4D8LA

Crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
294
Chain Sequence
b'LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTDWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 99
structure length 294
sequence length 294
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4d8lA00
4ERAA 4J5NA 3K5XA 2P53A 1P6CA 3MJMA 4HK5A 3IRSA 5FSEC 4GK8A 5LXXA 3OOQA 4OFCA 3F2CA 3AU6A 2Z7GA 4H9ZA 1KRMA 1QXLA 4CNTA 3PNUA 3GU2A 3A3WA 4IGNA 1HZYA 3PNZA 3LU2A 1R9YA 3RHGA 3QY6A 1FWGC 2DVUA 3ICJA 4NI8A 2O4QA 2UBPC 1FWCC 3K2GA 1W1IE 1YIXA 4JOMA 4IGMA 2FVMA 1K1DA 1UBPC 2XIOA 3B0YA 1O12A 4I6KA 2EG6A 1NDYA 2HQAA 1GKRA 1IE7C 4B90A 2PGFA 1ITQA 2Z27A 4C6IA 2HPMA 3UBPC 5FSDC 2QT3A 2PAJA 1PSCA 2AQOA 2FFIA 3TN6A 2YXOA 4EP8C 2OQLA 3URNA 4RDYA 1FWJC 2WJEA 1S3TC 4IFOA 4L6DA 3GU9A 4KEVA 3TNBA 3F2BA 2VC7A 4GXWA 1GKQA 3T1GA 4KEZA 4CQDA 3MVIA 4L9XA 4XD3A 2EG7A 4B92A 4DZHA 2D2JA 4C6EA 4XD4A 1NDZA 3C86A 1A4MA 1EJSC 3A3XA 1RA5A 3EGJA 4DI9A 3LA4A 4EPDC 4G2DA 3DCPA 3B0XA 4C6FA 4DLMA 4IFRA 4PE8A 4GYFA 4DZIA 2PGRA 4J2MA 2PLMA 3WMLA 1A5LC 1XRTA 3CS2A 4F0SA 1XRFA 4ZSUA 4QROA 4C6KA 3E3HA 5CH9A 2IMRA 2Y1HA 1UIPA 1YNYA 2WM1A 2ZC1A 3MDUA 1FWFC 3O7UA 4DO7A 1FWEC 1A4LA 4CEUC 1I0DA 4GY7A 4C6NA 1ONWA 2R1NA 3RYSA 1NDVA 3RN6A 4IH3A 2EG8A 3HPAA 5HMFA 1PTAA 3URBA 3JZEA 4E3TA 2Z4GA 3B40A 4ICMA 4R85A 4ZSTA 4GC3A 3PBMA 4H9YA 4IG2B 1NDWA 4F0RA 4XAYA 3S2NA 2WJDA 1BF6A 3QGKC 2CZVA 3T8LA 4ERGA 1FWDC 2R1PA 4NG3A 4C6BA 4EPBC 4GY1A 2Z26A 4H9TA 4KQNA 1A5KC 2Z2AA 3IPWA 1P6BA 4PCPA 3SFWA 4LCQA 1EJRC 3S4TA 4LAKA 2GSEA 2FTWA 4XAFA 4C6OA 2KAUC 2VR2A 4DNMA 5E5CA 2BGNE 4H9XA 1EZ2A 4CNSA 3GRIA 3OU8A 4XD6A 3OJGA 2D2HA 4J35A 4C6PA 4DI8A 2P50A 1WXYA 1FWBC 4LFYA 4MUPA 2E25A 3QGAC 4LAOA 4GX8A 4UB9A 3BE7A 1ITUA 1RJRA 1R9XA 4IF2A 2GZXA 3MDWA 4QS5A 2ICSA 2GWGA 1XWYA 3GUWA 2GOKA 1J5SA 4IG2A 2W9MA 4F0LA 1YBQB 4GY0A 4C6JA 4LCRA 1FWAC 5HMEA 3UR2A 3CAKA 2OOFA 2Z2BA 4XAZA 4C6LA 3O0FA 4IQJA 2VHLA 2Q01A 1O5RA 3ITCA 4LH8A 2OODA 3WZ0E 4GBDA 4RDWA 3MSRA 3T81A 1FWHC 4XD5A 4LEFA 4HJWA 3LNPA 3IACA 4LANA 3S2MA 4DYKA 1EF2A 2G3FA 3IJ6A 1KCXA 3V7PA 3HM7A 3F4CA 1RJPA 4CEXC 3LSBA 2Z00A 4PBFA 3GTHA 3ISIX 3LY0A 4WGXA 1EJTC 4C60A 4WVXA 4KETA 2Z25A 4TQTA 3HTWA 4D8LA 1KRCC 3TN4A 4DLFA 3MTWA 3GG7A 3MKVA 3K4WA 3FDKA 3IGHX 3IARA 1JGMA 2O4MA 4P5UA 2QS8A 2PUZA 3LS9A 1PB0A 5A6TC 3GTFA 1YBQA 4GZ7A 1J6OA 3QY7A 1UMLA 3MPGA 4RE0A 2YZ5A 4C6CA 4EPEC 1GKPA 1UIOA 1DPMA 3GIPA 1R9ZA 1RA0A 1WXZA 3A4JA 2YB4A 4INFA 4V1XA 4KERA 4EPKA 2AQVA 3E0FA 1NFGA 1J6PA 3CJPA 3S2JA 3SO7A 2BB0A 4C5YA 3FEQA 4CNUA 2OGJA 1EJWC 4H9VA 1E9YB 4C6DA 2ANUA 2F6KA 2R1MA 3URQA 1V79A 4BY3A 1RAKA 3LGDA 4M51A 2R1LA 1KRAC 4WHBA 2A3LA 2WJFA 1EYWA 4H9UA 1I0BA 4Z42C 4BJHA 2ADAA 2UZ9A 1P1MA 3NEHA 3EWDA 4GX9A 3TN3A 1ZZMA 1POJA 4GOAA 2HBXA 3UF9A 3UPMA 4ERIA 3IV8A 4H00A 2E1WA 2Z29A 3NURA 4UBPC 2YB1A 4IFKB 4LCSA 1XGEA 3E38A 2HBVA 4HK7A 4BKNA 3WYZA 1YRRA 2AMXA 3NQBA 4V1YA 2QVNA 4CQCA 4KF1A 3TN5A 2DVTA 4B91A 4H9MA 3E74A 3KM8A 4R7WA 3DUGA 3LGGA 3PANA 4YIWA 1M65A 3QY8A 3RCMA 1FKXA 3D6NA 4G7EB 4QSFA 1VFLA 4AC7C 3OODA 1V51A 3F4DA 1EJXC 1A5OC 1YMYA 1RK5A 3GTXA 4LALA 1J79A 4HA0A 4R88A 2I9UA 1EJUC 1K70A 2Z28A 1M7JA 2DVXA 4I6VA 2GWNA 2Q09A 4CQBA 1V7AA 3UR5A 4KIRA 1RK6A 4RZBA 5AKQA 2QPXA 4PBEA 4RDZA 2I5GA 3AU2A 3PAOA 4C6QA 3OQEA 4C6MA 5G4HC 4AQLA 2R1KA 3ORWA 3G77A 3R0DA 4IFKA 4XAGA 1ADDA 4PCNA 1RJQA 4B3ZA 2VM8A 3E0LA 3N2CA 1QW7A 1K6WA 1FKWA 2FTYA 3MVTA 4QTGA 3AUOA 1V77A 4RDVA 3GU1A 1A5NC 2RAGA 1FWIC 4C65A 3OVGA 4G7EA 2VUNA 4H01A 1E9ZB 2D2GA 2HPIA 4C5ZA 3F2DA 2Z24A 1PO9A 4HK6A 1POKA 4KEUA 4QS6A 1A5MC 2VC5A 3GIQA 3FDGA 1KRBC 2FVKA 3EWCA 3ID7A 4LAMA 3DC8A 1EJVC 3URAA 2OB3A 4QRNA 3LSCA 1V4YA 5HMDA 3S2LA 4KESA 4DIAA 3E2VA 2HNHA 1ONXA 4NP7A 3GTIA 1M68A
chains in the Genus database with same CATH superfamily
4ZO8A 3VIKA 3O2LA 2I16A 3M16A 3N2MA 4ATDA 4RCXA 1YPXA 5LKYA 1XBXA 3H4GA 5A2CA 4CNTA 1W37A 2XIBA 1HZYA 1MFUA 1W1PA 1SFLA 1OHLA 3ITOA 3O63A 4HGXA 2WV8A 1P1XA 3GXNA 2WHLA 2FVMA 5LA0A 2E9MA 1O12A 2J7HA 1W5PA 1E4LA 3LM7A 1KB3A 1Q6FA 4Y9PA 4PUKA 1BFNA 3CB8A 1A5CA 4B90A 3S46A 1GPFA 4ICCX 4DJDA 1JZ3A 3H2CA 3M9YA 1TTIA 4O19A 4O8AA 3K4DA 2CEQA 1EEPA 2DU2A 1GKQA 3DI1A 5M3WA 2OOGA 1TZ7A 1C8XA 3B97A 3DHUA 2CKRA 3A3XA 4ZTYA 3GVWA 5KZ6A 4KWVA 4IMCA 4KRUA 4OV4A 1OZQA 1B4KA 7ODCA 4GZJA 1CIUA 2HRWA 3T9PA 3K46A 2CLOA 2NVAA 3BSGA 4O14A 4HA1A 1XLGA 2C14A 5I2UA 1JQXA 3SI9A 1WA3A 1E0UA 3OVQA 4CGTA 2D73A 1ECQA 4WEVX 3ABRA 2Y1HA 3MDUA 2QJGA 4AX7A 6TAAA 3M43A 3C52A 4EANA 3AQUA 1KO0A 4WK9A 2W62A 3AJXA 2V8ZA 1EP2A 1EWDA 2VDGA 3E2RA 3MCMA 2WW5A 4M7TA 4Z0SA 2VCBA 2XG9A 4H7VA 5CG0A 1JPDX 3SAZA 4FOUA 4FLRA 4BI6A 3W01A 1K7FA 4LUSA 1W5NA 1VBGA 2PDCA 1TV8A 2QDDA 3IRDA 5K3VA 2QCCA 3SFWA 5AVNA 3UVIA 4BQ5A 1O68A 1OIFA 2BOGX 3KS6A 4PUDA 4X63A 1CXLA 3H55A 3R8RA 3DAQA 4XAFA 3QSRA 3RPDA 1FCBA 1V5XA 1OINA 1JYVA 2EKCA 1Y5VA 4XKYA 1IR2A 1AMKA 3OGRA 2B81A 3U8GA 1BWKA 2O9TA 3UZXA 3VGDA 3LI1A 3CHFA 2NQHA 2DQXA 4HHPA 3MUIA 2QF7A 3S8HA 4IG2A 2W9MA 3IGUA 1OG6A 1KXVA 4BQ2A 2F2KA 3ME3A 3WNMA 3NL3A 4IMGA 2E6DA 2DV0A 