62A 5CPSA 1O6IA 2YZ5A 1KRMA 2G4FA 3NPXA 1SZRA 3VX1A 4DBWA 3UJ2A 4LUSB 4QQ3A 2PF8A 2XSBA 1UWQA 3E0VA 4LXFA 4PH6A 2AKZA 3AZTA 5JH2A 1HKIA 4WJEA 4S3GA 4OIFA 4IXXA 4YTTA 2WVTA 3FYYA 1QO2A 5FEPA 1AODA 4PE8A 1VYPX 1R3VA 1SFLA 1NFGA 3H12A 3PB0A 2VNCA 3APGA 5LA0A 2HQAA 4POCA 4PUKA 4AD4A 1S2UA 1UKPA 3P8JA 3F1QA 1OFPA 3GNPA 4IP5A 1FKWA 3UETA 4GX9A 4M80A 3FEMA 3CHFA 4QGCA 3L0GA 4LCRA 3SIMA 1QMLA 1QUMA 2W92A 3P82A 4C91A 4M6UA 3GHRA 4HCLA 5HNNA 1VHNA 4PUNA 3DKJA 2EG7A 4CD7A 1NAL1 1JPHA 1X8CA 3U5UA 4JTGA 3L5LA 1QNQA 2CEQA 3CWHA 4NAFA 2DU2A 2Z6IA 4PUWA 4Q8VA 5CZKA 4CQAA 4O52A 5G1YA 1JQXA 3KL5A 1LP6A 4OECA 3HGOA 2REQB 1QAPA 4RDWA 1IZCA 3WMSA 5AYYA 3A9IA 2A0NA 1EP1A 4UIOA 1UHVA 2ZVRA 2NX1A 4I90A 1B54A 1HJVA 2WHMA 3W83A 2YCKX 4NVTA 1HVXA 3BAWA 1ICSA 3I7SA 4Z17A 1ZJIA 3WYZA 1DHKA 4R9OA 3S5YA 1FTXA 3CUJA 4UFHA 2VQUA 2XH4A 2R8WA 4BI5A 3EWDA 3LG3A 3I65A 1JXJA 3DECA 1Z41A 4LX4A 4LOCA 3FHAA 4JKLA 4S3AA 4ZCWA 5EMJA 3PZUA 1A0DA 2HXTA 3LN3A 5F1VA 2BXYA 1F73A 2OWWA 4GGBA 4OUIA 2PBGA 3USZA 1YPFA 4HA3A 3WUEA 4HNNA 4FOJA 3ARUA 3DOPA 4BQ5A 1OM0A 1H49A 2PA6A 2ADAA 2H9AA 4M8UA 3L7RA 3ITOA 1RALA 2GSHA 5G1MA 3OIHA 4QITA 4W84A 1YXYA 4H7ZA 1ISYA 2JE8A 3CU2A 3N18A 1NQKA 2NUXA 1EGZA 1OG6A 5KZ6A 4PMRA 1C8YA 5C9WA 4L9YA 5A6BD 3VNIA 4WIWA 1O68A 4L64A 1A5UA 1Y8BA 3ITVA 2DH3A 1SZGA 4ZFMA 3I7QA 2J88A 1GVEA 3AIRA 1TPWA 1UR4A 4XWUA 2DW7A 1ZQ5A 2WC4A 5HUPA 3G0UA 3HMCA 4DB7A 2V9DA 1IWPA 1CX9A 3R2GA 1MXGA 3LHVA 1JRBA 3BVJA 5AC5A 4H9YA 3QKZA 2XIIA 5LIXX 1O1ZA 3N6QA 5CC3A 3OBKA 1JZ3A 3I3DA 3GC2A 1VF8A 4UFMA 1WDRA 3NO3A 1BQCA 2VR4A 1UD3A 2WNNA 4UC5A 1V0MA 1FWTA 3PM6A 3NL3A 1VR6A 3D0CA 4ZB2A 3T09A 5I5RA 4BZYA 1JCXA 4JTRA 3KL0A 4IJBA 4L7ZA 2Y88A 1PZ2A 