4D8PB

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
193
Chain Sequence
PQPEQPEQPFPQPSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-DQA1 protein
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 193
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pB01
4S1SH 1OGAB 4BFEA 1S5IL 4E41D 1U9KA 5BW7C 3BDYH 4M6OH 5ACZB 2XN9E 3CCHA 2ZSVA 5F3HA 3ZMRA 1UACL 2LQRA 5C09E 1QYGL 1ES0B 4ODVL 2VB5A 3QA3A 3QR2A 3NFSL 5D1XC 2APBA 5K9JL 5E6IC 2ZUQB 1MY7A 2X89D 4NO2B 2HTKC 4K7PX 4NWUL 4PB0L 3TT1L 3F7PC 1JNHB 2V2XB 2QTEA 5GPRA 3RPIB 1NLDH 4XTRD 1YEFL 5ISZD 5E03A 4BH7A 1NAMH 3KLDA 3AGVA 4HGMA 3L3DB 1BVLB 4F8QA 2HVJB 4CL7A 3MJ7A 2R1YA 3GRWA 2HRLA 1DQJA 3V52H 2Y5EA 1FSKC 1CXHA 2HKFH 3Q2CA 5GJTL 4Z95H 1YEDB 1P5VA 2LU3A 4AEHH 5T5NG 1NCBH 1N0LA 4PJ9B 2DQCH 3N1GC 5IGXH 4PJBB 2NY7H 1RUML 3EOYG 4M1CD 4X5WA 3D25A 4PJFA 4YHML 5DD6A 4JFFE 4YWGH 1GZPA 1RZJL 2X41A 3L3HA 4M7ZB 1DVFD 3SQOH 4P3CL 1P53A 3MOAH 3TN0C 1OWWA 2X2YA 4HHAB 4U1JA 3KNBB 4XZUB 5K9QI 5KVFH 2CDFB 2VLRA 2J8UB 5KSAB 1U95A 3GO1H 3RWHA 1SVZA 4HKJB 4XNMA 3DMMD 2WLYA 5JNYB 5IV2B 2O5YL 3KR3H 2BSRB 5SWQA 4HPOH 5JO5A 1XCQA 1NAMA 4JDZB 4JDTH 2VMFA 1RU9H 4KHTH 3OG6B 3ZYOA 3TO2B 4DGVL 4JKLA 4PRIA 4YFEA 4LHUA 1NQBA 3P9LA 4QXGH 5HHME 3D3VB 4L8CA 4UT9H 3SE8H 1IC1A 4ZXBB 1H5BB 1JPFA 1QSFB 2P5EB 3U4EA 5D7KD 4JHBA 1QKZH 3CC5B 1SYSB 4UQ3B 5CJQL 4PRAA 5DJDB 1F4YH 3RWCB 3SY0A 5EU7E 2DM2A 3BUYA 4PV9A 4ETQA 3L5WA 5IB4B 3QB7C 4L29B 1Q9OA 5EO1B 1PYWA 5EU3A 3SDAD 1I9JH 3OX8A 2PYEA 4LLUA 3SDXF 1F3DH 1BQHB 2DYPB 5E6IB 5AEAA 2BC4B 1ORSA 4D8PA 3VFPA 1WBYB 1CN4A 1YEJH 2MPAH 4ONFH 2ITDB 4HG4J 3OR7A 4FTVD 4X6EB 5GQBA 1N8ZA 3DX9A 4FZEL 1Z5LA 2NR6D 4UNVA 4KZEL 3DURA 3O6LH 4DWHA 3MGAA 1U3HA 2P42B 5JHDD 2CKBH 5JW4N 1P1ZA 1FC1A 1FSKB 1CDBA 5F89B 4UT7L 4B5EA 3BHBA 1MQ8A 4NWTL 4MAUH 5CEZH 4YDJA 2IJ0C 5CJBA 1FCCA 5F3HB 2ZSVB 3BN3B 4WUKH 1AO7B 4HFWB 2R0WL 3RP1A 4OGZA 5I19H 1EMTL 1SM3L 3NTCH 3C5ZD 3TN0B 5EOCJ 2EH8H 1MWAL 3NH7L 4L4JA 5DZOA 1CGVA 2A6DA 4PJGE 5F9JB 2IF7A 4NQDA 5CCKH 2HFGH 1TVDA 3D9AL 3X17A 2VDOL 4LCUB 3C09C 5DYOB 3RRQA 4G9DB 2A74B 4BH7B 1NSNL 3LEVL 2NXYC 3IDNA 1SQ2N 2PO6A 1U3HC 2CKBA 3MODL 5LAXB 2R1YB 5GRUL 4LQFH 4X6DA 3M8OH 1KOAA 3KYKH 2MMXA 2ZZUT 2YR3A 4JG0L 4ODHH 5JQ6L 3UTSD 3OXSB 5BXFB 4MAYA 2ZPKL 2AXFA 4LVHC 1AQKL 1JVKA 1OARL 3QUYA 5F70A 1HZHH 1EIBA 3T0ED 2FLRT 4PJFB 2VLJD 4O4YL 5DJCA 2WANA 4DCQB 3L3HB 2YXMA 3U30C 1DANT 2HLFC 4X8JA 1JGDA 3EYVB 1RZIB 3LHPH 5ID1A 2FBOJ 3GI8H 2HFEA 1IM9A 5BMFH 4NQED 3QNZA 4KMLB 4MA3B 2VLRB 3HFMH 1JYXA 2A77H 3O4LD 4LASH 4XNMB 3VE0B 3MFFA 5SWQB 1A9BA 2YPKB 5JO5B 1XCQB 2NY4B 5ESQB 1DFBH 4FG6C 2GCYA 1IAOA 1PFCA 1OTUD 2PO6C 3P0VH 3OJDB 4KKCD 4MCZB 4G7VL 3V0AC 2AJ3A 1S7WB 2NY5H 4LHUB 3P40A 1CDGA 3P9LB 1LP9E 4K3EL 4X0KB 2VDNH 1CGSH 4MAYC 5MERA 4WHYG 2F58L 1FL6B 3QUYC 4KQ3H 6FABL 4LLWB 3HHRB 1EERB 4F7MA 1CCZA 2Y7QB 5I0DA 4QGTA 2E8ZA 1CE1H 5BJTB 2O61A 7FABH 5FYJH 3RVWC 1JV5A 3ARDB 3SY0B 4JHAH 3V0VB 4GRLA 4QWWD 5FOJA 1CDHA 5J1TC 4LQ1A 1MCNA 1Q9OB 5EU3B 2XTJE 3QJHA 4XCCL 2PYEB 4EDXB 4EUPG 4K55A 1QLEL 2A6IB 3B9KA 1HYSD 4NQCA 5IMLA 1KCKA 4KK6D 4K3GA 4QCIA 5DGQA 4D8PB 4YHYC 4W6WB 3MRJB 1BECA 1MUJA 3ROLA 5E7BA 2HVKA 1MREL 1CLYH 3DX9B 4MJ5A 1P4IL 1KGCD 4KI5F 4XPFH 4X7TB 3PQYB 3U0WL 3SDCD 4BKLB 2NXYB 5JXAH 1U3HB 2JB5H 3UTZA 1IE5A 1S7RA 4YXKH 3U0TB 3DI3B 3C5SA 4OF7A 5IMMB 2QSTA 3EOTL 3N50A 1BZ7A 5EU6E 4YDJB 3CSBA 5INDA 1P2CB 4RFNB 1BJ1J 2QSCH 5E2WH 4PR5A 1YPZA 4XP1H 4FQXD 2FGWL 3LB6D 5IM7A 5J7CC 2Z93A 4GRLC 1UH4A 1QR4A 4LOUD 3FB6B 5DD1H 4GMTL 5C0BE 2OSLA 2G9HA 