4GBDA 2GVLA 3BWWA 1M41A 1HJVA 1YNQA 4XKMA 4QP0A 3UT0A 3MT1A 3T8QA 4N7QA 4GIAA 2QDEA 4S3CA 1IQ8A 3DDMA 3OQ8A 4EF8A 3L5LA 4OHQA 2W61A 5GQBA 1EEXA 3IAPA 1F6KA 3G0UA 3USBA 3AMDA 3IGHX 1UUOA 5AY7A 2UY2A 3LRLA 1OT1A 3UZ5A 3O07A 2CIPA 2ZRWA 1NOWA 1Q13A 1JZ5A 3GTFA 2A3CA 3TC7A 3WNOA 3GY1A 2V2HA 3FAWA 3GFXA 1HF6A 1QW9A 1ODUA 3IUHA 1DIDA 1TZZA 3GDMA 3PPGA 3ZJ8A 3TJLA 2QVHA 1XFCA 3V4BA 4WOQA 2Q6ZA 3BW4A 3GXDA 5FJRA 7REQB 4LTSA 1FWSA 1P0NA 4DJDD 2POTA 3FKKA 1U2YA 4UFHA 4C6DA 3O6YX 3VDHA 1SFTA 3STEA 4XK2A 2G8ZA 8XIAA 1LRQA 3HPXA 1CWYA 4GXMA 2R1LA 1PDYA 1HX0A 1XIIA 4PB5A 4EAYA 2V3FA 1UH4A 1ZNNA 3W1TA 2WHJA 5FAGA 1IEIA 1VP5A 1E1EA 1PZ1A 1TX0A 4OBRA 1P1MA 5E9XA 3L67A 3IJLA 4NZ1A 5JXQA 1VJSA 3L4XA 1AL8A 4PMVA 5KTLA 1BRLB 3ZJ6A 1W3LA 2ZA2A 4ENLA 3EX3A 3W00A 1F05A 3HOJA 4F0HA 4CQCA 5M1TA 5C7VA 1XDMA 4A3YA 1IGSA 4QJ5B 4WSKA 3PANA 3WBYA 4X22A 1KFWA 4QCFA 3NEVA 3SIMA 3ALFA 1KBIA 2VUYA 5FF0A 3H54A 4JIQA 2V63A 1CW2A 1DJWA 2Z28A 2CETA 2W63A 3W7EA 4PBGA 4I6VA 3THQA 3AAMA 1NTHA 3CT7A 3RU8X 3FVMA 1FH9A 4HYVA 4AD2A 2ZX5A 1PXGA 3NPUA 3AMKA 3BOLA 3GZ3A 3FW6A 1CGYA 4HQVA 2I5IA 1I1WA 3G1RA 2OCZA 3SUUA 4AHOA 3SY1A 4MZ8A 3NXFA 4B3ZA 1DJZA 4UQAA 1OVDA 3AUOA 2I9EA 1Q45A 3FGCA 4RDVA 2ZADA 1BXCA 3UJ2A 2CWNA 4AD1A 3FYPA 3OVGA 3FJ4A 2VUNA 4JKMA 3P5YA 4HOWA 4HZMA 5C71A 3MHGA 3S6TA 4GFSA 4LS2A 2A3AA 3FX4A 2VQUA 2FMNA 2VD8A 3QKEA 2VC5A 4QAWA 4LBRA 5F2IA 3FJLA 5GJPA 4F79A 3M7SA 4XIAA 3GBEA 2Y24A 3G1VA 4UCGA 3CV6A 3O1NA 4LYKA 5C9WA 3AXMA 1EBHA 3OO2A 1PHWA 1T7LA 3IRSA 1QK0A 1HNYA 2ACUA 2P3ZA 4I9MA 3VZZA 2J9YA 3GXIA 4R53A 2CLEA 4JTLA 1KW1A 3RHGA 3BJFA 2PTXA 4FX6M 4LX4A 5E6ZA 3C8FA 1FWCC 4D6JA 4HOXA 4AF0B 1PTDA 1IXPA 4DO6A 3S1GA 1ZLPA 5JVLA 2HXUA 4JN6A 4MWAA 2FPYA 5CC6A 1W9VA 4AWTA 1X6LA 2FFIA 1J01A 3AZTA 1EXBA 3S9IA 1XIJA 2O7SA 5TIMA 5HDRA 1UJPA 3PC0A 4KEVA 3QZEA 4AW7A 2A7NA 3WQ4A 5I03A 3EB4A 1VKFA 4PFHA 4CQDA 1DXIA 3CUZA 4WQ6A 3TWBA 1TPVA 3TYDA 3TYCA 1GT8A 4JZ5A 3RX3A 3T0CA 4LF1A 3CMGA 1NDZA 5HQEA 1EJSC 2H90A 1PVNA 4UOZA 4Q4QA 1UKOA 4GZEA 4US6A 5HATA 2VZUA 5HR6A 4JNZA 3C2OA 4G2DA 4UIOA 3GH7A 5IOBA 3BQ6A 4BK9A 3LNMA 2J7DA 1V0KA 4J2MA 1G5AA 1TE1A 3NQDA 1H2JA 1RXOB 4JXCA 1M03A 3LK6A 3LCFA 3ZR5A 3KHDA 4E6MA 2I57A 1XM3A 5D9NA 2VQTA 4AWUA 3THUA 1PV8A 1Q6DA 3RX4A 3VZYA 3W84A 4XZLX 3P81A 3CV2A 2A85A 3FOKA 1UR3M 1LTDA 2HCVA 3AXHA 4UQCA 5G4EA 3KWSA 1M04A 1EWEA 2OKTA 1EIXA 1CLVA 5FL1A 1TJ0A 1OFOA 3EKZA 4CVWA 4NRRA 4IH3A 3A64A 5HPCA 1W2PA 3ABZA 3URBA 1OC5A 2OKOA 1OYCA 3GUGA 4YWSA 3SY8A 1XIDA 2F6UA 5EYWA 2J9ZA 2WZMA 4C7FA 1KXHA 4C6BA 3I7QA 2WWDA 1LOSA 4PCPA 1A0DA 1AJ2A 1FUYA 3RLUA 1Z32X 4Q8NA 1US0A 1JCXA 2NLIA 2Z1SA 1HTIA 4AWSA 3LPPA 1AJZA 3LXCA 4H04A 4OZOA 4XD6A 4C6PA 2CWXA 3V0SA 1QPRA 3JR2A 1FCQA 4V15A 4UFLA 2XVGA 3NVDA 3B8VA 4K8HA 3UYIA 4FIRA 3DBNA 3H12A 3W2JA 5EMJA 4F4RA 1ONRA 1I75A 4K8EA 1XR2A 3UD6A 3MS8A 1R3VA 6XIAA 5AYYA 3FYOA 1PIGA 1N8IA 5B7ZA 3ABXA 9CGTA 1B3YA 3WZ0E 3RM4A 1TX2A 4B5TA 1JGIA 3PZNA 3E02A 4BWLA 3S2MA 2J6XA 2WZTA 1THFD 3O6DA 3FJNA 3CQ0A 3BLOA 3LY0A 3RO6A 3ZLHA 8TIMA 2H6RA 4P7RA 2Z25A 3HPZA 2GDVA 1R2SA 3PG8A 1R30A 2D69A 2WBKA 3BH4A 2VFGA 4YN5A 4MM1A 3VD9A 3IVSA 4GO8A 1LG2A 4QIUA 3AWOA 2PDUA 1JYXA 3NM1A 4LGXA 1EB3A 1PYFA 2VEFA 1V03A 1NSJA 3L5AA 4ZB5A 1JAKA 1DPMA 1IT8A 2DJLA 4ADTA 5DO8A 2POZA 1J6PA 3AC0A 3W7IA 4JNMA 1F6PA 3GDBA 1A49A 2VTFA 5ABHA 1DTUA 3OBKA 3CU2A 1RBLA 1TWZA 5EL1A 4HSHA 3SCSA 2F84A 3R1ZA 1V02E 2DSKA 2V5LA 1O66A 4M51A 1VBHA 3NPVA 1X1NA 4H9UA 2NUYA 3MV01 3LZ3A 5HNRA 2WAGA 2DIEA 2JKEA 3UU0A 5EU9A 4L6HA 5CGMA 1JRCA 1AL7A 3CHEA 4PR4A 1EP3A 1C3FA 1XYAA 3UG5A 4FS9A 1LOQA 4AXKA 2OSYA 4RZ5A 3TEVA 1MUMA 1Z3NA 3W7HA 2DZWA 3TR9A 2OR2A 1VFOA 2CERA 3PY2A 3SRDA 4O1FA 3E9AA 3EWYA 1FH7A 2YCKX 2YSWA 2AKZA 3MY9A 3CTTA 1L0PA 3RG6A 1V7AA 2BS9A 3EOEA 2CZFA 3QV9A 2I5GA 1GOKA 1S5NA 3Q67A 1UQYA 4M6UA 3TK7A 3ZT5A 2WVVA 5KZEA 4Y8EA 2X1RA 3IJ7A 4BI5A 3N2CA 1QW7A 1FKWA 2XFYA 3PBYA 1M7OA 4RPQA 5J04A 5FEWA 1X7IA 3N12A 1HJWA 4FF5A 1FTXA 1UUQA 1JCNA 4AVOA 4IQLA 3DFNA 1BXBA 4GJ1A 2FZ8A 1GUVA 3DC8A 3GHUA 3PBUA 2ON3A 3NTYA 1BKHA 4JY9A 2E5CA 4TMCA 3B8TA 3N2BA 2BNJA 5BWFA 2PMQA 2UY3A 4PTDA 3CHVA 2VEKA 4P2VA 4CQ8A 4RKAA 3GU2A 3KEHA 2VFIA 4QG8A 1YIXA 5HULA 5LIYX 2W66A 1UZ4A 1UBPC 4LRSA 1U22A 3R43A 3MMWA 4GIYA 3AISA 3BCDA 2NUWA 3FJ6A 4GH1A 3E2SA 1OFDA 5BYWA 4UTKA 4YHEA 1KBLA 3AOFA 2E1DA 2BP1A 4OT7A 3B0UX 3MV11 1ICQA 1JZ6A 1K9DA 3F2BA 1OADA 2VC7A 4K68A 1BYCA 3LPFA 2OSWA 4XZWA 3A24A 5JIPA 4TV5A 5MKGA 3M0HA 3VDAA 2BY0A 3NDYA 3OHMB 4XD4A 1A4MA 2BVDA 1T96A 4NYYA 1WP6A 3KCOA 4ZXOA 3EDJA 3TTEA 4DI9A 4WF7A 1XKJA 4LS0A 4B3LA 4N9BA 2W92A 4L4MA 4IFRA 4XO7A 1Y0EA 4GYFA 5CZSA 3TJIA 3T2OA 1QO5A 1A5LC 1SPQA 1OCNA 3LQLA 3PZQA 1YW1A 2J74A 4MFDA 4I90A 2Z0IA 5IDIA 1FHDA 2EJ1A 4MTVA 1V7YA 5KETA 2AGTA 1HW6A 1G69A 2OQYA 2PRMA 1FWWA 3BQ5A 4DJED 2PI6A 1ZGDA 3TYUA 4XKYB 3KL0A 1TG7A 2OLAA 1JRBA 2CLKA 5AC6A 6TIMA 3TH6A 5HMFA 1E15A 3B40A 4ICMA 3VKDA 4NJKA 4H9YA 4IG2B 4XG1A 2DUZA 3GR4A 1LZOA 2WHKA 4BF5A 3W0KA 3EMZA 1IXOA 3KOXA 1HKMA 4EPBC 2NV2A 1HJSA 3B05A 1VENA 3PJTA 3CIWA 4GINA 1P6BA 