2PDKA 2W63A 3NQ8A 4P7LA 3GNOA 4TMCA 4UTWC 1UH2A 5DMYA 3P93A 3AJ7A 4QR6A 3DFPA 4TIMA 1C9DA 3W9ZA 1CXFA 1Q6OA 1OD8A 1CGTA 5LXEA 2VDHA 2W67A 4OOUA 2D22A 4W86A 2YW4A 3TW6A 2TMDA 4H2HA 5LNSA 3FFSA 2R82A 3H2MA 4JTSA 3AUJA 3VZYA 2FMOA 3LTSA 2YFOA 3WLNA 1E1EA 4B5TA 3W01A 1N55A 1IGSA 3C0LA 2HSAA 4K2SA 1X1ZA 4HJFA 1NWUA 3E0WA 2BG5A 3B9OA 1OC5A 3W74A 2NUYA 3WCZA 1OIMA 4D9PA 5F2MA 2J8TA 4ALDA 5HJXA 2BX7A 4JDYA 3UG5A 4C6CA 3HPSA 3AIVA 4RX0A 1M65A 1UKTA 1JFXA 4LCSA 1R85A 5AB3A 2C79A 4AU0A 3ECQA 4F66A 1W1TA 2O0TA 2WO5A 3UBPC 2V81A 1EC9A 4IIDA 2RHGA 3TNOA 1KWKA 2GGIA 3G18A 3L21A 3GDMA 3JRKA 1R3SA 2EPNA 3AWNA 1OHLA 1PKNA 4ZQPA 1BWKA 5ABTA 3DX5A 3NL5A 3QPZA 2DV0A 4PMQA 4GNKB 4KEUA 1B1YA 4OBSA 1QNSA 4AY8A 4MZYA 4O1CA 3SUUA 3UA3A 3ENLA 2JQXA 2UBPC 4DAFA 3B40A 5A2CA 3SUVA 4C6FA 1W56A 4W88A 1UR0A 3I6EA 1SZEA 4DWSC 1I8JA 3WDIA 3PZNA 4BA0A 5D33A 2IPGA 3ZXWA 3NQ7A 3UERA 3G6MA 1QT1A 1KFWA 1GQKA 3L68A 3MANA 4QHRA 3TOPA 4GJIA 1F05A 3WBEA 1SVDA 2ZRYA 1LZOA 1TKKA 1Z3NA 4DJFC 1PE1A 4XZWA 1RLCL 3P3BA 2V0TA 4WSKA 3S46A 1FWBC 4PR4A 4BKNA 3QOMA 1PWMA 2Z2UA 1KKRA 4ILSA 3ALFA 2O7SA 4G7EB 4REQB 4NNCA 4EAMA 1O5XA 4O54A 2WWDA 5IXEA 4GI6A 1TPUA 3W7NA 3FXGA 1QBBA 3OO2A 2ISWA 4JHZA 4CCZA 4JTLA 1MZHA 1A5CA 2YCLB 1GYNA 3QQ0A 3WX7A 3FSUA 1TPH1 5HINA 3U9IA 3HGSA 1PKLA 1VYRA 4R5EA 3ARPA 1E4LA 4Y9AA 4IQDA 2E09A 1OCNA 5BU6A 4WJ8A 2ZUVA 2HBVA 5I3DA 2V68A 4I9AA 4KWWA 5A5WA 3ISIX 1Z69A 1Z7AA 1TWSA 5TF0A 3V0UA 4ZZ9A 1A5MC 5ABHA 2R1NA 2NX9A 2PS2A 5LA1A 1AA1B 4DNHA 4L65A 5D2YA 3MVIA 4UTLA 1W1A1 4XVEA 1DJYA 3P62A 1JI1A 1XLGA 3P61A 1LROA 4KFPA 3HGRA 5TNVA 4IMGA 5KITA 1U1HA 3G0SA 1QNOA 1RD6A 5DANA 4KCUA 1Q7QA 3U7VA 4CN1A 1FDZA 4AZ6A 2FGLA 1ZAHA 2X0SA 1PHQA 