3B9KC 1NFIA 2C3VA 1CD1B 2P5WE 4W68A 1I7UA 4IS6A 3KPOB 3EUUA 1ZHNA 1AE6H 1B2WL 4OLXL 5B3NA 4LPWA 3T8XB 2FZ3B 1SMAA 1H3WM 4KUCF 5GJSH 3HUJF 1WIUA 1V3LA 2XOTA 1WZ1L 2YXFA 1FRGL 3IDNB 2J2ZA 2PO6B 5KSBF 2FH8A 2W9EL 4FFZH 4Y8DC 2NY5C 4Q2ZA 1T04B 3T04D 4MAYB 3B3IA 4ISVB 2AXFB 4Q74A 4QRRD 4X83A 3HG1D 3I3DA 4QEGA 3KPLB 3S5LA 1PBYA 3QUYB 4ONHB 4PJCA 3MXVL 1TZGL 3H3PH 4FHBD 4HX1A 4YHKL 3IDJA 1NANH 1PG7W 3L5IA 1YNLL 1QSZA 1TTGA 4OV6F 1OAYH 3T77A 1JGDB 2ITCA 5HD8C 3D0VB 5ID1B 3QUXD 1KJ2A 1Q72L 1IM9B 4DOHB 4KKBC 2YEZB 3OAUH 3CDGA 4W6YB 5ANMB 4YHYB 3F58L 4FMKA 4KI5E 4OQTL 3MFFB 1F4WH 4PJAF 1CDYA 3TBYA 2F8VA 1FV1B 3VRJA 2GCYB 1EEYB 2EE9A 3DVIA 2OYPA 2IBZY 3QDHA 5IESL 3B43A 2Z9TA 4YHZL 5J06A 4IMKA 2XTLA 3DV6A 1I85C 2AJ3B 2CD0A 1N3NA 5DMYA 3VXMD 4ZMAT 2LU4A 3IXAA 3QH3B 5FKAA 2HJFA 3FB5B 3VW3L 2EKSA 5MERB 1SYVA 1I9RH 2EYTB 4WWKB 2ARJB 3P4NA 1HHJA 4RFEA 4F7MB 1KYOJ 5F6HI 4NNYA 2OXGA 5C0RH 5BV7H 4JFQA 3C60D 2IPUK 3OR6B 5SX4H 3QPQD 4XP6L 5E8NA 4TVSa 5CINH 4HWBL 3DSFH 4XCFH 5C08B 3QJHB 4PREA 2B4CH 3G6JF 5KW9H 5D4QA 1BD2B 3B9KB 4NZDA 3MNVB 3LKNA 5IMLB 4IOIA 1LEGB 4QCIB 4AEFA 5IVXB 3S36H 5IB2A 3WFEH 4ALAL 2APWA 3HUJE 2XXCB 3MLZH 3PF2A 5FGCB 1MI5A 4ODTH 5KSBE 2ATPA 3U36A 3DXAB 3LPGA 1KULA 3SKJH 3UTZB 1SJEA 1HYRC 1JHLH 3HAEG 4IMKC 3C5SB 4YHLL 1G6RL 3DECA 3QI9A 2ERJC 3NFNA 1AKJA 1L7IL 3M07A 4R3SA 4WEBL 3TPKA 3RUGF 4DQOH 1JHKL 3IF1A 5D5ME 4ZTOL 4P23A 4DZBB 4HKBA 3WNMA 3G5ZA 1CBVH 5ESAA 4FNLH 1VFUA 4NJAL 2M8XA 2FEEL 1UCBL 3O6KH 5IM7B 4YQXH 4WEMB 3SO5A 2CPCA 3EJYD 1U8OA 1VGEH 1MAKA 1XGQA 1YQVH 2HJKB 2O5XL 4KXZI 4LCIL 5JPMA 2VE6B 3WO3B 1KCUL 1YUHB 2OSLB 2HYMA 4N90D 1I7UB 2AEPL 4C56E 2YD1A 2XA8H 1ZHNB 1AR1D 3VRLE 4FP8H 1IBGL 4XI5C 2QL1A 4RMVA 4K9EL 2BSED 1FAKT 4Y1AD 2NY6C 5D7IE 3IFPA 2W0LA 2XWTB 1P4BH 2HTLC 4PB9L 3C6LC 4EOWL 1NGWB 4JFEA 1TXKA 4JCLA 3I3EA 1NC4D 1NGZA 4M1GL 3H2WA 2DJSA 1A22B 1B0GA 3FQWA 3QI9C 1CLZH 4G8GA 4PD4J 5IEHA 3B3IB 4Y2OA 1UYWH 4YXHH 3UAJD 2VABB 4W70A 3S5LB 4M7LH 3ALXA 4ZQKB 1G9MH 5T3ZE 3NACH 4HGWA 5BV7C 3GSQA 3DUHA 3MRMA 4NM8H 1N59B 3G6JE 1X7QA 3VD3A 1S9VB 3FRPG 5FA3A 3T77B 2B4CC 4WHYH 5JR1H 1KJ2B 4NKMA 4JKKA 4AEEA 4G43B 3DRTA 1AD9B 1M6OB 4AJ0A 1JZ5A 5ITBH 1JBJA 3OKLB 1NPUA 2DQTL 3V0WH 2CGRL 2V2WA 4YNYA 1E4XI 1NL0H 3SDYL 1Q9WA 3TBYB 3LIZH 2BVYA 3OKMB 2EXWD 3VRJB 4EUPH 2K7PA 1X6NA 4S1DC 5DJ2B 3WSQH 2AABL 1ORQA 3DV6B 1OQOA 1OTTC 2MJWA 1G7PB 4UINL 2EE2A 4V2BA 3RUGE 4DVRL 4F7TB 1MCBA 2ERJB 3IXAB 2HJFB 3U9PL 2DIAA 4Y2DA 5EU4B 2IADB 3KPRA 3HMXL 1SYVB 1T2XA 3UTOA 2VDLL 1PG7H 3T2NH 4Z0BL 2UY6A 2VRAA 4GAFB 4V1DA 4LHQB 5EOCH 2XZCL 2AEIT 3C8DA 1XGUB 1MCCA 4JFQB 4KDWA 5TGBB 1OAQH 1C5DB 5E8NB 4M6NL 5FB8B 1OB1B 4PREB 5HI4C 1IGMH 1FLRH 2WBJD 4EN3D 3MRCA 3CVIL 2HAZA 4XXCA 4JRYA 1KB9J 4LDEB 1KCSL 2VZVA 1GOFA 3R8QA 3NN8A 1IQWL 4E5XB 1R3LA 3GUTB 2XWBA 2Z31D 1FAIH 3LPFA 1FNHA 5JMRA 2APFA 1E6OL 4EUPA 3SOBH 3C6LB 3U36B 5J1AB 4M5ZL 4P2YA 3VGEA 1FVEA 5ELIA 3QI9B 5DEZA 5C6PB 4ODSH 2HG5A 2VISB 2VXUH 5JW5B 1A0QL 4Y2DC 4OZIA 5JDSB 1A2YA 4G6MH 3QIBA 1U8NA 1IGYA 1G9MC 5ICZA 4JCMA 1MRDH 4Y5VA 4WU5B 5KVEL 3P9MA 1U8OB 1XGQB 1Q0XL 5EOQH 3WIIH 1O0VA 1TJGH 1K6QL 1T21A 4DZ8A 3BEVA 1T20A 4JKPH 1NFKA 3OHXA 4XXCC 1H3UA 1NUFA 1KTKE 3VFNA 3HA0A 2VH5L 4K71B 4HJGB 3LKSB 3BP4A 3QXVA 1FPTL 4WEUD 2E9BA 1FORL 3I50H 2CK0H 2X4OB 3IFPB 5AYQA 1UC6A 3BQUB 5F9OH 3VGBA 4KGJA 3SDDD 2BSTA 3WIFB 4G42B 1JWUA 3MV7E 4XCYA 3LD8C 3KYNA 3BKML 5D1QA 3U9UA 5E6YA 1B0GB 2VLKE 3BDYL 4M6OL 1NCWL 1K85A 4G8GB 2F8XC 5IEHB 3LEXA 3QIBC 4MJIA 4Y5VC 5D70L 4HGWB 3GSQB 4RISH 4KJQD 3EDJA 1T83A 