1O95A 2OYKA 2BLEA 2XFFA 3PK7A 1W91A 1IF2A 1IIGA 3O05A 1I2PA 1V6YA 3HGRA 4P7OA 1EZ2A 1V6WA 1KM0A 3OJGA 1T5AA 1RZMA 4DI8A 3PVFA 1DIEA 1XBVA 3KTCA 1SSDA 3Q37A 3GD6A 1TIWA 1DJQA 2H9AA 4JKLA 1WKDA 3UPWA 4X0VA 4RJEA 2WVUA 2D1ZA 3W2KA 5DMMA 1K7EA 4UFMA 5F4WA 1H7OA 3EXSA 3EEZA 3REQA 1LF1A 3W25A 4GA8A 1F5ZA 1I2NA 3VOCA 1W54A 4LANA 2VX4A 4E2OA 2G3FA 3C3NA 5T9BG 1NP0A 3WNKA 1RJPA 1V6TA 2Z00A 5FJIA 2CZDA 3TA6A 4C1LA 5JH1A 1TPC1 2XDFA 3CZKA 1Q63A 1CLXA 1JEZA 4Z0JA 1KCLA 1WDDA 5GPRA 1W9PA 3SBFA 2P8CA 2P5NA 2J8TA 3AYTA 1VQTA 1IGWA 3VUPA 1WB0A 2PZNA 2PC4A 1QWGA 3PG9A 1KFEA 4O0ZA 3KUMA 3UGRA 5HMSA 1RA0A 1PAMA 2FJKA 3MU7A 4IM4A 1XYCA 5DANA 1KBBA 4DO5A 3SUTA 2XH7A 1QJWA 3M46A 4LRTA 3N73A 2YDAA 3LTYA 3CUFA 4QE1A 3MUAA 1V79A 7PTDA 3GNRA 2HS8A 1EYWA 2ZXDA 4H3DA 3RJXA 4A8IA 1TJPA 1OCJA 2C19A 2BG5A 3F4VA 3EA3A 4ZOEA 1JCMP 1YX1A 2J75A 2A0NA 4JIIX 4H00A 1U30A 4M1RA 3T09A 3NURA 1E51A 3EDFA 2IPFA 3NAVA 1UD6A 2G3NA 2ZFAA 1ZFJA 1DJNA 1QI0A 2C16A 2PU1A 2DVTA 4ML4A 3ZR6A 1IZJA 1MYRA 3OGSA 4FHAA 1BF2A 2NXGA 5I23A 1ZUAX 3W1QA 3VABA 2VRKA 3W1XA 4C1KA 3GLCA 3BV4A 1G4TA 4R88A 3HB9A 1EJUC 4QHRA 1NWSA 1MQRA 2D0HA 2GWNA 3MB9A 1KFLA 4LUJA 4O0KA 4A4AA 2BDQA 4A29A 3V0TA 3AIVA 1JPHA 4PBEA 3LI0A 1RCQA 3OQEA 3G1FA 1XW8A 1F61A 4Y9AA 3M64A 1CXHA 3G77A 2WSRA 3RO8A 4PCNA 5BRPA 4KBXA 4P8XA 1DWAM 3ITGA 2BV9A 2FTYA 4ZFMA 1QU4A 4AY1A 5I5RA 3LZ5A 2RAGA 2J9XA 3TVAA 3LOTA 4U2YA 4HYWA 1FP8A 1POKA 1SFSA 3A13A 4N42A 3EKLA 2OEJA 4LNYA 2QIIA 3SGUA 3DGBA 2FZDA 4IP4A 3PZOA 4W87A 5CEWA 1CGWA 3W7PA 3P6LA 3URAA 1XG3A 1JG9A 1CXEA 1OJXA 1MO0A 3A23A 2JK2A 2EBNA 1S5WA 4J5NA 1R8LA 2DJXA 1AVAA 1TO3A 3UCCA 3P14A 1M53A 5I06A 4JR5A 3LXAA 1IEWA 5D32A 2OZ0A 3H21A 4EE9A 2ONEA 3VI2A 4ASTA 5LNRA 5AOUA 1UR8A 3B0VC 3HMCA 4GLEA 3VCCA 4AD5A 3QC3A 4US5A 2XM2A 4TVCA 1SW3A 3ERPA 2G50A 3GVQA 1TV3A 4MJ2A 2EHHA 1EA9C 4N9EA 2QT3A 4YTRA 3TN6A 3NOEA 4XBKA 4XIMA 2WJEA 4AZ7A 5HJXA 2Y8KA 4GKTA 4MSSA 3KP1A 2E5DA 4AHQA 4JTDA 3WDIA 2EG7A 2YXGA 1QWKA 1M6JA 5K4XA 3ZLFA 4PH6A 5K9XA 3B4YA 4QE5A 3CWHA 1XCXA 2NXHA 3EGJA 3THDA 3W2NA 1L6FA 2VOMA 3CAVA 3L4TA 1MEWA 4H2HA 2WC7A 1YDVA 3HIJA 1HKKA 3UFYA 1R3QA 1F6YA 3EB2A 3VFCA 3UXIA 3SRFA 3LUTA 3TA9A 3W9ZA 1MRQA 2VJXA 1W31A 3FCPA 2WMGA 4POCA 1YADA 1ZAIA 2G97A 3B9EA 5HPOA 4NQ1A 1XISA 3WD3A 2ZA3A 4MVAA 2CBVA 1P7TB 2H8ZA 4IP7A 3FA3A 3VKBA 3UXKA 5D9PA 3GB6A 3QFWA 1WBHA 1H5YA 1X98A 3KVKA 4LVBA 4DO4A 1SVDA 2D0FA 4ZSTA 1ZU8A 1I2QA 4RW5A 2GOUA 5H8UA 3T8LA 4ERGA 4IX2A 3KTSA 3S0CA 1OFPA 4QNEA 3VMPA 2W0UA 1XC6A 4UTTC 4DPPA 4QX4A 1LUCB 1G4EA 3V35A 2HXTA 3BLIA 5BNKA 1RLCL 4IL2A 4FXJA 3W53A 2CXEA 3N13A 4H7ZA 5A8QA 1F3EA 3LLXA 4DUXA 5HBFA 4H8HA 4CQAA 1CGTA 3WLQA 1WXYA 2PP0A 4LFYA 2J77A 3OIHA 1DOSA 1X97A 3QGAC 9XIAA 3BE7A 8CGTA 1E55A 3WLHA 1PKLA 3SY5A 4QNWA 5AYBA 3W71A 1FWAC 1SGJA 4ZZ9A 1CB2A 4FNPA 3WF3A 3DHPA 1DHKA 3CIVA 2QJMA 4IQJA 2VHLA 4UR9A 3ITCA 3ZT6A 3OEXA 3VK5A 4Z17A 4DM2A 1PDZA 2IQDA 1LLOA 3LCWA 1MQPA 1HL2A 4UTWC 2X7WA 1XD0A 1QPOA 3WMCA 2XJ7A 3ISIX 4O50A 4V2XA 4K1WA 2PZ0A 5E9AA 2Y8VA 3R94A 5BOEA 5TAOA 3QPYA 2OWCA 1H11A 2ZQ0A 1G01A 4ORMA 1MUWA 4S1FA 3B3DA 2BGQA 1HJQA 3OG2A 4XV0A 3IARA 1B57A 1RY8A 5HR7A 1C7TA 2VC9A 4UNLA 3OLGA 3ZQ9A 2G5WA 4FMVA 1W9DM 2ZZ3A 1SJCA 2UWFA 4C6CA 5I02A 3ZR4A 2JGYA 2GPTA 2X1UA 3DFQA 4B5UA 1QATA 1OCQA 5GNYA 4JDYA 3RMJA 3AIQA 1FWNA 1QAPA 1KGWA 1T40A 4AD0A 2C18A 2BXZA 3HG5A 4HNCA 3CZJA 4RV8A 2J7FA 4G9PA 4Q4PA 2PRHA 1UWQA 4MPQA 5E70A 4PL2A 1YQ2A 4UNIA 1LOLA 2ATSA 1K77A 4TX8A 4C7GA 1V3KA 1TTQA 1A5UA 1E0VA 2VEIA 4H4IA 4GX9A 4GOAA 4RE3A 1WPCA 5MHBA 3GXTA 1CPUA 2WZHA 2WPBA 1QTWA 2ZWZA 4W7VA 2GGGA 1DJIA 2XVNA 1UR4A 4P61A 2XSAA 1MRAA 3CIXA 4Q8TA 5FL0A 4UWMA 3LV6A 3SCQA 3TX9A 5F7UA 1UASA 2ALRA 4GWEA 4DXXA 2WXDM 3DUGA 2D20A 3G0SA 3D6NA 4AC7C 3VX1A 1J79A 2YCJA 4MADA 3O6AA 4AYSA 4I5RA 1OGGA 1UHVA 1JZ8A 1AODA 3W7RA 4CD8A 1J9YA 1A0EA 1XF0A 1RK6A 1XLEA 3M0XA 1XPGA 4W7UA 1LWJA 1QMLA 4DJEC 3H2NA 1UH3A 1GEHA 2VGBA 1AG1O 1J5TA 3L23A 1YLVA 3N29A 4QLLA 1C90A 5D37A 3TWAA 1WKYA 2QCFA 1BHGA 4ACYA 6REQA 1X38A 2DP3A 3QN3A 4ZQOA 4M24A 4DM1A 3FA4A 2IW0A 4PTNA 4QTGA 5E09A 4R7OA 2PLCA 1V08A 4DWSB 4Q32A 1S2TA 3SCPA 1W56A 1DVJA 2A5HA 3VMOA 1SW0A 4GI6A 3TTSA 3KRBA 1WO2A 1KRBC 1WZAA 4WLCA 4GQBA 3QXBA 3K1DA 2FFCA 3SJ3A 1GTHA 3UW6A 3CUIA 4DIAA 4HNUA 1OK6A 1F4HA 2WKLA 2QPSA 3QQ1A 1WUFA 1TVPA 1XLFA 1VH7A 3P82A 3P67A 4YPJA 2BXYA 1M7XA 4ZENA 2IXVA 4D6FA 5GVJA 3QY6A 4J28A 3N9SA 1OX4B 5FCZA 1IEXA 3AFBA 4PA8A 1S5MA 3QZAA 3WDJA 1J4EA 1NDYA 1LQ2A 1Z9AA 1GKRA 2EPHA 2OFJA 3NQFA 2Z27A 2EPNA 3ZWTA 1W9BM 1VS1A 4L1XA 4EP8C 2PODA 1VFTA 5HQMA 1FWRA 4L4OA 6XIMA 3U2EA 1S2VA 1NF0A 2QXWA 3T1GA 1OG0A 4KEZA 5TNVA 1F9CA 1TR9A 1OFEA 4L64A 3E12A 4CUCA 4QR6A 3U4FA 1ADSA 5REQA 2WOQA 4AFYA 2GVEA 1VYRA 3EPMA 1T8XA 3W74A 1TMHA 4EWJA 1JI1A 3DCPA 4R34A 4BQ4A 1A50A 3G1XA 1VEPA 2IKIA 1TELA 1HL9A 4U28A 4NX5A 3WUGA 4JIRA 1QHZA 1FVPA 1XRTA 3N17A 3WH6A 5BMWA 3F1QA 3SECA 4ES4A 2Y61A 5CH9A 3KBSA 2XTKA 5IHRA 3H23A 2QUMA 2QW5A 1LL4A 1C8YA 4AISA 4I8DA 1SR0A 4ZO9A 4U2ZA 3EOLA 1C8VA 2V5DA 5HJYA 2WCAA 2V3EA 3FNDA 3ATYA 2PWUA 