2ZE3A 3JS3A 3LV6A 2POZA 1EO7A 1US0A 2G4JA 2XIBA 4MAVA 4PB4A 1Z89A 1YDYA 1P43A 3MZ2A 1OYBA 4QSFA 1GVFA 2PFHA 3URAA 4IIHA 5K4XA 1H7WA 4LY4A 3TJLA 3SGUA 3P0XA 4Y8FA 5EMUA 8A3HA 1H2JA 3J7HA 3NQGA 2WVSA 1QI3A 2OZTA 2VEMA 4RZ4A 1XV8A 3W73A 4LAKA 1XYMA 3OODA 3M4HA 3VKDA 1MO0A 1WA3A 2Z00A 4IIBA 5CKSA 1JPMA 2Q6ZA 4OZOA 4WK9A 4Q4OA 2DORA 4PTNA 5EU9A 2DZXA 3MMUA 4PTXA 4UTUA 4QG9A 1F76A 1JCJA 2VM8A 3FY1A 4Q7NA 4WCJA 2HK0A 2CLOA 1XIJA 3AWOA 4JKKA 2JEPA 7XIMA 3L4XA 1J0JA 3BCFA 2VC9A 4GISA 1KLYA 4QROA 1QNRA 2B7PA 3QQ1A 4IF2A 4RZ6A 1PTAA 1LBMA 3PWAA 4IJRA 4MY8A 5A8PA 4KWSA 3TYEA 4A2RA 1ECQA 4HSNA 3P2VA 1EZ2A 3VOJA 2ZUWA 1OCJA 4WXYA 4GIAA 3UU0A 2EG8A 1BQGA 4KRZA 2DJLA 1TJRA 3GU9A 1OK4A 4JEQA 4DF1A 3C2VA 1Z42A 4MG4A 4LPCA 1J0IA 3UJFA 4MNJA 3TXVA 5FSEC 2HVMA 1FWIC 2A3LA 4JX4A 2VFGA 5HR6A 3URNA 1EJVC 4ADUA 4GUJA 4MVAA 3T8LA 1KV8A 4GMEA 2CLLA 1FH7A 2PTXA 3RFAA 2QJIA 3WUFA 3R5EA 6XIMA 5DMNA 3B0YA 1ITUA 1BTMA 3V0TA 4L9ZA 3V18A 4UXDA 5D30A 3VIHA 2D24A 1ONXA 2ATMA 3NM1A 4H9ZA 1OYCA 1UIPA 1XIIA 6REQB 1AZ1A 2E6YA 4KWVA 3O15A 4HOWA 2PSNA 1FHDA 4FIRA 4UMCA 4JIRA 3UXDA 4O1FA 2ZFAA 3WQOA 2OKOA 3EDEA 3K8KA 4PB3A 1TVNA 2GQ8A 1F7BA 2FDMA 2VFEA 3V5FA 4Y7EA 4D1IA 3AHZA 4UQEA 4Z1DA 3VCRA 1B9ZA 3BW3A 4QCEA 1TIWA 4LB3A 2GK1B 4M0XA 2GWGA 2NV2A 3T1GA 3E2VA 5LHEA 1W5PA 2PLJA 4H7CA 5CBJA 5AYBA 1PUDA 5FCZA 2JF6A 4ORIA 3TYUA 3LTYA 2AL2B 1DJNA 1M04A 4OKDA 5GNZA 3PZGA 2VWTA 2EBNA 3W7GA 3UW6A 2V69A 2B31A 3VIFA 2HNEA 3AYVA 3KP0A 3WLMA 4Q8PA 3VOGA 1R3RA 1KV5A 1E9IA 2D1ZA 4O11A 1A3WA 4V1YA 3W7LA 4FX7A 4WRHA 4Z2HA 3WO8A 1LBFA 2VDIA 4YWIA 2Q71A 3RRXA 1R47A 2CU0A 3T0DA 3E0LA 1I1WA 2RH9A 4O0KA 2ZUUA 3BMWA 3PZQA 3TU9A 4MFDA 3O07A 4YTSA 3L2IA 4H4IA 