4D8LA

Crystal structure of the 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
294
structure length
294
Chain Sequence
LTNDERILSWNETPSKPRYTPPPGAIDAHCHVFGPMAQFPFSPKAKYLPRDAGPDMLFALRDHLGFARNVIVQASCHGTDNAATLDAIARAQGKARGIAVVDPAIDEAELAALHEGGMRGIRFNFLKRLVDDAPKDKFLEVAGRLPAGWHVVIYFEADILEELRPFMDAIPVPIVIDHMGRPDVRQGPDGADMKAFRRLLDSREDIWFKATCPDRLDPAGPPWDDFARSVAPLVADYADRVIWGTDWPHPNMQDAIPDDGLVVDMIPRIAPTPELQHKMLVTNPMRLYWSEEME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-pyrone-4,6-dicarbaxylate hydrolase
publication title Structure and Catalytic Mechanism of LigI: Insight into the Amidohydrolase Enzymes of cog3618 and Lignin Degradation.
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 99
structure length 294
sequence length 294
ec nomenclature ec 3.1.1.57: 2-pyrone-4,6-dicarboxylate lactonase.
pdb deposition date 2012-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 4d8lA00
1POJA 1P6BA 4KEZA 4CEXC 4RDWA 3UPMA 3T81A 2BB0A 3TN3A 4L9XA 2R1LA 3HPAA 5HMFA 3GUWA 2XIOA 1ONXA 4EPBC 4C6BA 4WVXA 4C6DA 4ERAA 2Z26A 2Z29A 3URBA 1QW7A 4DYKA 3PNZA 1ZZMA 4H9UA 1GKRA 1FKXA 4XD3A 4C6JA 4QSFA 1I0DA 1EJSC 4QROA 4HA0A 1EJVC 3S4TA 3DC8A 3QGKC 1RJPA 4V1XA 1FWAC 4DNMA 3HM7A 3HTWA 3MJMA 3PAOA 2Z2AA 2VC7A 4C6LA 3KM8A 3A4JA 1A4MA 2HQAA 1K70A 4QTGA 2HBXA 2PGRA 2IMRA 4LALA 1FKWA 3OJGA 3ITCA 1KRCC 1P1MA 1FWJC 3UF9A 3B40A 4TQTA 1UIOA 1NDZA 4IGMA 4DO7A 1NFGA 1V51A 1WXYA 3GRIA 2I5GA 3LGDA 2DVUA 3CJPA 3B0XA 1EJWC 4DZHA 3LGGA 3IJ6A 4HK7A 5HMDA 1KCXA 3MDUA 4QS5A 2R1KA 2AMXA 1RK5A 2Z24A 2Z7GA 3F4CA 4C6MA 4G7EA 4GOAA 2BGNE 4E3TA 2GWGA 4H9YA 3MVIA 5AKQA 1QXLA 1WXZA 3TN5A 4GXWA 5A6TC 1JGMA 2ANUA 1A5OC 4B3ZA 4RDVA 2FVKA 3DCPA 3FDGA 2O4MA 3F2CA 1YNYA 2EG7A 3URQA 4WHBA 1J79A 1P6CA 2EG6A 4KF1A 4H01A 3MDWA 1FWGC 2GZXA 3N2CA 4B91A 1FWHC 4UBPC 4WGXA 1J6OA 1XRTA 2E1WA 2HPIA 4LFYA 4AC7C 1YMYA 4LAKA 1FWIC 3JZEA 4DI8A 1KRAC 4J35A 4DLMA 2YXOA 4ZSUA 1J6PA 4R7WA 2OOFA 3PANA 3CS2A 4C6KA 4PBEA 5FSEC 4IG2A 1ITQA 2OODA 3GU2A 4NP7A 1J5SA 4LEFA 3MTWA 1YBQB 4MUPA 4GX8A 3FEQA 1YBQA 1GKPA 4C6CA 1NDYA 2PLMA 4GK8A 4XAZA 2PUZA 3CAKA 2AQOA 1XGEA 2HPMA 4ERGA 4GY1A 4RE0A 2YB4A 3WZ0E 1RA0A 3TNBA 2QVNA 3E3HA 1DPMA 4LANA 4HJWA 4EPDC 3O0FA 1M7JA 2QT3A 2WJEA 4C6NA 3O7UA 1POKA 2P50A 2WM1A 3URAA 1RJQA 4IF2A 2YZ5A 4PCNA 2VHLA 3LSBA 4JOMA 2R1MA 4CQCA 3PNUA 4C5YA 1NDWA 3UBPC 3S2JA 1RAKA 4CQDA 3IGHX 3TN4A 5G4HC 2EG8A 3E38A 3IV8A 4BKNA 2OQLA 3OQEA 1V79A 4LCRA 2UZ9A 3LSCA 3GTHA 4C6QA 4ERIA 2VR2A 3R0DA 2Y1HA 4B92A 2GWNA 4H9VA 4CQBA 4XAGA 3EWDA 4CEUC 1EJUC 2F6KA 1A5MC 3BE7A 2YB1A 4DZIA 4INFA 2ZC1A 3E74A 4C65A 4GY7A 1KRBC 4IFKB 4OFCA 2UBPC 4H00A 4ICMA 4HK6A 3EGJA 3QY6A 5E5CA 3F4DA 4R88A 2PGFA 1A5NC 4IH3A 3K2GA 1EJTC 3IRSA 1HZYA 4PBFA 4QRNA 1YRRA 4GZ7A 2VUNA 4H9XA 1EYWA 4M51A 1V7AA 5HMEA 1UMLA 1R9ZA 3EWCA 3S2MA 3QY8A 2RAGA 4EPKA 4KEUA 3URNA 3GG7A 4HK5A 2D2GA 2GOKA 1ONWA 2WJFA 4UB9A 3OOQA 3LA4A 4H9TA 2D2JA 4QS6A 3NQBA 1S3TC 4R85A 2A3LA 4C6PA 3LS9A 4LAMA 3UR5A 4L6DA 3QY7A 2Z2BA 3D6NA 1VFLA 2Z00A 3T8LA 4LCQA 2WJDA 2KAUC 4IFOA 4XD6A 3RHGA 4EP8C 1PSCA 1FWCC 1UIPA 2Q01A 3V7PA 1EZ2A 4KESA 1EF2A 4XAYA 3E0FA 3GIQA 1R9YA 1I0BA 3OODA 4CNUA 2P53A 1FWBC 5CH9A 2PAJA 3SFWA 3MKVA 2Z25A 2ICSA 4ZSTA 4DLFA 1V4YA 3E0LA 2Z4GA 3IACA 1E9ZB 3AU6A 4LH8A 4IGNA 1EJXC 4KETA 1K6WA 3LNPA 1FWDC 2Z27A 4YIWA 3B0YA 1FWEC 3T1GA 3NEHA 3ISIX 4KIRA 3PBMA 4J2MA 3F2DA 4XD5A 3ICJA 3A3XA 2Q09A 3GTXA 2FTYA 4F0LA 1O12A 3IARA 3S2NA 4C5ZA 4B90A 4H9MA 2I9UA 4C6EA 4RZBA 2CZVA 4GC3A 5LXXA 2QS8A 1KRMA 2DVXA 2HBVA 3NURA 4GX9A 2W9MA 4C6IA 2FTWA 1K1DA 1RA5A 3DUGA 4RDYA 1PTAA 3GIPA 1A5KC 4I6VA 4BJHA 1W1IE 2AQVA 2G3FA 3GTIA 1ITUA 1A5LC 1M68A 4IFKA 4RDZA 1V77A 3QGAC 4DI9A 1RK6A 4GY0A 3RYSA 3FDKA 4PCPA 4XD4A 3G77A 5FSDC 3AU2A 4LCSA 2VM8A 2GSEA 4F0SA 4Z42C 3OU8A 1GKQA 4G2DA 2OB3A 4F0RA 1PB0A 3LU2A 3SO7A 2O4QA 3K4WA 2E25A 3UR2A 4LAOA 2VC5A 4G7EB 3GTFA 3LY0A 3AUOA 2Z28A 4PE8A 4I6KA 3F2BA 3RCMA 3GU1A 1BF6A 2HNHA 4D8LA 1E9YB 4CNSA 2R1NA 3GU9A 4IQJA 1XWYA 4KQNA 2QPXA 3ID7A 1IE7C 3WMLA 4C6OA 4EPEC 3OVGA 2OGJA 3TN6A 1O5RA 4GYFA 2ADAA 3IPWA 3MVTA 1UBPC 2FFIA 1NDVA 3RN6A 1XRFA 3A3WA 3E2VA 1YIXA 1M65A 4NG3A 1PO9A 4V1YA 4DIAA 4P5UA 2D2HA 4KERA 1EJRC 4GBDA 1R9XA 4AQLA 4C60A 3C86A 4CNTA 1A4LA 2FVMA 3MPGA 3MSRA 4XAFA 4NI8A 3ORWA 3K5XA 4IG2B 3S2LA 1ADDA 4J5NA 1FWFC 2DVTA 4IFRA 4BY3A 1RJRA 4H9ZA 4KEVA 2R1PA 3WYZA 4C6FA
chains in the Genus database with same CATH superfamily
