4D8PB

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
193
Chain Sequence
PQPEQPEQPFPQPSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 193
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pB01
1MCFA 3D85A 4PJGB 1KOAA 1KFAL 3JWDC 1KJ2H 1VACB 1CFNA 4E5XA 5T5NG 3WJLC 5DD1L 2GY5A 4OLYL 3MR9A 1ACZA 2CIIB 3DX9A 1P7QB 1JWSA 4X8JB 1RJLB 3CX2A 3NBNA 3NABH 2O5YL 5F9WB 2LQRA 5E8NA 3HA0A 1DE4B 2J4WL 5C6TH 4HQQL 3U0TA 2A9MH 2PXYD 3X14B 2D4DA 3DRQB 5ICXA 3GBML 2BOBB 1IGIL 2DBLH 2R1YA 1V8HA 1S9VB 5D96C 5JOPD 4M1DL 5DFVD 1C08B 4HK0B 4Z7WB 5JORA 1PBYA 4ORZC 3TT1L 5HVFB 15C8H 3R06B 3ARFC 1FYTA 4WFGD 5BW7C 1N4XH 3EGSA 4IRSC 1CF8H 5D1XB 1UXWA 1OAQH 4R7DB 5HVHB 3LRGA 2NXYD 3RPIA 4YNYA 1Z5LB 4I0KA 2B5IB 3HMWL 3DX7A 1HZHL 4GSDH 1DVFB 5E2UL 1NBVH 2H9GB 5DSCB 4RZCB 1T03L 4XNYL 5FCUH 2X4OB 3QCVL 2FECI 4I0CC 4I77H 4XPBL 4JRWA 3RX5A 1FNEA 1VB9A 2DQHL 3FQWB 5GISL 4J4PC 1NC2B 2EZ0C 4XX1G 5JUEL 1K4DA 1L4IA 4JN2B 4ERSH 4IHOA 1HHIA 3WEXB 4KXZH 2LU4A 3EHBC 1WBYA 3ARRA 3BOVA 3SJVE 3TT3L 1S7SB 3INUH 2NY7H 4HDIB 2PN5A 5D7KD 4PJDB 3V5HB 4GKOA 1EJOL 4JFEA 1BX2B 1V7ML 4GQ9H 4ZXBA 5SWSB 5CEZL 5FO8A 1CK0L 1KC5H 4Y5VC 4HUXB 2SEBA 4MD5B 1NANH 2Y7QB 3IDUA 2YD7A 4JJHA 4QT5A 4FA8A 3OX8B 1LO3H 1WC7B 4N90E 3T4YA 3WL9A 3EYFA 1OCWL 2YEZB 1Y6KR 1FCCA 1ZA3A 4QO1A 4EI6A 4OBRA 4MYWB 3IKCB 1CXLA 3CSGA 1I9RL 1JHTB 1CL7H 2ZUXA 3CDCA 5IVXF 4KDVA 3QIUA 5C0EA 4YDIH 1T4KB 4PJIA 1MCCA 3CAFA 4OTXL 4FQXA 4XP5L 4ZUUA 4ELMB 3ROLA 3D9AH 3FONA 4TUJB 4P9HH 3AFLA 4S11A 5T3ZD 3I9GH 4U6HB 2W65A 4FXKB 5MP6H 4G9DA 3AM8C 3NOIA 4Z9KB 5AWNH 1BQHB 1KTLB 3NFSH 4MLSA 4DK6A 2Z93B 5IGXH 4OFKA 4YIQA 2OS7A 4HLZG 2ADGA 1MIML 1AD9A 5JHDB 5CZVL 1EAJA 3H9SB 5E2VH 4TQEL 3QIBB 4JHAL 5CEXB 4FOMA 3WNKA 3BHBA 2UVEA 5DMJB 1KJMB 4LBEB 3GSUB 1VADA 3L3OA 2GUOA 1QFPA 2P47B 4XNUH 3MRJB 2P8LA 4IM8A 1QFUL 5EZJB 4OFIA 5BV7B 4YX2L 1YMHB 2HFGL 3GSVB 2X6MA 1JJUA 4OZHF 5IEKA 1HCFX 1KB5A 2VC2H 4JN1H 4NZRL 4WEMB 1ZK9A 3BPLB 4M1CC 1SJVA 5DS8B 2HMIC 3SO3C 2ZG2A 1YEJH 4OFPA 4ETQB 4UNVA 5EFIA 3ET9F 1CGSL 3HMXL 5GZNC 5HVGB 2FDBP 2NW3B 4ZOCA 1T7VA 2EH7L 2W91A 4APQA 4LCWD 1J05B 5I8EA 3QUXB 4M00A 3SGEI 5JNYB 3SPVA 5AD0A 1RUML 1QSEE 2PR4H 3UBXG 1KCUL 1P69B 3C8HA 2GSGB 2CLVA 1AY1L 3S35L 2GITA 2X9WA 4U7SA 1JGVH 1ZLUK 2W0FA 5DMIH 2C7UA 2NY5L 3EO1A 4K3EH 2XACC 1DFBL 3IRZA 1OTTD 1HQ4A 4L9LA 1BFTA 4NN5B 4LLVA 4PP1D 1JPSH 1CCZA 3FCTA 3OKLA 4Z5RB 4WI3A 3GHEL 3HAEA 4BSVA 1CDHA 3ZDYE 4UT7L 3VXUD 2F15A 5M95B 1ND0B 3V79C 5ESQB 1BVKA 4PJ8B 3WBDA 4LQ1A 3REWA 1TJHH 2WZPD 3KYOB 5JR1L 4NKOB 4X4MA 1P4IH 2P5ED 1I1FA 2R9HD 1KB9K 5F1NB 1N5YL 4Y5XA 2HKHL 3H0TA 3SE8L 4J2XA 1MWAL 5E7FA 3TBYA 4OFDA 3KPSA 2FBOJ 4KC3B 1NKRA 1H5BA 1EX0A 2WAHA 3C5JB 3LPFA 1CXKA 3FB7B 3SKOA 5IFAL 1MCQA 2ZUVA 3GMNA 1FVDB 3DGGA 3SY0A 1MQ8A 3L6FB 4MNQB 1F6AA 1R24B 3GRWL 1R0AH 1YECH 4GOSA 4CVXB 4PJFA 4OV5B 1KCSH 4S0SD 2JJTA 1OAKH 5GSVB 5IW6B 4X6CB 5GGSA 3BXNB 2A74A 3IFNL 1MCWM 1KFAH 3GBNH 5IR1B 4QLRA 3BKYH 1IL1B 4P2OB 4PD4K 1H3PL 3MBEC 2OCFD 1ZHBB 4ODVH 4HKJA 2X1WL 1W72B 4KV5F 4Q6IC 2XZAL 1BF2A 3JV4B 3BO8B 4JRXD 4HQQH 3S7GA 1MF2L 4JDVB 2F53B 3O9WA 3K2MC 5D2LB 1NCDL 4XXCA 5D6CA 1MAJA 1NFDE 4PRIE 4JFFD 5IESH 2AKRA 2VE6B 1XGQA 4PTTA 1R5IA 5ISZA 4ODXA 4NZTH 3TA3B 1BQLL 5E5MB 1KIRB 3H42H 4LARL 5LQBL 2Q6WA 3N0PB 4DGIH 4OCWH 1M71B 3QUYC 5F7YC 1F58L 1FFOB 4HHAA 3KLAA 4FTVE 4YK4C 4GBXB 5D7IF 3EDJA 2EKSB 3HMWH 3FO9A 2PKDA 2VLJE 3BP7A 3QUZC 3QJHB 4TULL 5T5FH 2QLVB 4XNYH 4YHYC 4F58H 3EYUL 4QHLA 4GG6B 2EDNA 5GISH 4LHUG 2PO6D 1IKFL 1HYRC 1TETH 1X9QA 4L3EE 4G6KL 3TO2B 3OJVC 1DCLA 2YC1B 3DTXB 1P7QD 1ZWIA 2YUZA 3OKEA 3TT3H 4Z77B 4GS7B 3QAZB 3ARGC 1QLEL 1EJOH 5DHYA 1V7MH 2VOTA 2P8MA 2VLLB 1U8OA 2PETA 1CK0H 3F62A 3R8QA 4TSAL 1HHGA 3KLSA 4WU7B 4HIXL 5BOZG 1NGPL 2OZ4L 1NDMB 1MVUA 5FOJA 1U8HA 5HGDB 1ZVSB 5BOPA 1U3ZA 5DGQA 3FFCA 4LCCC 2Q3AA 3O3BB 3RZCB 2GW5A 1UEMA 3HE6D 4JFQA 3U7WH 5JIHA 2DWEA 1WFUA 2XG5A 2CSPA 5IQ9A 5I30H 2XTLA 4H5SA 4BFBD 2E7LC 1FZOA 4RBPK 4Y89A 1JF1A 1LD9A 4OTXH 3MUZ1 3AS1A 4GAYB 4QXTB 4XP5H 3GUTB 2ZCLH 2AABL 4F9PC 4TSCL 2PYEE 2DL2A 1YEHL 4OCLC 4ZODA 5FDWB 4EIGB 5IMOB 1DQQB 5C0BA 3QDJE 4Q9QL 4N0CD 4JGJA 2B0SL 3NA9L 4DKDC 2LE9A 5EU4A 2GAZA 1EZVX 1RZGA 3CNKA 3O45A 5FAAA 3RWDA 3CH1B 5HYEA 2G9HA 3CXHK 3MRBA 3I50H 5I1CL 4XCCH 2IANB 5DYOB 3T1FA 3HPLA 3MFFA 4WFFD 5FYJL 2CDGB 1E4WH 1V3MA 2B7DT 2W1NA 5HHPA 4PLOB 3D39E 5IBUG 5T1MB 4LLUB 2BNQB 1P4LA 1Y18A 2ED9A 3D2UB 1C7TA 1T0NA 2HLFC 2CQVA 4R4FH 4DTGH 1JNHB 2VIRB 3SKJH 4M7JL 3BE1L 4M5ZH 4YX2H 5CD5C 4CDGC 4I0PB 3CX5J 2R1XB 4QRRB 1OB1B 2YBRA 1C5DB 4V1DB 3FMGH 4ODBD 3TWCH 2JK5A 2HFTA 3O2DH 4RMWA 4BFIA 5LXGL 3WIHL 2VDPH 4TTGA 5F3BA 9CGTA 4X7CC 1PDKA 1EVUA 4F80A 3IXTA 1J1OH 4MZ2A 1ED3B 4ODTL 2DLGA 5L0QB 2DL9A 3QEQE 1WBXA 3BRFA 5J12C 3H3PH 2VH5H 4KVNL 1BFVH 3ARYA 2K9UA 1CT8A 3VXSB 5FM4A 3OR7A 3ARBA 1ZHKA 2IADA 1Z9OA 4HS3A 3TPUA 1KCUH 1Q9LB 2I25N 3QFJB 1AY1H 4PP2B 5TE7H 4FQ2H 1S7TA 4TVPD 3VXUA 4RFOL 5EC2A 5CJQH 3GKZA 4KDWA 4AH2A 5JHDD 3HRZA 4MLIA 3PDOB 3VFMA 4H26B 1E28A 4MJ2A 4OQTL 4LSVL 3GIZL 