5EB8A 2XH4A 1ZENA 1B3ZA 4IJRA 2H9AB 2BY1A 5BOOA 4R85A 3CEUA 1VYSX 2YL5A 1W1VA 4YTTA 2PDBA 1E4NA 4G5DA 3TAKA 1EA0A 3L12A 4HBKA 2OZTA 1WZKA 4GY1A 3REQB 3STFA 1MW3A 4B2DA 4LCQA 2RUSA 1CLKA 3ABOA 1KFKA 5CBBA 3SIZA 3K30A 3OZOA 3CZEA 3EDEA 4H9XA 3VVGA 1XIBA 4J35A 3THCA 1UPMB 3HV8A 4DAFA 4MDPA 2O9OA 4UB9A 5F2LA 2ICSA 3GUWA 5AVHA 2G96A 1J5SA 4XSLA 3WH7A 5BZAA 1DJXA 4CU6A 1TWDA 5H6HA 4NNCA 4MOZA 2X30A 1R3SA 3B9NA 2OODA 3R6IA 2VT0A 1FWHC 1LL7A 3P60A 1US3A 4DBDA 2EGZA 2XINA 3SCOA 1LG1A 5F4XA 3OZMA 1TSIA 4LWWA 4HMDA 3AHYA 4PB3A 1MXSA 4IISA 3T55A 5H91A 5A6KA 1RY0A 1JDFA 5KZMA 1A47A 1UWSA 3PPHA 3EXTA 4JTEA 4TQTA 1Y5WA 4ZQRA 5A8PA 3K4AA 4O12A 1P48A 3QEZA 2ZXBA 1PB0A 5JBFA 4S3JA 4P8UA 1YTEA 5JUVA 2WZIA 4FF7A 4HNLA 5CC7A 4PCSA 4RE0A 5FAJA 3WLLA 3BMXA 4YTQA 2ZBTA 3AYRA 3KW3A 4CVUA 1YXDA 1X8FA 1R9ZA 2WMIA 5EGRA 3YPIA 4V1XA 1EX5A 1FDJA 2GLKA 3OLDA 3CJPA 1EJWC 4H9VA 1E9YB 3AIEA 2ANUA 3BSMA 3I6RA 4OQVA 3ITXA 2R1MA 4CQ9A 1L6YA 4WSHA 1TV7A 4B16A 4HU4A 4JBRA 1UROA 2QZRA 3G1SA 5TBOA 5EKYA 3B9AA 3GNXA 1F8MA 1S1PA 1RVKA 3F7JA 5C9XA 4Z42C 4H8NA 3MSYA 1AW2A 4HZ8A 3TN3A 4MAVA 2WWCA 3UPMA 3TYZA 1ZPTA 2ESCA 1Q7ZA 3P5ZA 3ARTA 4M81A 4KFPA 4FX7A 5CJMA 4QCEA 4RXFA 3HJZA 3DFYA 3MUCA 3BXWA 4NZCA 2YX0A 3TW7A 3R0KA 4H9MA 1PEZA 2Y5JA 1S5TA 4R9OA 5CBJA 4ZO6A 4MY8A 1IYXA 1KNWA 3WH8A 3TC3A 4XZ9A 2V9DA 1RK5A 3NR0A 2GGEA 3AUJA 4UTJA 2NWSA 5L6UA 2BZNA 1CX9A 5I78A 3WLMA 4B9ZA 3TJ4A 1NH6A 5EMYA 4AYGA 3BCJA 3N4AA 1BWLA 2JIEA 3MMTA 3R10A 1KWKA 4AY8A 1E1FA 5CG7A 5IXEA 3DXIA 2PDJA 3VNKA 5CJNA 3PTMA 2ABAA 2CLMA 2PWEA 4EK7A 3M5XA 1ZTVA 2YCLA 4DQWA 4YYFA 3PB2A 3NM3A 4IPLA 4U33A 3LCXA 2X2YA 4MNMA 3EPOA 4B2DD 1T41A 4FEZA 1PZ0A 2I1OA 1K3UA 4IPJA 1QNPA 1VFHA 2QULA 3DIPA 4HD5A 5BXRA 4MKSA 5EFDA 4MKVA 4LBUA 5CSYA 3WEMA 1XLCA 2YIHA 3KVLA 4MB3A 3VNLA 5BRQA 3FDGA 4FR1A 4DHGA 4S3BA 5TF0A 3LM3A 4U10A 2OB3A 4Y96A 4C1NA 3RCNA 4NZJA 1JYWA 1YTDA 3NDZA 3GYEA 2ALDA 3GTIA 1XDLA 3M4HA 1UD2A 3BSHA 1Q6OA 1EC7A 2PDPA 3F2CA 2PS2A 4OOUA 1XYZA 1EIBA 4E2BA 2I17A 3SCTA 1AQFA 3SCWA 3M1ZA 1AJ0A 1MDLA 3ICJA 4ECLA 3MSGA 4Q33A 5M03A 1J0IA 1W1IE 3WQCA 4UQEA 1KGUA 3FVDA 1HVQA 1GPWA 3A6OA 2FZNA 1K1DA 5DEZA 1XLLA 1GQJA 3D3FA 1Q6QA 4E4FA 2E6AA 3U5UA 3GS6A 3NPWA 3W1NA 4MB1A 1QOQA 1ITQA 3R79A 4OBTA 3O9NA 3UBPC 2OT0A 3LERA 2WSPA 3EMCA 1H7XA 2XUCA 3KOYA 3SURA 4LVDA 4L6DA 3BGJA 1QR7A 3FAXA 5LZLA 1ICPA 3O6CA 4FK9A 3KFTA 1BVWA 1EC9A 2BHYA 2JF7A 5G2HA 4C6EA 3AXIA 1D2KA 4O57A 2WCSA 1UR0A 4RNFA 3FHQA 3CNYA 4FSAA 5F4SA 1K6AA 1TTJA 3WLKX 5AFDA 3HURA 5FEZA 3C0JA 4UFJA 3I3BA 4DWSD 1OEPA 4HU3A 2PE4A 4HOZA 4DXVA 2DUXA 3TDFA 2TODA 4MHBA 5GNZA 3E3HA 2ZRUA 3BLEA 3GDLA 3CQHA 1AA1B 1YNYA 5BWAA 1DXFA 4J3VA 3V1HA 4NHVA 1OM0A 2YBVA 3WF1A 1IV8A 4BZYA 4GY7A 5T9CE 3M5ZA 3UETA 3ZVHA 2E6YA 1NDVA 2TMDA 3KRUA 2I5QA 1W5QA 1H1ZA 4XX6A 4XUGA 5LIKX 2JFEX 3DKJA 1GGOA 2NV1A 3DYPA 5I77A 5LHFA 1MVYA 4GC3A 5BU9A 5J5RA 4AH7A 1OCBA 4AVFA 1V8EA 1CGXA 1D3GA 5E6YA 3U2ZA 4GGBA 3PM6A 1E6RA 1RCXB 4UUIA 1QPKA 4KCWA 5E0KA 4F0MA 1IWBA 2NVCA 1IR1A 3IPWA 3SUSA 2JE8A 3KL3A 2XM1A 3SJNA 4LY4A 3DHDA 1D9EA 4Q4MA 2ZIDA 4WD0A 1KXQA 4JFVA 3GVGA 1M1BA 2KAUC 1FDYA 1UWAA 3W82A 1A3XA 2JGQA 4Z2LA 4HTBA 1AZ2A 3BAKA 1PX4A 2VNCA 4E2VA 1TVLA 5DCEA 3WK3A 2ZZ7A 4MMWA 4OWGA 4RLIA 4HMCA 1YDNA 1J2BA 4BR1A 4OVXA 3U2OA 3WL0A 7TAAA 2AL1A 4C6JA 1UA7A 1JCTA 3UR2A 2C7FA 1LCOA 3B06A 3TYAA 3O0FA 5DBUA 1OYBA 2FHCA 3MI6A 3DKLA 4NZFA 2NWRA 4TR9A 2DORA 3MSRA 3T0BA 1IZCA 3W38A 1AK5A 2TRSA 4N4QA 3EWUA 4YXGA 3AJ7A 1TPWA 1XBZA 4GHRA 4PBFA 1HO1A 1TWWA 3WUBA 3WLSA 1EDQA 3CWNA 2Q71A 4MF4A 2ZDSA 1UBSA 4RZ4A 5DRCA 4Y2WA 5FF3A 1EGZA 3UGVA 1BQCA 5G1TA 2ZE0A 4PUNA 3RIKA 2ISVA 4AXNA 3SN4A 4GZ7A 4AAJA 2OMAA 4JQAA 2HJPA 3MPGA 3JW7A 2E7FA 3W86A 4XZIA 2ISFA 1OT2A 4UNKA 1E1CA 1UIOA 2Q8LA 1R47A 1H50A 4FP1A 3W6YA 1T0OA 1L6WA 1J0HA 3AHZA 3E0FA 2E0PA 2VKZG 3SO7A 2SFPA 3G18A 3K13A 1CEOA 3VCNA 2KZHA 3Q2DA 4Q3MA 3STPA 2RDUA 3LLFA 4D6IA 4GJJA 2QEZA 4BF7A 3TC6A 3CASA 2PGEA 3CL6A 4JAWA 3VDGA 1OK4A 3LGDA 2J66A 3BLPX 2QCDA 1FXQA 2F6XA 2XN2A 4UMAA 3PP7A 5D8WA 1WCGA 4IIDA 4GZIA 3NEHA 3CO4A 2VRQA 4WJXA 3IV8A 3DC0A 3WF0A 4QAIA 2D24A 2V69A 1RP9A 3W24A 2F9RA 3LTPA 5HANA 2TPSA 6REQB 3H8AA 4GH3A 2X42A 3POHA 3WYZA 2EPOA 3DESA 3R58A 4RUBA 2DT2A 4DBEA 4KCUA 1GOWA 4GC4A 1DWIM 3U9IA 3A22A 4FPSA 3GNDA 2J25A 1UZHA 3OW1A 4CU8A 1CBGA 1NEYA 1F3XA 2ZXQA 4JTSA 1ZBKA 2FB2A 1SM9A 4RZBA 4J7RA 3P62A 4RDZA 3AU2A 5CZKA 1AW1A 4AQLA 1XYLA 3VKKA 3GSMA 4I7UA 4JTJA 3RR4A 2Z2UA 2WJZA 4YWIA 1C8QA 3GG0A 1TB3A 4GVFA 3PWIA 1UD3A 3B8SA 2ACSA 1D7KA 3UG4A 1W1B1 1FWIC 2XH2A 2DSVA 1R46A 3BTNA 1ME9A 3VMNA 2R8WA 4FLOA 2LLEA 1ECEA 1B2YA 5XIAA 2QCMA 3KTXA 5I3GA 2NX1A 1YPIA 3ID7A 3RCYA 1G7VA 1O7AA 4X3ZA 3W7DA 3LSCA 1FOBA 4IWWA 5HMDA 1HUVA 1JDCA 4IJBA 3VOJA 1UUMA 2HNHA 1SZNA 3WD1A 4JHOA 3V5CA 1P6CA 3TW6A 1B3VA 2J8GA 4A2SA 1K7XA 3AU6A 1QXLA 4LYRA 1LROA 5JBEA 3E5BA 3FSTA 4IHCA 1AQ0A 2NVDA 2ZUMA 2EPLX 5IFPA 3LU2A 4G8TA 3UCQA 4JYEA 3IUDA 2UBPC 5REQB 2A3EA 2DZBA 1VD6A 8XIMA 4EX4A 3MMDA 1KM5A 3S9ZA 1E9LA 2CNCA 3UXLA 5K2ZA 1PE1A 2V30A 3GAKA 3TJXA 3VUSA 1G4PA 