3TZFA 3GY1A 3N2BA 2FZ8A 1RCOB 5TQLA 3VK5A 4L9XA 2G3IA 4X3ZA 2WSYA 1QW7A 4YTUA 2JF7A 2QUTA 3GXPA 4H9UA 2QIIA 4QSFA 2VURA 5CLWA 1Q7MA 1TV7A 1VP5A 3G6LA 4R27A 3SCQA 1TVNA 1I2OA 4C1NA 3BOLA 3EYPA 4UZSA 1A3HA 3QMTA 3FV9A 1Q45A 4EIVA 1TWDA 2VGIA 3CL7A 1KTCA 2ALDA 2MUCA 2XHYA 1LT7A 1MQQA 1VJSA 1NDZA 4NJGA 2I9EA 4XQ6A 1J2BA 1ZFJA 4IT1A 4TTUA 2WPGA 2XYLA 1MXGA 2DZWA 1T41A 4LU0A 3HG5A 4JTEA 2VR5A 3DFHA 3MDUA 4DBDA 5JVLA 2ABAA 3N11A 1RK5A 1E72M 1R30A 1ZBWA 3AHZA 4GI4A 2H3DA 3AYVA 4FIRA 1E0UA 4Q8OA 1QXLA 4AD2A 3WUBA 3IANA 3TC3A 4K68A 4FLQA 5DCDA 1H0IA 4J3XA 3KLKA 3NSXA 3KLLA 4GH3A 4R53A 3W83A 1FWGC 1WZLA 4IJBA 2X40A 1Q7QA 1D2KA 4OTKA 1C8XA 1Q13A 4GACA 1CGTA 2WCAA 3DECA 3GXDA 2GVEA 3FIGA 3OLEA 2YA1A 1JPIA 1TPH1 1TUFA 1VLWA 2AAAA 1F9CA 1I6NA 4G6CA 5EMJA 4JY9A 2YDAA 5CZSA 4JQ3A 2Y89A 1V6YA 3WJXA 5M5DA 4LX4A 2E9LA 4C6CA 2CLIA 3QQ0A 4GK8A 5M03A 5K9CA 2PUZA 4AMCA 1Y5VA 1MMFA 1LLOA 4B9ZA 2YYTA 3SURA 1KM4A 1UR4A 1OFDA 2FB2A 4Q4KA 1M7JA 1FOBA 4C6NA 3F5JA 4P7OA 4Q8UA 1W1TA 2X09A 1Q66A 5LNUA 3HG2A 2CZ5A 1Q5MA 4GZIA 2R1MA 1U1HA 4I5RA 5FL1A 1IV8A 4M6PA 2VI0A 1MXDA 1OZQA 4R7OA 1I8JA 1E5JA 4UNLA 3GXFA 3KZPA 3LN3A 1IR2A 2UZ9A 3H4XA 1JYVA 3AS1A 3PSWA 3T07A 2DW6A 1QPQA 2VR2A 5EMMA 2WM0A 4ZOEA 1GG0A 2DJXA 4GQRA 2J7CA 2I16A 3QC0A 1RXOB 4CQBA 4H9VA 5D2XA 4E2DA 4XAPA 3OHIA 3DH7A 4OFCA 3B8DA 4TIMA 4DUXA 3BPWA 1JCLA 1FCQA 4F66A 2CBIA 5HUPA 3W2LA 5I79A 3VGDA 1GOWA 2R8WA 2IPFA 1QHZA 3ITTA 3W7EA 3CMGA 3DDMA 2J6XA 5AN7A 1JAKA 1BLIA 5A8MA 3GX9A 3QY8A 3NOYA 4L1XA 1IQ8A 2NSOA 1BD0A 3WUGA 3WF4A 4GIAA 3LA4A 4PMXA 1UD8A 4ZO7A 3OZOA 3UR5A 5T91A 3QW4B 3PN8A 3W7NA 3RLVA 4O0ZA 1P0KA 5HOSA 5C2CA 4XD6A 3OLIA 2V5LA 5EL1A 2O56A 1JPKA 3LI0A 3LZ3A 4CNUA 4QDWA 1JCTA 1D9EA 3W7IA 1EB3A 2D2OA 1NTHA 2ACQA 3MYOA 4KMQA 2ISDA 2WMJA 3C2FA 2Z4GA 4OJYA 1WKFA 2W6RA 2V5KA 4JIRA 3T2PA 2G3MA 4FMVA 5CZJA 1EJXC 3M1ZA 3CH9A 4V28A 1FWDC 4LY8A 4GZJA 1RV8A 3T1GA 1UWQA 1NJJA 1N8IA 1K9TA 5CGQA 5JMUA 2BP1A 1IZCA 2OQYA 3Q37A 4LJ3A 2D20A 2QEZA 3EX1A 1G94A 2VX5A 4MSSA 5DCEA 1N8WA 3NNTA 1V6WA 2HE8A 2E9MA 2PP0A 4RZ5A 4ZQRA 3AMGA 1D8WA 3UCCA 3AIQA 1KLYA 4DI9A 4D1IA 1HJQA 3S5OA 1FDZA 4G9PA 2VM8A 1G4EA 5KZEA 1IEVA 1MNZA 3WL0A 1WA3A 2B7OA 4E8GA 3AIUA 4NQ1A 3BCFA 3P62A 3VCCA 1OINA 4FOKA 3B8VA 3WFAA 2O9TA 3WK3A 1U30A 2NT0A 3HQPA 5E09A 1DHPA 2Y70A 3MUXA 3TKFA 3WQCA 1UJQA 4DVOA 2QPXA 3TX9A 3LI1A 2E6DA 1KNWA 2GDUA 2DT0A 1L6GA 1X39A 2H6RA 1PX3A 3QHOA 1RUSA 4TMCA 2E3ZA 2YCLA 1ZJHA 3VNIA 2VRKA 4TV5A 2AGKA 3HGSA 2XU2A 4A4AA 4S3FA 5JUVA 1V93A 2YSWA 3TU9A 4PN2A 2QW5A 4J5NA 2EPNA 4XSMA 2CW6A 2VZOA 1B9ZA 3AOFA 1V3KA 1RJRA 2ESCA 4KEVA 1W9UA 1I45A 4BQ4A 2J9XA 2J7HA 2XM2A 3IJQA 3UPMA 2PDBA 1HL8A 5EPDA 2CC0A 3CIWA 3WDRA 3E02A 3ZOAA 1QK0A 1FFRA 1LLZA 3N3TA 3G3MA 2IS7A 2ZX9A 2YCKX 3TMQA 4ES4A 5FEPA 4DO5A 4IIBA 4QEHA 1D3HA 3RITA 2ZZ6A 3BCJA 1EXPA 1TWSA 1I1WA 3HIJA 1R0MA 1VFSA 2XIBA 3MJMA 2P8CA 3N17A 3UD6A 2VC7A 1VFFA 3ITVA 3O2LA 1ONRA 1JULA 3MSYA 1DWGM 1JXKA 3A4JA 3ARRA 1BSLA 1L8PA 2NVAA 1NP2A 3RCYA 3HBLA 1SFSA 1KRCC 1LUCB 5CZTA 4IQLA 1Y7VA 3QBUA 1EJ7L 1V08A 3VOGA 2R91A 4JKMA 3A4XA 3GXIA 1WDRA 5AYBA 3NA8A 2VEMA 3FAXA 1GK8A 4B5NA 4LRSA 3G18A 4O54A 4BI5A 1SU5A 1WXZA 4GXWA 4Z2JA 4NZ3A 4B3ZA 2ZYFA 3ZYZA 3UY8A 3TJLA 1YNYA 3CEUA 4EK7A 3S5YA 3GFZA 4JFVA 1RQHA 4PBGA 2G97A 1YDOA 1OEPA 5FF7A 1B3WA 1J6OA 1XRTA 3GG0A 4NASA 4CD7A 3HQOA 1JZ4A 3IK4A 4HYVA 2C79A 4DWSD 3KS6A 3SZ8A 1UD3A 3U7VA 3TSBA 3G1AA 3SY5A 4GNJA 4E4UA 3LHVA 1O95A 4C6KA 2B0MA 3A5VA 3WMCA 2OODA 4KIEA 4PUKA 4LEFA 3TONA 1IT0A 1R7OA 3FA5A 2Y4SA 2BFGA 2OZ3A 4H3DA 3LCLA 5HA7A 2O9OA 1B90A 1DKWA 2VT0A 1HNYA 2G0WA 1KBLA 3IUDA 3WK2A 5KINA 4MNJA 3TQVA 2Y5EA 1KM1A 4AHOA 1S2WA 5LA1A 4CD5A 3AUJA 5KITA 3NM1A 4GUHA 3S2JA 4QJ4B 1B3VA 3Q45A 3CWNA 3WDJA 2F2KA 3VIIA 2Y5SA 2DQWA 4GQQA 2OZTA 3EEZA 3S1WA 3CAVA 4Z1BA 2F61A 2W27A 3UWVA 3R0DA 5A6JA 2DZAA 2TMDA 3HO8A 5CBBA 3GH4A 3QKEA 4ZQCA 4XIMA 4XAGA 5CQ1A 1FCVA 1VPXA 4Q3MA 4QLLA 3S1XA 1K7FA 2DUAA 1HKJA 1V6VA 4JY8A 3OLDA 4ICMA 4IMAA 1EPVA 1MEIA 1LROA 1XBZA 3EGJA 3QY6A 2XGBA 4R88A 3TQPA 4BK9A 1F3XA 4MJZA 2PWDA 5C9XA 1V03A 1FXPA 3UG5A 3QV8A 2YX0A 1E1CA 3V0UA 4B5XA 2PDNA 3K8MA 3N6QA 1J18A 3AQUA 3S2MA 2RAGA 4KRTA 4Q4MA 3KBMA 3OPSA 3FXGA 5AC6A 5GNZA 1TV3A 4U28A 4JX4A 1IT8A 3DGRA 4L6DA 1F8MA 1SR0A 4HNOA 1GNXA 1TA3A 3D6NA 1HF6A 3OEXA 1EKOA 4IMFA 1UUOA 5H8MA 3VKBA 3N2TA 4H8HA 3IEBA 1N2VA 3WNPA 1N55A 3VOJA 1I0BA 2P53A 3QV9A 1ZAIA 1WUEA 3P6LA 4DPQA 1LORA 4B2DA 3UWUA 3AIEA 3ABXA 4JTCA 4OE7A 4AD0A 2J13A 1E9ZB 1WDDA 3C3NA 1EYEA 4LH8A 3FGCA 4CN6A 4GYPA 4JIEA 1W3NA 3WQGA 1TZ9A 3CT2A 1KR0A 3EDKA 5KMYA 1EL3A 3H7VA 2CEQA 2OLHA 4ZXLA 2PC4A 1DTNA 1O1ZA 4JTTA 2VEFA 1G9HA 4C5ZA 2X0YA 1WDQA 1A5UA 3TW9A 4GVGA 5LXXA 3SCUA 3VDAA 3C2YA 4I9AA 1K77A 2C0HA 3B4YA 1OYCA 5A6BD 3C2RA 2PFHA 4DJDD 1ZUAX 2BHUA 1UG6A 3TW6A 1RK6A 4O1FA 4BZYA 3TOYA 1R3VA 1GG1A 4PCPA 2DT3A 3PUOA 4MDPA 1JFHA 2GSEA 1PIIA 4UWMA 3ZR5A 3SSJA 2HWGA 3PWAA 5A8OA 1VC4A 4D6HA 5AHFA 3QEZA 4G7EB 3J7HA 4NAFA 3TLLA 1N8FA 5I07A 1OFBA 4M82A 3JS3A 4ZFMA 3T2OA 4LBSA 4Y9PA 3CUJA 3VKCA 3HGOA 5I2UA 2NT1A 3LV5A 1NDVA 1X98A 3E2VA 2XJ7A 2GJXB 3O07A 1HN1A 1VFTA 3RRAA 4EKJA 2FZMA 3PP7A 1GVFA 2IXVA 1RD6A 3PUEA 3T40A 3BLDA 1IIHA 1V3IA 4PUWA 2A0NA 5F1VA 1J0KA 4Z0JA 2A3HA 3TCSA 3W00A 2QMKA 2AAMA 1DE5A 2DSKA 3B9OA 2V69A 4N42A 4QFUA 4H41A 4O0QA 1CBGA 1H1ZA 4US5D 3QFEA 1E9LA 5FA5A 4EPBC 3TSMA 4KW2A 4C6DA 3ARXA 4LUYA 3NQGA 4PMZA 4XZWA 1HGYA 1H63A 1UWRA 4HA0A 1S39A 5I24A 4HHHA 1EJVC 2C6QA 2VGFA 4H8VA 1TCDA 3GS6A 3PAOA 4C91A 1ME7A 4J40A 4LC8A 2GVJA 1HJSA 4PMJA 3LLDA 2OSYA 4GIEA 2YCEA 1G67A 1S2CA 4WSJA 2XH0A 2GLKA 3ZS4A 3ZSSA 4LUSA 1P1MA 5HANA 2V38A 5I5RA 1VPQA 5HWJA 3MI3A 1UHVA 4H04A 2I5GA 1ALDA 1GQNA 4LVFA 3CH0A 1M7XA 3W2KA 2F7FA 4AEEA 1Q63A 4HSNA 3GIYA 1PL9A 4NXSA 4LPCA 4FXFA 1X1ZA 3FSTA 3C0LA 1NVMA 2WVTA 1V0MA 2UY2A 3WQPA 3ARZA 4JYFA 