3N1MC 3F58L 3B2UD 5EU7E 3OHXA 1H3GA 3HKFA 4WU5B 5TH2B 3H6JA 3GHEH 4R6UA 4UT7H 1IZJA 3VH8G 3W39A 4NQXB 4PRPE 1SJHB 5KSAB 5MEQB 4H88L 4J3TA 5JR1H 2NTSP 1OAXH 4HW6A 4XHQA 2DTML 1U3HD 2ZOKA 3PHOA 3T2NH 2XQBL 2DM7A 3IDJB 3K1KC 3DVNA 4RFNC 4O4YH 3UO1L 4MJIA 2E5EA 5CLTA 2C3XA 3G08B 4AEHL 4PJXB 4AT6B 1FO0A 5IEHA 5IVXE 3RZWA 4Q2ZB 2X7LA 5D70L 2Z31D 5GRWA 4J12A 4JY6B 3FB5B 5B39A 1PSKL 1B6DA 3VFGL 4KPHH 4U3HA 2VRAA 4QXGH 5F1OB 2FEDC 5I8KH 1XFPA 5IHUL 1WZMA 1FV1A 1IC5L 3EJZC 1CXFA 4ZFGL 1MJ8L 4LLMB 4NWUH 4KK9C 4WWKB 1N8ZA 1U92A 3QPQC 4GT7A 5D7JB 3RIFF 5DJ6A 2AK4E 3MC0A 4Y5YA 4JM2C 3O4OC 2AXJA 1HXMB 3AUVA 3RUGB 3FB6A 2J8OA 1J87A 4NO3A 4YGAB 4ZFFB 5CKAA 2XZQL 3VJ6A 2NX5D 3I6GA 2A6DA 2EECA 3KHQA 2E8YA 2FHBA 4D9QE 1H3PH 3K8LA 1XIWC 4ZUTA 2QADC 4Z8FL 3MV8B 3TESA 1EA9C 4WV1B 1QNZH 3PV7A 4K3DH 5HDOA 4DQOH 4F7PB 4O02L 5E4EC 4ZTPH 4PREA 3QCUL 5JQHC 1MF2H 2DIBA 2LAAA 5C08D 1NCDH 4I3SL 4OZHE 2A2QT 1BBDH 1H8SA 1DEEA 1I9IL 2BMKA 2FIKA 2N1KA 3D18A 5DEFA 4HIEA 4QCIA 1BQLH 3WJJC 4KKCD 1KELH 1QFOA 5DD0L 1U58B 2MMXA 3CLFL 4H0HB 5E6ZA 3MPCA 1JMXA 5T33H 4XVSL 5LQBH 4JO1H 2OTWA 1WCQA 4PRHA 3U2SA 1MELA 1F58H 3ILPB 2X09A 3HZKA 3QXUA 4LSUL 4RGOH 2UWEF 1MCNA 4PJGA 3ZE0E 3MV7D 2P5WB 1VACA 2ENSA 1RUKH 1UADC 4Y19D 5I66B 4LMQI 4XRCB 4ZNEE 2CIIA 4TTDC 5E70A 1P7QA 2BSSB 4X8JA 1RJLA 3GDBA 2JB6B 1DE4A 2IPTH 3X14A 3DRQA 5IK3B 1ZE3C 2BOBA 5C0DB 1S9VA 3EYSH 5E1AB 1YY8B 4HT1H 2FLRT 3CFDB 2IC2A 1C08A 4Y4KC 4HK0A 4Z7WA 1JNNH 1FDLL 2NY4D 2VXSH 4Y2DD 5JW4N 4Y4HD 4KUZL 1FFRA 4NQSB 5FYKU 2F53D 5H37G 1WAAF 5HDBF 1MCPL 1A7OL 1JGLH 1QFWM 2MKWA 4NO0D 5GS0D 1MI5B 3LS4L 4G8IB 5D1XA 2OZ4H 1ZLSH 4R7DA 3L1OL 4U2YA 1Z5LA 2NY1B 4QOKB 1RUPH 3NPSB 2NY5C 1K5NB 1O7SA 1DVFA 4XPFL 5TQ0L 1Q72L 5F7HA 2H9GA 2ADIB 5DSCA 4RZCA 2DD8L 4M8QB 2X4OA 1UJ3C 3MRPB 3RDTB 1CDGA 1MFAL 1B6UA 3FQWA 1X5LA 3BVNB 2GK0B 4GXUN 1NC2A 1U8NB 1N64H 1OHQA 4JN2A 4HKXB 3WEXA 1BWMA 4G8GE 4ZUSB 1WWCA 4X4ZA 5E2TH 5FHAL 1S7SA 4HDIA 3M8OL 4EUPH 4PJDA 3NCEB 3V5HA 4ZTOL 1BX2A 5MEOB 1E4KA 5SWSA 4GRLC 3V7AG 4HUXA 4PLJC 1YQVL 3VGEA 3IAGC 4MD5A 2Y7QA 5HGHB 4MQSB 3V0WH 2NY6B 3Q5OA 4MA7L 6CGTA 3OX8A 4JFHE 3CFJB 1WC7A 2VJXA 2NR6D 2YEZA 1I1AC 1OM3L 5CP3A 2AJ3B 1C5BL 3SDXF 5L9DH 4NO5B 5F88B 4RGNC 1SYVB 2YUVA 3IKCA 4HZAA 3BD5A 3MJ9A 2NY0C 1JHTA 4I3RH 4PJAB 5GS3A 5DUMH 4AJ0A 1JCKA 1D5ZB 2W59A 3GSQB 2YK1H 4HG4K 1T4KA 3RZCD 1A6VH 1FNGB 4KJQD 1KCRL 4ELMA 4K8RH 4TUJA 1HOCB 2W9EL 4LEXL 4EI5C 4WI5A 4U6HA 1J7VR 5E8DH 1AKJD 4UDUB 3MCLL 5KSVB 2FNBA 3S37L 1G7HB 2DLHA 1IZKA 4YDLB 1BQHA 1KTLA 1KEGL 2PW1B 3U82B 5D7IE 4G9FB 3G6DH 2Z93A 5F7DB 1KT2B 4FZ8L 1P1ZB 1ZKAA 2DTSA 1R3KB 1KCLA 1E4JA 1U6AH 5SX4I 4YHPB 5JHDA 1AR2A 3H9SA 1JNJA 2Y72A 3QDMD 2DI9A 2YPVL 3F7RA 4UZGA 3QA3B 5D2NB 1RZKL 3CFBB 3PWLB 3QIBA 5CEXA 1KJMA 4LBEA 3GSUA 4W6XB 1G1CA 4YDKL 3MRJA 4CRPA 5EZJA 1YMHA 3GSVA 4OQTH 4LSVH 3GIZH 3WS3B 4KFZC 5HSFA 2RJMA 4N8CL 5INCB 1IT9H 5HYQB 5D4QA 4LSTL 5SWZD 5DS8A 2VZOA 5C9JB 1A14L 3C5ZC 4QRRD 4ETQA 5D1QD 5JOEA 5TJWK 5F9OL 3AGVA 2K7QA 3O4LD 2D03L 5KTEL 2XQBH 3EJJX 2NW3A 4YQXL 3G6JF 3BKML 5IBTH 4OGAD 1J05A 3SDCC 5I74C 3QUXA 4UQ2B 2DDQL 5JNYA 3VXRD 3CDGB 1BD2E 2QHRL 3VFWB 1N6UA 2A6KB 4LGRB 2GSGA 3BD4A 3AY4C 4AEFA 3PWUB 1I8IB 5IHUH 3RVTD 2R0ZH 4RAVB 4UILH 3GFUA 5JZ7C 1CVRA 3A6BH 4PS4H 3KYKL 1CFQB 3W9EB 4Q9BA 4Z5RA 4LIQH 2H3NB 2YMXL 3GKWH 1ND0A 4PJ9B 2XZQH 1HDMB 5ESQA 4PJ8A 4Q97A 2UYLB 4L4TB 3LS5L 4ALAL 5JA8B 3KYOA 4FQIL 4NKOA 3LQAH 1LHZA 3TN0D 4UTBL 1CDUA 5DWUL 4Y4FB 1WITA 3DECA 5F1NA 4IJ3C 1AXSB 1FGNL 5CWSB 3UZQA 1U42A 2OXGA 2WM0A 4YPGB 4YC2B 2RAMA 1Q9WA 3QCUH 2DLTA 4O58L 3NFNB 4TOYL 4P4KC 3UPCA 2XZCH 2RHEA 3C5JA 4Q58C 4Y16B 1J0KA 3BX7C 2EEAA 4U1IB 2Q8BH 4HEME 2V9RA 4HJ0D 3FB7A 5I8OL 2D31B 1T5XB 1FVDA 3DVIA 3L6FA 4MNQA 1WEJL 1R24A 1KB5L 1IAIM 4MAYD 1ZHLB 3SJVD 3Q6GH 3CFEB 4P2RB 4JFDB 4CVXA 4OV5A 4B7IA 2D4FA 3NZ8B 5HYFA 5IIEB 5GSVA 1SEQH 4XHJC 5TDOB 4N1EA 4WWKD 2ZKHH 5IW6A 4X6CA 3BXNA 5C86A 3B9KC 3QBTB 5IR1A 4KK5D 1IL1A 4P2OA 1FIGH 3E1F1 1ZHBA 3MGTB 1W72A 4R96B 1CLOL 2GJZB 3JV4A 2DYPD 4D9RE 3C60D 3ARFB 3UBXB 3P30H 1HHKB 3BO8A 2BP3A 4JDVA 2F53A 4G6FD 5D2LA 3CVHH 2Z8SA 1QVOB 1T2JA 2VQTA 2VE6A 1FP5A 4OLVH 3TJHC 1QA9B 1FDLH 3TA3A 5E5MA 1KIRA 3BN9C 5FDYA 5FM5O 3GJFK 5D6DC 4EOWL 4LFHG 4OCXH 1WCBB 3BWAB 1W8OA 2XT1B 1M71A 1VEMA 3LS4H 5TE6L 1JPGB 2CGRH 1Y6NR 1X7QB 4Z7UF 1FZKB 4J6RH 1FFOA 4GBXA 4G3YH 3MLRH 2EKSA 3OGCB 2YN3A 1XR9B 2AI0H 3QJHA 4EJ1C 1GVIA 5ITFB 4GXVL 1SM3H 4OI9A 4N9OB 5EIVA 5CEZE 4XVTL 1R6VA 2RGSA 4KQ4L 5DFTA 4GG6A 3LIZL 5FYLD 4Y5VB 1EJ6A 2EC9U 4RIRB 5IV2B 3TO2A 3S34L 3FO2B 4OM0H 2YC1A 3TZVB 3DTXA 3BSZH 2YPLD 1X5KA 3HZYB 3NIDE 1UGNA 5IVNA 4OZGB 5FHAH 4AK1A 1CGYA 5BS0E 7FABH 4Z77A 1IARB 4PBXA 3VMNA 4K55A 2VLLA 4NHCL 5E03A 1AO7B 3OXRB 5EUOB 1EFXB 4WU7A 1NDMA 2UY6A 5GGRY 1KULA 5HGDA 1ZVSA 4MAUL 3D0LB 2E7HA 2E9BA 3O3BA 3KJ4C 4LPTA 1NGYB 2AEIT 1OM3H 1UJTA 1E0OB 3RZCA 3CK0L 1A8JH 1ES0B 3QULB 3QDHA 3UTTB 2XRAL 1OARH 4M7ZC 3VW3L 4XNZC 4F15C 2NXZB 3ZDZF 3OKMB 3MA9L 2DQFB 4YAQB 2QQKH 3UTSB 1QSED 4GAYA 4QXTA 3GUTA 4U1NB 