3LKPB 5TE4L 1AC0A 4I2XA 1EA9C 2K9UA 2MSPA 3LRHA 2AJXL 4TTDC 4PJEF 2I26N 2HT3D 2C4FT 1H3GA 3K8KA 4Z77B 4HEPG 4UIMB 2EDLA 4HJ0D 2NZ9D 2BZDA 2JIXD 2FL5A 5AAMA 3RX7A 1JMZA 3MOQA 1TTFA 2V2WB 4ORGA 4YNYB 3ZKND 2YD7A 1Q9WB 4GRWF 5FM5M 1VACA 5IJVA 2YUWA 1GAFH 2HKFL 1GOGA 3G6DL 1T66D 3OKKB 4P4RA 1MWAB 1NCBL 3PXHA 4R8WL 3SE9L 1XF3A 4J3TA 5D1XD 5D1QC 1DEEA 3D0LB 5IGXL 3S88H 1BJ1H 2JELH 1MLCA 5SX5H 1QA9A 4Y2DB 3VFVB 4CU6A 4ZO9A 3NIGE 5F88A 2UYLA 3CLEH 3VXTA 4MJ6B 4EJ1C 2HTKD 3TPUA 3HN3A 4X7SH 3U7YH 4ELMF 3HAEH 3O11B 2UUDK 1T83C 1ZHKA 1UCTA 2SEBA 3CX5K 5LQBL 4PTUA 3PP4H 1FFPA 1K4DB 5F96H 5ADOL 4AG4L 5A3ID 3MRCB 2ZUTA 3KYMA 1F3JA 4IRZL 5E8PA 3WFDH 4RAHA 2VXSL 4LLDA 1RJYA 1FJ1A 3VH8G 4CMMB 3NN8B 3GSOA 1KEML 4JDTL 4X80L 2XN9A 5IHLB 1INQA 1RU9L 5GRVL 5TDNB 1WICA 3U83A 5C09A 4WFGD 1FNFA 4NHUA 4JZNB 5DD3L 2BRQA 1VCAA 1LE5A 2KDGA 1UB5A 1N4XH 2KKQA 5FKPB 1CGWA 3DGCR 2YWYA 1F13A 2HKHH 3LD8B 1X4ZA 4M61A 4OI9A 4FQ1L 1FVEB 4NYLB 2DKMA 4WFED 2ENYA 1OY3B 2HG5B 5TQ2L 4OZIB 3C5JA 1A2YB 4C4KO 1K4CA 4M93C 1CXFA 1TCRA 2XQBL 4F9PC 1IGYB 3WL9B 3EYSL 1Q94A 5ICZB 1QHOA 3RNKA 5K9KB 4RIRA 1FVDA 2BOCB 3A6CL 1MHEA 4OGAD 1QPPA 4NSKA 3P9MB 4PJEE 1ZLSH 3A6OA 3VXPA 3AU1A 5DUPL 3PWJB 3WLBA 4M62H 1FGNL 4Z7WA 4OM1H 4DZ8B 2V7NB 3BEVB 3MV11 1DBJH 2YKLH 3ZT5A 2DLEA 3OHXB 1A4KA 3VFNB 2C1PB 2VQ1A 2NCMA 3BP4B 4GRWE 1ADQH 3WUWA 3FFCA 4JFFA 1G9EA 4MX7A 5EWIH 5I8KH 1LO5B 2NQCA 1WK0A 1IZJA 1FZMB 2HP4A 2BSTB 4ZTPL 4XVSH 1UB6B 1JWUB 3MRKA 2AXJA 4XMLH 4M4PA 1V05A 5D1QB 1KIQB 2QQNH 4HBCH 4RMUA 5D8JH 3CNKA 3MLRH 1K8IB 3RY6A 1HKLL 4X4ME 3NAAH 1FIGH 1ZXQA 4TQEH 4WUKL 1S7SB 2ZCHL 5I19L 2VLRD 3KJ6L 4ELME 4OZHF 4LP5A 3PGFH 1DLHA 4MJIB 5DA4A 4AZ8A 1BVKA 4EEEA 5BZDA 4RSVA 4I2XB 4Q6YA 5IQ7H 1MCDA 3ALWA 1UWXK 1M71B 3BOVA 3VGGA 3SKNA 5C1MB 4PRID 5CCKL 2HFGL 4QYOA 2YA0A 5C2BL 1MRCH 5DWUH 3MRPA 5DRXB 3KDMA 3KPQA 3IDGA 4LQFL 1LQSR 1VACB 5IJVB 2X4NA 2BY3A 3WFBL 2FNBA 4WCYL 5GGRY 4OD1H 5I73B 4Q9QL 4KZDH 1K5NB 5J56B 2FBJH 1KELH 3QPXH 4G8IA 5J4MA 1DEEB 5HHOE 3P77A 1I8MA 4WI8A 2KH2B 3RY6C 4K3HA 1MLCB 2H9GA 5TJWK 2ORBH 2P43B 1T5WA 4G80A 5E95B 5MHSD 4WHTB 4S10A 4UBDC 3B2UC 1FFNA 4F2MB 1BEYH 1ZHKB 2VUOA 4AT6A 2SEBB 1RPQA 1OM3H 2D4FA 4PTUB 4OLVH 1FFPB 2Y25A 3H7BA 3QNXB 3CMGA 4O2CA 1F3JB 1IGFL 4LU5L 1BJMA 1XCTB 4PJIB 3GSOB 3OF6A 5F7LB 1FFRA 2XN9B 3I75A 5I18H 3FTGA 1CD8A 3DYPA 5FYKE 4B41A 3P0VL 4RX4A 4LSRL 5EU7C 1I1AB 2GT9B 1LE5B 1UB5B 4M6MH 3IJYB 4NP4L 2VDNL 1CGSL 5LBSL 2HLFD 3RVXC 2C5DC 2EIEA 4OD3L 4PJGA 4KQ3L 1WITA 3K4ZA 4KU1A 1YEEL 3MJ6A 3C5JB 4UB0H 7FABL 5DQDH 4LSUL 3X13B 1IQDB 4NQDD 8FABA 2NW3A 3BUTA 2UY7A 3MUGA 1ED3A 1FVDB 2E6JA 1MHEB 1D5IL 5LKNA 3L7FB 5F7MC 3VXPB 1KCVH 3AU1B 3AY4A 3G5VA 3QJFB 3UC0L 3WLBB 5GGRB 4KHXL 3U7AA 1NCAL 4U6HA 1BFVH 4F33A 2A6KA 1A4KB 3D69A 4XPTH 2VQ1B 3BFOA 2VXVL 3MOBL 2BNUA 4DGYH 5CEZD 4MAYD 1F8TL 3WUWB 4JFFB 2AV7B 2JB5L 3NCYS 4IMLA 5INCA 1Z6JT 1AGBB 4PRHE 1HH9B 2G75B 4IHOA 5HGDA 5F7DB 3VA2C 4DKFH 5DFTA 2QQKH 5IK3A 2QSCL 1MCEA 1OSZA 5E2WL 1GGYA 4JO1H 5L2KE 2W0KA 3QQ4A 3ARBD 3QWQB 4DN3H 4QRPD 5K33A 3V8CA 1RZKL 2P49B 3VMOA 1DLHB 2DI9A 1VESA 4TYUA 1LD9A 3U48A 3O6FD 4WDIA 5D7SH 3AY4C 5SV4A 4KFZC 4U6XB 2GK2A 3QXAA 3GJFA 4OLWH 1H0DB 2AJZA 1LP9A 5C9JB 2GK0B 1MFAH 4MB3A 4QYOB 5EU5A 5HDQH 1CIDA 4L3EE 3RNQB 4HK0A 3ULUH 3TYGL 4O5LH 4P46A 3E6HA 1FVCA 3G08B 4XVJL 1Y0LB 5HHXH 2H2PC 3KDMB 3KPQB 3RVTC 3Q5YA 3ARTA 4JN1L 2X4NB 3GK8L 2A6JB 3DIFA 1EXUA 5H2BB 3UBXB 4ZUTA 4RRPA 1QFUH 4GRLD 4JZOB 1QG3A 4G8IB 9CGTA 2F5AL 1H3XA 3C2SA 3P77B 2ZG3A 4P2RB 5E9DD 4ZNEE 3AFLA 4URTB 3R06A 