4ROQA 3T05A 1WZLA 3KX6A 1DYSA 3XISA 5EPDA 1DKWA 1QR7A 3GXTA 1M53A 4AY1A 2NSXA 4XZMX 3LSBA 4GE8A 2QJJA 4J28A 3PJTA 2VHLA 1XGZA 1O5KA 3ZYZA 1L6GA 1CGYA 1XLJA 3CLWA 3N3TA 3S9IA 1Q2RA 1CLXA 4RNHA 4KESA 1I0DA 3R94A 1FP9A 3I4EA 3L23A 4LB4A 3W1NA 1IEIA 5D2VA 2GVYA 3SY1A 3CT2A 4IMEA 1UH4A 4RNIA 4Z2JA 1CI1A 3LOTA 3ARTA 4XVDA 2FZMA 2NQ9A 4PRRA 1RAKA 3LHZA 2ZE0A 4LT9A 2DT1A 4CNTA 1E6RA 3OP2A 2OEMA 1GYLA 3ZWSA 2I14A 2JGYA 4MYAA 3CQIA 3DI0A 3EDFA 3NL6A 2G8ZA 3E2RA 4LNCA 4WDUA 3ZVHB 4FNSA 3EWBX 3WF3A 2AAMA 3LA4A 1WV2A 5FEZA 1M7XA 2V3DA 4LANA 2PDFA 1ADOA 2JIWA 4MM1A 4JR5A 3ZIZA 4DWSD 3O05A 2IQ0A 2Y62A 4UTTC 3W7OA 4O0QA 4BWLC 3ME3A 4DM2A 1GVRA 1C90A 5D05A 4ECLA 3SSZA 3DAQA 1D2KA 1HKJA 4J40A 5AYIA 5DLCA 3CMJA 1DJQA 1YHTA 3WQ8A 1MDRA 3BG9A 2J7GA 5A8NA 4WDXA 2B4GA 2ZZ6A 1C93A 1G4EA 4W93A 1SW3A 1HUVA 4PL1A 3A4WA 2QUMA 2FVMA 2ANUA 3JUGA 3KAOA 3WIJA 1W6TA 4HPHA 3TSBA 3V0SA 1EIXA 5BU9A 1WXZA 1ZBWA 1EP3A 3LRKA 1LLZA 1MEWA 3BV7A 1Q7MA 3M43A 3W1QA 3LX9A 1A5KC 3NG3A 5GVJA 2WC7A 5BOEA 3CL7A 4GWEA 3UR7A 1C92A 3HF3A 3PTKA 3CUGA 2EO7A 3KLKA 5CPNA 4FNPA 4O28A 4WY0F 1VFMA 3AHTA 3WQVA 3S9ZA 1U1UA 3SUTA 1CPUA 3UD6A 2G41A 4IOTA 3A21A 4IJCA 3ARSA 4RZ5A 2VUYA 3K1DA 1WUEA 3TH6A 1XCFA 1KQYA 1SMAA 4HD5A 4DI9A 4DO5A 2XG9A 1LOQA 4A4AA 1V0LA 5CZSA 3GUGA 4AZ7A 3N19B 3PVFA 2J75A 3P60A 3HZ3A 3B97A 3Q94A 1XRFA 2GWNA 5MHBA 1AQFA 2Y8KA 3LCWA 3OEXA 1VBGA 3MJYA 5CAKA 4Y9PA 1E40A 1S2VA 2J7EA 4IPLA 1CGUA 6ENLA 1KRAC 1ZCCA 1HKVA 3NSMA 4TQTA 3RF9A 4O15A 3KHJA 4IM4A 1JAKA 1OZQA 3KVMA 1TRIA 1EB3A 1M7OA 1WZAA 1RA0A 4HPXA 3PHAA 4F0KA 3CBWA 4HU8A 3EOEA 3LXBA 4LTSA 2IQTA 4C1LA 4RJEA 3HJZA 2DIJA 4F79A 1IHIA 4GYPA 3RRAA 4S3KA 5MKGB 4IL2A 2NQLA 2WKJA 4U31A 2INZA 