1H1YA 1EC9A 1O94A 1QHOA 2NQLA 1R85A 2XIMA 3N9RA 5C9WA 1OFRA 1M9HA 2W5FA 4LB4A 3QPEA 3ZLHA 1JGMA 1LL7A 1EBGA 1NWTA 1PUDA 2NWSA 4JHMA 2WLZA 3ZVHA 4A21A 5FAJA 2GJLA 2EG6A 4UXDA 4P8WA 4B91A 4CNPA 1H7NA 1LDCA 3IUHA 4UTTC 2XDFA 1LT8A 3SN1A 3H70A 3ZIZA 3TIMA 2V5DA 4OOUA 3V35A 1J6PA 2ZXQA 2E8ZA 1JI1A 1UR0A 2FZBA 1W3TA 2YLAA 3U3HA 5E93A 3PJTA 1J5SA 2VUYA 4QM1A 3CPRA 3FJ4A 4F0HA 3NPXA 1GKPA 3CM4A 1IT7A 3GW3A 4ZOBA 5CXPA 1VBUA 4AZGA 3ITLA 1UUMA 2XPKA 3PZVA 3T78A 4D6CA 4D8ZA 1KTBA 2X1RA 4AISA 4HJWA 4LOCA 3URAA 2QCGA 4JOMA 2J8GA 3IAPA 4O28A 3SM0A 3MZ2A 4U2ZA 1R3SA 2WC3A 2OX1A 3HGRA 5GNYA 1F4HA 1EC7A 4K6AA 4JKKA 2XVKA 2WBKA 3GVVA 3CZEA 1V5XA 4FX8A 2PEVA 4HZ8A 4IL0A 1UZ4A 4WDWA 3TTSA 1KW1A 1VB9A 1T6MA 4UMBA 3WUFA 2R9RA 1PZ2A 1X7IA 1SZRA 2PA6A 4CCZA 2QQ6A 4AYGA 2RDWA 3WIJA 2E4TA 4OOZA 2JBMA 2QCEA 2Z6IA 1JDFA 4CNOA 2XWEA 4GY7A 1XCFA 3M0MA 3YPIA 3N2MA 1O5KA 3EMCA 4K8EA 2Q71A 1K7XA 2UV8G 3OBAA 3C2VA 5I23A 2QXWA 3GR4A 5E5CA 1W3KA 2WW5A 5FJTA 3PG9A 3WF3A 1ZAJA 2H8ZA 3PY2A 2OMAA 1W9DM 1XSIA 4H9XA 4QJ5B 5HMEA 1RPXA 3N3MA 3GBEA 3MYPA 1R9ZA 1YDYA 3UXLA 1A5BA 3NZRA 2EXOA 2DORA 1HKIA 3DENA 4ZVJA 4ZTXA 3BMXA 3T44A 2E68A 4JFUA 1HJWA 1OFOA 3P80A 2PLKA 5EB8A 3EZ4A 4P8XA 3CAQA 2REQB 1LWIA 5C2XA 4IFOA 3SADA 3VKKA 1UIPA 3TQKA 3E0FA 4K1WA 3B97A 1FWNA 3H7RA 3GUGA 1Q6DA 4IPLA 4YWSA 2DZPA 3WEMA 4DEFA 5DY3A 4AX6A 1DWHM 2Z7KA 3W01A 4IIFA 2QHAA 4FNQA 1XLAA 4QG8A 4ICCX 1W1ZA 1XIMA 4UTTA 3IJIA 4GH1A 3CZGA 3PBMA 4W85A 4LS0A 4XD5A 3A3XA 4AIBA 1RPKA 3EA3A 3KOFA 3UQNA 1H5VA 1UJPA 1Z32X 2ZADA 1XV8A 5KZDA 2A7RA 2ZA3A 3UG4A 4Q6JA 4ZB2A 4Q8WA 3NURA 1EEPA 1FHLA 3HPZA 1NQKA 4GYJA 3ARTA 1D7FA 5CBIA 1FY6A 2BNJA 1W1IE 1ITUA 1JD7A 1M68A 2Y62A 1V77A 4PL2A 1E4MM 5HXMA 3STEA 4D8AA 3RO6A 1E56A 3QSTA 3NUKA 3MANA 3O15A 4IX0A 4ZXOA 5C7HA 5I0DA 2XVPA 4EACA 3EA1A 2OVLA 4UC5A 3HG4A 3W37A 1FHVA 1MEWA 3LY0A 3W29A 2IXUA 4MF4A 1IGWA 4FIQA 4PE8A 1AW2A 1AQHA 1IGSA 3KVMA 2J7EA 1X97A 1RCXB 4ZQPA 4W5UA 3NL3A 2XVGA 1IEWA 1IE7C 4EXQA 1HGWA 5GVJA 3MW7A 5D8WA 4FLSA 4KWWA 3LERA 1G4TA 1CEOA 2ADAA 2GVGA 1JXJA 2D1ZA 3CGTA 3S1GA 1ZJIA 4DIAA 4RL3A 2D2HA 2VDIA 1XINA 2FYMA 1J96A 1UKQA 1DE6A 4CNTA 2PTYA 5LGZA 2HK0A 1PIFA 5AC5A 4ZO6A 3H55A 4LUIA 4IG2B 2QV4A 4C7DA 2NV2A 2OGYA 2ZVRA 4LWWA 2D0FA 4NVTA 4WY0B 3WSUA 1POJA 3AS2A 2A3BA 4IP4A 4X2PA 5JIPA 1WNOA 2R1LA 3BO9A 4GUIA 5CCZA 3FOKA 4NYYA 1P1XA 3FFSA 4MJ4A 2WKGA 2CWXA 3M5VA 3QQ1A 1V6XA 4O4VA 2CLFA 3QGKC 7TAAA 1XCXA 5BROA 4Z2KA 1OK4A 3LHTA 3QPYA 1U33A 3TYEA 2XSBA 4WR3A 2VEIA 4JCMA 3UETA 4BCEA 4QTGA 1F73A 2IMRA 1FKWA 3CHEA 1JUEA 5D02A 3H26A 3QGVA 2ACSA 3FCPA 5DBTA 4LYPA 3LGDA 4MFDA 4P8UA 1CXIA 3B0XA 4OBRA 5FIPA 2FGBA 1Z44A 3SUWA 1CPUA 4HB7A 1NWRA 3TXVA 3T6CA 3GNNA 2VGGA 1VF8A 1MSSA 3PK7A 1O66A 3WQ4A 4DJEC 5AKQA 1BYAA 3CZLA 3E1F1 1B3OA 3NGJA 4EXAA 1E6NA 2GGIA 3P5ZA 4CQAA 1V02E 4ACZB 4MUZA 4PMOA 3WH9A 6REQB 4R5EA 3VD3A 5FOOA 3GHTA 3MDWA 5A6AA 1E40A 4S3JA 3CV2A 1GQLA 2YW4A 2WMFA 1Q6CA 2DEPA 5ABHA 5EBUA 3WLJA 3DOPA 4J3UA 4NP7A 4ZR8A 3NQEA 1YNPA 3U2CA 3SIMA 5D09A 1EIXA 1G7VA 4HNLA 5LHEA 4GVFA 2UY3A 3AHVA 4KPLA 2CZDA 3S5ZA 2BXYA 1Q6QA 4AY7A 5D38A 4AB4A 3GBDA 1LOLA 1W0MA 1XYLA 4JQ1A 4PYSA 2WMKA 3HJZA 3R1ZA 2VR4A 3MHGA 1XYBA 4ML4A 1GJUA 3BZGA 3NQCA 3N4AA 4X9YA 2DIEA 1RP9A 1WP6A 1QNOA 5JU6A 4MADA 3PNUA 5HPOA 1NF7A 1MRQA 2BBFA 3CUHA 1K6AA 2GUYA 4LB3A 1VFHA 3TN4A 2PURA 5F2MA 4PODA 1ZBKA 2WV8A 4FEZA 3VD7A 1NFPA 3TMLA 3I7QA 1NF0A 1WKYA 1QU4A 1E0VA 1LUCA 4ZB5A 5BOEA 1NY1A 5HNUA 1WDPA 2IW0A 2PDPA 3AIWA 4XUGA 1HKKA 4N6EA 3NL2A 4JPGA 4XVDA 1B54A 4JTUA 2NQJA 1FA2A 1NOFA 1JPHA 2X30A 3R0UA 4FO4A 3PM6A 2Q3OA 3A24A 4GO9A 4MY1A 2DJLA 1SW7A 4NJJA 3VC5A 2VFGA 1R5YA 3A3HA 3RNDA 1NH6A 3W9ZA 1V7AA 5C55A 3VVGA 4JFWA 1V02A 5CSSA 5CPNA 2ZX5A 4EPKA 4O0KA 4OV9A 3SY1A 2FZ9A 3PZMA 1JPMA 3ATYA 4Y9OA 5M3WA 4XBKA 3NQBA 4H8UA 4R85A 5K9XA 1VKFA 4EVZA 4F9DA 4ZGYA 1ME8A 3WY1A 4CQ9A 5HINA 3C2OA 2DZTA 5AZ1A 1F8IA 5EGRA 3T8LA 3A23A 2CLLA 2ZXDA 3VOFA 3T7VA 4PB3A 1C29A 1L8NA 3V7PA 1GT8A 3LTSA 3W24A 4DJEA 2V68A 2PDQA 2YL5A 2WCSA 3V0TA 3AYSA 2JGQA 5GQBA 3E0LA 1X96A 2BS9A 1MZHA 4UOJA 2ZRXA 1CECA 1F6PA 4QE4A 3CV1A 3PBWA 3LNPA 4I9JA 2YLLA 1DWIM 1BAGA 1MWOA 4E2VA 2X8RA 3PR2A 3TAOA 4ADUA 5A6KA 2P76A 2TRSA 3TJXA 4MIMA 4UTLA 1BWKA 5DN1A 4P8VA 2QS8A 4ZENA 4J28A 1JZ8A 3DUGA 4FNUA 4JIQA 4BJHA 3KHJA 5DT5A 2BOEX 4Z0SA 1UKSA 2VJXA 1HP4A 3L5LA 2CHRA 1XG4A 1KM0A 2ZICA 3KVLA 1E6PA 2E6AA 3RYSA 3VPLA 4M7TA 1BSIA 1UH4A 2Y0FA 2A21A 1DJYA 2V6AA 3HU7A 3G1XA 3DI0A 1QRQA 3LGEA 4LVAA 4WD0A 2X7VA 1HX0A 2O4QA 3UR2A 4LAOA 3B05A 3ARVA 3N04A 7REQB 1W54A 2ZTJA 3CMJA 1Q6GA 5CSRA 4XZLX 4MKSA 2W61A 4P61A 4D8LA 6CGTA 3AYRA 3NO3A 3PPHA 4H8NA 2KZHA 1MW1A 3VNJA 3BLIA 4KGJA 4AX7A 4Q8NA 1JD9A 3VIFA 2P10A 3T55A 3CUGA 3KVJA 2PF8A 2PWHA 2FMOA 3STFA 1YIXA 4PTVA 4PEKA 2YDSA 2YYUA 1QPKA 3KBWA 4P7LA 1OC7A 4C60A 3ZM8A 1NELA 1JQXA 4DF1A 2V3EA 4EE9A 4DM1A 3WD3A 4HHPA 3RK8A 3NTYA 3SRKA 5CBJA 2PSNA 4E6MA 4YTRA 1BEUA 2YFNA 2WKLA 2W4XA 3OYXA 4C6FA 4ATDA 4WF7A 4Q8QA 1BPLB 2ASHA 3IUIA 1OFQA 5HMFA 4W8AA 1SPQA 4TTGA 1GGOA 4WJ8A 4ERAA 3W6MA 1Z42A 1KCZA 4U2YA 3W7OA 3M16A 2WNNA 2QULA 4UTIA 3TVAA 1I0DA 5C9ZA 2C1GA 3T9PA 