4NQCD 4Z7QF 1T5WB 4G80B 3TZVA 3I6KA 4TRPH 3RL1A 4JGUA 5ALCL 3QDMB 3QO0B 3QQ3A 1CFTA 1INEL 1F4AA 4I1NB 1FHGA 4P2QE 5IMKB 2BMKA 1HHGA 5F7FA 1BF2A 3AUVA 3MFGB 4OCSL 4AT6B 1ITBB 1AXSB 5D6CB 2AJYH 3H42H 3OAYK 2B2XH 4LCYB 1PZ5B 1KJMA 5EU6A 1F4WL 1A14L 2RAMA 2G60L 3I75B 1QVOB 4PY7B 2JE8A 5BOZG 1C16A 4WJ5B 1JGVH 4BYHA 2HRPH 1GGCH 2XZQL 3KS0J 3EW3B 5FYJD 4MGXA 2FEEI 2XTJC 1N0XH 1WIOA 3PWPE 4J23A 5C0BA 2BNRE 1DBAH 3VH8A 4L8SB 2QQLH 5KANI 3MQIA 3ZTNH 4F3FA 5M95B 3UBXI 3K2UH 2MKWA 4PJGB 3V4VH 2DQHH 4I0PB 5DRWA 4P5KA 1HQ4A 4KKBD 3TZVC 1EHLH 1AJ7H 3L95B 1QLFA 1V7MH 5D2LE 1M7XA 3X14A 3PHQA 4NN6C 2X9YA 3MUGB 1KN4H 2VDML 2VOTA 3S6CA 5CFHA 1NUGA 1T7YA 2AEQL 1S5HA 4IRSA 3F7RA 1AQDA 5D9SA 4KDTA 4U6HB 4F33B 4P0DA 2A6KB 2OXHA 3MLZL 3D69B 3BKYH 4IDLA 4OCNC 1QPXA 2BNUB 2Q3ZA 5DTFA 2CR6A 4ACPA 3ZKMD 4WRLA 1HHKA 2OL3H 5E8DH 5F7NC 4DN4L 4IMLB 3SDXB 3K2MC 4XMPL 3PIQA 2E9IA 1D5BA 1J5OH 1WISA 2PW2A 4FQPA 1OAUL 4MD0B 2IGFH 4L4TB 2BVUA 1BWMA 2BHZA 4JLRB 1M4KA 3S37X 5I1GH 4YQXL 3F8UB 2Y07L 1S9XB 1VGEL 4CVXA 1RIVL 5E56A 4XCEA 5HYFA 4JHZA 4XNQB 4WDIB 4QRQA 1A3LH 1S78D 2VDRH 4FQLL 4MXVF 3HI5L 2QSQA 1JHTA 4N68A 4IRSC 3GJFB 4XCNA 2C1OB 2AJZB 4G5ZH 5MEOA 4KDTC 4M8QA 3CAFA 3DX7A 5EU5B 4HKXA 2NX5B 2JB6A 1RD6A 3WHE1 4HK0B 2E7CA 3F65A 4J3OC 1NBVL 2FX7H 5DD0L 3L5XL 4MQXC 3RI5F 4F7EA 1IEBA 4QXTB 1YN6A 1NDGA 4WFHD 2RHEA 1EO8L 1LDPH 3PHSA 3DIFB 2XTJB 3STZB 3MLUL 3QIUA 4ZUTB 3MGOA 4NDMB 1RUPH 2X1OA 1T1XB 4YXHL 1F45A 5ICXA 3P4MB 2ADGA 4D9QE 4KI5C 2AXGB 3TZVB 3HUJA 1LHZA 4NM8L 3GI9L 3RL1B 3QQ3B 1BLNA 1CFTB 1RUKH 4G6KH 4PJXF 5I17A 5KSBA 4WO4C 1DN2A 2GJZB 1KXQE 4XVTH 2NY6D 5IR1A 1HHGB 1MI5D 3OGCA 4JN2B 1EHXA 4IEFB 4NO5A 3MA9L 2AQ2A 3R1GH 4K3JH 3QQNA 3UYRL 5MENE 1S9YA 4LSQH 5C8JB 1MQKL 1FDLH 3OKOA 3ULUF 1KJMB 2E7MA 4HXBH 5D5MA 2Y36L 2AGJH 3KJ4C 5FV1L 4OBSA 4M03A 4YHIA 1AKJD 4P59L 2EXYC 4YIQA 4YK4C 1U8JB 5T3ZH 4DFIA 4P23D 3VD9A 3MLSL 2EC9T 2DJUA 1XGPB 4POYA 5C0AA 1IC4H 5C0BB 1H3TA 3QIUC 4LAJH 3O41B 1FYTE 2ADIB 1ZANL 5FK9A 2P5WB 4F3FB 3WN5A 2EDJA 4C56A 3UJIH 5HBBA 1LGVA 1Z9MA 3D39D 4P5KB 4OLZH 3ZLQC 4KUZH 4I8DA 5TDOB 5D7IA 3BISA 4PP2B 1VSCA 1YEKL 2F54D 1QLFB 2AK1L 4X4YA 4IOSD 5J6HA 2OZ4L 4GKZA 4M8VA 4B50A 4MXVE 3HI6L 1GZQB 4NKIL 4Y16A 3V6ZB 2PYFB 4CGTA 3CMOH 1X5YA 4I9WE 2W59A 1H9VA 4Q0XL 3F7VA 1S5HB 4JFED 1AQDB 3VFOA 1A7RL 1A6UH 2A9MH 1ND0A 2R4SL 1KXTB 1RMFH 1QSVA 4LCWE 3HNSH 1QFOA 4XPBL 1FAIL 4NCDA 1NGQL 3KHOA 3QHZL 1OGTA 5DTFB 4JJ5A 4IBLT 1R0AL 2VITA 1OPGH 3HRZA 3HNTH 1HHKB 4UTBL 1CR9L 4GW5A 4JY4B 3PP3H 3VXUE 3PIQB 5C9KA 5L6YL 1D5BB 5JW3L 1CXKA 3QUMA 3UEZA 1MHCA 4U1LA 5DHYA 4PS4H 5BS0E 1BOGA 3WN5C 3G5YB 4UV4H 4G6ML 5HI4D 3WD5H 5A2KH 3FAWA 4NPYB 4MJ2A 2EDFA 4NKOB 4PJXE 1JPGB 2NY3B 3MRLB 1ZSDA 5B3JF 4FS0A 2CLZB 1N6UA 4WO4B 4XCEB 3WIIL 4Y16C 2XV6B 1F6AB 3TO4C 3LH2L 5BRZE 4JKPL 4NQTA 4L4VD 5E2VL 3BH9B 4XCNB 2CUMA 2DQUH 3RUGA 5JOFB 3MZGB 5E08H 5MEOB 3DX7B 1DBML 4HKXB 4JFDE 3GMQA 4Z7UA 1TITA 3KJ4B 2XNAA 2CK0L 5CAYB 1OAXH 2ZCLH 5ITFA 4ODWB 5F9OL 2J4WH 4YK4B 1QNZH 3MA7A 3KPRD 4HIXH 1NGPL 2A9NL 1YN6B 4MNQE 2W07A 4ONGL 1G7MB 4QTIH 2EEAA 2E5EA 2E8YA 4V1DD 3WHE0 1EJOL 1OTSD 4ZFZA 4RA3A 1CVRA 4K7PL 5E2TL 1VGKA 3QIUB 4PYHA 4BQBA 3MGOB 4WUUB 2N4IA 2CDEA 1JZ8A 2ADGB 4TPRH 5GRZA 5DJAA 5CSBA 4JRXB 5HHVH 5DFVD 4JRYD 3HUJB 4M3JA 4X8XA 5E4EB 2BHYA 3T0AA 3OPZH 5KSBB 4KVNL 4KMQA 5T1LA 2V17L 1K3IA 4XWGH 4JFZH 4OFIA 4Y4HA 1SEQL 4NO5B 1IL1B 2FD6L 1RUAL 4UOW1 1PSKH 3GKZA 1FNAA 1VKXA 3WUZA 4H0IA 5L8LB 3MLYL 1S9YB 3CD4A 3OKOB 3NPZB 4XP5H 3RU8H 3GIZH 2I9TA 1X4XA 2AK4D 3TIEA 3EGSB 2Z4QA 