3NPZB 2W9EH 4U1GC 5IMOA 5FDWA 4LPWA 1DQQA 3RDTD 3L5XH 3QFDB 2Z8VC 4XP4L 3QH3B 2FWOB 2J88L 4R97B 4UQ3B 1J0ZA 4K3JL 2M8XA 5F6IB 1KEGH 3EDDA 3CH1A 2UWEE 3UDWA 2BERA 5B3NA 3TJEL 3CFCL 1MCRA 2IANA 3SKMB 4FZ8H 1I8MB 4NKMB 3SE3C 1QFWI 5EG6C 5DYOA 5HHME 5D72H 3DSFL 4LOUC 2CDGA 5SX5K 3V5DB 1FLTX 3AB0C 2DQJL 3UYOD 2C4XA 5T1MA 4LLUA 2BNQA 3WUWG 4HWBH 5LWYH 2B8OT 1RZKH 3T0DA 3D2UA 3RTQD 4DW2L 3AMKA 2MPAL 1DZBA 2EDXA 1ERNA 2NY2C 4U1MB 4YFLF 5I15H 1JNHA 1KN2L 2VIRA 1LEGB 3P4OB 4GRWE 5HYIA 1N2RB 2ZZUT 4I0PA 2R1XA 4QRRA 1OB1A 1F02I 1C5DA 4V1DA 1MCLA 2D0FA 5E24E 1OVZA 1U8QB 1DLFL 3IETB 2DIJA 3T2QA 3DXAE 1WAAE 4FQQB 3KJ6H 1ZLUH 3EW3B 4Z7VB 4HC1A 4JDTL 4CKVX 3KDMB 4M8VA 3TM6A 2OTUB 3MODL 5BJTB 1ED3A 5C0IB 4HWUA 2EYRB 1X5ZA 2HJFB 4YQXH 4UV7L 3BKMH 3SDAC 3UYPA 2MJWA 4M48L 3BIBX 4OLXL 1I7UB 3CXDH 3OJMB 3VXSA 5FHBL 2DDQH 5T3ZL 4G9FD 1FGVH 5I9QB 3SGDI 1Q9LA 3QFJA 1A7QH 4JRYD 5L7XH 4PP2A 3I75B 3MLYH 3E6FB 4U0QB 4UT6H 5D7LE 3PDOA 3BGFB 1OTSD 4H26A 3KLDA 1FC2D 1TPXB 2D0GA 5EOCL 2R2HB 2ILLA 2BXYA 1A22B 4NNYB 4WU5A 5TH2A 1MJ7L 3SBWC 1QLRB 4NQXA 3LRHA 1BOGB 1NMBL 1SJHA 4NT6B 5KSAA 5MEQA 5I1HL 2BVUA 2EDBA 4FQIH 2FATL 4OCYH 1XF4B 4UINH 5I18L 3MV9B 3OKKB 3SDXE 4FTVD 1L7IL 3M1BB 3IDJA 5C3TA 3WO4C 4DGVL 4O9HL 2XXMB 4PJ7B 3MRNB 3G08A 5GJTL 4PJXA 4AT6A 5IBUB 2F54E 1Z9SA 1FZMB 1FGNH 3FRUB 4M93C 1FNAA 3BW9B 3FZUD 4Q2ZA 4ZFOL 5EU6B 4JY6A 4TOYH 3FB5A 4LAQL 4XB7A 3VXNB 2F5AL 3ALPA 4RDQG 4WW2C 3V6ZB 3I02B 4LLMA 1BAFH 4FQ1H 4WWKA 4L3ED 3SGEH 5D7JA 1WEJH 5F8QC 4KKNA 3MLXL 5F7UA 4MNGE 4LSRL 3RUGA 1HXMA 4L4VE 1HWHB 2KKQA 5D1ZB 3VI3F 1VGEL 4OUOA 4ZFFA 1J1PL 4QRPE 1ONQB 4UT9L 3OZ9L 5I1LB 2HLAA 1NCTA 4QWWD 1DTUA 3MXWL 4MVBC 1ADQA 1NKOA 5KOMC 3LB6D 2RR3A 2WWMC 3MV8A 2WMPA 1YMME 4WV1A 4PJ9D 1CLOH 1PQZB 3MRCB 4F7PA 4JQIH 5BO1L 4EDWH 5B4MD 3TIDB 4F57L 4I2XE 3O6MH 3A67H 1KG0B 3V0VB 4PGBB 4JY4B 1QBML 1NFKA 4Y4FD 3C6SB 3W0WB 5CZXD 1QRNE 3QG7L 4G7YL 3RVVD 5J13C 1YYMH 5EO9B 2VISB 5EN2B 5HDQH 5FKPB 3MLZL 4E0RB 1E4XI 1U58A 1G9NH 1UACL 1TZHB 2C3VB 3VH8B 4Y16D 3U4EB 3AS3A 5TE6H 1MAMH 1FCGA 3ILPA 2FEEI 3K7UA 3T8XB 1RZKC 2FIRT 4KHXL 2P5WA 5C09E 2R8SL 3ZLQC 5JXAL 4OFYD 1DN2A 3LCYA 4P2RD 4GXVH 3MMEB 2BVEA 1FO0L 3NCJH 3ZKXB 8FABB 4XRCA 5I66A 1EHXA 2BSSA 4JZNB 3CMOL 3MRHB 4XVTH 5EPMB 4XMKL 4OZIF 3D39D 3QHTC 5FV1L 2JB6A 4ZXBC 3AMLA 3NACL 5IK3A 1YEEH 3S34H 4FNLH 5GHWL 3JWOL 5C0DA 5E1AA 1RIUH 4JPWH 3CFDA 5DK2B 2ZCKL 2CDFB 5E9DE 3ARFD 3TGXA 4IRSD 4NQSA 1XGUB 4XC3L 4CAGA 2IPUG 3GMOB 3O81A 1MI5A 1IAII 1ZAGA 4G8IA 2CKNA 3RA7H 3QIUC 1EEZB 2NZIA 4XNQB 1H15B 4Z18A 5JW4Q 1P4BH 4QOKA 4FQXC 3X3FH 4B41A 1HI6B 1TXKA 1PD6A 5ANME 1K5NA 3CK0H 3QEQD 1FHGA 5EO0B 2ADIA 1EHLL 2CK2A 2XRAH 1UA6L 1KEML 4M8QA 2X10A 3MRPA 3RDTA 4CADB 2HT4C 3VW3H 2IAMA 3QNZB 4ZSOE 4J4PD 2EZ0D 3BVNA 2GK0A 2JB5H 1U8NA 5DRWB 3RVXC 3SDDB 4FQJL 3DGCR 3EHBD 1JRHL 4J8RB 4HKXA 1ITCA 5FYJE 4E41E 4ONOA 4HWZB 1CI5A 1ZMYA 1AQDB 4ZUSA 5DRZB 4WY7L 4LRIC 2DMBA 5EBMB 5MENB 5DMYA 1NMCC 1T2QH 1JWMB 4XP4H 2R2BB 5F70A 1BGXH 1YPZB 5MEOA 4KAQL 4KI5D 5IB5B 2EO1A 3QWRD 4D0BB 5HGHA 2E9JA 2WLZA 2G5BB 3UTPD 4HWEL 3CFCH 4XNMB 4JR9H 3CFJA 4PIRF 2AJVH 1TQCB 2AQ3A 1S9WB 2GTZB 3U1SL 1CDIA 3S3JA 2AJ3A 4BUHA 5GS1B 3QQNA 1NEZB 4N0UE 4NO5A 2DQJH 5F88A 2QL1A 1EFXD 1I85A 1SYVA 4JCMA 3HNSH 4PJAA 1HYSC 4DW2H 5EOQL 4GKZB 1D5ZA 5LVEA 3GSQA 4M6AA 1PKOA 1CFTB 2OLDA 5JA9A 5CAYB 1FNGA 3UC0L 2ZSWB 2C1PB 1HOCA 4PGEB 1OWWA 4NN7B 1MNUL 4KUCD 4UDUA 4APQC 5KSVA 4X7SL 4X7TB 5C70A 5FYJU 1G7HA 4LLAA 1PKQE 1NMAL 3K74B 5DD5H 2APWA 2PW1A 5B21A 1CDYA 1UXSB 3F12B 4G9FA 1OQOA 1VEPA 3KPLB 1EERB 5DD3H 4F8QA 5F7DA 3D0VB 1KT2A 4JG1L 1J12A 2CLRB 2P44B 1T89A 1P1ZA 4TNWK 1OF2B 1R3KA 4UV7H 2Q86B 4YHPA 4L9LC 4OLXH 5FHBH 2JKXA 4X5LA 4QHUB 5T3ZH 4H20L 1MLCB 3HG1E 1S7UB 3QA3A 4NKQB 5D2NA 3CFBA 3PWLA 2N4IA 2ZJSH 3G9VA 4M6OL 4DKFL 5IKCB 4HS6B 4OD2B 4ODUB 3QQ4B 3RWGB 5IUSA 4IS6B 4AMKH 1JI1A 4BQ8A 1PG7L 2QQLL 1T20B 3WS3A 3LMJL 2R0LL 4M1CD 5EOCH 5FYKD 2F9BT 5INCA 1I75A 5HYQA 4LHUD 4Y5XC 3KPRB 5GZOC 1EH9A 2MNUA 3NA4A 4L8SB 5C9JA 1NMBH 4YEFA 2ZUYA 5GZND 5I1HH 2VLRE 3F7YB 4D8PB 3MCG1 3BIAX 3ZSSA 5DLMH 1KCVL 5HHOD 3A0OA 3QYCA 2APTA 4LIQE 3MJ9L 4UQ2A 5CKGA 1JWUB 3LKPB 3ZDZE 1WWWX 1H3XA 4JM2B 2IQ9H 3CDGA 3TEUA 2IBZY 3VFWA 2A6KA 3ZO0A 3B9EA 2J8HA 3PWUA 3SQOH 2F5AH 2JJTC 1I8IA 2XOTA 3OF6D 4RAVA 4KH2A 2DMCA 4UIKH 4FMFA 2EDYA 2BDNL 3ZTJH 2X4RB 5KBNC 2UZIH 2QADB 1CFQA 3W9EA 4Z6AT 2I9TB 1XZ0B 4K7PX 2H3NA 4YHML 4HCRH 1CGTA 1LK3L 4PJ9A 1J1PH 1MSPA 1HDMA 1IBGH 2E9WA 5I1EH 1CVSC 4DAGL 4PUBH 4HIJB 2UYLA 4L4TA 3O9WC 4QTHB 4XXCC 4RAHA 4Y4FA 3QDGE 5DJ2B 3VMPA 1CLCA 4WUUE 1AXSA 4IRJB 1U9KA 4FN0A 4LVEA 5CWSA 1NBZB 2VZ1A 2VXVL 4YPGA 3BEVB 1UCBL 3UEZA 5LGJB 3PGCB 5E2JA 3OAZK 3NFNA 5BV7L 1KJ3L 4Y16A 5JMRA 2VKWA 2ARWA 2EIDA 4U1IA 4HULB 1CU4H 3QG7H 1GAFL 2D31A 1T5XA 2J8UF 3HR5B 1SY6A 4RRPA 2X9XA 3JVGA 5GGVH 5A40E 5EU6D 1F3DJ 1UACH 1ZHLA 3CFEA 4JFDA 5DJDB 5FFLA 5I1DB 4DN3L 3NZ8A 5IIEA 5TDOA 4OF7A 4Y8AA 1LGVA 3MBED 1UG9A 5KSBB 4OCSL 5CEYB 3MTRA 4WDIB 2QQNL 3NAAH 5KVMC 1FO0H 3MGTA 3LHPH 4R96A 2V17H 