3W3OA 3WK1A 3UR7A 2RGLA 2NQZA 3KLKA 4N6FA 1UP3A 1WDSA 1LBLA 1XV8A 2FDSA 3SUWA 1B5TA 3JZUA 3MVIA 4XD3A 1GVOA 3APYA 1JXJA 2YL8A 3AI0A 4B9YA 1H49A 2ZX8A 3CMJA 2HVOA 3AYSA 5DXYA 1BGGA 4XVEA 3B9OA 1GCYA 4QITA 1KBJA 2VEPA 4PE8A 2ZWYA 3EWZA 4NT0A 1EGMA 1Q7QA 2Y6ZA 3ITLA 4MFEA 4ZOAA 3QGVA 1QW8A 2DZTA 3LCLA 3PTKA 2Y7DA 3K8KA 4JTQA 3SN1A 1NAL1 4QROA 1NFBA 2GSJA 3TR2A 4JQ4A 3UERA 1W6TA 3CAWA 3KDOA 4MGGA 2WM1A 1PZ3A 2GQ8A 4X9SA 4PUUA 3WKZA 3WLPA 5A6LA 2J7GA 1F07A 2CBUA 4R9XA 3G1YA 3MHFA 3HG3A 3AS0A 4KRTA 3QW3A 5C9ZA 5EBAA 4XBJA 2IKJA 1QNQA 4FB7A 1PTAA 5CPTA 5T26A 2YLAA 1JCYA 3EEGA 3WO8A 4YMZA 1UPPA 2P0OA 3S2NA 4YTSA 1H7RA 4I3GA 3ALGA 2B0MA 1M5WA 1FWDC 4DWDA 2A6LA 1A5BA 5EA9A 4MUZA 2E67A 5A6JA 4UC5A 3TQ0A 1JNEA 3E5PA 1XH0A 5L9FA 4E0CA 5ABFA 1JUEA 1ZAHA 2FTWA 2IXUA 1BGAA 3GO2A 1NVMA 1KM3A 3W6LA 2VR2A 2HE8A 5I79A 4UQ9A 3PFRA 2VGGA 1F74A 4DBWA 2P50A 1N55A 5KMYA 1H41A 1Y7VA 2RJHA 2CCRA 1RJRA 2QGHA 2GZXA 4DJFD 1TRDA 1XWYA 4WIWA 3PZMA 1GVEA 1L8NA 4M29A 3GC5A 2OOFA 5DT7A 2YFOA 4J3ZA 4E3VA 5JU6A 3WBWA 2D0GA 2BSLA 4G6CA 4LH8A 4WDWA 3VIMA 1R5YA 3S1WA 3G8EA 4UR8A 4PEEA 1FHLA 3FA5A 4L7ZA 4ZBCA 3NZPA 4HPJA 5IDZA 4C90A 1GHSA 4HT3A 4J3UA 2X8RA 5C2XA 5A6BD 4WGXA 2OGYA 1EKOA 4O53A 4LSBA 4TXEA 5DMNA 4UTHA 2PBOA 2GFTA 3WQ5A 5IHSA 1EHAA 4DVOA 3Q45A 4GISA 3CQKA 3K4WA 1JGMA 3AZRA 2Z1BA 2EPKX 4HP5A 3LV5A 2AL2A 2WLZA 3WQ8A 3BLLA 2Y4SA 4JDBA 1EUNA 4UTMA 3P2VA 1Z48A 4TIMA 1I8JA 1OX5A 1ZRQA 1RBAA 3S5ZA 5CBIA 4S3FA 3EB3A 4Y9OA 1GONA 1LP6A 1NFGA 3VD5A 5H2ZA 1VCFA 4I5UA 2CKSA 3MYPA 1QT1A 2FHBA 1KXTA 3NWRA 1QPQA 3BMWA 1U5VA 2VR5A 4RK8A 4A3UA 1KFCA 5D03A 3PUOA 2WJFA 3EDDA 4O1BA 4NU7A 1I0BA 1EX1A 2NQJA 3VO0A 1ESWA 1U1UA 1FBAA 1W8SA 2QCGA 3W1AA 2CPUA 1EP1A 4WDUA 2G95A 3AS1A 3M0VA 3UZZA 2WNZA 1H63A 1X8CA 1V6UA 4PCTA 5BW6A 1Q3NA 1R3WA 2PDKA 5DMLA 3N04A 3IAQA 4LCSA 4K2SA 5D05A 4KT2A 2PDHA 1X1OA 2AMXA 2MANA 2QVNA 1MQQA 4U3CA 3TN5A 3W27A 1YHTA 5C9RA 4IPPA 3G0XA 3KM8A 1QCWA 3PFMA 1U5HA 4PMZA 4IMEA 3SCVA 4DWSC 1SZEA 4U4MA 1OF8A 3OODA 2PEVA 2PSNA 1YMYA 5IBXC 3G3MA 3UG8A 4Q8WA 1MFVA 4QJ4B 1KQZA 3A9IA 4XZHA 5G2WA 1K4HA 5AHNA 1H61A 3DECA 2REQA 1RQHA 2ZXAA 2DVXA 4D8AA 1B31A 2OWWA 2A2IA 2A21A 3U3HA 2ZZ1A 1OABA 3PAOA 4C6QA 5BROA 3DX5A 5AC4A 1I2OA 2YCIX 4LV9A 1L8PA 3BICA 4UXDA 5ECVA 4L80A 3ORWA 1VHNA 5FJTA 1XX1A 3NQGA 1G67A 1KKRA 4N6EA 4B4HA 4JFWA 4DELA 4ZB0A 4FO4A 1NARA 4WUIA 2RKXA 3BLDA 4WR3A 4JHZA 1B3WA 5A1AA 4ORIA 1CI1A 1HKVA 1BVNP 3W07A 2ZOXA 3VD7A 3NZRA 3DN5A 1GW1A 1UD4A 1V4YA 1VJZA 2ZUWA 2NQ9A 1CCWB 3GDRA 3WEZA 1V3HA 2GL5A 3USZA 3BC9A 2OVLA 3SQSA 3DOPA 4LJ3A 4WY0B 4I9TA 5A94A 3NL2A 2OO0A 2RDTA 5G4WA 4Q8UA 4JCMA 1R9YA 1VLWA 5D2YA 3QHMA 4JX4A 3E2QA 1UD8A 3V5OA 3ZJ7A 4I8YA 3CL7A 4L4LA 4JYDA 3B0PA 3CPRA 2EG6A 3ITTA 2J62A 1KC7A 3SGZA 2Q8ZA 2V3DA 4S39A 1V3JA 4DZAA 3UJSA 4C6IA 3MKKA 1V93A 1W3HA 1LBMA 3WJWA 3BL3A 5LIUX 4IQDA 2EKGA 4MZYA 3FY1A 4LS1A 4OIFA 4ZL1A 2R82A 4GJIA 3GVVA 4ZE5A 1P0KA 2Y62A 3L68A 5EMKA 4AMAA 4KH2A 4L9XA 4EOUA 3QOMA 3CTLA 5D9OA 3T2QA 3LHVA 5D02A 4DZHA 3S9YA 3ZVHB 3PSVA 3NA8A 1OD0A 1XRSA 3K8LA 4S2CA 5I6SA 2CLHA 1US2A 2PRLA 2CW6A 2GGJA 1E6SM 1ITCA 4JL1A 3I7RA 5BOFA 1TJ1A 3ZJKA 3RPMA 1UR2A 5CAHA 3BG5A 4ONVA 2VURA 3GX9A 4WJEA 1SJAA 1Z89A 3UJRA 2O56A 2V38A 1GW9A 2W5FA 1VBJA 1KV8A 1TPUA 1ZJAA 3SUVA 3UWZA 2OELA 3LPGA 1E4IA 1BTCA 4RW3A 4Y9MA 4PMQA 4PUWA 3WJSA 2YR1A 3V75A 1UC4A 4E8CA 4P7NA 1A4LA 3H2MA 3C8NA 5T8GA 3SEPA 4J2PA 5FJOA 3RYSA 2WK2A 3EX4A 1J10A 2CBIA 4AD4A 3NQ2A 4CU7A 3W1UA 1NDWA 4GUFA 1LM1A 1FDZA 2DQWA 4MY1A 2VD9A 1W32A 3TFXA 1WE5A 4CNOA 1JDAA 4BS0A 4L1WA 1RQEA 1ME8A 2Z26A 4H9TA 3FIGA 3N3MA 3CHDA 1FCVA 3OB8A 1GG1A 4DF1A 4MJZA 3NQ7A 4DNMA 3RF9A 4CNSA 2YDRA 3MP3A 1JD9A 3W22A 4JIEA 5D2XA 3Q65A 1PKMA 3WFLA 2CESA 4HPGA 3GDKA 2PP1A 1FWBC 1SQ7A 2NT1A 4MUPA 9RUBA 3H4WA 4UOJA 3A21A 4IF2A 4A3RA 4QS5A 1OD8A 2J88A 4NZ3A 4PMJA 3WQDA 7ENLA 3AS2A 3T7VA 4QG9A 1E1CB 1NIUA 4TTUA 1XINA 3IIOA 4FLQA 1NF7A 2E5BA 3LDVA 4U31A 4RDWA 3T81A 3MZ2A 3N9KA 4GABA 2R94A 3WQVA 4LEFA 4HU8A 3LNPA 5I09A 1GVFA 2E3ZA 3IWPA 1PS9A 4ROQA 3LSBA 3B8WA 2GVGA 2QV5A 2D2OA 3EWWA 2PTZA 4C60A 2VP8A 4A8NA 4KETA 2TAAA 2X16A 2C1IA 3P74A 3VE9A 3BLKA 5D9MA 4L6OA 1KRCC 2J7BA 2QCDB 3GG1A 4KKXA 4AG0A 2EEXA 1HT6A 2TYSA 3V1PA 4P5UA 1F4AA 3VGHA 4NZ5A 1GTEA 1OWQA 3CBWA 3VGGA 2WC3A 1JPIA 2YZ5A 3ANYA 5DQPA 4EIVA 2C15A 2I14A 2X05A 5AHMA 3QTGA 4INFA 2WVTA 3OBEA 2F61A 4E2DA 2AQVA 4WGHA 1GORA 2OTDA 4MG4A 1S2AA 3RX2A 4EKJA 5I07A 2YZRA 1QBAA 3GIYA 5FEPA 3E0IA 1TKKA 3W88A 1LDCA 5GJNA 3T4WA 1KRAC 4NJGA 3PJUA 3KL5A 1J0KA 4ZVJA 2J7EA 1XGDA 1KCZA 2ADAA 4ILSA 1NWRA 4W8AA 4A22A 1QI4A 2Z29A 3A3HA 1PHQA 2YB1A 4NAFB 3NQMA 3LMYA 3E38A 3WLIA 1JF6A 1J8VA 2HROA 2PPGA 2YL9A 1XSKA 5E1QA 5AN7A 3BZJA 1QI2A 1FFQA 3HPFA 2QKFA 2NQLA 3G3DA 1IWPA 1W9UA 4Q8PA 4FA3A 2CXGA 3S2CA 4HA0A 3WSUA 1S2CA 3NOYA 4YVXA 2CZEA 1K70A 2XZ7A 2WMKA 3FKRA 1RD6A 3KBJA 1GQKA 3APTA 1JUKA 5DCDA 1ITXA 4KEMA 4V27A 1TQXA 2OU4A 2J47A 3TQVA 2OPJA 4AIBA 4LU0A 1W3NA 2DY3A 1RV8A 3DYOA 3R0UA 2VXNA 3TCEA 1AH4A 3G1HA 3CMFA 2PWGA 4P8WA 3S47A 2J24A 3VE7A 3QR0A 4DNHA 