3ZZ1A 2Q86B 1NMBH 1XR8A 3X12B 2P1YA 1CGYA 2Q7NA 3QIBD 4CJ0A 5J11B 2BY1A 4WW2A 5HYSA 3P73B 1A5FH 4ZUSA 5HHPA 3S88L 3TH2T 2ED8A 4D0CA 3GSUA 5FK9B 1QRNB 4TTDD 3WN5B 3AS0A 3TC9A 2HMIC 4C56B 1NMAL 2Z92B 1EZVX 3FO2A 4RBPK 1J12A 3RVUC 3EHBD 1XIWA 1WFOA 4BZ1H 4X4YB 1ZGLM 1ZGLB 1W0VB 1LO0L 3TO4B 5DJ8B 1TPXC 3RZCD 3MV7A 3MCKA 4Y4HC 4NGHL 2VLKA 5ACMA 3VFOB 4EVNA 2R69L 4UUJA 4X6BA 5I6XC 3OB0K 3U6RA 3O8XA 3STLB 3WKNA 3MLVL 2CDGA 3O3BA 3G5XA 3BIKA 1RZKC 2AKRA 1OGTB 4JO2H 5IFAL 5HGHA 2VITB 3HTLX 1RZ8B 1ACYH 3HRZB 5IBUB 1TNMA 2HKHL 4WW2C 3G6JB 3MRIA 5E5RB 4JFHE 4QNPF 5C0GA 2J6EL 3VI4E 1F90H 3QUMB 1KN2L 1U0QA 2VYRE 4OFYA 3TH4T 4OZGF 4R7DB 4WI7A 1MHCB 5TPWL 1TCMA 4U1LB 3I6LE 2JLLA 1BOGB 2Y5TB 1NDMB 4XT1C 2G2RA 3L3OA 1HEZA 3E8UL 4N9GB 5T3XL 3ZYIA 1XGTA 4R4FL 1YECL 1KJ3L 3GSNH 2BOBB 3MACH 3UJTH 2B0SL 4DKEL 3ISWA 1ZLSL 5AD0A 2VAAA 5DMJB 1ZSDB 1IC5L 1YEIH 3CK0H 2PUQT 3MRGB 1IRAY 1EFXD 3K7UA 4OM1L 4XAKD 3QAZB 5FHAH 2VN7A 4U7KA 4XH2B 2EO9A 3RUGB 3AXLA 2FWOA 3NCFB 4OZ4A 1YC8A 2GIYA 3GMQB 1ADQL 3BDBA 5I1JH 3O8XC 1HSBA 1IM3A 5JIKA 3THMH 3MMEB 1A7BA 5C7XH 4WFFE 3QDJB 3MA7B 1HQRB 2BJML 4XVSL 1F4XH 4YAQB 4XMLL 1GPOH 3NFPB 1CG9B 5DO2D 1HNGA 4HBCL 5D8JL 2VSCA 4XGZB 4FXKB 1VGKB 1RK0A 3NAAL 1FIGL 4OB5H 2FYYA 3ZDZE 1J05A 3IB4A 3RBGA 5DJAB 2XZAL 3ET9F 3HCVB 1Y18B 3MV9E 2O5ZH 4N8CH 3GSNA 4TUJB 3AAZA 3LOWA 3MC0A 4YBQD 5IQ7L 4K23L 3E0GA 1UFUA 3VWJD 5C09D 5CZVL 1TPXB 2AV1A 4Y4HB 5KSUA 2VKWA 1UM5H 1BPVA 4O02H 2WWKT 4NNXA 3EFDH 4F7CA 5MEQA 4LPUA 2L4OA 5E8OA 5MP6H 5I6XB 4PJ5B 4R97B 5FECA 4S11A 1C12B 3RJQB 4J8RA 2ICWJ 3LPWA 4NFCA 1OOAA 3EDKA 3BP7A 1YYML 2QHRH 1U8LB 3ESVF 4OD2B 3ARYA 4PJEA 3DRQB 1R3JB 1XR9A 5EOTB 4WW2B 3VXSE 3QPXL 5HYSB 4OZGE 3V4UL 4ZUSB 5JTWA 1SBBA 2DQFB 3CFJA 2ORBL 4D0CB 3GSUB 3FQUB 5I1CL 4Q6IA 5JUEL 2FR4B 3OL2A 4GS7B 4HDIA 3BPNB 1C7TA 1RULL 2GY7B 3TBTA 4X6CF 2Q8AH 5IQ9B 4PGJA 1GRWA 1FGVL 1T5XA 3LV3B 5IOPA 2IANE 3HC3L 3NZ8B 3IS0X 3FFCD 4ZAKC 4OLVL 2ARJQ 2YRLA 5C6WH 1CZ8H 1ZT1B 3MV7B 3MCKB 4UT6H 4QLRA 5ICYB 4N8VA 3TV3L 1AI1L 5GS0L 4X4MA 4X6BB 3HE6B 4A2MA 5FUCE 5IB5A 3MRFA 3U6RB 12E8L 2CDGB 5CP3H 2VERN 3G5XB 3MXWH 3BIKB 3GBNL 4BELD 4D9RE 5E5MB 2QHLA 5HGHB 1JUFA 4HV8A 5KTEH 4BJLA 5I1KH 2HFTA 1CDIA 4QXWA 1BZ9B 4MXWH 3B2UD 2R9HC 3MRIB 5EC1A 4ETYA 1JI2A 5C0GB 5TF0A 3FT3B 2W9DL 5TQ0H 2DQEL 3BKJH 3O9WD 3GMRA 1ETZB 3T0WA 1YMMB 2G2RB 1NBQA 3L3OB 4GAJL 1HEZB 5E00A 1SMOA 4V2CB 5HHMD 1FNGA 1U91A 1XGTB 5ALBH 2X9WA 5FYKH 3RAJL 1GIGL 4QRUA 1WFUA 4PRDB 4JREC 1U3YA 1MH5A 5EH1A 5HHOA 4XPTL 2FWOB 3O0RL 1AGFA 3RVXD 1MOEA 2NLJA 3CUPA 5CP3A 1HSBB 1M05B 2ESVB 1EHNA 5GGTH 1J7VR 1UADC 4H1LB 3E3QE 4CN6A 4KRPC 1U2HA 1OGAE 1YNKL 2OI9C 2OZ4A 2JJVA 2V2TA 5KSVB 2ADJA 4WV1A 1T1ZB 4KTEH 1MY5A 1Z3GH 1ZLVK 3E1F1 1TLKA 3L3KA 1DJSA 5IBTL 1RK0B 1HCVA 3FT4A 2FYYB 2CKNA 4JO1L 1G7IB 4PPTA 5FUZL 4N1CA 2K1MA 4DN3L 3VJ6A 5LGJB 5C07E 2Z0BA 2CRYA 1OP3K 4AL8L 2ZKHH 2CLVA 1MVUA 3OF6D 2FJHA 1BX2A 3IETB 1NC2A 4B7IA 3VXNA 2HT2C 4ZAKB 2HJLB 4D9LL 4MQ7B 4RX4D 4FFWD 5I0ZA 4CRPA 5KSUB 5HDQL 1W8OA 3KVQA 1R24A 3WBDA 2DJ4A 5C6TH 3ULUL 1TETH 1KFAH 4O5LL 3EOBA 3MLTB 5F7WC 1U42A 4ZNCD 5EDXA 6CGTA 1CFNB 1E4JA 2FSEA 1E4KA 3L6FA 3I2CH 2EECA 4XPHL 4LEXL 4WV1C 2YC1A 1BQLH 4OGYH 4PJEB 3L3IA 3S9DB 1AIFA 2LE9A 3IDMA 3C87A 5DEFB 2VR4A 1AHWB 2VZSA 2VDQL 3CFJB 1L7TH 3VFUA 3FN0L 2YK1H 1EJ6A 2D0GA 4TRPL 3BW9A 4HDIB 4HWEL 4GRWB 3R0MA 1OAKH 3LZFH 5EZJA 1S7TB 3K46A 4NZRL 1T5XB 5GIRB 5IOPB 3W39A 3HB3C 1A6PA 4JREB 3RIAK 3VGAC 4C57C 4PRHA 3VFWA 5ILTL 4D0BA 4NJ9H 3ZKQD 3RVTD 4ZO7A 2NYYD 3DNKA 1X5LA 5H35A 1JYWA 