2GJZA 1RUQH 4WFHD 1RIHL 3ARFA 3UBXA 1HHKA 4DGYL 2BHUA 3OPZH 1H0DB 1EEUA 2VXTL 3HI6L 3VXPB 3JWOH 1QVOA 2WNGA 5ALCL 1A5FL 3HTLX 1QA9A 5FUCC 4I8DA 2YA1A 3L3DB 3NVQA 4L3CB 4DKAA 1XH3B 3QUYD 1WCBA 3BWAA 1UJ3B 3HFMH 1JPGA 1X7QA 3KLHC 1FZKA 1XAUA 3HAEG 4KRNA 3OQ3B 3IYLW 3UBXI 3LSOB 4NQUA 5AAWA 4NHUB 3QUZD 3OGCA 2R0KH 4HBQA 3T0WA 2FX7H 1XR9A 3BZ4B 2Q20A 1LVEA 5C92A 4KHTL 5ITFA 4NJ9L 3QEUB 1K9TA 5F21B 3BPNB 2C3GA 5ALBL 1MWAB 4PB0L 4Y5VA 1IGCL 5CBAB 4RIRA 5IV2A 1NCCL 4FQJH 3FO2A 5ADPL 2NMSA 3TZVA 1DBBL 3HZYA 3K80A 2VXUL 4OZGA 4KVCL 3ARGD 1QP1A 1I1AB 3JSSA 4CN1A 4RX4D 5GGRB 1AXTL 3VI3E 2ITCB 3WLBB 4RGNB 4KAQH 2NY0B 1AO7A 3OXRA 5EUOA 1EFXA 1U2CA 4M02A 1R3HB 1U8MB 1JYVA 1BQSA 4QYOB 3OG6B 3D0LA 1YA5A 2LVEA 1NGYA 3D48R 4OF0A 4MWFB 1ES0A 1W72L 3IDMA 3QULA 3TCLB 2M26A 3UTTA 3BPOB 5EOQH 1A3LH 3B9VA 4LKXB 3PIQB 2GKIA 2ERJB 3VXMD 5I73B 3OKMA 4XC1H 2DQFA 2E8ZA 5KOVC 4YAQA 4OGXL 3UTSA 3UC0H 4U1NA 1NGZB 1RK0B 1LP9F 3THMH 4KRMB 5C2BL 2M2DA 5F89B 3UJTL 1UWEL 3QFDA 3LRSB 4ZO8A 3WIFB 2V5YA 3MXVL 4OLUL 3QH3A 2FWOA 4UQ3A 4H8WH 5T1DL 2QSVA 1NMAH 2AS5M 4QRSB 1LE5B 3ARBC 3BIKB 2EKJA 2B1AH 4XBGB 3SKMA 1I8MA 2J2ZA 2FJHB 4NKMA 3R0MA 1GGTA 1XF3B 3V5DA 2XNAB 4OZIE 4PG9B 2HLFD 4H20H 4UNTA 4ETYA 4KDTC 3V6OE 1QQDB 4M6OH 4U1MA 5CD5D 3U30B 3EBAA 2W92A 3C5ZB 4BSWB 1LEGA 3P4OA 1N2RA 1CFSB 4N9GB 1FSKB 4N5EC 5H8DA 2QQLH 3WNMA 3ULSB 1U8QA 2DRUA 3IETA 3TYGL 4C4KO 1MFEL 4FQQA 3OKYA 4Z7VA 5C0AB 3KDMA 5CGMA 2OTUA 1ZGLB 5BJTA 2DKUA 5C0IA 3ISWA 5F1KC 2EYRA 3WCYA 4GMTL 4WI9A 5IHBA 2HJFA 3EYOB 1KCVH 4C56B 3BDYL 1CLZL 1HH6B 4ONFH 4HUVB 3JWOC 3QPXL 4WW1B 1I7UA 5CILL 4RAUB 1L7TL 1IGFL 4Y5YC 5GGSY 1SJEB 1QFWL 3LVEA 2ARJB 3I75A 3H8NA 2CH8A 5SX4H 3E6FA 2CO6B 1QBLL 2VDQH 2I07B 3ZL4L 3BUTA 4TPRL 4EBQL 2R2HA 1BZQK 4NNYA 4XZUB 3OB0K 3C87A 3C09C 3QQ9C 5IF0B 1EV2E 1MJUH 1MEXH 4YHMH 1QLRA 1NGQL 3BZDA 4XAWH 5C07E 1LK3H 2Q7NA 5EWIL 1BOGA 3UJIL 1HHJB 5IW3A 4NT6A 4KKLC 3QEGL 1XF4A 4Z7QF 4HF5L 3MV9A 3OKKA 3WD5L 1FNLA 4TVPH 3BJ91 5T1KB 4QNPE 3M1BA 2DOCA 2DQTL 4CN4A 3ESVF 4PJ7A 3MRNA 4URTB 1LO2L 1FZMA 3FRUA 3BW9A 4LSQL 3HLAB 5EU6A 5HHQB 2CMRL 5CEZD 1MPAL 5DRNB 3EJZD 3VXNA 1B0GB 1CN4A 3C8DA 1YC8A 4KK9D 3QPQD 4JPVH 3V6ZA 2OMNA 3DHMA 3I02A 2P45B 3B9KB 4JM2D 3SE9L 2VZUA 1DQJB 4JAMB 4XCNB 4JKPL 1A4JB 1TZGL 1I1YB 5D1ZA 2PYFB 1VHPA 4HC1L 4R7NB 3F8UB 1ONQA 1G7JB 4BZ2L 3KWWB 4I18B 5D71L 5F9WC 4DUWA 4B5EA 5I1LA 2H8PB 1XIWD 2QADD 3OR6B 1VFUA 4NM8H 5C0CB 3GJFH 4NC1E 1CDCA 2HRLA 1CGXA 1FJ1B 5ESVB 1TJIL 1PQZA 1RMFL 3MRCA 4CVWA 3QIWB 2WWKO 3TIDA 1MREH 2R39A 4X4ME 4D94A 3ZT7A 5JMOC 1KG0A 1N6QH 2VXTH 1YEIH 2R0WL 4JY4A 4PGBA 3V0VA 5T1LB 3C6SA 3MLSL 4RA3A 5D1XC 1GPOH 3W0WA 3NH7H 3D3VD 4K2UH 1ORSB 4PJCB 2B5IC 4W6WB 2VISA 5EO9A 5EN2A 3RY6A 1J8HB 4YXLL 1AH1A 1GGCL 5FKPA 2VDLL 4UOW0 4E0RA 1DVFC 3KPSE 3PL6B 1TZHA 2C3VA 5DHXB 3VH8A 2VLKB 4U7MA 1FG9C 3U4EA 3FKUS 2ZUQB 3T8XA 1IGJB 3HZMB 1PY9A 2R2EB 4LQFL 2VLJB 5FGBA 3CLEL 4TTDD 4X80L 3MMEA 4NJ9H 8FABA 4PJDF 5HHMD 4MB5A 4JZNA 1UKQA 3MRHA 1KPUB 5EPMA 2P4AB 4K3GA 2HT2C 2VDKL 2EDQA 4ONHB 4S10A 4PB0H 1E4KC 5I1KL 1M6OB 4JHWH 5I1AB 4IDLA 4IDJL 4PJ5B 2MHAB 1DBBH 2BY3A 3E0GA 3PP4L 4Y4KD 1MUJB 3VRJB 3P9MB 1JGEB 5K9QG 5DK2A 2CDFA 5DHVH 5ABDE 1XGYH 4G6JL 3O3UN 3UPRB 1XGUA 1YEDB 3ARVA 4WFGE 3GMOA 4G6ML 2HJKB 4OIIL 1EEZA 4WO4C 4XNQA 1H15A 1DQTA 4PPTA 4F9PA 1HI6A 3PGFL 4HS8L 4QXUH 4ZO7A 1ADQL 5AG8A 4OZ4B 3MQIA 2R15A 1IMHC 1LDSA 5EO0A 3MJ6A 3WFZA 4XNXH 4CADA 4KTEH 5FM8A 3QNZA 1MVFA 2PYEB 4NQVB 3VWKB 1G6RH 4OGXH 4XWOC 5GJSL 1F4YL 3QDJB 5GS0H 4JVPA 5DRWA 1NL0L 5H2BB 4ONGL 5SX5H 2J8UE 1AGBB 3SDDA 4J8RA 1P6FA 4HWZA 5C2BH 1AQDA 1JTPA 2VITB 5DRZA 4DKEL 2R29H 4Y0GA 2YA2A 5EBMA 4X9HA 5MENA 5D7LD 5MEPB 1F4WH 3X3GL 1JWMA 3IFOB 4JFOB 2IFFL 2WUBH 5D7KE 1B4JH 2R2BA 2WSKA 4GRLD 4UUJB 1YPZA 4PLJD 5INDB 3OAYK 5IB5A 3QIBC 3REVB 5FXCH 4D0BA 4K7PH 2G5BA 3O2VL 3IF1B 4L3AA 5F9AC 4EN3B 1TFHA 3LDBB 1I1AD 4KRPB 4XNMA 5BV7C 2WUCL 5FYLL 4YWGL 3F7QA 1S9WA 2GTZA 2H32H 4RGND 5GS1A 2NY0D 5BXFB 1NEZA 1T83A 2F54D 3BPLC 2FB4H 3TC9A 3LKQB 4GKZA 1CFTA 3ES6B 3FFCE 5FUCE 2XI9A 3VGAC 1IC7L 4M4RA 4EI5D 1H8OA 3HE7B 2ZSWA 5D93B 2C1PA 4OJFH 4U1LB 4G80B 4R4BB 4PGEA 3DV4B 5T3ZE 3VFNB 4LDLB 5DD6B 4X7TA 1L6XA 1G7PB 3QUXC 3RAJH 2YZ8A 5DGRA 1HHHB 1LK2B 3GHBL 4J3UA 4L4VD 1WFNA 1UXSA 3F12A 4QGYA 1KXTB 2CXKA 3KPLA 4LCYB 1I9JL 5C0BE 3D0VA 5D8JH 1YNTB 2CLRA 2J6EH 3V52L 2KZWA 3ZT6A 1CQYA 1OF2A 2Q86A 4LFHD 2FSEB 3IKKA 4NN5C 4QHUA 1MLCA 2BX5A 4JZJB 1S7UA 1L7TH 3W5MA 1CTOA 3MJ7B 3V4UH 5IKCA 1QFWH 3TIEA 4HS6A 4OD2A 5L2JB 1YZZA 4ODUA 3QQ4A 3RWGA 5K9JL 4PJ8C 1HSBB 2V5MA 4IS6A 5EA0L 3VXOB 3ECBB 1HKLL 3LEVL 1T20A 4R90H 1UWXK 4YH6A 3VFOB 4EBQH 2OYPA 3MRLB 4PRPB 3ZHKA 5FUOL 3KPRA 1X4YA 4P59H 3C5ZD 2K3TA 3MJGX 4L8SA 2O5XH 2YKLH 3UJIH 4DZ8B 5DJYB 1PJ9A 4YBHA 4OGZA 3GM8A 3LKNB 5GGTA 3MOBL 4HF5H 3WD5H 2DQGL 2DM3A 3BT2L 4X7EC 3F7YA 4D8PA 3SDCD 3GMQB 4KMLB 4LCWE 5C09D 4YBLB 1FIEA 1H8NA 4ZG1A 5C0AD 2MTPA 1JWUA 1GGIL 3LKPA 1NC4B 1JZ6A 1NJ9B 3QP3A 1MPAH 4M1GL 1FL3B 4I3GA 4J7RA 2N7AA 3W2DL 3EZ8A 5JZ7D 1LP9E 1WK0A 