2QDGA 4XV0A 4A22A 3KDNA 3HTWA 5DO8A 1KFKA 4ZFCA 1R8LA 1ZGDA 3L12A 4IHCA 5HK4A 3KCJA 1NEYA 1B4EA 3RCNA 1EDTA 3DKJA 4W7WA 3W25A 3ITCA 1LYXA 3OLGA 3UF9A 3W3OA 4WX2A 2FIQA 2WYSA 2A79A 3JW7A 2NVDA 2VZUA 1XYZA 1FVPA 1EJWC 3LGGA 3IJ6A 4GXMA 4NNBA 3CPUA 2JQXA 2EHHA 1ZALA 3F4CA 1KQYA 2QMJA 1OG0A 3RGTA 1VH7A 4G7EA 4FF5A 3T4CA 4Q6XA 1BKHA 4HCLA 3QYSA 5H8UA 4MNLA 2PDLA 4XX6A 3G2GA 2CIPA 3KRBA 1W9BM 2PBOA 2QJHA 1U22A 3ARPA 3UU0A 2X2YA 5J5DA 2YJQA 3BLKA 4GRSA 2GZXA 2ZE3A 1K3UA 3GK0A 3TDFA 3C0JA 1S5MA 3U2ZA 3UWYA 4KCUA 4AC7C 3IS4A 3B8UA 4JNZA 3UWQA 4LUTA 1ZRQA 3NZQA 1J11A 4NI3A 3UGRA 5AFDA 3PZTA 2YR1A 5D2VA 1ZPTA 1XGEA 2HPMA 3WMSA 4ERGA 3WELA 2F2HA 2C13A 4EX4A 2JK2A 1B1YA 3ARQA 4S2BA 3EWYA 1HG3A 1VR6A 1XFCA 1XIBA 4HA1A 2OU4A 4YXGA 3V36A 1QOXA 4PSRA 4L4MA 1QI2A 5EYWA 1J0JA 4GBUA 3VFLA 3AWOA 4FS9A 5FJJA 4OUEA 1US2A 4UQDA 1GWJA 1RAKA 4AZHA 2DZUA 4LC6A 4GKTA 1XLIA 1W2VA 3KOYA 1UR3M 3H4GA 3L68A 1S46A 1OVDA 4NUWA 3VU2A 2J27A 5ENLA 4ML9A 3LTPA 3M44A 4LV9A 1W1VA 4WKHA 1IZKA 3CMFA 1OWQA 2GPTA 3V5FA 3W6LA 4NY2A 1BVZA 5BW6A 4IUOA 2HXTA 4LVDA 4HOXA 1CXKA 3CQIA 2DU2A 2V5CA 2PF0A 4AMAA 2WCGA 1Q4NX 1XBYA 3OZYA 3CHFA 1I1XA 4IH3A 1H62A 4RPQA 1EA0A 3L4ZA 3TC6A 5K3VA 2E6YA 2VWTA 3BCDA 2EPLX 1XSKA 3WBXA 2ZQ0A 4S38A 3CYVA 2FH6A 3T0BA 3URNA 3E96A 3GG7A 4RR4A 1F76A 3I68A 2OG9A 1TPUA 4GMEA 2V30A 1UKOA 4QITA 3CHVA 3LRKA 4QS6A 3PC0A 3A12A 1FWSA 4M1BA 2A3LA 2H3BA 3MUY1 2PRLA 4Q4SA 4YMZA 3PZQA 3ANUA 2W66A 1MO0A 4WK9A 1PDZA 5D03A 4AUBA 2VFHA 3IIZA 3MO4A 3EMQA 2FPYA 4XZMX 5AB3A 2YDRA 1MRAA 4GA8A 4XAYA 1ML1A 3IVTA 1EIBA 3UYCA 2VCCA 2BY2A 3PF3A 4M5PA 4U4MA 4HHMA 3VIPA 1L6FA 4W9TA 3FLUA 4KWUA 1EOMA 4J1OA 4MNKA 4PH6A 1OF8A 4EWJA 2OYLA 3BSGA 4H7CA 3WQDA 3OGRA 4RK8A 2W62A 1PAMA 4RE2A 3MI2A 2RJHA 3OP2A 5G4WA 3W28A 3MU7A 3W1MA 4MZYA 3PPCA 4YLWA 4IJCA 5CJNA 2ACRA 2NQZA 2CZVA 4JTIA 3K46A 4I7VA 4XVEA 4AZIA 2CHNA 4BFAA 3HQ1A 2ZX6A 2XN2A 3O6DA 2GUBA 3I10A 4GY0A 1ZNNA 4PMQA 1Z8AA 2VO5A 3G8RA 2Y5JA 2WJZA 4Q4PA 4OHQA 4ZEPA 3KCLA 1W31A 1OBAA 1DVJA 4UR7A 1DJZA 1PB0A 3B8TA 4WY0F 3SECA 2WQPA 3MB9A 1FUYA 4N02A 1FH8A 1YTDA 4WJEA 3P5YA 3MP3A 2GJPA 1QI0A 2EGZA 2TSYA 4I7WA 3WMLA 1VQTA 2R6OA 4YJ5A 5C71A 1XLGA 4L1GA 1TELA 3R13A 4R9XA 4BI7A 3M46A 4CGTA 5TAOA 1IZJA 1GTEA 1UWAA 3E0IA 1XLFA 1S5TA 4UFIA 3KWXA 3WD1A 3AALA 4Q7BA 1HIZA 4M6VA 4C1KA 4YVPA 4GQBA 5DRCA 5FI8A 1EP3A 2P0OA 2FVMA 3VGGA 4OU1A 4YHEA 3M0JA 2X1UA 3ORWA 3EX3A 3G0SA 3DZ1A 4QE1A 1H11A 1EQCA 1AZ1A 3V18A 2V0TA 4L9YA 2HVOA 4OBSA 3KOWA 2J9YA 1PE1A 4Q7IA 1CLXA 3CLWA 2P5NA 1SO6A 4JEQA 2BB0A 2CCRA 2PDMA 2NVCA 1PS9A 3ABRA 4OWGA 3T2QA 3RAOA 3L4TA 3W76A 1XH1A 1ZZMA 3U4FA 3W4RA 3EKZA 1SZFA 5CPQA 2VRQA 1T8XA 2HEJA 5TBOA 3AC0A 4AWEA 4AD5A 1RJPA 1H09A 1JUBA 2QV5A 5ABTA 3D3FA 3OVQA 2J24A 2NQ9A 1TQJA 7ODCA 5BXSA 1E6ZA 5FESA 1U83A 3VKDA 1UIOA 5DX7A 1QPOA 5CGTA 3LCFA 2BGSA 4RZ4A 3P7YA 3SCTA 3W7HA 4BWLC 1QWGA 2G4FA 4UFHA 2R1KA 4FB7A 5I3JA 2B4GA 1UD4A 3CC1A 2GWGA 4H7VA 4I3GA 3VIJA 5T9CE 5EKYA 2FGLA 1GZJA 1LQAA 1XW8A 4X9SA 3FDGA 3UXKA 1WQ5A 4AZ6A 1IXNA 4KS0A 1J79A 4KT2A 5ABFB 1M03A 2PTZA 1PJ9A 3A64A 3REQB 3QMRA 1YMYA 1OGBA 1J8VA 3KS5A 3CZ8A 1OFPA 1E0WA 4WXZA 2BXZA 1M41A 3BMVA 3LENA 5K4XA 1E0TA 1TWZA 3MT1A 1OT2A 3CS2A 5FSEC 2WMIB 2PRHA 4IG2A 2FJKA 3IVSA 1WOBA 4PRWA 4XBSA 1E55A 5IHRA 3BSMA 1R87A 4Q4QA 1YBQA 1D3CA 4WY0A 4M81A 1UH3A 2V3FA 2CLOA 4XAZA 3BURA 3QR1A 3WLOA 2AQOA 3PWGA 5HWNA 1TTQA 3LHZA 3CEPA 3TWBA 1DPMA 3D5HA 2BG5A 5EFDA 4UTFA 4LANA 1H1NA 2PWEA 4CQCA 2GJNA 3RLHA 2GYIA 4B3KA 1KKRA 1U5HA 4HU8A 1QOPA 2DT2A 4WGHA 2YDQA 2RGLA 4UUIA 4QAIA 4UFLA 5CEWA 1OCJA 3DU0A 2ZUUA 1U2YA 1LBFA 4MY9A 1WYIA 3CU2A 2FMNA 3KTSA 3LQGA 1BFNA 4XTDA 2QJNA 3HZ3A 5LIKX 4B5UA 2HV5A 4DZIA 4C65A 2ZC1A 4JCLA 3LNMA 4LAZA 5I03A 3BVJA 3W2NA 3NYDA 4ONVA 3F4DA 4DM2A 2CERA 1LRQA 4X60A 3ZZ1A 3VDGA 3N4EA 1VENA 1TX2A 1E3XA 1TREA 4PUNA 1YPXA 1BGGA 3HB9A 4PRRA 2EPMX 4TU1A 3GTNA 3BDKA 4HZMA 4Y8EA 3KDOA 6TIMA 1UMLA 4ACZA 1W5NA 3WH6A 3L7RA 3LPGA 4A3YA 6REQA 2GFTA 2E40A 3MUCA 5EFFA 3TYBA 3U4AA 4AXKA 1Z3NA 3DGBA 3LDVA 2MANA 3ZLGA 2VFFA 3M4HA 3G3DA 5LZLA 4CD8A 2HISA 2FTPA 1S3TC 1EZWA 3EOEA 1LTDA 2PTWA 1OX4B 4REQB 3M0KA 5G2WA 3VA8A 4DF2A 1OT1A 3G1FA 3W6YA 1GORA 2VD8A 2DZBA 3NQFA 5BCAA 4IMGA 3RHGA 4EP8C 1FCBA 1J2WA 1EF2A 3CB3A 2XZ7A 3OODA 2C3ZA 1OGGA 2PAJA 3P84A 4IJRA 1UWTA 4MZ1A 4L4PA 4A8NA 2IKGA 4DUWA 3HF3A 4LBRA 1AK5A 1KBJA 3NL6A 1EHNA 3B9AA 1W17A 4YIWA 1FWEC 2XFWA 4O8AA 3N18A 3EMZA 3VUSA 1G69A 2AKZA 4TVCA 2CKSA 2BVWA 3RFAA 5IRPA 1U5JA 3USBA 1AW5A 3TTYA 1VCFA 3GTXA 1I60A 2VCBA 3K1DA 3QMSA 5I78A 1G0CA 4I7UA 3DFPA 4GJIA 1Y5XA 3MA8A 3VNZA 2V81A 4G5DA 3MKKA 1RA5A 4RDYA 3BLEA 4X2RA 1PCWA 3P14A 2AQVA 1KV8A 2W63A 1QW9A 2I5QA 4PMYA 4ZE4A 4UTWA 1R3YA 3EWZA 1CIUA 3H2FA 3DFTA 1H2JA 5LIUX 1DQWA 3FJNA 1QNVA 4GGBA 4FZIA 2E25A 4A35A 3VE9A 3WBAA 4K3ZA 3NCOA 3WBEA 3EWBX 3FEMA 3AMDA 3V5OA 3MCMA 4JEJA 2BY3A 3M64A 1DJHA 3GU9A 3IV3A 1KBBA 4IQJA 2ZC8A 3O9NA 3K8LA 4H6KA 3ZT5A 3OVGA 2IQ0A 2AL2B 4JN6A 3M0IA 2A5HA 3GM8A 1JR1A 4LRTA 4FP1A 3IJ7A 5HUOA 3FHQA 2GK1B 1K02A 3OVPA 3MPGA 2IQDA 2VGBA 1V0LA 3K8KA 3TW7A 1OX6A 2MNRA 3S2LA 1ADDA 4AVFA 4D6GA 1BG9A 1GPWA 1XX1A 1BVNP 