2F19H 4ZS7H 2GKIA 4N8VB 1UA6H 5A2IH 5L2KA 5IB5B 4N9OB 4ELMB 4KJYA 1GGCL 5GZND 35C8L 4KRPB 3R8BB 3SGEH 3HC4L 5GZOC 3D3VE 4BH8A 3MJ8B 2EDTA 4AMKL 5DK0A 3IVKA 1QSFE 4UV7L 2P5EE 4KVCH 2D7TH 1HIMH 4NUGL 2FX8H 3ZTNL 1J0HA 3U4BH 2FJFA 4GMSH 3P0GB 4L3EA 4Y19B 3JBG7 3WFHA 5E00B 2EZ0C 1V7ML 4JB9L 4L3AA 3QG6B 5DMIH 4GRMA 4P46D 3QCUH 4NC2B 4QRUB 2IBGA 1UGNA 2VL5A 2A1WL 4M48L 1I7TB 1JGLH 4NUJB 3RIFF 5HHOB 1MLBB 3LQAL 4YXLL 1AGFB 4YHOL 4ZNEA 4Y7MA 2AJVL 3PABA 4PJHF 3CUPB 4O51A 5C0DB 3O45A 3MREA 2V2TB 1NJ9B 1KLGB 3B5GA 4P2QA 1WC7A 1OCWH 5HYQA 4IDJH 1JNLL 2VDKL 4UTAL 5H94A 5EZIH 1A6VH 4QOKD 1LO2L 2UVFA 3PWVA 4A6YH 4JO4H 4F80A 1UQSA 2NY1C 2WUBH 4FQCL 1CF8H 3EOAA 3GSXA 2V9TA 3BI9X 1YYLH 4ZFOL 5EU6D 3S4SB 3ULUD 2CLVB 1MVUB 3IDIB 1BX2B 25C8L 5M94B 4GSDL 1EGJH 3EBAA 3HMWL 5EBGA 5JXED 3VXNB 2ADFH 4PY8J 4PRBA 3FO0L 3PWPA 4G5ZL 2BNRA 1WAAF 1LO3H 1WBXA 3DBXA 4H88L 1OD9A 5FM4A 5GSRA 1R24B 4WU7B 5EBLA 1R3KB 3EOBB 4OZHB 4Z7VF 1MFCH 4BUGA 4EXPX 4XC3H 3L6FB 3HNVH 5D2LA 1EV2E 4GBXB 1LDPL 5IVNA 3KPSE 3HC0B 1WEJL 5JPNA 2YC1B 4U3XA 5JMOC 3EO1B 3D18A 4OCMC 1W72H 3ARFA 5TH2A 5D71L 4A6YA 5FDYA 4H8WH 4CADA 1I9IH 5L2JA 3VFUB 4IRSD 1BVZA 1V8HA 2KL6A 3HR6A 1Q9LB 3BW9B 1DBKL 2GTZB 3PDOA 4OCWH 4LF3B 2I60H 4S1QL 3WIHL 5JORA 1EBPA 1RSFA 4YBHA 4LLMA 3SN6N 1EGJA 4HUWA 4AIZA 4GXVH 2IQAB 4MQXD 1U92B 1ZHLA 2F5BH 3W39B 3KPMB 3V5KB 1T2QH 3IFLH 4K3JL 1UH3A 3REVA 4D0BB 1LK2B 4GG8A 1J8KA 1LE9A 2AEWA 2IAMA 2UUDH 2A83B 5H35B 1IVLA 1HSAB 1Q38A 1N5YL 2DBLL 3ILPA 1ZT4A 1VHPA 3CFBA 4PJHE 4OSUL 1SY6H 5L2KB 2H1PH 4KJYB 3GKWH 2E7HA 4N0UA 3UTPE 4G6FB 5L7XH 1KBGL 1IC4L 5DK0B 5AWNL 5D72L 1PKQE 4XP4H 4BZ2H 1W72A 3ARFC 1PAMA 4OCRH 3V6FA 1GL4B 1KTDB 5GGQH 3BPLC 4OLZL 1G7HB 4JM2F 1TVHA 4L3EB 2NY1B 1H15A 1AP2B 1ROWA 4R2GC 4RDQF 3C08H 1KB5L 5EUOF 1JZ3A 4HIJA 3D2UA 4BSVA 3WO4B 2EXYD 4U3HA 3IAGC 5DLML 3B83A 1T89A 3T1WA 2A9ML 2IAMC 4JFOA 3T1FB 3PQYE 3HNSL 4Z7VE 1GGBH 4Z6AT 3H9SB 3WHXA 4U6VH 1XGRA 1U58B 2VIRA 1CE6A 3V6BR 5F9WC 3PABB 4QXUH 2MCPH 3B9VA 3P4OB 1TTUA 4LARH 1CLOH 3DV4A 4G8FB 4P2QB 5HYQB 4POZC 4UILL 3BZEB 3B9DA 4PS4L 5H94B 5CMAB 2IBBA 1U41A 3NCEB 4GW1A 4NO3B 3WD5L 2DMCA 2VR5A 1KACB 5HY9A 1CL7H 1UWGL 3PWVB 3DROA 5MENA 1ZHBA 4H8WC 3QRGL 1BAFH 4RAVA 1UQSB 1UENA 3KYOB 2HT4D 2GI7A 1E27A 3J8F7 4MA1C 1T1WB 3J7HA 4FQQA 5EA0H 3NBNA 3UZEA 3LN4A 3FOMA 1D9KA 3W5NA 2FX9L 3MGTA 4TSBH 4PRBB 2DQUL 3PWPB 5TE6L 1T89C 2BNRB 1DQML 1WBXB 15C8H 4QRTA 1FYTA 4ZUUA 2YSSA 3ZSTA 4GH7B 5C0IA 3EDEA 5GSRB 5C0AD 3RA7H 1HWGB 5EBLB 2YN3A 1CT8B 1OAXL 5M7QA 5C71A 2LVEA 4HFUL 3O2VH 2VL4A 4M9PA 5I1HH 1F42A 3DETD 1EX0A 1UVQB 3JTSA 2B1AH 5JPNB 2X4RA 1W0WB 3HZMA 2H26A 4X99B 4G6AC 4J6RL 3SKMA 4RWYL 1EFQA 1FCGA 4P2OD 3VG0L 4K3DL 4Y16D 1BHGA 1Z9OA 2HLAA 3SJVD 2DWDB 1MJUH 4LCWA 5EUOE 2Q1EA 4R2GB 3Q1SH 1TZHA 4FFVC 3EZJB 1RZ7H 2VLLA 2J8OA 2H6PA 3H3KA 4OLUL 5JORB 3B8SA 3DVNA 3MRQA 4HUWB 4XWGL 4AIZB 5T3ZD 1D9KC 4H26B 1KIPA 4XX1G 4YDLC 3VXUA 4G8EB 4NQUA 4OTXL 2WP3O 3ABZA 4GG8B 3O3DA 1TQCC 4JY5L 4XP5L 5BS0A 3GIZL 4FFYL 3ILPB 4NN7C 4AEIL 5KOVC 1CICD 5T33L 4M43L 4Y5YB 1NMBL 2IQ9H 2R0ZL 3BXNB 5CZXD 3MLWL 4PJXA 4WTXA 5HPMB 5AZEH 4HS8H 2YPLD 4BFIA 1C5CH 4PJDF 4WTZG 5GGUB 1KIUA 4P9HL 5HDBF 4LLVB 4RNRA 4DGIL 4RFOH 2PTTA 5J6GB 1I9EA 4MSWA 4Q9CA 5I1LA 2CIKA 3I9GH 2QLVB 2X70B 3V6FB 5IKCA 4MD5A 4XWOD 4UAOC 4JFDA 5FCSH 5C08E 1CTNA 5KG9B 1H15B 3NPSC 5C0EB 3H9HA 3RVVC 5K9QG 2H3NA 4NT6A 4TULH 1R5VA 3MLPA 4MNQA 3D2UB 3M17B 5IVXE 4R26H 3JWDH 4EXKA 3I3BA 3X3GH 4X98B 2ZUUA 2BCKA 1I3GL 1WGOA 3TVMB 3DXAE 3BPCA 2DI8A 4LKXA 2VIRB 2UWEF 4PGZA 