4YCOA 1IQ8A 5XIAA 1ZBVA 4C6OA 2QDGA 1PTDA 4C6DA 5EMYA 1R2RA 4P5UA 1UIOA 2WKLA 3GH7A 1X6NA 3AXXA 4JTJA 2RDXA 4CQ8A 4LGXA 1YW1A 2WMKA 3PNUA 3RJYA 3L2MA 1QI5A 4WF7A 3RM8A 4LVFA 2LLEA 4L56A 3ZVIA 4HU0A 5C9XA 4QCFA 5FI8A 5DCDA 3W1XA 4JFUA 3G2GA 1BXCA 4PCFA 4GGHA 2WJDA 4S1FA 3Q45A 5A6BA 1EPVA 3SN1A 4X0VA 3UZWA 3OLGA 4CUCA 1NVMA 3QR3A 1VRDA 1FOBA 2CWXA 4AXNA 1M41A 3SR7A 3KBWA 4MY1A 2INEA 3S6TA 4UFLA 3SBFA 3EPMA 3GNXA 1S2WA 2BXVA 4A8LA 3IAQA 2W27A 4F8XA 3WSUA 4WGHA 4BF5A 2ALRA 4BEQA 3VOFA 1DXFA 3KRSA 4LBSA 3BSGA 4GCAA 4EK7A 1OT2A 1UD6A 3GHSA 2X42A 1CIUA 3N2CA 1TZ9A 5D9NA 4H83A 1PYFA 5GNXA 3WLLA 1J5TA 1Z9AA 1GUVA 2E6AA 3TN6A 4FAMA 2PDBA 2NT0A 1XJBA 3CHVA 3C2RA 1H7PA 1LRQA 1S1PA 4O14A 3EEGA 3U2CA 4M7TA 1WNOA 1PX8A 4NRRA 5A1AA 3TYAA 5HAOA 1ZB5A 2Z2BA 1VCGA 1HIZA 1TX2A 4HSOA 1DVJA 3NZGA 3FDKA 1TR9A 3QBUA 4O50A 1GEHA 3HGJA 4FI4A 3T08A 1XCWA 4GJJA 1AQHA 2YYUA 5FAGA 4NNAA 4OBRA 1ZZMA 2ZX9A 1T7LA 4XAZA 2EGZA 5HWJA 1XP3A 2FHCA 5H1WA 2VX6A 3UF9A 2E8YA 2QEZA 2EJ1A 3KZSA 3S2NA 5I6SA 3GAYA 3NQEA 1POJA 2FTPA 3GC5A 4Q4KA 4MJ2A 3GD6A 3BG5A 3M0ZA 1UKOA 3W84A 3TFCA 2BB0A 2CYGA 2QVHA 1PV8A 3BQ5A 4RKAA 1V3MA 5DXXA 7A3HA 1X6UA 1VHCA 3DC0A 3VMOA 4GI4A 2BVYA 2BMBA 4KIRA 2F8QA 1V77A 4I9TA 1XF0A 1VH7A 3HFTA 5D2TA 2F61A 3NQBA 3GIYA 3RX3A 4I9JA 2Y7DA 3K4AA 1MRAA 4I7WA 1OVDA 3VD7A 1OG0A 3L65A 2NQHA 3F03K 3CZLA 2J74A 1TQXA 3QSRA 4J3ZA 2Z28A 1FQ0A 4ACYA 4G8TA 4YVVA 3GBDA 2QW5A 1KM3A 4Z2GA 4KPLA 1I6NA 1H1ZA 2OWCA 1YKWA 2DT3A 3GTXA 1IV8A 1K7XA 2E28A 4PRWA 4KKXA 4LF2A 1TJ2A 4R53A 3O63A 1WDSA 1D8WA 1J01A 4HHHA 4NAEA 4U3CA 2XZ9A 2ZTJA 3TQVA 2C7FA 4WKAA 2P8BA 4NZ4A 3V1HA 1XG4A 3QZEA 1S38A 2NVCA 3TZFA 3FEQA 5TBOA 1UKQA 3MCOA 3KVKA 3KCJA 3B0UX 