3CWOX 1RJQA 3O3RA 1DJGA 3A12A 4F2BA 1WYIA 1JFHA 4Q6XA 1EBGA 2ZDRA 3FHAA 4L56A 3GU1A 4LXFA 4N4PA 5A8GA 1H51A 2PU0A 1W1TA 1H1YA 3W73A 1TZ9A 3PF3A 4G7EA 1KA9F 4JTGA 2I56A 2XFRA 3HQNA 3TSBA 4C5ZA 2CLIA 1CZ1A 4KEUA 1QASA 3TYBA 4UTTA 8RUCA 1XIHA 3VZXA 3T0DA 2XN0A 3BARA 2OX4A 4AEOA 1EJVC 4JTUA 2QNEA 5EY5A 4HIBA 2PDIA 1B0IA 2XISA 2PWDA 1GVQA 5D2TA 1OZMA 2G4JA 2XHYA 3CH0A 2DSUA 4OFCA 4RNIA 3KVJA 3RK8A 2QDHA 4NJJA 4GKLA 4DJFC 2ZUNA 4ZQPA 4CN6A 4TTGA 2XN1A 1V3LA 4H8UA 3RLGA 3LRMA 2BX7A 3N15A 2GQ3A 1UP0A 4GCXA 4UFKA 3NPXA 5FD0A 3L4YA 3T4CA 1W3IA 1CB7B 3V18A 3H7RA 1YTKA 1Q6LA 2CITA 3C2VA 4IUGA 1FWTA 3AMCA 1NOFA 3WD4A 2X0SA 3G5EA 4OKDA 3W7NA 3SSJA 4UTWA 4QSHA 2YXOA 5AECA 3URNA 4O15A 3SSZA 1VAHA 3TMLA 1RR2A 1EO7A 3OVPA 1XG4A 1ME7A 1PWMA 4AZGA 2GUYA 3MKCA 2FHFA 3ARQA 5DFAA 1LQ0A 2EPMX 2D2JA 1JXKA 1G4SA 5FF7A 2YBTA 2VELA 3H2AA 1XLDA 4N9DA 5RUBA 2V0TA 1XH1A 2VZOA 3WENA 4C6FA 1C91A 4IGHA 5CGTA 2C79A 3AICA 3PB0A 4W5ZA 2PLMA 4JN8A 3OLIA 3WMLA 1Q6RA 3ITYA 4QEHA 1UC5A 1GOXA 3P84A 4F0SA 1XRFA 1UR9A 5I7GA 4ZSUA 5FJUA 2GUUA 5EMLA 3D46A 1GQLA 1DJHA 2IMRA 2WPGA 1XS2A 2D3NA 1UIPA 5AC8A 2ZC1A 3R13A 5C2CA 3BPWA 4S3KA 1S1RA 3UQNA 3KXQA 1VPQA 3WFZA 5C8BB 2QAPA 2UV8G 5BXTA 2Z1XA 5SWUA 2PDQA 1WUEA 1VRXA 5I3DA 3RITA 5A2BA 3WQPA 1S5VA 4JTAA 1GVRA 1UJQA 2AOSA 1QPNA 3LRKA 1V0MA 1HJUA 1UW9A 1KV5A 3TLQA 5U7SA 4E3TA 4V28A 4W8BA 1P4CA 1DE6A 3QMTA 3T44A 1JDEA 4MB5A 3QGKC 1B4EA 1JULA 2D23A 2GJPA 1VEMA 3MC5A 5FOOA 3TYEA 1Q65A 1R38A 1XKYA 1UWTA 3W2LA 5LNUA 2ACRA 2CZ5A 1M01A 2XIJA 4QM1A 3MI2A 3JUGA 4XISA 4MDOA 4QISA 3MO7A 3N11A 3FK4A 3FN9A 5I24A 2YA2A 3OU8A 3HFTA 4PODA 1F2JA 1ZCCA 4DJEA 4PMNA 2PTDA 2VMFA 4CNPA 3NG3A 3WQGA 3M0LA 4PMUA 4D2JA 3L9CA 2OEKA 1DWFM 4O4VA 4YL2A 2AL2B 1GOQA 3EA1A 3BGGA 4JFUA 3NCOA 3GR8A 3A47A 4HCDA 4GYJA 2FDMA 5EPDA 4XAZA 1O5RA 4HZ6A 4M1BA 1LJYA 4KWSA 3MYOA 3WH9A 2IPJA 2X1TA 3QLDA 4AF0A 4UTLA 3C4UA 1KQYA 4IMAA 1J2WA 1WAWA 3D5HA 4XVDA 1R7AA 5HAOA 3HM7A 1EHNA 3F4CA 2Y85A 3M44A 3ENLA 4MB4A 2VRJA 1ML1A 1W1ZA 2ASHA 2Y70A 2VI0A 3A4XA 3ZZ1A 5CPSA 3TN4A 2C0AA 1S2WA 5AC7A 2YPIA 3FDKA 5DBTA 1XUUA 4FNUA 2VX5A 2YCEA 4HN4A 1OGBA 2X0YA 3W28A 4Z2KA 3VIGA 1TPH1 2DZAA 4Q4OA 4JIPA 4TO8A 4EPEC 3FS2A 1GKPA 3BANA 3WNLA 3KHJA 2C1HA 3ZT7A 3UCDA 5CPLA 3CB3A 5XIMA 2UY5A 5IRPA 4LW7A 3TXVA 3RAOA 3QC0A 4JX6A 2CYGA 1NQKA 3W7QA 3GNNA 4CLMA 4IT1A 4I7WA 2GJRA 4PEKA 3EX1A 4HA4A 2QUUA 3GFYA 2CHOA 3VC5A 3UNTA 2PB1A 3VDCA 3APGA 2PDNA 4H6QA 2HBXA 2FMOA 4EXQA 3AZSA 2BY2A 2EAWA 2Q02A 4IP5A 2E1WA 3W85A 3LLDA 2BFGA 1IXQA 4HNTA 3GHSA 5C7HA 4YVPA 1HVXA 5LGZA 3AYVA 1DHPA 2ZX9A 4BKNA 1NWUA 2HVNA 2E68A 5D30A 1JCJA 4KF1A 4B91A 4Q8OA 2Y8UA 2J79A 2DEPA 4K8GA 1R2RA 2H3BA 2G41A 1XYMA 2Z1KA 4IOTA 4LOCA 3WBXA 4LALA 1CGUA 3LENA 2ISDA 2G3IA 4QXIA 4AZHA 4MWAE 2YGYA 3KBVA 3QR3A 1VF8A 4O0QA 1ZCOA 3NL5A 4ALDA 2FZBA 2A3BA 3LHYA 3WELA 3TTQA 2V2DA 4YNGA 3RFAA 3OBAA 5G4HC 1JD7A 4W5UA 1UA3A 1ZP3A 2C91A 4Y7EA 5LIWX 3PHAA 4XAGA 4OUEA 2GK1A 4GIRA 3WH5A 3E0LA 4H2CA 5DY3A 3VIJA 1P43A 4RX0A 3MVTA 4LUSB 2G0WA 1GYNA 5LA2A 1HQTA 3W37A 1OX6A 4WXZA 2GDUA 2HE5A 3U57A 2DFAA 5KITA 1E5JA 1ISZA 3ZMRA 3UNDA 3L2MA 2VFEA 4Q4SA 2VCCA 1I9CB 2ZYFA 4LUTA 3P8JA 2ZZ6A 2CFFA 2B4GA 2WKJA 4KIEA 4AB4A 2BXVA 3STCA 3E2VA 4O17A 1ZB5A 3I68A 3VPLA 5FSEC 3L4WA 1R7OA 3VIIA 3HV9A 2PWHA 2GJLA 1DKWA 1EH9A 2E4TA 5HQLA 3EZ4A 4AMCA 1SUXA 2PF8A 2P8BA 4NI8A 2O4QA 4D6EA 3F4WA 3WDPP 4U5KA 5KZDA 2Y63A 3OA5A 3TNOA 3W7MA 4LPCA 2XIOA 2PA6A 4G56A 5DF0A 4JGDA 4X60A 2BMBA 2OEMA 4JFSA 1CXKA 3NZQA 3N3TA 3PPCA 1TJ2A 2HPMA 1L6GA 3NO1A 5FSDC 1FCUA 1R85A 4RDYA 1UWUA 1BG9A 1ZP4A 1FWJC 2WMHA 1HXJA 4AU0A 3CZGA 4PUJA 1YXCA 3W72A 3B8IA 5LXEA 3VXGA 3WX7A 2NV9A 4GNVA 2Y5EA 4WSJA 4KMQA 1TV2A 1J0JA 3KBNA 2WLYA 2Y7GA 3EYPA 1ZQ5A 2AMGA 2DW6A 1S2UA 4LV4A 4R3UA 5AHEA 3S1VA 1PIIA 3CGTA 5D2VA 2ZX6A 4DLMA 2V6AA 1XD1A 2J27A 3GTNA 1VBUA 1GVIA 1M7PA 2GVJA 5I00A 3ZVIA 4FOKA 3UA4A 2OSXA 1LQAA 1R87A 1A0CA 4H6KA 4W86A 3WG6A 3W87A 1ZSXA 2WZEA 5DX7A 4FNTA 4JTTA 4MYAA 1LORA 3WMBA 4X61A 1XIEA 1H0IA 1J0ZA 1W3KA 1ZBCA 4G7FA 1I0DA 2FYMA 3I10A 4V33A 2QYGA 3IGSA 4PC8A 1AD1A 2V82A 1HN1A 4HZ7A 3AHVA 1CT5A 1E5NA 1P5BA 5HUPA 1L2QA 4TX6A 3LCHA 4F0RA 3C0QA 1DL3A 1JZ2A 3GE7A 2PWVA 3N4EA 2O9PA 2PDMA 1VIWA 1EJRC 3S4TA 2PDYA 1Q4NX 3W83A 3JVAA 1UH2A 5HUOA 3BMVA 3CK5A 3WQ6A 2BGNE 1VFUA 2Q3OA 1QOXA 4ML9A 5LHEA 1WDQA 3IJ9A 3BK0A 3NSNA 1HGYA 3S83A 2DZUA 1GYMA 3FGCB 3ZXWA 1ZJBA 4C6LA 4EVZA 4NASA 3J7HA 3H6OA 1RHCA 3OZPA 4WY0F 5CPNA 1Q8AA 4LAZA 3V7PA 1ZALA 4O1AA 1Z42A 2PTYA 4F9DA 1D7FA 5CCZA 4AZ5A 3TIMA 1CXIA 9XIMA 1QOPA 4ZCWA 1K8YA 2G3MA 3PUEA 3WLJA 3HGOA 4PMOA 2Y0FA 1E6XM 3MBFA 3ATZA 4W9TA 2QCLA 4PUMA 3W4RA 1TA3A 3LXBA 3WMSA 2PUZA 4KWOA 4DXKA 1SO4A 4C7DA 3OP2A 1F76A 1IIHA 5CZ0A 1WDRA 4AIOA 4WXYA 3WK0A 1K8XA 3OYZA 3MCOA 1X1ZA 2WMFA 5K4ZA 1SJBA 1SJDA 5AYXA 3BGAA 4RR4A 1HKWA 4M82A 3PZGA 4KERA 2ODOA 4MWAB 1G1YA 4CKQA 3WD2A 3VNYA 1BG4A 5C5YA 3UR8A 3URQA 2QCNA 4BY3A 1K02A 1V6VA 2DSZA 2PFHA 3VGFA 4Q8QA 2YDQA 1OQFA 2H3DA 5M2FX 2PDXA 3WDRA 4HCLA 2OYMA 4L4PA 4GACA 3RLVA 4XTDA 1IEVA 4ERIA 3WUEA 3R4IA 