2J12B 3MBEB 5LGKA 2HMID 4RGND 2OTWB 2K3TA 2L7JA 1U6AH 1HDMA 4H25A 1XF5A 5AUMA 3DV4B 1QTYT 4K7FB 2EEDA 1LEIA 5FM8A 1F2QA 3FQRB 4H5SA 4LNRB 5K93A 3V7MA 3ZDYF 5T1LD 5FA4A 3SKOB 5HY9B 5MENB 4TUKH 5CWSB 3HRPA 1AH1A 1F02I 3HPLA 4RAVB 3ARVA 1J1OH 4U1GB 1E27B 5CP7B 3F7YA 1VEMA 3IRZA 5DHVH 1YEIL 4FQQB 3CK0L 3VDBA 2YD5A 1INDH 3LN4B 4MD4A 1D9KB 4QY8B 4YDLB 3HZKB 4MB5A 1DTUA 3MGTB 5FOBA 2XKUA 3NCYP 2R15A 3P30L 4QRTB 1FYTB 1TQCB 3SGDH 3CU1A 1NKOA 5I1JL 2B39A 4NN7B 1RIUH 2D7QA 4ESKA 1FNSL 1MF2H 4PJDE 5DR5H 1UEYA 1MCWW 5GHWH 4XMKH 1UWEH 2DI7A 3ILQC 2HWZH 4O2FA 2X4RB 3P0YH 5ECJE 1XIWD 2ZOLA 4YBLC 3O81A 2H26B 3CVHA 4HT1H 3SKMB 2CLRA 4B7LA 1MAJA 3PHOB 3L7EA 3TBWA 4KGLA 3DVFA 4UAOB 2XG5A 2HLAB 4Z76A 5FCUL 2O5ZL 2NXZC 4EDWL 2VLKD 1J1PL 1C5BH 3EYFB 3GNML 3MRNB 4NO0D 4DAGH 3NPSB 1EO7A 2ZSWA 5LWYL 3NA4A 4ODUA 1K2DB 3O8XD 2KPNA 4RAUA 5DJ0A 1BQHG 4X6FA 3DVNB 3INUH 1KIPB 3VXUB 1KC5H 3QDGA 2CMRL 5F72S 1E28B 3JWOH 5CD5C 3AMKA 4LKCB 3MSPA 5MP6L 5BS0B 3KYAA 3OWEA 3C6SA 4OFYD 4MCYA 3W11D 3DUUB 5I74C 3OAYH 4YHPA 3ZE1E 1U8MA 3ROOB 3IU4H 3NIFE 2R29H 4PJXB 3RDTB 3ARWA 1ZLUK 1H8OA 5L88L 1J9CT 1NFDF 2R56H 4XB7A 2QV2A 1F11A 4ZYKA 2D7NA 3RHWF 5BRZB 3O2DH 2PTTB 1MRFH 2V5TA 4MSWB 3PV6A 5I8CA 5I1LB 1CI5A 3LQAC 1RQ5A 4YUEH 5IKCB 3QG7H 1BOYA 4LEOA 4NC1E 2PXYA 3WS3A 1U8HB 2H3NB 1I1FA 4NT6B 3U0PA 1WQVT 2R2HA 1R5VB 4MNQB 3ULVH 2EDQA 1ZTXH 3TWCH 1Q8MA 1WZMA 4YPGA 3VFGH 3P11H 4UQ2B 3UTSE 1DL7H 1QBLL 4PJ8A 4HH9B 4WGWB 3GSWB 2OCFD 5L9DH 2YPVL 4PGCA 2CJUH 3U7WL 3GSRB 2XY2A 3MV9A 5ID0B 3QUZB 3T0EE 1FZOA 3NCMA 4U7SA 3LY6A 4K8RC 3TA3A 2VLJE 4MXWL 4GKNA 3DVGB 1HDMB 1N5AA 5F71A 5LGHL 3QFDA 1LEIB 5CLWA 3FJTA 5JLZA 1BP3B 3O2DA 1P7QB 2UZIL 3UZQA 2X1PA 1YC7A 4NQEE 4XBEH 1F4HA 5FA4B 2H32H 3K4DA 2MQ3A 1OD7A 2BVPB 5EO9A 3O4LE 4TVPH 5I76A 2PXYC 4S1RH 2FATL 1KUMA 3F7YB 3JV5A 4F58H 3VWKA 4MMZC 4OV5B 4MD4B 4HZAA 5TDPA 3VXSA 5CUSH 2DD8H 5FOBB 1A7PH 4YFDB 3JWOC 3T2QA 2R1WB 2Y06H 4PJ8C 5CEXB 5E24E 4PTTA 2OTUB 3EO9L 3QQ9C 1KB5A 4UDTB 5I74B 4EBQH 3S35H 1LWRA 5IHBA 1S7XA 1SJHA 4L9LC 3TA3C 3FAXA 4KTEL 5DZLA 5CGYD 4PP1C 2IANA 4Y4KA 4JHWL 4LHUG 4WI5A 4X4XA 1YEHH 5K9OA 3FMGH 3SCMD 1JNNL 3CVHB 1VFBA 4HXAH 5DQ9A 1WZKA 3LQZA 1PZUB 2JCCF 4P5TA 4LGRB 5DT1H 2IMMA 3MUZ1 4KJPC 1A02N 3MNWB 4LL9A 2X7LA 3A67L 1DUYA 3TESA 2ZSWB 2ED7A 1IT9H 5CSZA 4GQ9H 1KGCE 5GRXG 4TNWK 5DJ0B 1N64H 4GOSA 3WEXB 3IFOB 1RJCA 3U46A 4KRPD 4Z78B 5B39B 4L8DA 4K94L 5JIPA 1CK0H 5C6TL 1TETL 5AAWA 4XRCA 5TFSH 4YGVA 1FN4B 2WLZA 3DO3A 1D5XA 4BQ8A 3C6SB 2VR9A 4MCYB 4EI5A 4HMEA 4ZFOB 1U8MB 4OT1L 4OGXH 1TDQA 5DF0A 3IFNH 3OKDA 3BD4A 4KTDH 4OGYL 2A0LC 2X4UA 1GH7A 4JPVH 4Y4KC 1A6AB 4ZYKB 3MYJA 2QEJA 3LKOB 4HUXA 1G9NH 3TLRA 2C3XA 3EYUH 3JVGA 4NRZB 3VXQA 4DVBA 1B4JL 3WDHA 1D5MB 4P5TC 4J12A 5BVPL 4HCRH 1F00I 1DQQA 4WTZA 5T1KA 3ORJA 1WCBA 3LZFL 4LEOB 3S96B 1YJDH 5E1HB 5FUCC 3IDXH 4OUUA 2Z8WC 1OGAA 1AXTL 1HNFA 2R2HB 3VG9C 1A6WL 4NJ9L 1MVFA 3KG5A 4WHCA 1KPUB 3QEGH 2RR3A 3W5MA 4TOYH 2R0KL 1VEPA 1MELA 5D1ZB 5ETUA 3MTRA 4QHNB 4DK3A 1OSPL 4PJ8B 5I30H 2MNUA 4Y89A 3MCG1 4PGCB 1X9QA 3BSZH 2XPGA 4EI5C 3OB8A 5C07A 3JTTA 2PN5A 2CUIA 1AFVL 3Q6FA 4L9LB 5HI5D 5KVDH 5GRJH 4ZUWA 1YEGL 3QFDB 5FHBH 4HC1H 2V2XA 5FYKD 5DURB 5FUOH 2GJ6D 3U4BL 5JLZB 1NC2D 1JYNA 2X1WL 1LVEA 5KS9E 4GMSL 3JVGC 2VDPL 1BVLA 1ZT7B 3RJDA 5DC0A 4LLQB 4HQQH 5EO9B 2N7BA 3QCVL 4HF5H 4JFXA 4JJHA 4O2EB 3E3QC 3EDFA 3BP6B 3L3GA 3P3YA 3ULVF 1JGUH 2DM3A 4GFTB 5TDPB 3MRBB 4TUOA 3VXSB 1WJ3A 5GZOD 3RWIB 4OZGB 4N8PA 3ME0A 4ZD3H 3VXME 1AGEA 4KKAC 1KPRB 4I77H 3L1OH 3S37L 4QKXB 3IKKA 4PTTB 1X5AA 