3LXBA 5HWMA 1JZ6A 3ME3A 5JXQA 1KGWA 1K8ZA 3W71A 1QVBA 4GKLA 1FP9A 4W7UA 3GR8A 1WB0A 5E0KA 4MPQA 4RV8A 4C6BA 1S2AA 1W5PA 5D32A 3URBA 2BVDA 3I6TA 1XIHA 3DXIA 4HCHA 4TX6A 1ZJBA 4CVWA 3UJSA 1R2TA 1BTCA 3DHPA 1DIDA 4V1XA 1FWAC 3ZLFA 1FWRA 3HM7A 3D3AA 1SYTA 3UCQA 1C7SA 3O63A 1VGAA 1A4MA 2GDQA 4O52A 3SCSA 4U3AA 3IWPA 1AQMA 2WLYA 4HNUA 3QV7A 3EWWA 4FHAA 5FL0A 3GRIA 3D46A 4PUUA 2Y7FA 3Q65A 3GZAA 1VBGA 4W8BA 2OPJA 1C9DA 1E9IA 2D23A 3S83A 3OIHA 5A8NA 1F3WA 3ITGA 4YPJA 3G1DA 1UD2A 4GOAA 4JIPA 7REQA 2DSUA 4MLRA 4CCCA 1W3HA 2CLKA 5A6TC 3I3EA 1SGJA 2RH9A 2WWCA 3FAWA 3IIOA 4DNHA 1XR2A 2Y2WA 3B8SA 4ZOCA 1ZTVA 5BYWA 4A05A 5K2ZA 1JJKA 3OO2A 3HOJA 4ZB0A 2Y7EA 4AG0A 1I4NA 3ZFHA 1P7TB 1AD1A 3QLDA 2Y8UA 1FP8A 4JTQA 5E0FA 3WDIA 5JH1A 2P3EA 2PTDA 1K8YA 1S2TA 7ENLA 2ZIDA 1GYNA 3WO8A 4RV3A 4B4HA 3M0LA 4G56A 5F4WA 1P43A 2PLMA 4KCTA 2WZEA 4KH2A 3M6DA 4LAUA 3TTEA 5LNRA 4NZ4A 1XH2A 3TNBA 1X6UA 3KVKA 4Z2LA 1QJWA 4MPKA 1G01A 3WN6A 1VBJA 3GR7A 1ZBVA 1LQ2A 4W86A 2Z1WA 4C5YA 5C54A 2C16A 3G6MA 1EXBA 5I3IA 3W75A 1FWWA 4UTJA 1JZ3A 5AC7A 3FVDA 4D71A 3KRSA 3L4YA 1PHWA 4Q8MA 3E49A 1XM3A 4M7SA 3EEGA 4GG9A 3R5EA 3L65A 1Q4WA 4IFKB 2QJGA 2ZWYA 1EPXA 3V3WA 1B30A 1JL8A 3L0NA 3DHDA 3SFKA 3U2EA 5FKYA 1L6WA 1ISYA 5AHNA 1GOOA 2JKEA 3I3BA 3WK1A 5F1UA 4JXCA 3FYPA 2VZSA 5REQB 1HTIA 3RJXA 1VIZA 3PFMA 4UTMA 1IXPA 1GVQA 4KEUA 3WF2A 3A6OA 3CO4A 1KXHA 3VD4A 3OOQA 4DO6A 3TXZA 3OG3A 1F3TA 5E0CA 3Q58A 5HAOA 1CXFA 3E5BA 3GC5A 4V33A 1GUVA 4U3CA 5FF0A 6ENLA 1TV2A 3T05A 3AS3A 1NP0A 2GUUA 4ROPA 3SCNA 5XIMA 1THFD 5H8PA 3MV11 4U10A 4U31A 1OCBA 3W81A 1YLVA 4DWSC 1WX0A 3ABZA 3SBFA 1CLVA 3P74A 5JH2A 2YPIA 1A0DA 4RNFA 5HNNA 2JEQA 5FEXA 4ZSTA 2ZKMX 3GDMA 1B3ZA 5LNSA 3AU6A 2G8ZA 4UIOA 1MDLA 4C1LA 3GZ3A 3N12A 3U5UA 4H83A 1YADA 2VELA 2R14A 2CBUA 3KP1A 3MCOA 3NEHA 3ISIX 2PDUA 1AW1A 1UR9A 4L6OA 3UA4A 4QG9A 5C5YA 4HMEA 3KRUA 1XS2A 1AG1O 3EB2A 3WD2A 4WCJA 2QYGA 2WMGA 3U48A 2VFIA 2FTYA 3GAKA 1Y8BA 4F0LA 3FX4A 4R7JA 5EA9A 3T42A 3HJEA 3TFXA 4D2JA 1TR9A 1US0A 2W79A 1YTKA 3EPMA 5C9RA 5AYXA 3VINA 2HCVA 3NG3A 3LCHA 1KGXA 3UZYA 5CC7A 3CUZA 1C8VA 1B31A 3AU2A 3OQ8A 1CT5A 2ATMA 5DFAA 1S2UA 1PX4A 1HQTA 4O4WA 1DTUA 1UB3A 2FZDA 5BNKA 2PDFA 4RW3A 4AC1X 4PULA 1OADA 3G1HA 5E9AA 3W1AA 4PFMA 1L2QA 3NQ7A 1AD4A 4QP0A 3WKZA 2WB5A 3UGVA 1WUFA 1UBSA 2YXXA 2HNHA 2R24A 3NDZA 2QJMA 4JYDA 1QHPA 4O1DA 3NSMA 1ODZA 4HNTA 1EH9A 3TN6A 3V4BA 2EQDA 4YCOA 1W5OA 3E2RA 2YCJA 1FTXA 4JNYA 3UCDA 1BVWA 5CJ5A 4NAEA 3WLTA 5LA2A 1JCMP 2P8BA 3GHRA 1DEDA 4K8HA 3WQ6A 3QM3A 5FJUA 1R9XA 3ZR4A 4MM1A 3EX6A 2BODX 3R8RA 3P8JA 3L66A 4ILSA 1XQLA 4FLOA 4W84A 5FJRA 1XYMA 1ZB5A 4MGGA 1LCOA 1GZ1A 3NZPA 1E43A 2HS8A 1J0HA 3CTTA 5LKYA 4ZQNA 3IIXA 4WOQA 4W8LA 3JU2A 2ZOXA 4BY3A 4JTAA 3SCRA 4L6HA 4WSKA 4CEXC 3T81A 5IBXC 4KWVA 4D1JA 4GUJA 2XSXA 2XWDA 4PGLA 1JGIA 3W23A 1UASA 4DYKA 3PNZA 3L4WA 1LOSA 2YOCA 4C6JA 1OZMA 1TV8A 1M7PA 1QAPA 2P3ZA 1EDGA 1WZMA 3WENA 4RXGA 1FX6A 4C6LA 3PPGA 1AA1B 4Z1CA 4RX0A 4LALA 1TJRA 3P82A 1DXFA 4EF9A 1K4HA 3VCRA 4DN1A 2Q8LA 1NFGA 2ON3A 4DJED 2VEGA 2IQTA 4Z17A 1PYMA 3UEQA 3RU8X 2C0AA 2HRWA 1XLMA 2AMXA 4DJDC 2UY4A 2XFYA 3NO1A 1D8CA 1H41A 2BGNE 2AKMA 1EDQA 2PU1A 3EXSA 2BLEA 1EF3A 5G2HA 1LOQA 1IR1A 3B0UX 1A5OC 1YQ2A 2ISVA 4Q8PA 3CBWA 5D33A 5D8ZA 4L4LA 1TO3A 1FXQA 1SM9A 3N2CA 2HS6A 1R38A 4UBPC 3AIVA 4QG6A 2J7DA 2WANA 1MXSA 4DI8A 3WL1A 3OVRA 4AU0A 4FX7A 4Q22A 4XBJA 2D69A 3W1QA 2IKIA 1JCJA 4HNNA 3S47A 3VMNA 2OELA 1EGZA 2XTKA 4MUPA 1H7OA 5AYYA 1MVYA 2NLIA 2FZNA 5L9FA 3N73A 5LSMA 2VD9A 2HVMA 4JTKA 3V75A 2PTXA 2V3GA 4HMDA 1I2RA 1TMQA 1M04A 1T5AA 1UH2A 4WKFA 1LWJA 1RJQA 4Z2GA 4FPSA 1B0IA 4N7QA 4JDYA 4AZCB 1TPC1 3WCZA 2W92A 5HR6A 4DF0A 3UBPC 4CQDA 2NSXA 4NJHA 2QF8A 3UXAA 1SW0A 3SCWA 1XF0A 3EPNA 4PTDA 1LRNA 4P2VA 4BKNA 1V79A 1XIDA 1PCKA 3BJTA 1NWUA 3CL8A 3LHUA 1OCNA 3BAIA 3VGEA 3R0KA 1KRBC 5IBXA 3PBYA 2OLSA 3CV7A 5AYZA 1XLJA 3KTXA 3UP8A 3K2GA 1TPDA 2WNZA 4AVNA 2NWRA 5EU9A 1YRRA 2B31A 6XIMA 2OX4A 2ZUVA 5I3GA 2PDXA 1LG2A 2J88A 1RR2A 2I17A 2UWFA 4Y2WA 2BX7A 5ABFA 1HJXA 3O16A 4HK5A 1OJXA 2D2GA 4S1FA 2JIEA 1XBVA 3G1YA 3REQA 1NWSA 1V3MA 1LF1A 1RQBA 2JFEX 3W1PA 3UJRA 3VX1A 1EGMA 3SCVA 3HN3A 4DJFC 3O6YX 3BAJA 2Q01A 2I5IA 1V0NA 3S9YA 4MG4A 2C1IA 3P67A 3BWWA 1DJXA 1FWBC 5I3KA 3LBCA 3WQEA 2BASA 3UR8A 5A8QA 4DLFA 2V63A 3POHA 3QTPA 5F4SA 3MP4A 3PWIA 1UWIA 4U5KA 1KM2A 3MS8A 1F61A 2X1TA 1ESWA 1NAL1 1F2JA 2J78A 4ORMA 5BWAA 3N2OA 4LNCA 4QCEA 1SFLA 1Z89A 1XICA 1UROA 4AD4A 3A9IA 4Z08A 1T0OA 1D7KA 3RUBL 3TC7A 1CLKA 2CKRA 1C91A 3ECQA 4KBXA 4ZL1A 1R7AA 1MQPA 3VDCA 1KA9F 3G0XA 5GNXA 3NL5A 1TTPA 1PTAA 3C0SA 3BOXA 4JGDA 1TE1A 4H4IA 2OYMA 3GTIA 8XIAA 1YPIA 2QUUA 2Z2UA 4QEEA 3CK5A 4AF0B 4OBTA 2DY3A 2Q02A 4LUJA 5AC4A 3G24A 1W8GA 3V16A 3CWHA 3W7CA 3QZ6A 1REQB 1A5AA 2VX6A 1OD8A 4S3BA 3QTGA 4PFHA 4CU6A 1RY8A 1J9YA 1N7KA 1SJDA 1EOKA 1BF6A 3D47A 3HFTA 2NW0A 4TX8A 4F48A 3VNYA 2PS2A 3R12A 1Y5WA 2ZVIA 1TR1A 3W7DA 1TZ7A 3U8GA 1UQYA 1J4EA 4A3UA 1KFWA 4N9EA 4GYFA 1DJGA 3MVTA 1M1BA 2QR6A 5HQMA 3I6EA 4RJEA 1WZAA 3GXMA 1OX4A 4REQA 2HSAA 1QDSA 2YCLB 3WQFA 2OTDA 5G1YA 4ZE5A 3ANYA 4OGZA 4W93A 5CC3A 1X1NA 1A4LA 2HMCA 1Z7AA 1CWYA 5CSYA 4NZFA 2GQAA 4GIRA 