5F2GA 1X7FA 4DF0A 5ECUA 1GJUA 4O10A 3W81A 1R2TA 5AZ1A 1QO2A 3NQBA 1B1YA 4V1YA 1O5QA 4GVHA 5FKYA 2VDHA 4ZOCA 2NW0A 1DP0A 4R33A 3RCMA 1Q6GA 4G7EB 1VFLA 2JKAA 1HG3A 1YE6A 3ARRA 4O4WA 1EJXC 1A5OC 1AZ1A 4Z2HA 2JF6A 2CHNA 5A3HA 2XPKA 2ATMA 2QPXA 4OBSA 5A6SA 3SCRA 1F3WA 4C6MA 4NF7A 4WDXA 3BLFA 2QPUA 1BAGA 3VAVA 4J3XA 1DIOA 3PJXA 3RNDA 2V68A 1P0BA 3CUHA 1DWJM 4D6DA 2WQDA 4O28A 3A9BA 1B3OA 5CSSA 1CTNA 3V16A 1JI2A 1W8GA 3ZWSA 4U3AA 2BVTA 1LT8A 2WVSA 4AX6A 1TIMA 4H8VA 3T0TA 4Z2IA 3AMLA 3P93A 1X96A 3NSXA 1V02A 3RGTA 3BAWA 2YW3A 4ADUA 3PULA 4B4FA 4IXXA 3VFLA 2OT1A 5FI8A 2HZGA 5B80A 5HK4A 2A79A 4LC6A 5FF4A 5MF5A 3QYSA 1DQUA 1WOAA 3OIXA 3OOQA 3DHFA 4M7SA 4EXAA 1KGXA 2FH6A 2R14A 3GBDA 2WSKA 3GFZA 3SGGA 2IPGA 2C1GA 2ZVIA 1YDOA 3HN3A 3W1MA 4GE8A 3I3DA 2INEA 3XISA 1MSSA 5A95A 4PL1A 5AHFA 1XLMA 2P0IA 1A3HA 4P8VA 2AGKA 4BEUA 1D8CA 1T8QA 4GPNA 1PJ9A 2MUCA 1LRTA 3CV1A 4GYKA 5I3JA 3DBPA 3BG9A 4TOQA 4MJ4A 3PZIA 1XP3A 3ES8A 5K9DA 1K03A 3P0WA 3OGVA 3IK2A 1VHCA 4GI4A 5CPQA 1QNRA 2YL6A 1XI3A 4GXWA 4AUBA 4B92A 4DAIA 1LL6A 1UKQA 1SW7A 4GMEA 2PLJA 2CLLA 3VIFA 3TOPA 4DPQA 4HYRA 4J40A 1JZ4A 4DN1A 2X2GA 4HMNA 4BA0A 4BEQA 3B0XA 3QSTA 1FX6A 6ALDA 4NY2A 4J3SA 3QQ0A 3CUJA 1U1JA 4IGSA 4IPIA 4QG6A 2E77A 3QZ6A 4JKKA 3KOZA 1PL9A 4ADSA 2VFHA 4H6EA 4AIUA 4YU1A 1FHUA 2W79A 2G4FA 3BW3A 2QV4A 4F2TA 4NAEA 3JZEA 5HWJA 3DFSA 3G22A 3M7WA 3COTA 4FNRA 3MHUA 1HL8A 1T6MA 4D1IA 4XAYA 1BF6A 2CZVA 1GZ1A 3N9RA 6PTDA 4ZFCA 4WZHA 3LEPA 2FH8A 5LGXA 4L1GA 5DMYA 1H0GA 3W1LA 1MW0A 4O1DA 1OFAA 1YKWA 1I6NA 3DFHA 4JPGA 1L2UA 2O0TA 3G6MA 3MW7A 3AIUA 1JR1A 3QF0A 2WQPA 2PTWA 4Q4RA 4TU1A 4AD3A 3H4XA 1SZFA 1E3ZA 1TYGA 1E4MM 2VEMA 2PCQA 4F9JA 3QMRA 1BLIA 3VOHA 1PIFA 2WVVB 1G0CA 4GXPA 2BTMA 4GX8A 2FQIA 2PP3A 1EZWA 1JF5A 3C3UA 1N7KA 2HVMA 4F66A 1Z8AA 1TPEA 3CAKA 3RMEA 1EDGA 1NM9A 1BYBA 1M9HA 4AZCA 1H1NA 1SO5A 1VCGA 3EMQA 1SFJA 1DJYA 3L4ZA 4FNQA 4E8DA 3AALA 4RXGA 4HKPA 2VEGA 4E4PA 5LNSA 1N8WA 3LCIA 4GYPC 2HK1A 3UESA 2QJNA 4A2RA 4KGLA 3W7JA 3GG7A 4LEQA 1VZWA 2Z1WA 1PPIA 4Y9NA 2VFFA 2DIJA 1K9FA 4WOZA 5A6TC 3RUBL 3LTSA 5F2MA 2GVYA 1UMLA 3LGEA 2PGWA 2VDIA 3UYCA 1G9HA 5KSWA 4NRSA 3N6QA 1L9WA 3GG8A 3RDKA 2BWGA 5CLTA 1EPVA 1E71M 2X40A 3BG3A 4NX0A 2NSXA 3R7MA 4OU1A 2FGLA 1EQPA 5ABEA 1KR0A 2ZZ2A 3LMZA 5DCBA 1JJKA 3L7RA 4D1JA 4GNKB 1JDDA 1HGWA 2F38A 1H3GA 5E0CA 1X6UA 3NQEA 1Z7AA 3FEMA 5FIPA 2UZ9A 3R11A 2DPEA 5MKGB 1GWJA 4B5WA 4LBSA 3VX0A 3LHZA 3M0IA 3WEOA 3W1RA 1VFMA 1SZRA 2FGZA 4AIEA 4UBPC 3UJFA 4O1EA 1K4GA 1H4PA 1P7TA 1XGEA 2B7QA 3NZGA 4TUFA 4N02A 1DQXA 2GK1B 1DWHM 3ARZA 2QLYA 4GG9A 4S3DA 1KTBA 4HPNA 1R3RA 3AXKA 4JTCA 2E09A 4H83A 3CAQA 4Z1BA 1S46A 2DZSA 3G1DA 1QUMA 4QQ3A 4WKAA 1EJ7L 2NSOA 4QQUA 1LUCA 3HZ3A 4KCVA 3TXZA 5K7JA 4LF2A 3NZ1A 4LUTB 3HQOA 3GHRA 3PZ9A 1TPFA 2Z7KA 2Q09A 3QVQA 3UR5A 4DUOA 3F4NA 1RCOB 5AB3A 3PTDA 2ZUTA 1TWSA 2Y88A 1QRQA 4K7YA 1OY0A 4IFKA 3LBOA 5DXXA 1ADDA 2ZE3A 4J3WA 1A3WA 3WQEA 5DLCA 3UZWA 3W1PA 4ZB2A 4CN1A 2FKPA 5D04C 4JTRA 4OUIA 1GZJA 1CGVA 4YCPA 2YXXA 3M0MA 3R89A 4H01A 1UZDA 1E9ZB 1OBAA 1CDGA 3HU7A 2EJAA 2HPIA 1B9BA 4NIRA 2PDFA 3MP5A 3G2GA 4QEEA 4MWAD 3HG2A 1LYXA 4XO6A 2V3GA 2F7FA 4WKHA 1RQBA 4LVGA 3W02A 3SM0A 5GJMA 4JCLA 4QRNA 1UKSA 3PPFA 3ZSTA 1W0MA 1E0XA 5BRBA 2VWSA 2BHUA 1ISYA 4GK8A 4KPLA 2QGYA 1XYBA 2VYOA 1O60A 1G94A 1K8CA 3U0HA 1WV2A 3C2YA 3IVTA 4S3AA 3MWCA 4IIFA 3RRXA 1OGSA 2C8NA 3K2GA 4AHPA 1KM1A 1KLZA 4JOMA 3SQMA 1ISWA 4LT9A 4KFNA 4X0NA 3U2CA 4GNJA 2PGFA 3EX6A 3QV7A 3NFUA 4HNNA 1G7UA 3QM3A 8A3HA 3SRKA 1XRVA 4DF2A 4URIA 4GCAA 4Z1DA 1AQHA 2XSXA 4NNAA 1VC4A 1GVSA 2O9RA 1FP9A 4R7JA 4S23A 4C91A 3CQIA 1RA5A 1Z44A 1L6SA 3TAOA 2VO5A 4CD7A 3LA4A 2HV5A 3ARVA 2XGIA 1KM6A 1R3TA 3F5LA 1NJJA 3BCFA 3VOFA 1A5SA 1V3IA 3QW4B 4EWND 2PBGA 3SRHA 4MNJA 2NLYA 4RZ6A 3ZM8A 4FR6A 2CC0A 3CPGA 3EOSA 3LQGA 3QQWA 4HNVA 4TV6A 3GZAA 4JNYA 1SO6A 1TR1A 3CO8A 4JFTA 4W84A 4GUJA 4CCEA 3N25A 1CXFA 2R1NA 1K9TA 2QUVA 1GHRA 4J27A 2D3LA 2IS7A 3PSWA 2P1FA 2Z4GA 1A80A 3S5YA 3LN3A 4M6QA 3MI3A 1XH2A 2XVLA 1F3TA 3RU6A 1XXXA 4NUWA 5E93A 1E6QM 1FXPA 4YYCA 4KQNA 4QFUA 4DWSA 4I9AA 3N34A 4Q4KA 4PMYA 3TUUA 1XLAA 1XLHA 2W4XA 4TVUA 5IBXA 4TX9A 1QNOA 2FJUB 4S38A 2MNRA 3A4WA 4FAMA 1OFRA 3SDOA 1RVGA 4KW2A 1OYAA 5LNVA 3S6DA 1TPB1 1Z6KA 4DY1A 4Z1AA 1CECA 2WANA 3W75A 2IKHA 3D0CA 1LLWA 3ZIZA 1TA3B 1B54A 2QUTA 3N1AA 1EF3A 3LX9A 1MEHA 5LIXX 4UOQA 3NIYA 1BD0A 1SMDA 2PD5A 2Z2BA 1OX4A 2CBJA 4NXSA 5LSMA 4Y6GA 4M5PA 4HJWA 3G6LA 1CYGA 2HDJA 2J13A 2V5JA 1Z41A 5EBUA 1PZ2A 3C61A 3WK2A 1ADOA 3N2XA 3UWUA 4DJDC 1AQMA 1RP8A 2V67A 4WVXA 1DEDA 3L4UA 3HQPA 3CLMA 4GQ0A 4D8LA 4XSMA 3MKVA 2O55A 1BSLA 4M6PA 4ATWA 2RHGA 1ELSA 2J8FA 3AROA 3NQ6A 4ZEPA 1YBQA 3E6EA 3PBWA 2JALA 3UG3A 1FH8A 4IIEA 1E6ZA 1TV4A 2W3ZA 5AHIA 4OJYA 3A4JA 3GW0A 3T42A 1R6WA 3DZ1A 3TQPA 5G1MA 1D3CA 3QPZA 3AIBA 4QJ1A 3S2JA 1EL3A 2E40A 2OGJA 4M0XA 5H8MA 5A6AA 2F8QA 1J96A 3ZS4A 3M0ZA 3RILA 4QJ3B 3VGEA 1EC8A 3VD3A 3WF2A 2WKGA 3QBUA 1GOOA 1WAUA 1AD4A 4HTYA 4PTWA 2TSYA 3RXZA 3W7GA 3W70A 3QV8A 1NU5A 3M47A 4Q6JA 3I7SA 3PUDA 3MZNA 5FJPA 3ZSSA 3TKFA 2VGIA 1EYEA 1OC7A 1QBBA 