3MV11 4IUOA 5EL1A 3R11A 1QW9A 4JOMA 5HULA 3RAOA 1UR8A 4FA3A 4V27A 1ITXA 1QNPA 2ASHA 4O13A 1THFD 3W0KA 1HKKA 3QN3A 1HXJA 4XD3A 7CGTA 2PDIA 2WJEA 3BC9A 1J0YA 5F2GA 1HN1A 4MWAB 1XFCA 1XLCA 2HV5A 1BGGA 2Z27A 5BW6A 2Y5JA 3CEUA 4V33A 4G1KA 4E2OA 4RDVA 4FXFA 1H7XA 3IIXA 3ZJ6A 3BLIA 2FZNA 5AHFA 1J0HA 1GHSA 3CUIA 3WQ4A 5HR7A 1J6OA 1TV7A 3W7PA 4MB1A 3TNBA 5BZAA 4Q8OA 5E9XA 2OPJA 2XM2A 3GSMA 5AZ1A 1J2WA 2J9YA 5HPCA 2F9RA 2XSAA 3TLLA 3W23A 4HOZA 1S2TA 2QKFA 5GQBA 2WC3A 2WLZA 3OBAA 1KXQA 4W4QA 3RCNA 3S83A 4FNTA 3WQGA 3WFZA 2JK2A 2Y7FA 3K5XA 1UZ1A 5E93A 2QVNA 3QTPA 3NSXA 2PCEA 1J5SA 2E6FA 1KFCA 3FA4A 3AYTA 3FJLA 4M19A 4DZ5A 1TZZA 2GVLA 1WE5A 4F3HA 2W3ZA 1Q85A 3E2QA 3CZEA 2WVUA 3GG7A 5AC4A 5EMKA 2PDUA 4V1XA 4LVGA 5D2WA 4ZO6A 1HG3A 4LC8A 2NT1A 4XUYA 1UWAA 3ARQA 2UY3A 1D7FA 3VGDA 4D6EA 3F5JA 4M5PA 4HK7A 8TIMA 1Q65A 5BMWA 4JZ5A 4QG6A 4GBUA 3W2LA 2HXUA 3L66A 4IICA 5ABGA 3MUIA 4F2TA 2OOFA 5HMDA 7ENLA 2V38A 2IQDA 3JU2A 3ITCA 1OGSA 3NYDA 1FWWA 3PPGA 1V7YA 1KRBC 4KMQA 1YTEA 2JFEX 4NY2A 3U0HA 1AMYA 3NPVA 1K02A 4DO6A 3WMCA 4FALA 2OU4A 1NU5A 3EB4A 5FL1A 2QCEA 1YADA 3SQLA 5HNRA 3VIIA 2CIPA 2XU2A 1DIKA 1HJUA 3AXMA 3UVAA 2QCMA 4XTDA 1EGVA 2P1FA 1I2RA 3Q2DA 2ACSA 3EMCA 3KBNA 4FIQA 4LY8A 4AY7A 2ZADA 1WOBA 2ESCA 1FHLA 1NARA 4EACA 4JQ3A 3OJGA 4UOJA 3M0KA 3MDWA 3GKFA 1KGWA 4XBSA 1RJRA 4JD4A 1KR1A 3CB8A 1V5XA 4C6LA 4W8LA 3DFYA 2YZRA 2I5GA 4N02A 4UZUA 3G1XA 3FYPA 4M1BA 3GTIA 4UTIA 3MA8A 1QI4A 1VZWA 2XIMA 4EF8A 5H6HA 4PCPA 1PSCA 2C1HA 2A3CA 4QQUA 2F2HA 3C56A 3N9KA 1RXOB 1UQZA 1L6FA 2PBOA 1QXLA 1I2NA 3RLGA 1NOUA 4Y9OA 3HG3A 1KFKA 1I45A 4MYXA 1YX1A 3S6DA 4GZJA 1W1ZA 2WSRA 1HX0A 2J8GA 4L6DA 2YDQA 3BUVA 4HK5A 2DSUA 1EQPA 4GVGA 4C1NB 