4PUEA 2IUZA 3KE0A 2CNCA 4F4RA 1FWFC 3C8FA 4RPPA 5HNRA 2GGHA 3K4AA 3ENLA 2WKJA 2FHFA 2PDJA 4HTBA 1XISA 3SB0A 5T9BG 1S38A 4O13A 3GUWA 4EAYA 4F40A 1H51A 4WVXA 2PGEA 4NNAA 3AXXA 4XKMA 1MI3A 1HVXA 4QDMA 2X0SA 3R79A 2ZRYA 3VNLA 3LZ5A 2PRMA 3GW0A 4QAWA 3DC8A 4B5SA 1SZGA 5IDZA 2Z2AA 1UYQA 2Y61A 3MV01 4DJFA 1TZZA 2ZUMA 5HULA 1KCKA 1M53A 1MNSA 2J25A 4B5TA 2C19A 4UFMA 3WQVA 2JE8A 2J9ZA 4DO7A 3WH8A 4HJFA 4B4FA 4BR1A 3CQKA 1KC7A 1UP2A 2DVUA 4XK2A 5DXXA 1XPGA 1LP6A 3PS7A 3P3BA 2VDGA 3RLGA 3PTQA 3SRDA 4IX2A 1ITXA 1JAEA 3LG3A 1MUMA 4BF7A 2WMHA 3T0DA 3ZO9A 1OQFA 3SUUA 3SUSA 3II1A 3W7MA 5FEWA 1UUQA 1V3HA 4K8GA 5LA0A 2DZSA 3L9CA 4IPJA 1W9VA 3GQYA 2WSQA 2DP3A 5BU9A 3WQOA 1OC5A 2P0IA 3DCPA 3E12A 1PZ0A 3K4DA 3IIPA 2OR2A 2V5JA 2VP8A 2AL2A 5LYRA 4KF1A 4H01A 2QAPA 4WEVX 4IOTA 1XI3A 1TMHA 4EANA 3H2EA 1W9XA 3PAJA 2DPEA 3W70A 3CIXA 5ABGA 1HKWA 2GK1A 3ITXA 1SFTA 3RPMA 2XVLA 1CGVA 1ITQA 4UOQA 1JPDX 4E38A 2Z0IA 1NOWA 3MTWA 4L5ZA 3ZT7A 3VDHA 1AL7A 1RBAA 1XSJA 5T8GA 4WQ6A 1RY0A 2QUVA 4O12A 3IAQA 1R3TA 3BTNA 3W87A 3B03A 5IXEA 3TTOA 1O5XA 4JR5A 3ZQ9A 3GHSA 4IMEA 4LBUA 1XUZA 3VTRA 3MBDA 3KL3A 5TIMA 4I8YA 4H7ZA 2O9RA 1WPCA 4ATLA 1E51A 2WM1A 2J8FA 4AHPA 2ZUTA 3PTKA 2DSVA 3P0XA 5LHFA 2VHLA 2E5BA 3S2CA 4LY4A 2WWDA 2J62A 2E5CA 4MAVA 1E6RA 4NL1A 3GE7A 1RBLA 2QDEA 4CCEA 2HZGA 4D72A 1H7WA 3NM3A 1WDWA 1C7TA 2OEMA 4GWEA 2OQLA 4LCRA 3LSCA 2OLAA 4DO4A 4ERIA 3F4WA 3GSMA 3H6OA 1OY0A 2G96A 4L80A 2Y1HA 1W1A1 2GWNA 3RF9A 3NQ8A 2F6KA 3O0KA 2QCFA 1JYXA 1OC6A 3NGFA 3M0VA 3R8HA 4YVVA 5AECA 2XH2A 3ATZA 1A47A 1C3FA 1Q7ZA 2BVYA 2TYSA 5D2YA 3TV8A 1ISXA 4AHQA 2IPWA 4UNKA 4GZ7A 3R7MA 2IPGA 4PUMA 2OFJA 1AQ0A 1T7LA 2DSWA 4CNNA 4HMCA 3W1XA 4AZ5A 2D0GA 3UY7A 3VNKA 1PX8A 4QDPA 3S1UA 4UB9A 2BGQA 4DXKA 3N9SA 1KR1A 2RGMA 4MAZA 1P7TA 2D3LA 4IXHA 4UTKA 2E28A 4O1EA 5MKGB 2Z00A 4ICNA 3WMBA 3TYAA 2WJDA 1FWCC 5D04C 4MMWA 3T0AA 1EZ2A 3KP0A 2J4GA 3QHMA 3G8EA 1JCXA 1R9YA 1XIFA 4RCXA 5CH9A 3QYQA 2WQDA 1QW8A 3SFWA 2E09A 4C7FA 4PZVA 2VC6A 3BLOA 4IICA 1ZP3A 1B2YA 9XIAA 1QR7A 3IACA 1MQRA 4NF7A 1TPB1 3SRHA 4XKYB 4KKXA 4B15A 4IGNA 1MZRA 2Y63A 4KETA 2GGEA 2A7NA 4A8RA 3W1NA 4CU8A 3USZA 2OEKA 3WX7A 5B7YA 1WAUA 3MSDA 3UR7A 5JIWA 1IHIA 3SR7A 1TV5A 1O12A 5AOUA 3PBUA 3FXYA 4C6EA 2INEA 1EO7A 4GC3A 1KRMA 2W9MA 4AEOA 5ECVA 3BW3A 2FTWA 1K1DA 4KCWA 2E1DA 2HJPA 3TQ0A 5CAKA 2G3FA 1F3EA 2VOMA 4IFKA 1ZAHA 2Y24A 4TXEA 3ABQA 1HFBA 1O4UA 1G5AA 1E4NA 3G77A 4E4FA 4TOQA 2QCMA 1FDJA 1S3HA 3W7PA 3WNOA 3VD5A 3PZ9A 1QOQA 1A53A 5DQPA 1TQXA 2AL1A 3THQA 1X38A 4MWAB 4PTWA 4MYXA 5BXTA 2CBJA 4QR6A 3A47A 5LNVA 5REQA 3AUOA 3I4KA 3P93A 4QNEA 1R3RA 3HV8A 3QN3A 3I6RA 4JICA 3DEQA 1BYDA 3B8WA 4AWTA 3VOHA 5JBFA 4YHGA 2OWCA 3IPWA 1XKJA 3AISA 2VYOA 1GJPA 4KRZA 1IWPA 2WO5A 2FVLA 4E4PA 4AQLA 2RFGA 3C86A 2VXNA 2VZTA 1OGSA 1E0XA 3NEVA 4MNMA 4BHYA 8TIMA 1UQZA 2OJPA 1JIBA 2B7NA 1GQKA 2ZCGA 3F7JA 3WEZA 4M29A 1JNEA 3PJXA 3VFCA 3EX2A 1CGWA 4O18A 1ECEA 3DN5A 2QUMA 1KFCA 3HPAA 4IMCA 3UZXA 3LPOA 4PL1A 2XIOA 3R8GA 2RHGA 2ZWZA 1VLIA 1PKYA 4WDTA 1GYLA 3ARUA 5DEZA 2VVSA 4JHZA 5ABEA 1FKXA 2PLCA 2NLYA 5FJOA 1E71M 1OK6A 2GQ8A 3KXQA 3QOMA 3QOKA 4DYEA 2NQHA 3TYUA 2ZDRA 3U9IA 1P4CA 3VXGA 3PTDA 1KQZA 4A2SA 2VEPA 1VBRA 3SY8A 2HBXA 2J6VA 4LUSB 4B16A 1YXDA 3NFUA 3KBVA 2E8YA 5HDRA 1PYFA 3TSDA 1ICSA 4XO7A 3B04A 4HK7A 1F05A 1U5VA 4EXBA 5HMDA 1TPVA 4B9YA 4QS5A 4LEQA 2ISSA 4DX3A 5A8PA 4IL2A 1DHKA 2NUXA 4C6MA 3ALFA 1TRIA 1EUNA 3WF0A 2OO0A 2POTA 5LGXA 4HU4A 4QHRA 1YHTA 3H7UA 3VI2A 2AMGA 3LPPA 4YTSA 4GE8A 3NSNA 4H2CA 1UKTA 2O4MA 6PTDA 4J3TA 4PTXA 4PC8A 4IGHA 4X0VA 4UMCA 1P6CA 4A8IA 5C7VA 4OQVA 2G3JA 3NOEA 1MW2A 3XIMA 4A2RA 4S3AA 1OHLA 3VZXA 4ZZ9A 2E1WA 2HPIA 3GXNA 1CB2A 1DOSA 4HP5A 1LL6A 1FWIC 3JZEA 4KFNA 3WLMA 3TP4A 4J35A 1ISZA 2HROA 4RNJA 1S1PA 4J3SA 5A5WA 2ZUWA 3PANA 3SRFA 1SVDA 5GJNA 4YN5A 2FPTA 3VABA 4IM4A 1W1PA 2R94A 5A69A 3W26A 1XLHA 1H49A 4XZNX 3Q2DA 4M0XA 1DIKA 1XL9A 3WFLA 3C6CA 3S9IA 2BV9A 1SJBA 1R47A 4JBRA 4DZ5A 3RX3A 2WC7A 3KRZA 3E3HA 3LCIA 5DLCA 3UVIA 1QNPA 4DY1A 4F9JA 1CI1A 2QCNA 2PDHA 4NRRA 4IF2A 2QCCA 1US3A 3N9KA 5HJYA 3SGGA 3LSBA 1WE5A 2ZA2A 3K1GA 4K37A 1AODA 4LT9A 5G4HC 3N6HA 6ALDA 2JIWA 1CTNA 3EOUA 4Y7EA 1SZEA 3M5YA 5J8LA 2HXUA 4C6QA 1S2VA 2BMBA 3N19B 2J79A 1KFLA 4UNIA 4MFEA 1AVAA 3EWDA 4QNWA 5G2IA 3W7GA 4WDUA 4FXJA 4ZA0A 4NJIA 3MUIA 1JCYA 3PVFA 2V9DA 3MBFA 1OB0A 3W7LA 3BLFA 1K8XA 5M2FX 1Q65A 4EWND 1ME9A 4QCFA 3ANVA 3OG2A 3QZAA 2CESA 5AHMA 3RJYA 4NSBA 3ABSA 4JX5A 3WLLA 2X16A 5A6LA 4O11A 5IOBA 4HZ6A 4FR6A 3S5SA 3EWCA 1H7PA 5RUBA 3P8IA 4KGLA 3BICA 1RBOB 2PPGA 3T09A 3RM4A 1LBMA 5I06A 4GYKA 5D9PA 1YKWA 1GONA 3GDKA 1UKPA 4TVDA 4RKAA 1SR9A 5EY5A 3L2IA 4J4KA 3DYMA 5A2AA 3M0ZA 3FHAA 4MY8A 2FDMA 4BQ5A 2PODA 3QQWA 3LQLA 2HNEA 1B3XA 5DCBA 1XDJA 1UMYA 5PTDA 3I7SA 2DH2A 2POZA 1HT6A 4ALDA 3CL6A 2ICSA 4AYSA 4WKAA 3ZWSA 3GDBA 5H2ZA 2ODOA 4JKLA 4ZOAA 3NZ1A 2C18A 3GVQA 2EPKX 3DYPA 4AZCA 3PZNA 4LYRA 3GYEA 4BF9A 4L56A 1DYSA 1TX0A 4M80A 3V1HA 1Q85A 5LIYX 2A2IA 2Q09A 2A85A 4GUFA 1UA7A 3BV7A 3LXAA 3PG8A 4M6UA 4DXVA 2AQWA 3QKZA 1ENUA 3AHXA 3L5AA 3GIPA 2ZZ5A 4F0MA 2ZXBA 4M19A 4YCPA 5FSDC 3MUZ1 3LBMA 5CZ0A 5DBUA 1FH9A 2G3NA 2WSPA 3BJFA 