2RB8A 1MCBA 4GRMB 1Z3GL 1UH2A 2IFGA 2X4RA 2Y5EA 3SGDH 4NNPL 4P2OC 2I9TA 1CLYH 1XZ0A 2BNRB 2W9DL 5E9DD 4NM4H 4JPKL 4HC1H 3VXUE 4AYFA 4HIJA 2VERN 3QUMB 5SV3A 1BQHG 2HH0L 4HD9A 4ZS7L 3TH2T 5J57B 4QTHA 2V2XB 4H25B 2IBBA 1F2QA 5DJ2A 4IRJA 1LO4L 1KSRA 1TJIH 1NBZA 3JV6B 2CXGA 1IM3B 3TA3C 4P4KD 4OZHB 3BEVA 5LGJA 2DWDB 3PGCA 3U0WH 4JFXB 2DQIH 3SDYL 2R0WH 3MLSH 4LNVA 1C8PA 1QFHA 2XTJC 4GBXC 3TBWB 1RZ7L 3DLQR 3HR5A 5FYJD 5DUBB 1DDHB 2VDLH 2OK0H 4RMQA 2IJ0C 3FB8B 5DJDA 5I1DA 4XHJD 4YXKL 4GG6F 2ZNXA 4HK3J 1DQMH 3B9KD 3N9GL 4Q0XH 1JZ8A 5KSBA 3SGJC 4WNQA 4YPJA 4WDIA 4HPOL 2LFGA 4OLZH 3U83A 4X80H 2E6PA 4FFVC 1PYWB 3T4YB 1FFPB 4M6NH 4GS7C 3BAEL 5E2WH 5F6HI 5E99L 3E2HB 4M43L 3P77B 3PQYD 3MRDB 4JRXE 1H0DA 1KGCE 5GRUL 5C0CD 4IDJH 5FUZL 5E0QA 3C08L 4J3XA 3VXPA 5F96L 3PP4H 3TJHD 1B4RA 4JFFE 1JVKA 3DETC 3BN9D 1CE1L 4S1SL 5DC0A 3L3DA 3ILQC 4L3CA 1LDPL 1XH3A 4OZFG 1BWWA 4G6MH 1LEKB 4Z7QE 1DANU 3LD8B 4OIIH 5HHVL 5EZIL 3LSOA 1CFBA 3HNVH 2HP4A 4NHUA 2AJXL 2BSED 1E4XH 3JZ7A 1IVLA 1JGDB 2W0PA 3BZ4A 4DJMA 2FD6H 3QEUA 4G6AC 4NQEB 2D7TH 3HG1D 4JCLA 2HAZA 1C5CL 1F13A 4PJGE 1MWAA 1WZ1H 1F4YH 3CSBA 4G8GB 1KF9B 4X98B 5CBAA 5FOBB 1NL0H 4ONGH 3UDWC 2Z35A 1BMGA 5I76B 4DKEH 4LRNL 1I1AA 4ELKB 1M7XA 5GGRA 2ITCA 5J1TC 3WLBA 2AJYL 1VFMA 3FL7A 3WN5B 1NUNB 1R3HA 2BXZA 3ULUL 1U8MA 4ODWB 1UZ6E 4QYOA 2QJDA 1A6PA 5FYLH 3BMVA 4I5BB 4Z7WE 1B2WH 4I0PC 3NGBB 2KQNA 4MWFA 1RZ8B 2WP3O 1IAIH 2BVQB 3TCLA 5CMAB 4JFYB 3ULVL 2HTLC 3FAWA 1KPRB 4LKXA 3PIQA 5EBWB 1E6OL 4R0LC 3SPVB 5IJKA 4OLWL 4AENB 1SJXA 1IC7H 3VWJB 3K46A 1NGZA 1RK0A 5L0QC 2FO4B 1WIUA 5F89A 1JYXA 3LRSA 3WIFA 3LV3B 4XMLH 5D7IB 3EDEA 4DN4L 1VKXB 5A16B 3FHAA 3SOBH 4LAJH 4QRSA 1LE5A 4TNVK 3QEHB 3BIKA 1I9JH 1IM9D 5F44A 3WFHB 1J1XL 1A6AB 4JKMA 2JCCF 4XBGA 5B8CB 5JW3H 4LOUD 3V52H 2FJHA 3NCYP 3REWB 2QSQA 1XF3A 4PJDE 3VRIB 3DHJA 4Q9RL 3RX8A 1K85A 1G0XA 1H3TA 2H1PH 2XNAA 2HFFB 2AK1L 4PG9A 3JWNC 3EOTL 2A6JB 3WKML 3MLTB 3QSKB 5SWSE 5DJXB 4ZO6A 2NY2D 4WUUD 3RWCB 1IQDB 2AXHA 1QQDA 4NKIH 1NCWL 4OSUL 2GIYA 3C5ZA 4BSWA 4L8CB 3K0WA 4OKVB 5KSAC 1CFSA 1HQRB 4N9GA 4C58B 1HKLH 4QKXB 1WZKA 2OQJB 3LEVH 4JFZH 4XVJL 1HIMH 1RU9L 3ULSA 4POYA 3S9DB 4PJXF 4OF8A 4OAWB 1F6AB 4HPYL 5JHLL 1TVBB 3ARDB 3BZEB 4GH7B 3JBG7 5C0AA 2PTUA 4HBCH 1KN4H 5JIIA 1ZGLA 1BREA 4BSJA 3MOBH 4H1LG 4IRZL 3SDAD 3KPTA 1SEBB 3BH8B 3EYOA 4N0YH 4C56A 3MZGB 1HH6A 4JO4L 4HUVA 4EQ2A 5D7JC 3BJLA 3O6LL 1FRGL 4RAUA 1GGIH 5HTSA 3P0YL 3RUGF 4C83B 2AAVA 2QSCH 3U9PL 1IKNA 4R9HA 5HGAB 1RUAL 1SJEA 1YY9C 2ZWLT 2ARJA 3FO0H 3UTQB 1K3IA 2YWZA 1FFQA 1TCRB 5E4IA 1Z3GH 4MA8L 5JHDE 4L4JA 2YD5A 3V5KB 2I07A 1A3RH 1MFCH 2QSTA 4XZUA 5JW4R 3OAZH 4NCC2 5IF0A 3EIFA 2W9DH 4WV1C 2VTFA 2VAAB 4HZLB 4CN6A 4MA3B 1HHJA 4YHZL 5HYJD 3RNKB 1INDH 5C9KA 3VA6A 4E9LA 3BH9B 3B4NA 2IMNA 3DARA 4Z0BH 4XBEL 5T1KA 4LCIL 5K59F 3UJJL 1RIVL 2D7OA 1S7VB 4DWHA 1HINL 3KS0J 1Q1JH 1KBGL 3HLAA 3KXFB 4XPHL 3L3HB 5HHQA 1Z9MA 5DRNA 2W9LA 4WVRA 3SDYH 5I1IL 1B0GA 4NPYB 4QHLB 4XP9H 3D85D 3FN0L 3B9KA 4K7FB 1AE6L 1TVDA 5D9SB 3EZJB 4P9ML 3T0EB 5JW5B 4TUKH 1NC4D 1KXVC 4LLWB 4ZAKC 1DQJA 4JAMA 4XCNA 2ESVB 1A4JA 2OJZH 1DBKH 1RSFA 5DZOA 1I1YA 1F8TL 2PYFA 3WFBL 4R7NA 1UM4H 1EHAA 1O0VA 1X5XA 1G7JA 3KWWA 3MZTA 4I18A 4ZQKB 4TNWF 2H8PA 1J8KA 1INQB 3D87B 4MVBD 2YUWA 3OR6A 2WWMD 4HPOH 5C0CA 4G7VL 2F8OA 2DQEL 2IGFH 5E8PB 1FJ1A 3GSNB 5ESVA 3BAEH 1FYTD 2NZ9C 3QIWA 4NJAL 3RHWK 4BQCA 5D6DA 1VESA 5E99H 1KXQE 3Q1SL 4PRIA 2PNDA 1IEAB 5I1JH 4OCNC 3O2WH 5FUZH 5T1LA 1X5GA 2ICCA 5AEAA 1MFBH 5I71B 4XBPB 4XXDB 2I27N 1BFSA 3IDIB 3PV6B 4GMSH 1URLA 5I19L 2NY1C 1ORSA 4PJCA 3CX5K 3NPSC 1CE1H 1J8HA 5E08H 2BNUB 3RWIB 3ZHDA 4ODHL 1LO0L 3PL6A 4O5LL 4XAKE 1Q0XL 2GT9B 3PDGA 4XB8A 2VLKA 4UTAH 4JM4H 4U1HB 4YR6B 1MHPL 4KROB 3E8UH 2IAMC 1B0RB 1IGJA 3HZMA 12E8H 5HHVH 2R2EA 1TJGL 5EZIH 2VLJA 4JJ5B 3ZDYF 4HLZH 3MOAL 2O61B 4MZ3A 4XTRC 1RFDH 2M1KA 4Y7MA 4RSVA 4JFED 1ZEAL 1KPUA 1XR8B 1JNLL 3OSKA 4XP6L 4ZXBD 3TO4B 2NPLX 3VGFA 4X6CE 4ONHA 3P3YA 4OD3L 5AAMA 4I4WB 4YDJB 1M6OA 3VFVB 4ZFOB 5I1AA 4PJ5A 5BS0B 2MHAA 3JWDH 1MUJA 2NY6C 5T5NF 3P9MA 1JGEA 1SY6H 4LRNH 3VRJA 4WHTB 3ZTNL 5F9DC 4U1SB 1IGMH 4WRLA 1CDJA 2G60L 2PF6A 5C1MB 2Q8AH 3UPRA 3L95B 1YEDA 2F53E 1X5AA 1T7WA 3QIUD 3HNTL 2Y9RT 3PWNB 3MYZA 2HJKA 2EDTA 4FQXD 3OXSB 4NYLB 3BESR 5FKAB 3SCMB 5BZDB 4NQCB 4LPVA 4K94C 1F4XL 4OZ4A 1QPXA 2HT4D 2VDNL 1OP5K 4AL8H 4HUMB 2EO9A 1JZ5A 4P46B 5DFWH 2ED7A 3RVXD 2PYEA 4NQVA 2X5PA 4YDLC 3VWKA 4AQOA 1RZFL 3QDJA 1HK6A 5H2BA 2CPCA 4JANA 2VZTA 1AGBA 2OL3H 3S5LG 5BVPL 4NIKB 5CGYC 2VITA 2EYSB 1KTRL 1J11A 1T89C 4NQED 1XGTB 2NTFB 5MEPA 1MCOH 4JFOA 3IFOA 4R2GB 4X6DF 2UWEB 4HIIB 4PLKC 4GG6E 4UUJA 4DN4H 2MSPA 5INDA 4A2MA 3REVA 3MLVH 1OTUC 3IF1A 4EN3A 3T0BA 3MUGB 1I8LA 5HJ3B 1KNOB 1GC1L 4PRNB 5F7EL 1BJ1H 3O0RL 3HPJB 3SKNB 5ITBH 5BXFA 1HYSD 4OF3A 3CC5B 2B20A 5J6GB 3N1FC 1I7RB 1NCWH 3LKQA 4OSUH 1D5IH 2ZG3A 4YHOL 2D7MA 1D6VL 3ES6A 1U2HA 4YHLH 4LHQB 3RWFB 3HE7A 1RU9H 4U1LA 4G80A 2E6JA 4R4BA 5IT2L 4A6YH 4PJBF 4HXAL 4APQD 2GSIB 3DV4A 1A7PH 3VFNA 3K2UL 5DD6A 2UY7A 1AFVL 1QD0A 5JHLH 