1FUYA 4AIOA 3ZZ1A 3W00A 3BLLA 1XIHA 2QDEA 2Y70A 4W8AA 1R3TA 2IW0A 5FF0A 4F40A 1KM5A 5FJOA 4GY7A 3ES7A 4UNKA 1FWJC 3F2DA 1N82A 3T2PA 2GFTA 3H2EA 4BQ3A 1YE4A 4GINA 2D3NA 2FJKA 3MUY1 3CV6A 3UWZA 3WLSA 1LYXA 2R14A 2HTMA 1ME8A 3CV2A 5BXRA 3ARRA 4NIRA 2UV8G 4EAYA 1YXCA 3PG8A 1UZHA 2ZC1A 2Q02A 3REQB 2GJNA 1QK0A 5IBXC 3LRMA 2J47A 1J93A 1HJWA 1GTHA 3MSYA 4Q7IA 2V67A 2WCGA 3SAZA 2ACRA 4WDTA 3N29A 3FKRA 3UCCA 3DN5A 3KXQA 1MXSA 3SECA 3Q65A 2YB1A 5CPTA 2H6RA 4GQBA 2VC7A 1EIBA 1WXYA 3BMXA 3PZTA 1E0XA 3B8SA 1JPIA 4O4VA 3VDHA 9XIAA 1K77A 4DWDA 4QJ3B 4ZGYA 1FCUA 1SU5A 5L9FA 1N7KA 4DY1A 1KB3A 4UZSA 3PUEA 5A3HA 1YDOA 3MUAA 2DZBA 3OZPA 5A95A 5CPLA 1DL3A 3E9AA 2Q8LA 1AW2A 4JTKA 3VNZA 3P6LA 5KMYA 4U2ZA 1HNYA 1Q4WA 2VC6A 4CCCA 3S4TA 3AIEA 1KCLA 2QCLA 4B5UA 3BZGA 3VUPA 2NLYA 4AW7A 3UEQA 2INFA 4JTDA 1C29A 4BFAA 2GQAA 5FEXA 4O1EA 1RUSA 3B04A 4MFEA 1OK6A 2BGNE 1X39A 3WD3A 3SW6A 4GO9A 3ES8A 3B8WA 3MWAA 4IUGA 3H22A 4RE0A 3F5KA 5EFDA 4KCVA 3TROA 1RBOB 4LUSA 1Q63A 2YLLA 4JNMA 2VX7A 2GQ9A 2VMFA 1A5LC 1I75A 3AOFA 3NL2A 4AFYA 3CASA 1DPMA 4DJDC 3R8HA 1RZMA 3FVDA 3WL1A 5HMEA 5EB8A 2J79A 2Q3OA 1U83A 3AHVA 1NIUA 3BLDA 2PF0A 1JUBA 3KOFA 1TUFA 1Q2SA 3GXDA 2FH6A 3DHPA 1DJIA 3GTHA 1XIDA 1JCNA 4S2BA 2Y0FA 2VJXA 3WLIA 1QWGA 2D69A 2JKPA 1JZ7A 1XS2A 2P0OA 1EUAA 1EPXA 4MNLA 1V6TA 4UMBA 1SFTA 1PEZA 1V0KA 3V3WA 1R3QA 1ZP3A 1YNYA 2H90A 1X8FA 4GH3A 4GXWA 1RPKA 3CUHA 3L4TA 4TO8A 1KO0A 2QYGA 4MZ8A 4KH2A 1FWNA 2YBTA 4KQNA 4IQLA 4EOUA 3FJ4A 4O10A 2Y5SA 3URBA 2ZDSA 1ML1A 3MQTA 4O1BA 5D03A 3MUCA 2HEJA 4B5WA 3QGAC 3QMTA 3ITTA 1GOQA 4RV8A 4GLEA 3RR4A 2REQA 1ECEA 4LC6A 3G1RA 4S23A 3O6AA 1P6CA 5GJPA 2WHJA 1SM9A 4LUIA 1OCBA 3W7MA 1E5NA 3S0CA 1HVQA 3R12A 3TV8A 