3PUDA 5A6MA 4UMAA 3AJXA 3HPSA 3NXFA 1W1B1 3LU2A 3WLRA 4XIAA 3CQ0A 5E9XA 3OTRA 3M7SA 5F7UA 3GTFA 4FNTA 3VILA 1K7EA 4LF2A 5HMSA 4BQ2A 2CFFA 1T8QA 3S42A 4HOZA 3OA3A 2OKTA 4A29A 4K1GA 3A5FA 3AAMA 3UESA 5HQEA 3SQLA 3BC9A 3DYOA 3I3DA 1XRFA 3TJIA 3NPWA 1OYAA 4W88A 2VFEA 2YBVA 1VHNA 3JUGA 3ERPA 3IJLA 4J2PA 1YPFA 3NPVA 2XGZA 2GJRA 2ZFAA 3BW2A 1LJYA 1VPYA 4JDBA 3HMCA 1UZDA 2EBNA 3OYZA 3RM8A 3EB4A 2X1IA 1RD5A 1O7AA 1IYXA 2ISFA 1EUAA 4GQ0A 3AXIA 4NZ1A 3F5LA 3I4EA 1P48A 4OZOA 2OZ0A 4B5WA 1XRVA 1XLDA 4FXSA 2WVVB 2PDIA 1UOKA 1GHSA 3WDQA 1EJSC 3VGBA 4IUGA 3MJYA 4HZ7A 5BOOA 3WLPA 4QSHA 3GDRA 2D24A 3EDJA 1GVEA 3VM5A 4S2CA 4N9CA 1RH9A 4E0CA 4Q4RA 3O6AA 3GFXA 4W4QA 1QO2A 1PTDA 1EBHA 2BSLA 5DRIA 4AF0A 1GW1A 3OBKA 4QQ3A 2QCHA 3FS2A 2FHCA 3UPBA 3CJPA 2A6LA 3W1LA 1TJ1A 1E1EA 1W3LA 3LCXA 1REQA 2HDJA 1KCXA 3GHUA 4AD1A 3BOFA 3QJAA 4QJ1A 2Z24A 3W2JA 1CENA 3R4IA 1TVLA 3DHFA 4AWSA 4E3TA 2I56A 3W85A 2CLHA 4DWDA 1HJUA 4FLRA 4IISA 4E3VA 1XLEA 3JZUA 1GZGA 3FSUA 3SJNA 4UFKA 4WHBA 5A95A 1IEQA 3SSZA 1O68A 4HYWA 1DORA 4V2XA 5A2CA 1K9EA 3U2OA 1EQPA 2PCEA 1RP8A 3QXBA 4LAKA 1C9WA 3AHTA 1W56A 1KB3A 2GGGA 2OYKA 4WLCA 5CAHA 1Q2SA 2ZZ4A 1KD0A 4L9ZA 4IP7A 1SUXA 1GHRA 1DL3A 4HMNA 2VC9A 4HU3A 2OSWA 1O60A 2ZZ7A 1NDYA 3CIVA 3CAKA 2VMFA 1BHGA 5I3FA 4HT3A 5BRBA 1JQVA 2QPUA 2G41A 1FQ0A 2VTFA 2XISA 1KO0A 4MB5A 4AH7A 1TFVA 3O0FA 3O7UA 1POKA 3ES7A 1WXJA 1AH3A 5HATA 2J7BA 1VYRA 2YL8A 1DJNA 4Z1DA 4PSPA 2TAAA 4A3QA 2QDHA 2WXDM 4UQEA 4LXFA 3ZSTA 2D0HA 3IIVA 4OECA 5HPCA 1O6IA 1A5MC 4ASTA 4DHGA 4LV4A 5IM51 5GPRA 3RX4A 2NXIA 3EX4A 4HGXA 1YW1A 1UR8A 4JL2A 3NQ6A 3BQ5A 1WZKA 5JQ9A 1YE6A 3C8NA 4G1NA 3LMYA 5C6MA 3H2CA 1WBJA 4PBFA 1HJVA 2C14A 2WSRA 3OW1A 3LEPA 3UZWA 4CD4A 3K13A 3UJEA 2CHOA 4U33A 3IGXA 4UFJA 4LS2A 1AH4A 3ZJ8A 4O53A 1X8FA 4HOWA 4FI4A 1OX5A 5AHLA 4GYPC 1NARA 4HU0A 2VEKA 2ZDSA 4US6A 4IIHA 2I1OA 3NDOA 3L2MA 3EXRA 3PJUA 3ITYA 1CX9A 5AC8A 1TB3A 4C6PA 2EF9A 4IIEA 2GQ3A 2WHJA 3P61A 3C0QA 5DMNA 1LQ0A 4M8UA 4O1CA 1QNSA 1Q6FA 3W2UA 4LYQA 2V2DA 2KAUC 1C93A 3POCA 1UR2A 4J3ZA 1AJ2A 1JF5A 2WNWA 2G50A 2HK1A 2GSJA 1EO5A 1KXVA 3AYTA 2PD5A 1VYSX 4AIOA 4PR4A 1W2PA 3NQVA 4D6IA 1X6LA 3UNDA 2WZHA 4N4QA 4BF5A 4HNVA 1P0DA 3CXOA 3GG1A 2Q8XA 3BARA 4Y9MA 4MWAC 1ITCA 3GYCA 4Q8TA 2H90A 3WD0A 4ZQOA 3IARA 1XUUA 3VIOA 3BK0A 1KFBA 2XM1A 4H9MA 3M0HA 2I9UA 1XGZA 4DPPA 2UY5A 4MTVA 1R2SA 3F5KA 4GUGA 1V6UA 4KFOA 4D6FA 4NT0A 1SSDA 5DY2A 1XCWA 2G95A 3FDKA 3FJ6A 3MP5A 4LCSA 2XIJA 1W91A 4DXXA 3QRHA 1R46A 1ZU8A 3OU8A 4QLKA 4MWAE 3NQDA 3T08A 3M5XA 2VC5A 1H7XA 1EP2A 4RW5A 4XSLA 7PTDA 1BF2A 2CZFA 3AXMA 1B4KA 1XIJA 1UP0A 3BJSA 3DKLA 1LM1A 1BGAA 1YXCA 3UPWA 1HUVA 2WBGA 3RG6A 1BQCA 1FDYA 4XZHA 3TH6A 2Y7DA 1C90A 3A3WA 1QPNA 3W22A 2GJXA 3UWWA 2IKJA 3M07A 2XH4A 5MKGA 3HG3A 5I6SA 2PD9A 6TAAA 3W72A 1LZOA 4NI8A 4S3EA 1XIIA 5EMYA 8RUCA 1CNVA 3CB8A 3GB6A 1GQJA 1I75A 1RLCL 4G8TA 3FYOA 2D73A 5C2GA 4RZ6A 3U57A 2EPHA 2BY1A 4TO8A 1OIMA 3H8AA 2R1PA 3WYZA 3I7RA 1IEXA 1TSIA 4S3GA 1A80A 1VD6A 1E6QM 4OV4A 1HW6A 3KL5A 1P0EA 1XP3A 3TZNA 2HTMA 4XKYA 4RDWA 2CBVA 2DFAA 2VENA 4O14A 2WHLA 3PZIA 5E70A 1XDLA 3MO7A 1GW9A 2Z29A 4XZ9A 3QVQA 2A3CA 1DIOA 5D2WA 3SI9A 5A2BA 3TUUA 9XIMA 2BWGA 2CWNA 4GI9A 3NQAA 1GOIA 1WOAA 4NJKA 4WXYA 3O1NA 2NX1A 1BYCA 3HURA 1YEYA 3FA4A 3KM8A 3WLQA 1CGYA 1K70A 4AW7A 1R2RA 3B9EA 5CZKA 3ZWTA 2WZMA 3OJGA 5EMUA 1L9WA 3B40A 1UD6A 5D9NA 4BA0A 4IGMA 2L5HA 1R86A 1KXQA 4A6GA 1J12A 4K36A 1QWKA 5F4XA 4G7FA 1RSCA 1HVQA 3UXIA 1MUCA 2Z7GA 4MWAA 3DBPA 4NIRA 1PTGA 2QCDB 4XZIA 3DG6A 4J3WA 5HJXA 4CN1A 2CZEA 1ZCOA 3DFQA 3WJWA 1NU5A 5IDIA 3FVMA 1H5YA 4A8LA 4AZBA 5HQLA 3EA2A 3BANA 1BWLA 3QLLA 4UOZA 2Q6ZA 3FW6A 3H4WA 1T96A 1QNQA 4QBXA 4AIUA 4POCA 4WGXA 4ORIA 3EAUA 4Y90A 3WLIA 4S23A 5CC5A 3H2AA 1S5WA 4Q32A 1O5QA 4JFTA 1EWDA 2VNCA 4LUTB 1QCWA 1JRCA 1FHUA 3EOSA 4WUIA 3V0SA 4EOUA 3OBEA 4HN8A 3GU2A 3VC6A 3TOPA 1A5CA 2PDWA 3F03K 1U1JA 3H12A 5B7ZA 1S5VA 3FEQA 4Y9AA 3GNDA 4WJXA 1PZ3A 3NXLA 3TEVA 1F5ZA 3WZ0E 1RA0A 3MHFA 1AFSA 3BQ6A 3WNMA 4EPDC 2OXNA 2WJEA 4JTHA 3KBNA 2QNEA 1EX5A 1HL9A 2P88A 1ZY9A 4XUYA 1KFEA 1X7FA 4HPHA 2YW3A 1EA9C 3IGHX 2X41A 3GO2A 3IV8A 3TYCA 4JTRA 4DBUA 1E73M 2ZX8A 3O05A 4XTIA 3WNKA 2CYGA 4H6RA 4O8RA 3UYIA 2ACUA 2VCAA 2PE4A 4LTSA 3MMDA 4H19A 4S39A 1VEPA 2EJAA 1R3QA 4DWSB 4JQ4A 1ONEA 2WAGA 3BE7A 3E74A 4K7VA 6XIAA 1G4SA 3CPGA 2OQHA 1N82A 2UBPC 3EBVA 3FKRA 5FEZA 3N14A 2BY0A 2LLEA 4D6DA 2A3EA 2OO6A 4W7VA 4DBSA 1HZYA 4LNYA 5BRQA 1GJWA 4HA3A 2V67A 4JTDA 2OSXA 1SW3A 4GCAA 2PBGA 1Q6RA 3SGUA 4HNCA 1ZHAA 4E2BA 5KZ6A 1TKKA 1GTHA 5J5RA 1LRTA 4XISA 1Q8JA 2PP3A 4JTSA 4U5IA 2W91A 1ONWA 2VKZG 2WJFA 4DJFD 3B4UA 3R2GA 4V27A 1Z41A 1DIEA 3TAKA 3H24A 5T26A 4N4PA 3C2EA 2EEXA 3BH4A 5CKSA 2Z2BA 1K4GA 5BXPA 3G22A 5KETA 1VFLA 4HPXA 3WQ5A 2REQA 4CUCA 2BHYA 4JTFA 3U0HA 1G6CA 1QMLA 3SN0A 1J10A 2Z25A 5DMYA 1WCGA 3WJSA 4J27A 4PB4A 1L2UA 4Q7NA 3ZT6A 4QXIA 1EP1A 2V82A 4YYFA 2W0UA 2ZA1A 1W3JA 5CG0A 1UWSA 3THAA 3DHUA 4C7GA 4LQ1A 1XLKA 2D3NA 2GDVA 2Z1XA 1Q2RA 3W7RA 4E8DA 3S9ZA 4KIRA 4HBKA 3F2DA 1CGXA 1XLCA 2DQXA 1ICQA 3ICJA 1CXHA 3EOLA 4JN7A 1GEHA 2ZZ1A 4HSHA 4JIIX 3W82A 4GIYA 2XG9A 2WVSA 2O55A 4B3LA 4N2YA 4B90A 3KW3A 