1G7PA 1HHHA 1LK2A 4X0KB 3R8BB 4IRZH 4LCYA 2DKMA 4NDMB 2FGWL 3ZT5A 1YNTA 3OB0H 4XWGL 5C0RL 1RULL 4LL9A 4JO4H 4OM1L 2FSEA 1OPGH 5FF6B 3O6LH 1CZ8H 3QDME 3P0YH 4JZJA 1KIQB 4IIQB 4JB9L 5I75B 3MJ7A 1Q9KB 3N85L 5L2JA 5DT1L 5ADOL 5C0JB 1HSBA 3R0NA 2CIKB 1JGUL 1TTFA 3VXOA 3ECBA 2AP2A 4MXWL 1NLDL 1J5OL 1FH5H 5GZOD 1AR1C 5DR5L 1A0QL 1T21B 4PRPA 5IMKB 2ID5A 3M45A 2GJJA 4G8EB 2BJMH 3HHRB 4P3WA 3TYFB 1CGWA 3KPSD 4DZ8A 5DJYA 4YHZH 4NN6B 4M5YL 5IB1B 1T0MA 4QRRE 1PGRB 2FJFB 4V1DE 4FXLA 3S96B 3LKNA 1ACYL 4ENEC 1V3KA 5L88L 3O4LE 4Y16C 1RJCA 4UB0L 3UJJH 1JF5A 1QYGH 4J3VA 3GMQA 1RIVH 2X4NB 2VDOH 3MUHL 2CR6A 3GK8L 1HINH 3O8XB 4R8WH 2QHLA 4WEUD 5FYKH 3P11L 3JVGC 3WIIH 3L3IB 2FBJL 1NC4A 4NGHH 2X89A 1NJ9A 1XCTB 3VXRE 3S35X 3M07A 1FL3A 2VR9A 1N3NB 2DMKA 5DRXB 4FQLH 5IFHL 1EEYB 4GRMA 3ULUC 1TNNA 4WWID 3BKCL 4PJHB 3MBXH 1AE6H 2AJUL 3VXSE 4MNGB 4P9MH 1S9KC 1U8KB 5IQ7L 1NBYB 4ZFZB 1M05B 5BRZB 4OGYH 2BNRA 4XPAH 2UUDK 3QFJE 1TENA 1F8TH 3PJSB 3WFBH 5E8EB 3CUPB 2XN9B 1JV5B 4RQQB 3ULVC 1NAKL 1WT5A 1Q8MA 2JCCE 3O9WD 1VSCA 4ACPA 2ITDB 3QUMA 1XMWA 3S3PA 1ZT1B 3DI2B 1BM3H 4W4OC 1YMMB 2V2XA 4H25A 3SN6N 4G7VH 2PCPB 1LO5B 5A1AA 5ISZD 5EZOL 4QTIH 5GRYA 3DUUB 4GO6B 3JV6A 1IM3A 4NJAH 2R69L 5EBLB 4OZHA 2ZCHH 3Q1SH 2AGJH 2DWDA 3UTZB 4JFXA 2ZOLB 1FNSH 2A6IB 1QRNB 4P5TB 1HNGA 2IPUK 4KY1L 4Z95L 4M62L 4QRTB 1AQKL 4P4RB 1NPUA 3LOWA 4PJXE 3TBWA 2BRRL 1YEKL 5DUBA 1I9EA 1UZ8B 1DDHA 5DO2C 3FTGB 2ICWB 3BN3B 4ODHH 3B6SB 3D5OF 4X6BB 3RGVB 3VG0L 3FB8A 2J1KA 2GFBB 1MCHA 3AREB 4O2EB 4U6XB 5JTWA 3G6JB 1EHNA 1T5WB 5FO7B 5M7QA 4DCQB 2PTVA 4KI5F 5GGTL 4XP1H 3SHSA 4HJJL 4LHJB 4KI5C 2KH2B 3MOAH 4ZNEA 1GGYA 3FT2B 3TZVC 5K33A 1PYWA 1I4FB 4JKLA 3RUGE 2YD9A 3V95A 1FFPA 3JTSB 1JNLH 3VE0B 5EUOF 2EDDA 3P77A 5I0DA 1NH6A 3MRDA 3QB7C 6FABL 1N0XL 1TZIB 4WO4B 2A73B 2EIZB 3FFCD 2X4QB 4U6VL 2IQAB 4UOJA 3DMMB 2GCYB 2VDRL 1SBBA 4YLQT 3W82A 4EIZC 3UZEA 3KLHD 5KVDL 4KUCF 5DURD 1LEKA 4AEIL 1CE6B 5ANMB 2FGZA 1ZTXH 3C6LC 2NXZC 3PP3H 5K59E 1UYWL 4S0TD 2OR9H 2CJUL 3I6KB 4KQ3L 5C0BD 1JGDA 1P53A 2FX9L 4HUUB 4K07A 4BZ1L 3HC3H 4LRIA 5KVEL 4ZSOB 3OAYH 4JKKA 4NQEA 4N68A 2DLFL 4R97C 4E41B 4G5ZH 1QSFB 5F6IC 1RZFH 2BHYA 4X98A 4G8GA 1QKZL 5FOBA 2P5WE 5T3XL 5FYLE 1HN1A 3MYJB 2VQ1B 1A21A 4OD1H 5I76A 5ERWB 2YPLE 5FGCE 4ELKA 5L6YH 3GO1L 2ADFL 3AVEA 3PE9A 4RRPG 3HC4L 1T66C 1QBAA 2NLJB 4NFBA 4QHKJ 2Y5TB 3WN5A 3WXVH 1YEGH 3T77B 4ODWA 4OT1L 3HB3C 2QEJA 4N0UB 4I5BA 5DK0B 3VGAB 4KGLA 3N06B 1U91B 4PRBB 1RZ8A 2BVQA 4DOHE 4LPXA 5CMAA 4JFYA 3ZE0F 5EU5B 5BCAA 4KKBC 1KPRA 4Z7VF 1YEFL 5EBWA 2VXQL 5ILTL 4N0FB 1EAPB 1D6VH 1AIFB 4UI2A 4NQCD 3U9UB 4AENA 1NCAL 4KMTL 3VWJA 5FCSH 1DJSA 1F2XK 4HXAH 2FO4A 4Z7UB 3QHZL 2R4SH 1PKQB 1FAIL 4LSPL 3LV3A 4DFHA 5D7IA 1ZS8B 3ARBD 4OZFB 1VKXA 2XIDA 5A16A 4MS8C 2A9NL 3QEHA 5I9QC 5I6XB 3WFHA 4NRXB 3V9FA 1A6AA 5B8CA 2P48B 4XWGH 5C0RH 5E00B 3VRIA 3LQMA 2V9TA 3BGFC 2HFFA 5HGBB 3IFLH 2A6JA 1TPXC 3MLTA 5DJXA 2CKBH 3RWCA 1IQDA 1MRFH 5A2LH 1CD8A 3N1GC 1OGAB 3CPLB 4N5ED 3X11B 4L8CA 1Q9WB 1QHPA 1QTYT 4OKVA 1E27B 1HQRA 2DQDH 2WQ8A 1MCKA 5E6IB 2OQJA 4JO3L 2XG4A 2Y06H 1UH4A 5KANG 4MJID 5AZEL 3IDXL 4L5FL 4OAWA 2Y4SA 2VLRB 1TVBA 3ARDA 3BZEA 2Y36L 5BMFL 2GJ6B 3F7PC 5L2KB 5L88H 1HXYB 3H3BC 4HXBH 3ZE1F 4CJ0A 1SEBA 1ZVHA 3BH8A 4UBDC 5KVGL 1A9BB 2NQCA 3RBSA 3BISA 4WHCA 4N0RA 5DK3A 2MCPL 1G1YA 3DIFB 1VPOL 5DD1H 2FBJH 4OLYH 1T1ZB 1IC4L 4C83A 3EYVB 4G9FE 3OBAA 3S8WA 5HGAA 4D3CL 1NSNL 2V5SA 5D1ZC 4JRYE 5E6YA 3UTQA 4WJ5B 2O5YH 3TBSB 1TCRA 2J4WH 3IDNB 1KGCD 3GBMH 3V5KA 4IOSD 3P4MB 2ZSVB 4X6DE 3VGBA 5IQ7H 3QQ9D 5GSRB 1IGIH 3BEWB 4ORGB 2VZ3A 4X7DC 3UTOA 4XPGL 5D2NE 2DAVA 4M1DH 1F6LL 1VDGA 3EOBB 5H37H 4CMHB 4XX1E 3KPQB 3TT1H 2VAAA 4HZLA 1CBVL 4KKLD 4MA3A 2DLEA 3RNKA 4K9EL 2BY0A 3QDGB 1ZVYA 3BH9A 4O2FB 2B39A 3PWJB 4UU9B 2KPNA 2XTJB 3U4BL 1OP9A 1S7VA 5DUPL 5C0NC 1EMTL 1HZHH 1X3DA 3RY6C 3VRLF 1PEZA 5E2UH 1DUZB 4GLRI 3KXFA 1W0YT 3L3HA 1T03H 4PRHD 5GRJL 2Z91B 1ZSDB 3QCVH 4NQDB 4XPBH 4KY1H 4NPYA 2DQHH 1VENA 4PJBE 1RPQA 4LP4A 5FGBC 1YJDL 4K7FA 5JUEH 43CAB 5D9SA 1ZLWK 1WFOA 2HVKB 5JW5A 3T0EA 1GC1C 2YXFA 4LLWA 4OLEA 1YYLL 3CVHB 3WFDL 2ESVA 3ZKXC 4R26L 4HLJA 4ZQKA 5GGTH 5CEZH 4H1LB 1INQA 4HJJH 5CFHA 5HPMB 4LU5L 1YNKL 1VFAB 2X1PA 4BQBA 4BELD 1M1SA 1OCWH 2XN9D 5E8PA 3GSNA 4AG4L 4ZOAA 8CGTA 4YUEL 3RBGA 1I1CA 1I9RH 5D1XD 2V9QA 4NZJA 1IEAA 4Y88A 5LGHL 3J8F7 1P84J 4XBPA 4XXDA 4ZPVB 5EIIB 3IDIA 3BP6B 3PV6A 1EBAA 3TNNA 2GI7A 1DVFD 4PLNC 5KAQG 3KR3L 2FHFA 2BNUA 3RWIA 5KS9F 2GT9A 4S1QL 25C8L 1L9MA 3CZFB 3WS6A 4U1HA 4YR6A 3U46B 1B0RA 1FPTL 3ARZA 4C59B 1NC2D 3MO1B 4JHBA 4JJ5A 1UYWH 4XI5C 5J56B 2A83B 2APFA 3RJQB 2BCKB 2O61A 3D6GA 3SDDC 2FX9H 3VXTB 4BZ1H 4FABL 5KVEH 2AQ2A 4P2RE 4JFDE 2HT2D 1MIMH 1HWGB 1UM6L 1AGCB 1XR8A 1YPZF 4WTZG 5CZVH 5EIQA 2DLFH 3TO4A 5SWSD 3ZYZA 4TQEH 4Y8DC 3ZKNC 2KZ1B 4JHAH 4I4WA 1OP3K 4YDJA 3BGAA 3VFVA 4ZFOA 2ORBL 4P5MB 5BS0A 1GHFL 4UIMB 5EO1B 1QFUH 1RQ5A 2E7BA 4WHTA 4P3DB 1FVCB 2HFGH 4U1SA 4RGMC 4NNXB 1TQCC 4LASL 4HMEA 3ULVE 1F6FB 4XMPL 2ADFH 5GS1C 3HC4H 3L95A 4NZRH 4WO4D 1ZXQA 3PWNA 1T83C 