1QHOA 2YBVA 2ZUMA 4H8UA 1I0BA 4I7VA 4EIVA 4C6NA 1BVNP 5JUVA 3I3EA 3MY9A 4QJ5B 1D3CA 2PDWA 2BWGA 3EYPA 2EHHA 2VGBA 2HNHA 1FCBA 3AQUA 3WK2A 1GONA 4HGXA 3W1RA 3IIZA 1D7KA 1CXIA 1SZFA 3VFLA 4MB4A 4D72A 3IARA 1GOKA 4I9MA 4AQLA 3OLEA 1JVNA 1E9ZB 2IPWA 4W85A 1YPIA 4EPDC 4W5ZA 1ZENA 3QMSA 5E70A 1HKMA 4L6OA 4UNIA 1L2UA 1OZMA 5C9RA 4TOQA 4ZBCA 3M1ZA 4B9YA 1C7SA 5DCBA 1G1YA 2FYMA 3C2OA 4IG2A 2O55A 2HISA 3M7SA 2WZHA 3KM8A 3V75A 1OC7A 3EMZA 1DP0A 1FFRA 2JGQA 4QAIA 4X63A 4PUEA 4XISA 4HNUA 2E4TA 3QM3A 2ZZ1A 1JNEA 4IPIA 4HN8A 4I7UA 1JDDA 1TR1A 2C15A 3MHGA 1PIFA 4KEVA 4OGZA 2WZMA 2QLYA 2V3FA 5C7VA 1VLWA 3GLCA 2BY0A 3GDTA 3SN4A 3NR0A 3MSGA 5HQLA 3EPOA 3WQEA 1ZJAA 3WMBA 1ZU8A 4EE9A 4GQQA 4GXMA 1A5OC 3SGZA 4GVFA 1IT7A 4P7NA 2P8CA 2TPSA 5C2GA 5ECVA 4HZMA 3EXSA 1TV2A 2NQZA 3LENA 5I7GA 2XHYA 4ZEPA 2PWUA 4PUMA 4S39A 2J13A 1NH6A 4FOUA 3L12A 1QOXA 1XKJA 3IVSA 4XD5A 3ZR5A 1ZFJA 3VIKA 1S3HA 2HK1A 5T9CE 2E1WA 2E68A 4JIPA 3WLHA 3LCLA 3NO5A 3VNDA 5I23A 1BG4A 4GQGA 3QFWA 4RV3A 2ZRXA 2IXVA 2YCEA 5A2AA 1XIGA 3PBYA 3PZVA 3PR2A 2I5IA 4HK6A 4YHGA 3SI9A 3W85A 4GZ7A 2C3ZA 2ICSA 3C6CA 1JAEA 5AHEA 4LYKA 3MKCA 4NASA 1T5AA 2C0HA 2VZOA 1QPNA 3QRHA 4PB5A 3WQFA 1GJWA 4YTUA 3GXNA 1XD0A 4W9TA 2CWNA 3NNTA 3CAVA 1BD0A 3QKEA 1CT5A 3CZ8A 1XGEA 3JR2A 1YIXA 1FXPA 1FWRA 4B15A 4E8CA 2BDQA 1LF1A 2DPEA 3HQPA 1XLMA 4LU0A 1UYQA 4IH3A 4US6A 1E71M 1MQQA 2EF9A 3UG8A 3DENA 5DY3A 4H9TA 4K7VA 2QCGA 4TX9A 4GFIA 3SIZA 4ICNA 5K4ZA 3OA5A 3R79A 1YLVA 4C7FA 3WLPA 2YA1A 5A94A 4PRTA 4JBRA 4NJGA 3L2LA 1IR2A 1UWSA 4PFMA 1W1B1 4Q6JA 1V6WA 1G4TA 3UT0A 3DZ1A 4OVXA 2AMGA 2PLKA 4D6JA 2C91A 3NJ3A 3UZYA 2EKCA 1PTGA 3M44A 1H1YA 3TTYA 5HA7A 1ODUA 3GG1A 2QF7A 2ZUNA 1A53A 3K4WA 3GF