3H2OA 3SJ3A 1YNQA 4GX9A 4IPNB 4HPJA 1JFXA 2YCIX 3CHDA 1UD5A 5FACA 4GHRA 1VIWA 2INZA 3QGAC 1KWGA 1OD0A 1QI3A 4S3CA 1DJQA 3W2MA 4DELA 5AVHA 1E15A 4S3DA 1XYAA 1PZ1A 1XG3A 3SEPA 3W27A 4LF1A 1SMAA 4F0RA 4GNKB 3SO7A 4PTMA 3BG5A 3VKAA 1OCQA 1UR1A 1UA3A 4X0NA 3W7JA 2Y7GA 2Z28A 3GAYA 2RDTA 2V3DA 3AROA 2R1NA 4URIA 1OIFA 4GD0A 4HPNA 3ID7A 1DP0A 2PB1A 3BZJA 2OGJA 5A94A 3DI1A 3VM7A 1TJPA 2J7GA 5HJLA 1UBPC 2FFIA 2XUCA 4NILA 4DRSA 2CETA 1MFUA 1PO9A 3SUVA 2JKPA 3HA1A 4KERA 3N25A 3ARSA 1QBBA 3M0YA 2O7QA 2OWXA 3QSRA 3GNPA 3K5XA 3HGJA 4DBEA 3DG3A 2HE5A 1TJ0A 4NXKA 4PMVA 3O6CA 3KEHA 1V3LA 1HKMA 1F6KA 5CPTA 3TE9A 5KSWA 4N6FA 1JG9A 4FOJA 3EB3A 3L4VA 1P6BA 4F2BA 3TLQA 5U4NA 4BS0A 5C70A 2FQIA 3T0CA 2PWUA 2DUZA 1ZL1A 1X6NA 4O17A 3EXTA 1UW9A 2QCLA 4R3UA 4MJMA 3G0UA 3C52A 3VDBA 4PA8A 1XGDA 4R9OA 1LG1A 4JX6A 4W5ZA 5H1WA 2EPOA 2PWFA 3MUAA 2F84A 5MF5A 1PEZA 3GFYA 1VS1A 4JNMA 4GCXA 4I5XA 2OCZA 5IFTA 1PBGA 3QFWA 2Z1VA 1AL8A 1GOQA 4TQTA 2E5DA 4NNCA 2ZUNA 2ZUSA 5BXRA 4DZHA 4L64A 2WK2A 3NO5A 4K7YA 1G7UA 4H6EA 2ZBTA 3S6DA 1K8CA 4XG1A 1K9DA 1SO3A 3R43A 1EWEA 2GGJA 3GNOA 4H9YA 4NU7A 3CHCA 5TNVA 3TN5A 5LIXX 1Z69A 3WJZA 4JYEA 3E5PA 4GI8A 1UZHA 3GNRA 2XVNA 2H9AB 3EDEA 3W1RA 7XIMA 2PZNA 2GSHA 1T40A 3ARWA 3JRKA 4LVGA 3CT7A 1OSEA 1JZ5A 5GJPA 2FKPA 2Z1KA 2ZRVA 3OHMB 3S5NA 3D0CA 3N13A 3UFYA 4AY1A 3UG3A 3HQNA 1CB7B 1PDYA 1EX1A 3AMLA 4PB5A 4DAIA 3N4FA 4GLEA 1TWIA 4BWLA 4Z1AA 3PZUA 3LPFA 5J04A 3GDTA 4GQGA 1B5TA 1YBQB 2BOGX 4JD4A 3R94A 4D6JA 3M47A 4Z2HA 1VZWA 3IJDA 4LSBA 3M6YA 2IPJA 3VIMA 2QUNA 2XFFA 1PVNA 1TCMA 2YB4A 2WNQA 2XINA 4MDOA 2QVNA 1XPYA 3TROA 3LTYA 2AGTA 1GPFA 3O8AA 3WLHA 1B9BA 2QT3A 4GFIA 1H3GA 4UTHA 4JHOA 2WVVA 1SJAA 2PU0A 4PCNA 1E4IA 2C1HA 2EG8A 3NZGA 3TR2A 3RLUA 2NQ5A 2RDUA 3IGSA 3OZMA 1H4PA 3SQSA 2CXGA 5F2LA 1WDSA 3APGA 1BXNA 3P81A 2VZVA 1BRLB 2FH8A 1M01A 1L0PA 1M6JA 2J47A 2DUXA 1KM5A 4BEUA 4CEUC 1EJUC 4BI6A 1OFAA 3ARYA 4JTLA 2C91A 5HNTA 3TFCA 1CW2A 3N6JA 4HK6A 1TG7A 2JALA 3UJ2A 3FNDA 4IIDA 2J77A 3IRSA 3LXCA 7TIMA 2G5WA 3HMJG 2X2GA 1YXYA 2EKGA 2QGHA 2VUNA 1EYWA 1Q6OA 1PV8A 3IRDA 1A5SA 2O7SA 2ZXAA 5EMLA 1UPPA 1F74A 1J93A 4X63A 1QASA 5E6ZA 1ZP4A 2DIKA 4ACYA 4F3HA 1XC6A 4L4OA 3W53A 3COTA 3RO8A 1HXJA 4AZ7A 3NDYA 3OA5A 3WF1A 3LS9A 3NYZA 4GC4A 4RXFA 3DFSA 3CQJA 5DANA 1BWVA 2PWGA 4OKDA 2J74A 4LCQA 1TWWA 3GG8A 5K7JA 1PSCA 5FF3A 2QIWA 1VJZA 1YDNA 1GOKA 4ENLA 5D2TA 4NX0A 1IEIA 2WHMA 3MKCA 4F0KA 1IIGA 4O16A 1DXIA 3WNLA 3TYDA 5CJMA 3NAVA 2J75A 2BZNA 3DESA 1AJ0A 3EKGA 4IP5A 2O9PA 4PMUA 1O1HA 3KOZA 3STGA 4UZUA 1C8QA 3G1VA 2DT1A 1XQKA 2GVYA 3EKLA 3FK4A 3R10A 4O57A 3BGGA 3N15A 4G1KA 1FRBA 5LXEA 2QGYA 3KL0A 1PWMA 1BXCA 1ICPA 1CXEA 2VX4A 2NX9A 3VIHA 1HO4A 3W7KA 3BW4A 2Z1SA 4XD4A 1VFMA 5TD4A 1M5WA 3W84A 1EGVA 4F2TA 4RNHA 3RM9A 4ADTA 4HTYA 1PIGA 4XZBA 1RVKA 4NX5A 5EBAA 5HR7A 3LV6A 3DIPA 3DBNA 3PUGA 2QJIA 3M9YA 3ELFA 1VJIA 3RCMA 1CZ1A 1YTEA 2Y8KA 1JVNA 5AY7A 1SZNA 2VDHA 2DH3A 1DBTA 2WZTA 4GFSA 5C0QA 4FAMA 1XWYA 3THDA 5C9UA 3WG6A 1KTNA 2DDXA 3DG7A 4V1YA 4P5UA 4YL2A 2X05A 3FY1A 1IWBA 3EPOA 3TTQA 3T8QA 3N34A 4QJ3B 4HIBA 3T4WA 2ALRA 2OT1A 1L6YA 4FR1A 3PBVA 2DVTA 2YL9A 3ABOA 2YL6A 4H9ZA 3GVWA 3ZJKA 4ZMGA 1ISVA 1A50A 1E1FA 3GC2A 1AUSL 4KEZA 5EMKA 3VOIA 1XRSA 1P5BA 4XB3A 1ONXA 1F7BA 5SWUA 2Z26A 4P7RA 1VRDA 4PCSA 3P0WA 1KM3A 3RDKA 4QROA 5DF0A 1PKNA 2RKXA 3EOOA 2ZRUA 1RVGA 3B06A 4UQCA 3GH7A 4MJ2A 1JF6A 3TA9A 3OZPA 3S4TA 4DNMA 2E6FA 2YBUA 2VQUA 5I00A 2FDSA 4Q33A 2E7FA 3RR1A 2OEJA 2HQAA 4Z2IA 5BOFA 3LHYA 4FXRA 1A0EA 2D22A 4DYJA 3EWXA 1KV5A 1U1UA 3BLLA 3GKAA 3W07A 1XHGA 3QR0A 4CKQA 2BOFX 1VYPX 1P6WA 2ONEA 1UP3A 4KWSA 3VGHA 1UC5A 2WPBA 3TCEA 4LS1A 1J01A 2H8XA 4J9JA 2QF7A 3KTCA 2Y8VA 3KHDA 3E0WA 3R89A 1GQIA 5FF4A 3M41A 3BAXA 1KXTA 3WFZA 3EDDA 1PHQA 3F2CA 4PEEA 5G1TA 3LM3A 3URQA 2RJGA 4NRSA 3UW6A 3APTA 2NUWA 1FWHC 1Q8AA 2ABBA 4CU7A 1K03A 4RNIA 1CGUA 2XFRA 4HHLA 1GVRA 1DWAM 2YIHA 4D6EA 9RUBA 2DGAA 2X42A 1W5MA 1BQGA 1TRDA 4R7WA 1MYRA 1UCWA 4PBEA 3QV6A 2Y6ZA 1UWUA 2V2HA 1NFBA 1AQFA 3DFNA 2BVTA 3LM7A 3G1SA 3WQWA 3CUXA 3MMWA 1Y0EA 1AH0A 4WIWA 2VFDA 4GVHA 5CG7A 1XYCA 3MWCA 4GI6A 3N2XA 3S3GA 4AWUA 5KTLA 3UT0A 4RE0A 5D4YA 4I9MA 3GNXA 3AZSA 3SQMA 3SUTA 2DV0A 3VOCA 3AI0A 4X22A 1B57A 4LYKA 4N9DA 1TPFA 4MKVA 1NDWA 1XBXA 3TNOA 3W74A 3G5EA 1M3UA 4YU1A 2FLIA 4FA3A 4K38A 1PWLA 3O06A 3C5QA 3H2MA 3S46A 2V5BA 3GVRA 3HPFA 4AEFA 3OQEA 4P7NA 3GTHA 5G5IA 1LBLA 5HBFA 4DUOA 3DFOA 1RLDA 3L0KA 4PRTA 3W88A 1Z9AA 2YXGA 2BTMA 4GABA 5CC6A 1BG4A 2HVNA 1TV4A 4HPGA 3KBJA 3QZEA 3L2LA 4LGXA 3PZOA 2WSKA 2PWVA 3XISA 1E5NA 1VCVA 3BGAA 3JR2A 2QCDA 1KLZA 2OWWA 2VVNA 4S3KA 4QRNA 5D9OA 1DXEA 1QATA 1RHCA 4H1ZA 3S8HA 3BV4A 3W02A 3AWNA 3WLSA 1TTIA 4O1BA 1FH7A 2XH7A 2I7GA 1XXXA 1JYWA 1UOZA 1V8EA 4YTTA 5DT7A 2ZZ2A 8A3HA 2YKKA 3BG9A 3GH5A 3KAOA 4HYRA 1K9FA 1EC8A 1T99A 4FNRA 4M3PA 4QLJA 5L6UA 1J0ZA 1KFJA 1E4LA 4F79A 4MZ8A 5CSUA 2CLMA 1A49A 3E2SA 4KESA 1KCLA 1W3IA 4F2UA 3B0PA 3GIQA 1VEMA 2GQ9A 5C8BB 1CDGA 1TPEA 2PMQA 3MKVA 3WQ8A 2IKHA 1V4YA 3NVTA 1P0NA 2Q8ZA 4GVIA 3ITOA 4JAWA 4PCTA 4QE5A 1MUWA 3IJ9A 4PCFA 2C7FA 4HCDA 2C71A 1XLBA 3S1VA 3UXDA 5B80A 3TR9A 1H50A 3APYA 2FFCA 3M5ZA 4TV6A 1KBIA 3LLXA