1WWBX 4R0LB 4OT1H 5DVNA 2DKSA 3OXSA 4NYLA 5DJZB 5FKAA 3SCMA 4GAJL 5BZDA 4NQCA 2I5YL 1CGSH 2AERT 3HMXH 4KK6C 3CMGA 4GRWH 5GIRB 2V7NB 5DEZA 4FZEL 2EH7H 4NN7C 5J0BA 3TVMB 3SKUD 2ATKB 3NTCL 2HKFL 4XWOD 4P46A 4LP5A 4LNRB 1RUMH 4KKAC 2VZSA 1D9KB 3IB4A 4P5KB 4M7KL 3S35H 4XVUC 4Y2OA 4F2MB 5LAXB 5IHZB 2OTPA 2XA8L 2NY5H 2EYSA 5KZCB 3QHZH 1RK1B 3U7YL 3I6LD 1DFBH 1FAIH 1XGTA 2NTFA 2YHGA 3H9SD 4DVRL 2RCSL 2X4TB 3JTTB 5IOPB 2UWEA 4HIIA 2FX8L 3QIBD 2CRMA 4KDTA 4KI5E 2IBZX 2A9NH 5IB3B 1CYGA 3O2DA 1CICB 3UTPE 4OZGE 1QEWB 3MUGA 4OZIB 2EDHA 5HJ3A 1KNOA 4PRNA 1JHKL 3MRGB 4LSSL 1UQSB 4WI4A 3HPJA 3SKNA 3CC5A 1AO7E 3WNPA 5EUOE 4NZUL 5J6GA 1JI2A 1AP2B 2NY3B 1N5YH 4ZD3L 4YGVB 2HKHH 1I7RA 3SE8H 2HA1A 4NKDB 3GI9L 1MWAH 1I8KB 4L8SC 1WIOA 3RWFA 4JO3H 1WAAA 3T0VA 2GSIA 2HFEB 2JIXB 5IFAH 5DEGB 3IDXH 3QUXD 3ARQA 3S37X 3GRWH 4JM2F 3NIDF 3UTSE 4X0KA 5F1IB 5SWQB 1GCFA 1DSFL 3U79A 4IMLB 4NDMA 1QR1B 2XKNB 3RIFK 4U7KA 4JQVA 5KVGH 2J5LB 3FFDB 4EVNB 2HLAB 3BQUB 1W8NA 3IFNH 4S2SB 1S3KL 2MCPH 5FF6A 5H35B 3TBVB 3F5WB 3FQXB 5K9QI 3C5SB 2OMBA 1IC4H 1KIQA 4IIQA 4HIHB 1VFOA 3VFTB 5CCKL 4TUOB 4XCFL 4D3CH 1Q9KA 1K6QL 1AD0B 4PJ8D 2XZAH 1FL6B 5C0JA 1J88A 2OXHA 2CIKA 2JJUA 1VCAA 3S5LB 3RIAK 1B88A 3WNNA 3ARWA 4U31A 2JE8A 3FHQA 3LZFL 4I13B 3SE4C 4XPGH 3CSYB 5FYKE 5C07B 3L7FB 1T21A 4RMTA 5IMKA 4G8EA 4IRJC 1F00I 3TYFA 3PGDB 3TPKA 4CVZB 1IJ9A 1CBVH 2WBJB 3G9AB 1IQWL 5IB1A 4XAKD 3LKSB 3ZKSD 3B2VL 2FJFA 4LARH 3S96A 3KHOA 3V8OA 1QPPA 2LTQB 3ZYOA 3U4BH 4MNQD 1YNLL 2X4NA 3DVFA 1WLHA 5HHOE 5DQJB 1MCSA 1INEL 5DUPH 4ZAKB 3O8XA 4Z7VE 3NFPB 3L3GB 3QI9B 2GJ6D 3L3IA 1FBIL 4JQXA 4TULH 5B22A 1JRHI 5L2KD 1NEZG 1XCTA 3O6FB 1P7KB 2E9IA 1DQDL 3GSOB 5ACZB 1N3NA 1BIIB 5DRXA 3EYUH 3L5IA 1YN7B 1EEYA 4MB4A 4RA0C 2Z4QB 1IKFH 4PJHA 1BHGA 4P2OD 1Y6MR 4G6KH 4MNGA 2EC9T 1U8KA 3WFCL 3CH8A 5CJBA 1NBYA 4ZFZA 1M05A 4NWTL 5BRZA 4GRWF 1YYLH 3OAUL 3WFDH 3MLPA 2Y07L 4MHHG 4TNVF 3P0VL 3L7EB 4KI1A 5ETUB 3PJSA 5E8EA 3CUPA 1RVFL 1QLEH 2XN9A 1JV5A 4RQQA 2CUIA 1EFQA 4LEOB 1J10A 5F97E 2ITDA 1AC6A 1FE8L 1P9MC 4TSAH 4JG0L 1ZT1A 4LU5H 4HIXH 3OKNB 1NGPH 1YMMA 3HR6A 2PCPA 1LO5A 3TA3D 3DUUA 4JO2L 3ARTA 4YUEH 5EBLA 1A3QA 2BVPB 3T1WA 2IPKB 3UTZA 2ZOLA 2A6IA 1QRNA 4P5TA 3AAZB 3FQRB 2IAMB 4LVHB 2XTJD 5DC9B 4GBXD 5FEBA 2EDRA 4P4RA 4PJ7E 4PJEF 4QRTA 3ZYIA 2AABH 4TSCH 1UZ8A 2OI9B 1YEHH 3KR3H 3FTGA 2ICWA 5EU6E 5GS2H 4Q9QH 1NQBA 3B6SA 4X6BA 2NYYC 4NQDD 1KPVB 3RGVA 2B0SH 25C8H 3NA9H 3FO1B 2GFBA 4O2EA 3AREA 4U6XA 3G6JA 1A7NL 5ACMA 1T5WA 5FO7A 3ZE1E 4DCQA 3BPNC 1SYSB 4CBPA 3IAPA 4FFVD 2OSLB 35C8L 4PGDB 3KYAA 5I1CH 2VO5A 3FT2A 4FABH 3I3BA 2KBGA 5C6PB 1I4FA 5FYJH 1AHWB 3JTSA 5E5UB 3VE0A 4MX7B 4X4XB 2PXYB 4WFHE 5IJVB 5TF1L 1AC0A 3QNYB 1X5JA 2IG2L 1JK8B 1TZIA 1CR9L 4WO4A 2A73A 2EIZA 2XYCA 3DETD 1UWGL 4M7JH 3BE1H 1OP5H 2X4QA 2IQAA 4ZMAT 3GNML 5F7MC 3QUKB 3DMMA 2GCYA 5CJXA 5MI0C 3ILQD 1AGEB 1FG2B 3W11C 1X44A 4POZC 3G5YB 4PRDB 4UAOB 2NXYB 5LXGH 3WIHH 1BJ1J 3BPOC 5JLZB 2YXMA 1CE6A 5ANMA 3T0AA 3A6OA 2ERJC 3QUML 5I73C 2H6PB 1R3IL 3QRGL 5IJKC 4GAJH 1N6VA 1X5IA 3BDXA 3FOLB 3I6KA 3KPPB 1MCIA 4ODTH 4HUUA 4P23C 3VRLE 4G6AD 4ZSOA 4FZEH 5LCVL 3O11B 3MLUL 4KVNH 3NTCH 4YFEA 1RZJL 2J8UB 4E41A 1QSFA 2N7BA 3EO0B 3O3DB 3MYJA 4M7KH 2VQ1A 2IAND 4JVUA 1N26A 2HT3C 4K9EC 3NABL 2YD4A 4RFOH 5ERWA 3SEPA 3U7YH 4LDOB 3J7HA 3UAJC 5C6TL 2BNQD 3F58H 3X12B 3QRFM 3D2UD 2DBLL 4YE4L 2NLJA 2Y5TA 3T77A 3U30C 3VI4F 4I0PD 15C8L 1IGTB 2X1QA 1JHKH 4N0UA 4H88H 4V1DD 5DK0A 1U91A 1N4XL 1MAKA 4PRBA 1FSKC 1GIGL 1G84A 3NCFB 2DTMH 3WE6B 1OAQL 1YJDC 3GBLA 2HTLD 4NZUH 2EYTB 4PY8J 3UO1H 4OF6A 5EU5A 4AEHH 3FRPG 3PWPB 3VXME 4N0FA 1EAPA 1NBVL 1AIFA 5D70H 5DQ9B 3U9UA 5HXMA 1ULVA 5FCUL 5HDLA 3V8CA 3RPKA 1PSKH 1VGKB 3VFGH 1Z0MA 3DWTA 4I77L 3WLWC 1IC5H 4Z7UA 4YXHL 4LLDB 4ZFGH 1MJ8H 1PKQA 5KS9E 3VXSD 4R3SB 2EE2A 3BDBA 4MGXA 1I7ZB 4HMCA 4POUB 4ERSL 1ZS8A 4OZFA 3ZDXF 1QACA 2XFXB 1W0WB 3QFJD 3WNLA 3INUL 2NY7L 1IKNC 4NRXA 4U33A 3RVUC 5MENE 4GQ9L 3ZYJA 5KSUB 3DSNA 5E00A 1KTKE 1KC5L 4FP8L 1YPZE 3LPWA 4PR5B 5HGBA 4Z8FH 3VD9A 4PGCB 1JZ4A 5CCKH 3Q0HA 4NUJB 2C1OB 1OSZB 3U48A 4GKSB 1K6QH 1OGAA 4O02H 5KSAD 3CPLA 4X6EB 3X11A 5DJAB 5IHLB 1E27A 5E6IA 1BVLB 1RZIB 3C9NB 4I3SH 3DX6B 1QSZA 3UYRL 2NY3D 4YDIL 1I9IH 4DEPB 2AJSL 3PHQB 1T22B 5EOTB 3HUJB 4HGKC 2VLRA 3D9AL 4C54A 3D69B 1VFBB 4P9HL 3VD4A 5DD0H 1IQWH 3CLFH 2VR5A 3B2VH 2GJ6A 3CJJA 4XVSH 3B5GA 3I9GL 1NBQA 4M61B 5L2KA 2DJUA 1KENL 5EDXA 5MP6L 4LCWB 1HXYA 4M9OA 2JIXD 4KTYA 4Z7NE 3OL2A 5AWNL 1FFNB 1NAMB 4LSUH 4RMRA 1A9BA 5D7JD 2B1HL 1NCUA 2FYYB 5IGXL 3DIFA 1MFNA 1FBIH 1T1ZA 1BBJB 3EYVA 1YY9D 1KLGB 1LP9B 4DFIA 1QUNA 2XQYG 1ZHNB 5CHNB 5JXEA 5I1GL 5E2VL 5A43C 4WJ5A 5F9JA 3TBSA 1GZQB 4I18C 3L5WA 1WFTA 1R3JB 3IDNA 2APBA 4BK4A 3P4MA 2ZSVA 3WFCH 5GSRA 3BEWA 4ORGA 3MV8D 4XNUL 3OAUH 3L9RB 3FJTA 3EOBA 3P0VH 3ABZA 5ICZB 3BD3A 1RVFH 4KU1A 3KPQA 1EEQA 4DK3A 3QIWC 4KUZH 2EE9A 2VC2L 1MCPH 1A7OH 2P5EB 1FE8H 3QDGA 1RI8A 3TP4A 5FA4B 4O2FA 3L1OH 3PWJA 4UU9A 1TMCB 1YEJL 2EEBA 4PJCF 1WUNT 3VDCA 3V7AE 1DUZA 4XPFH 5TQ0H 1Q72H 4XGZB 2AV7B 3IS0X 3PL6C 