2BY3A 1JAEA 4YIWA 4IXHA 1LBFA 1FKXA 1V51A 3BVJA 3I4KA 3SN0A 2ZTKA 4BCEA 4FLSA 2HISA 3KDNA 4AZBA 2FPVA 4QE4A 4JS3A 1XPYA 3HF3A 4KFOA 1HKJA 2V2CA 2B7PA 3SW6A 5AKQA 2E8YA 2KX9A 2QR6A 4XB3A 1KM4A 3B9DA 3H7UA 4PGLA 4FALA 3MP4A 1VCVA 3W2UA 2P3EA 3CUGA 3O06A 1H60A 5BXSA 1ENUA 2ZA1A 4IZGA 1WXJA 2H8XA 4MLJA 3T6CA 1K6WA 3GH4A 3EWXA 3GR7A 4CCDA 1UWIA 1KR1A 2YYUA 1DTNA 3T07A 2RFGA 4HU0A 1KBKA 3C2RA 3LBMA 5CLWA 3L66A 1KM2A 4QS6A 3W7LA 2B31A 2HWGA 1LT7A 2NZLA 3R5EA 4NL1A 1TMQA 4HSOA 3NQCA 3GXMA 1EOKA 1Q5MA 4HN8A 4KESA 5C55A 3VNDA 4ERAA 3K5XA 4HK5A 3CC1A 2HTMA 3N4FA 3MMUA 5G1YA 1N8FA 1XLIA 3W76A 5LXXA 4H9ZA 1KRMA 4W7WA 3PNZA 1NFPA 3MJYA 4PSPA 1JIBA 1H5VA 3TV8A 3VKCA 4LB3A 2JIWA 3EKGA 2NT0A 2ZZ4A 3ARUA 1XQKA 1VFSA 3CV7A 4O1CA 3C0LA 3TU9A 2HQAA 1VIZA 1TWIA 3T40A 3VOGA 1IE7C 3AMGA 3TLLA 3UXDA 4DBUA 3IIPA 1PSCA 4LB4A 3V0UA 2OQLA 3WFAA 3A5VA 1QI5A 2XU2A 4YVVA 2JEPA 4IFOA 3GU9A 4A8RA 1YEYA 2Z6JA 1XQLA 5CSUA 1PWLA 1DBTA 3NYZA 4PTVA 4N9CA 1A53A 3QOKA 1Q2SA 1Q6CA 1UG6A 3INPA 2PLKA 1C29A 5CXPA 1GYLA 2IKGA 5KINA 1E40A 1SO3A 4NAEB 3L5MA 3WCZA 3G8RA 4EPDC 1MWOA 1B30A 4ZQCA 4JTKA 3MCNA 2W27A 4E5TA 3N19B 2Z1VA 1DXEA 4DZIA 1HO4A 4MZ1A 2O92A 1AH0A 4JY8A 1H7PA 4TVDA 3U7VA 5HA7A 3CS2A 3UWEA 3BURA 5DT5A 2YJQA 1XLBA 4IMFA 4NKCA 3NVTA 4IQEA 3NQAA 3BV7A 1XIGA 1KD0A 4REQA 3O7UA 5AHLA 3U4AA 1TMLA 3W6MA 1PKYA 3E1F1 1KKOA 1HP4A 2W91A 2NXIA 6CGTA 4A21A 3MQTA 2WNWA 2XWDA 2PDWA 2R24A 3ABQA 3CZLA 4N2YA 4UMBA 4TMBA 3RN6A 3TP4A 5C2GA 2EG8A 3HPAA 3LHWA 4S3EA 3WQFA 4NI3A 3WQOA 2OLSA 7XIMA 2ZCGA 4AZCB 2QCEA 1KFJA 1N2VA 3EOUA 3MUXA 3ZYZA 2ZZ5A 3CLWA 3HJEA 2VZTA 2R9RA 3RM9A 3OG3A 3H2OA 3NGJA 4R5EA 4LAKA 1ZJHA 2GGHA 3BAJA 2YKKA 2YOCA 4XUYA 4JEQA 4ROPA 3M5YA 3L0NA 1VFFA 3M5VA 2WM0A 2A7RA 1VLIA 4HVXA 3OHIA 3WLNA 1NY1A 3PWGA 4AEEA 1BVZA 3L21A 3U5YA 3SR7A 2E25A 4LAOA 1FHVA 3E49A 1R9XA 2ZX7A 3NUKA 4EF9A 1FFRA 2XGBA 1Q85A 4F3HA 1G6CA 1BSIA 3H70A 1DIKA 5A5WA 3IS4A 3MBDA 4PTMA 3LB0A 1FRBA 1P6WA 5G5IA 1VEOA 3S3GA 1KLYA 3GWQA 4RE2A 4MWAC 4DYKA 2WYSA 3ARYA 3E0VA 4X9YA 4D8ZA 3B04A 3JS3A 1AFSA 2P10A 5B7YA 4IJCA 3TQKA 3W7CA 5U4NA 4JHMA 4D6HA 3UY7A 4F48A 5I0DA 2JBMA 3HTWA 3MTWA 3IUIA 1KFBA 1MZRA 2VCAA 1F8IA 2DSWA 3CH9A 5AZ0A 3S1UA 1N82A 4AZ6A 2ZRXA 4FXSA 4DJFA 3I6TA 5IFTA 1CNVA 3GKFA 4PFMA 4UQDA 1W2VA 3U7BA 1BXNA 2FZ9A 4ZOBA 5FF2A 1H62A 2GDQA 2GUBA 3M41A 1UB3A 3DG6A 1YNPA 4C5YA 4CNUA 1LWHA 2ISWA 3VYLA 4DX3A 3M07A 5XINA 3SADA 3EWBX 1MEIA 3GVRA 3LYEA 5M17A 2F6KA 2YA1A 1YE4A 2QIWA 3KBMA 1TJRA 1PCWA 5A6BA 4WRHA 4LY8A 1D3HA 1S3HA 3HBLA 1GZGA 5C0QA 3VM7A 3VIHA 2VOTA 1PCKA 4XBSA 4BJHA 2BOFX 1MMFA 1C7SA 1SR9A 1ZS2A 2ZC8A 2F2HA 1XGZA 2HS6A 4DYEA 2EF9A 5HNUA 3DH7A 4F0KA 4PMDA 3QHNA 4QDMA 4IFKB 3D3AA 2VX7A 1A5AA 3WQWA 1RUSA 1UOZA 4GGHA 3V36A 1I4NA 3F03K 4Q22A 4FI4A 1LLZA 5H8PA 3LGGA 3VU2A 4MY9A 4IUOA 4JTFA 4HCHA 3GTXA 2FGBA 2DT3A 2I9UA 1V0NA 4W4QA 1BQGA 3KAOA 1D8WA 4YTUA 2BVYA 1QHPA 3FXYA 3VTRA 3GYCA 4M8UA 1NWTA 4GQGA 3GC2A 2ZRVA 1J12A 4GD0A 3LHTA 2Y7FA 4JN7A 3R0DA 2P88A 4MKNA 1SMAA 2OXNA 2FIQA 4HB7A 3UP8A 4M6VA 1PYMA 1KTCA 4NZ4A 1DWGM 4HMEA 7TIMA 3PJWA 3VILA 4OOZA 3KE0A 3M6DA 4US5D 3KCJA 3NQVA 2QF8A 4BWLC 3TTOA 1UQZA 1A5MC 6A3HA 3ELFA 3KOFA 4KRZA 1W1YA 1JUBA 3GH5A 3DENA 4M3PA 3EWCA 5T91A 2XYLA 2PURA 4LAMA 1XUZA 1W5MA 1TREA 3TZNA 3S2LA 1I45A 3IV3A 1XIFA 3HQ1A 1FY6A 2GSHA 4OV9A 2VFDA 1WBJA 3BJSA 4RV3A 1XLJA 3PNUA 3BJTA 3A3WA 4F8XA 2VVNA 3ITVA 1ONEA 4P7LA 2FVLA 2QJIA 3DYMA 2WCGA 3JU2A 5I3FA 3DG7A 4K3ZA 4XWUA 1SSGA 2NX9A 1E73M 4K38A 2A1YA 4AWEA 1VGAA 3Q4DA 2V5KA 1YPFA 1J11A 3W23A 1GJPA 2CU0A 3JRKA 1VPYA 3U6WA 4RNJA 3RLHA 3I6EA 1BTMA 3ES7A 4NYUA 5A69A 2E6FA 3GQYA 4O13A 3EXRA 1W3TA 3WNNA 1H7WA 2P76A 2JQXA 3OVRA 4R27A 2OO6A 2WMIB 5IM51 5HXMA 1E70M 4K7VA 2A6NA 3BW2A 1PKNA 3H26A 3TFCA 3N2TA 3PWAA 3MUY1 3WLTA 4I5XA 5TD4A 4XTIA 2PGRA 4L65A 4HPXA 2DH2A 3C56A 3MUZ1 1GG0A 3P7YA 2C3ZA 3IGXA 3VNIA 1TUXA 2Z6IA 5BCAA 1QNVA 4L9ZA 3ZO9A 3S6OA 3TOYA 3ONBA 5JH2A 3M0KA 2VZSA 4ZMGA 4PULA 4W88A 1IEQA 4FOJA 3P61A 3H22A 3C5QA 4FXRA 1WKFA 3QYQA 3TSDA 3N6HA 3PBMA 4PB4A 3VINA 1ALDA 3PUGA 2WJDA 4D9PA 1WOBA 2VR4A 3XIMA 2R1PA 4NG3A 3HPSA 5AYZA 4BFAA 3NNTA 3HGSA 1KCKA 4EAMA 5DELA 1B9ZA 4RL3A 4DUVA 3VC6A 1Y8BA 4GUGA 3GRIA 2ZRYA 5LYRA 5CPMA 4AY7A 3IANA 2OZ3A 3GNPA 3B8DA 1GQNA 3O0KA 5CPOA 4GUIA 1NOUA 1TRIA 1ITUA 3L2IA 2GJNA 1J93A 4B5XA 2OG9A 2YCLB 1JQVA 4F0LA 1YBQB 3OZYA 4LCRA 5HMEA 4HSNA 1C9DA 4UQBA 4B5VA 3GAYA 3NSMA 4JIHA 1GQIA 2X7VA 1WZLA 3L65A 2XVKA 5H1WA 2DZVA 2DZPA 3NYDA 2L5HA 1O94A 4UTFA 1VB9A 3TE9A 2XZ9A 4JL2A 3F5JA 5ENLA 5A2AA 5ABGA 2BHZA 5J8LA 1P0DA 2XIMA 4C1NB 2XFWA 1PX8A 3QV6A 3FSUA 3R25A 4GFIA 3BO9A 2ISSA 2YA0A 1FQ0A 3N14A 3DI0A 5AYIA 1EXPA 5KEZA 1RALA 2HNEA 3PZUA 4B5SA 2DH3A 4CNNA 5CC5A 1BYAA 2C13A 1RBOB 2O4MA 4M19A 4HHMA 5CC3A 1EUAA 1HIZA 1EQCA 2DT0A 1REQA 2XIQA 3BAIA 1R0MA 5F1VA 3GIPA 3QKZA 1SU5A 3SB0A 1Y65A 3EX2A 1B3XA 4EPKA 1MUCA 1GOMA 4QDWA 3PTQA 4XAPA 3FEQA 1AH3A 2AAMA 2INFA 1EOMA 2IQ0A 4P7QA 5D33A 4X2RA 4A6GA 4UFIA 3T0AA 1H09A 2RJGA 4BI7A 2AKMA 3H7VA 3ANVA 4WHBA 4UZUA 4FIQA 2UY4A 3S42A 3NGFA