4C4KT 2Z91A 2DD8H 1ZSDA 1SVZA 4NQDA 1MFAH 4WI7A 1FQ9C 2ZUQC 2EIBA 5EZLB 2D9QB 2W0KA 4PBVC 4NOBA 2P5WD 4ZAKD 3SGJA 1ZV5A 43CAA 1WBZB 2HVKA 3RWJB 1JGVL 5DMIL 1MCWW 3CVHA 4LGPB 3KNBB 3M8OH 4ZTOH 3QT2A 2G75B 3LEYL 1JHLL 3R4DA 4H1LA 1JPSL 5JQ6L 4RDQF 1YQVH 5GXBB 5HPMA 1I3RB 4AIZB 4D0CB 1VFAA 4WHYG 4MA7H 2J3SA 4TN9A 3RL2B 2NZ9D 3OKDB 3MCKB 3ZSTA 3S3SA 1C5BH 4JRXB 3GM0A 1P4IL 3C2AL 4AIOA 3IDMB 1MI5D 2H2SC 3LH2L 4LLYB 2IG2H 4JFFB 2XICA 4HH8A 2W0LA 2NY1D 1DBML 3C6LB 4QOKD 4ZPVA 5EIIA 3BP6A 3GNMH 1BJ8A 5IM7B 3D3VE 1KCRH 4LEXH 4G8FB 2LU3A 5IVOA 3G6AB 4YHKL 2IAMD 3QR2A 2RQ8A 3CZFA 4ZS6C 4LPYA 3MCLH 2DLIA 3S37H 3U46A 3QUMH 3MO1A 4N8PA 1R0AL 1YECL 1R3IH 2A83A 3VWKC 5DVLA 4XTRD 2BCKA 4Q74A 1KCSL 5FB8B 3VXTA 1OAKL 1RV6X 4JFPB 3MV11 1XGRB 3L3KB 1NLBL 5D5MF 5LCVH 4FFYL 5J1SC 1AGCA 3GBNL 2PO6B 1RZJH 3BKYL 2YPVH 3HI5L 4U1KB 3LY6A 3CFKB 1KACB 2D2OA 5KSBE 4ODVL 3RY4A 3Q5TA 3RL1B 2NY6D 4P5MA 2Q1EA 4UIMA 4I48B 4YDKH 4EN3C 5EO1A 3LDBC 4KRPC 1I8LC 4P3DA 1FVCA 2DJ4A 4NNXA 1K4CB 1GYAA 5ESAB 4YE4H 5IESL 4O51B 4N8CH 4LSTH 2V5RA 4OCRL 4MNHB 3WV0A 2GYSA 4R0LA 4MXQC 4X9FA 4NZTL 1A14H 2WWKT 3CFIC 5DJZA 3H42L 3HE6B 3WSQL 5F9OH 1ZT7B 2L7UA 3G5VB 3NIGF 1GIGH 4DGIL 4OCWL 3HE7C 1M4KA 1TTUA 5GIRA 2D03H 5D93C 5KTEH 2V7NA 3OKOB 3GSNL 4MJ6B 2QKIB 5DMKB 3TVMA 3MNWB 2ATKA 4YDVB 2AXFB 1CXHA 4LNRA 3H9HB 5T5FL 3TBTB 4EEEA 4PJEE 2QHRH 1D9KA 5CGYD 2DM2A 4P5KA 3MNVB 5CLWA 4HWBA 4F2MA 3JUYA 5LAXA 4F58L 5IHZA 2WV3A 1RK1A 4YXHH 4PLKD 1TETL 2X4TA 3JTTA 5IOPA 3KYKH 3UMTA 4P57B 5MHSE 4ZUVB 3H9YA 1OTUD 4JZJC 2QV2A 1OT2A 5IB3A 2YMXH 1CICA 3GGWB 3MA7B 1QEWA 1P5UA 1OAYL 4OZIA 1WVZA 4ALAH 3LS5H 3MRGA 5EU7C 1I7TB 1UQSA 1S78C 4FP8H 3V6OA 4RGNE 4UTBH 4M3JA 5EBGA 3V4PL 4U2ZA 5LJYH 4O2CB 1G6VK 5DWUH 2F19L 1AP2A 4YGVA 2I26N 4NKDA 3WDJA 1I8KA 5GPRA 1XEDA 3U7WL 4O58H 1EO8L 4DUVA 4WW2F 5I30L 3UYRH 2DB8A 2AJSH 2HFEA 2JIXA 5DEGA 5I8OH 3PWPD 5TGBB 2ZCLL 1KB5H 2YPKB 4YBLC 3FQUB 5DJ8B 5HPOA 1VEOA 5F1IA 5SWQA 2AJZB 2XKSA 2OR8A 1KENH 4IMLA 5AG9A 1QR1A 2XKNA 4QF1B 4C55A 3ME0A 2X4SB 3FFDA 4EVNA 3BQUA 1TLKA 3CD4A 2B1HH 4S2SA 3DURB 3GMMB 2VLME 2EXWC 3TBVA 1W2KT 3F5WA 5H35A 3FQXA 3I50L 2FRGP 3C5SA 4XCCL 4HIHA 3VFTA 3JUZA 4TUOA 5DJ0B 5FM5M 4YFDB 1AD0A 5I1GH 1E4WL 4L4TD 1FL6A 3LN5B 1WT5C 3S5LA 1OOAA 1KV3A 1PG7X 1FZJB 4OKDA 2I60L 1AR1D 3BP4B 4R4FL 4DTGL 4BM7A 4V2BA 3CSYA 1AGDB 5C07A 3SKJL 3L7FA 4M5ZL 1UVQB 4OI8A 3QXDB 3M17B 3U0PB 4EXKA 3PGDA 4CVZA 3FMGL 2WBJA 3KPNB 3ALXA 3TWCL 3VI4E 3HAEH 4ENED 3HI1B 3LKSA 4EOWH 1U3HB 3O2DL 3PXHA 3BMWA 1RZJC 1ZLWH 2VDPL 1WICA 4FFZL 1G0DA 1KYOK 5H94B 1EK3A 2YRZA 4Q6YA 4X4YB 1CG9B 5J11B 5DQJA 2Z31B 1J1OL 4ZAKA 4AM0B 3NFPA 3L3GA 3QI9A 5C0AE 3DNKA 5EULV 4JFDD 3O6FA 1P7KA 3H3PL 2VH5L 4Q9CA 2WW8A 3GJFB 4AY0A 1BFVL 3ULUD 1UKTA 3GSOA 4KQ4H 1BIIA 4U3XA 5ACZA 3SQBA 1YN7A 4C56E 4LVOB 2Z4QA 3PABB 3LIZH 4BQ9A 1L0QA 2CK0L 4FXGB 4JREB 5TE7L 4C57C 4FQ2L 3ZDXE 1HEZB 4FRWA 3GIVB 5CJQL 3ULVD 3L7EA 3DO7B 5E94B 5ETUA 5F7LB 4RBPH 2NX5B 3LEYH 1BECA 1JHLH 1F42A 4LEOA 4NHCH 3L3JA 5JQ6H 3E2HC 4L29B 2X70B 1H3UA 3OKNA 4PJIF 2BK8A 4MAUH 1FLRL 4U05A 5HYSG 2AXGB 5BZWB 4W70A 1NDGB 2XWBB 1OAXL 3T2NL 5C08B 3RJDA 3C2AH 1GOHA 3CDFA 2BVPA 5JDSB 1XF2B 2IPKA 2B4CL 4O4YL 5ID1B 3IFPB 3LH2H 2JJVA 3AAZA 3FQRA 5F6HJ 3V7MA 5I17B 1DBMH 2R4RL 3MA9H 2EIEA 3LD8C 2XY2A 5DO2D 3RI5K 3F65A 5HBBA 3MUJA 4OIAA 4OV6F 4GLRH 1RAMA 3WFEL 3S4SB 1DBJL 4KPHL 4QXGL 5I8KL 4YHKH 1OP3H 1KPVA 4BZYA 4WTXA 5FK9B 4NWUL 3FO1A 3PHSA 2J88H 4K3JH 3MV7B 2UZYB 2D7QA 1SYSA 5HGGS 5DHVB 1JYWA 5C3LD 1G7IB 3K3QA 2A38A 3PUCA 4Q7DA 4Y19B 2BC4B 3TJEH 3TZVD 2OSLA 4PGDA 1NLBH 4ODSL 2P42B 1PX3A 3GMRB 4RGMB 1UT9A 1FORL 4FFYH 3DSFH 1U8IB 2CR3A 1AHWA 2H45A 5GGUB 4MX7A 4X4XA 3T04D 2PXYA 2P1YA 1AO7D 3HI5H 4QNPF 5IJVA 4DVBB 3QNYA 3QWQB 3PQYE 1JK8A 2MPAH 4P9HC 2WK2A 5C0CE 3BWUC 1QNZL 4K3DL 3WN5C 1KN2H 4DQOL 4JPIB 1UKSA 4ZTPL 2NY4B 1MHEB 3QUKA 4Y2DB 1AGEA 4Y4HB 1FG2A 1G6RB 3NGBC 3KPMB 4NO0B 1DLFH 3UTTD 5J9PB 1BBDL 3FN3A 3G5YA 4PRDA 4PGJA 2ZP0T 3C6LD 2NXZD 4OCRH 5JLZA 4E42B 1EXUB 3UTSD 4JDTH 5CS7A 1KELL 4YZFF 2H6PA 4PJCE 3WSQH 5T33L 1J8HE 3MODH 3FOLA 1WIPA 4JO1L 3KPPA 4GKNB 3VWJC 4F7CB 2JF1A 1T7YA 2VLKE 3GSNH 3O11A 4RGOL 4MXVF 2W38A 5CD3B 5L8JB 4M48H 3Q2CA 2J8UA 1OAZL 1RHFA 2HWZL 1RUKL 2H32B 3EO0A 3O3DA 3RWEB 4A2LA 3ETBF 1B90A 5K9KB 5IB4B 2BVTA 3TIEB 5B8CC 3EYQC 2ZNWA 2IPTL 2YUXA 1T66D 5LBSL 3EDFA 3X12A 4G43B 4KK8C 2ZUWA 3EYSL 4HT1L 1MJ7H 3PWVB 4PJ5E 4NSKB 3HB3D 2X44D 1JNNL 4PBWD 4PV8B 2VXSL 1OAYH 1IGTA 3T09A 3IU3B 2OBGA 3BRGC 2FATH 1JGLL 5I18H 1WTLA 1ZLSL 3WE6A 1U3YA 3V4PH 1TQBB 1L7IH 5IVZB 2F19H 4DGVH 4KKBD 2EYTA 4O9HH 1RUPL 5GJTH 1YUHB 3PWPA 3GB7A 3VFRB 3ARDC 1P5VA 5DQ9A 4PJFF 4CU7A 1EO8H 3P0GB 4HKBB 4LAQH 1KTDB 1VGKA 1T0PB 1AKJB 3I2CL 3VFPB 1X5YA 4LLDA 5E1HB 3Q48A 5ACLA 4R3SA 1WTGT 1N64L 5C6WH 1I7ZA 3IJYB 4MS8D 3TH3T 3W81A 3I85A 1WISA 3MLXH 3VG9B 2XFXA 1W0WA 4LSRH 5E2TL 3CU1A 3HRPA 1VGEH 3VGGA 5GGQL 3ZHLA 4XCYB 4UT9H 3OZ9H 5D5ME 3RKDC 5KSUA 3QDMB 4MD0B 2WIIB 2ENYA 4LLQB 4P2QB 3KYNB 3ARSA 3MXWH 4PR5A 3V0WL 1RURL 1RJZB