4HHAA 3GBML 4OLYH 1KB5B 3ZL4L 2CDFA 4U1HA 1S7XB 1SJHB 2EZ0D 3QISA 4YH6A 4HC1A 4E0RA 5EZIL 5JNYA 4MVBC 4N0YL 5IV2A 1FE8L 2BSRA 5HJ3A 1FO0L 4HH8A 1MAML 4JDZA 4LPYA 4ODXB 5DSCA 1VFBB 1X3DA 4PRHD 5DQ9B 3LQZB 1IAIL 3TO2A 4P5TB 3O2WH 1X5KA 1T03H 5T1DL 4KK9C 1YJDC 3HLAB 1G1YA 2WUCH 1DUYB 1F6LL 4HD9A 4FQJL 2GYSA 4LSSL 4M7KH 5CLTA 1X5GA 5CKAA 1UG9A 5GRVK 2X9XA 2YD8A 3D3VA 3VG9B 2PR4H 4ZXBA 1H5BA 1IGJB 1QSFA 2P5EA 3VXOB 4IRJA 4G9FB 1SYSA 1VFAA 4OCYL 2B8OT 4FQ2H 3RWCA 2OK0H 1JTTA 2I07A 4M7ZC 4L29A 2B5IC 2COQA 4YDIH 5EO1A 4PBVC 3ZT7A 3LRSA 4EI5B 3DPBA 4QHMB 3NA9H 3TFKC 3DX6B 3V4PH 4JGJA 5EO0A 3OKDB 1S7VA 1WBYA 3MRHA 1HE7A 2ITDA 5DUML 3MYJB 4W4NA 3L5HA 4X6EA 5SWZD 1KIRA 4JFPA 1UKSA 3ZDXF 3MCLH 3PL6A 1VPOH 4OKVB 2PNDA 2V5SA 4Y1AE 1MCRA 4OUUB 4XPAL 2E7LA 3WNLA 4KK5C 4OQ1A 1TNNA 4Y4FD 3HKFA 3MUJA 3A6BH 4RBPH 3RTQC 4PJIE 1FG2A 4ZXBC 1H5BC 5DS8B 3VXRD 5B22A 3CFCH 3LEYH 3BZDA 4IRJC 3RL2A 1AO7A 4HFWA 5GS1A 5ETUB 3QEQD 2X5PA 4ZS6C 5F9AC 2GTWB 2DQJL 1SY6L 4NKDA 1RIHH 2QADC 3TN0A 5BOPA 4X6CB 4LSVH 2XPGB 1T22B 5C07B 4XB8A 3TNNB 3SHSA 3JTTB 2RFXB 5DEGB 3Q6FB 4UI2A 1QO3B 1EH9A 5F9JA 4OAWB 5HYJB 1ZVYA 4ZUWB 2MCG1 2NTFB 1D6VL 4LCUA 1BGXL 5DYOA 4G9DA 1GC1L 2A74A 1ZOXA 5GGQL 3EYOB 2WNGA 2AJSL 2IFGA 3S5LG 4D94A 3GHBL 3KLHC 5LAXA 2CQVA 5EBWB 5ENWB 3PL6C 2ZG2A 4JFXB 2BNQE 3MJ9A 2E7LC 1IEAA 3OXSA 4XNZC 5BXFA 1CU4L 1DN0B 3L3GB 4PJBF 5SWSD 4R90H 2W1NA 3WDIA 4TUOB 4J3UA 1J86A 5EULV 3T08A 4O9HL 3ARGA 4JPIB 5GS1C 3CFKA 1AGEB 4DCQA 2B5IB 3QWOA 3ARFD 3EYVA 1RZIA 4N0CC 2AQ3A 5F1NA 2EC8A 3PG2A 4R4NC 3BWAA 4LARL 1MHPH 2J8UF 4U1HB 2R2EB 1NCNA 4MA3A 4GXUN 2BY0A 2L7UA 3VE0A 3UO1L 4E0RB 1OQXA 3R0NA 5HJ3B 1HI6B 2YPKA 5F9DC 5KZCB 2DN7A 5ESQA 4KRMB 1BAFL 4KV5E 5DSCB 4HUVA 3LRGA 5F3BB 2AS5M 3N1QC 4PJHA 1ZK9A 4NHCL 2IAMD 3OJDA 1IGTA 1MJ7H 4MCZA 2EEBA 3HI1B 4ERSL 2J5LB 1NUDA 1S7WA 4NZUH 2VXTH 1ZEAL 2FLBT 4X0KA 4TSBL 2ZCKL 5LCVH 1KCRL 3G9VA 3RTQB 1FL6A 2GFBA 4QT5A 2XRAL 2Q7YB 2MKLC 15C8L 3BGMA 4LLWA 5EIQA 4HGKC 2Y7QA 2DLFL 4IRJB 1UZ8B 3ARGC 1VFAB 4J1UA 5BJTA 1A3RL 4Z8FL 3ARDA 4POZD 3V0VA 2I07B 5IFHL 3V7AE 4CU7A 4Q58C 2QADB 3QFJB 1RZFH 4NOBA 4EDXA 3T65B 1FQ9C 3LRSB 3BP5A 2A73B 4YX2L 2A6IA 5EO0B 5HI3C 4P2RE 3MRJA 1S7VB 4HS6B 3MRHB 2H2SC 5HGGS 3VD5A 3QDME 1NAKH 4PBWD 2LAGB 4FABL 1I8LC 2NY4C 1KIRB 4X7TA 3PQYA 4TNWF 1MJUL 4BKLA 5HVWA 2MHAB 4JFPB 4X9GA 3KXFD 4PRPD 3U0TA 3PL6B 3N85H 5IMMA 5E8EB 5J3HD 4ZFGH 1BM3H 4GAGL 4BUHA 4XNZB 2ZWLT 3B2VH 4XNYH 3V5HA 1JRHL 3UYOD 4XHJC 1FG2B 1P2CA 1GHFL 1G1CA 1JFQL 4G3YH 3RL2B 5GS1B 1A64A 1IC7H 1DQLH 3JSSA 3PXJA 3ARDC 2IQ9L 4NKDB 3QIWD 1X44A 2NTSP 4G6AD 4XVUC 2B1HL 1I4FA 3CSPA 3BT2H 3CH1A 3FB6A 5CJXA 1L4IA 3QWRD 1CD1A 3P4LA 2P7TB 1DSFH 1OAZH 3KPOA 2DRUA 2YD3A 4RFOL 1IJ9A 4HLJA 1JWSB 1RFDL 4U0RC 5FXCH 3T8XA 2FZ3A 2I5YH 3HE7B 4O58L 5ABDE 3BKCH 4KY1H 3MV8B 3QHFH 5BZWA 5J9PB 2X4PB 1J0KA 1UH2A 2DTSA 2IPKA 4APQB 4L8BA 3UJJH 3C9NA 4TULL 5T5FL 4UZGA 1T04A 1IEAB 1YY9D 3LS5L 2X4QB 3BMWA 4ISVA 3LVEA 3KPSB 4XXDA 5J12C 5I1IL 2BY2A 1KSRA 3KPLA 3F6IA 4RFNC 4ONHA 1ZA6B 2BRRH 2OJEA 5FDWA 3ARGB 4JPKH 3CFKB 2RCSL 5I66A 1O7VA 1T1YB 2EH7H 3SDXE 4HZLB 3QWOB 5EUOA 1IGIL 3D0VA 3MBXL 5CJXC 5F1NB 1U6AL 4QO1A 3QXDB 3BWAB 4L4TE 4LCWD 2YEZA 3Q6GL 1N6QH 1CQYA 4NQVA 5ANMA 3RVVD 4XC1H 4JANA 4JR9H 3L9RA 2NY0C 2EYRA 1MCOL 1MJ8H 2J1KA 5E2UH 3IT8D 1VERA 1FV1A 3RWDB 4HUVB 1EEYA 2FIKB 1ZLVH 1J1OL 3ZHDA 4LIQL 2Z35B 4PJHB 3FQTB 2R0LL 1IGTB 4OCXH 1JZ4A 3T4YB 5IJKA 2XZZA 3SBWA 1KNOB 3D85B 3QH3A 4WFGE 5I9QC 2NX5E 3FB5A 1V3JA 4I3SL 2EYTA 5F6IC 2GFBB 4QT5B 4WWKA 4CVZA 2ARJA 3BGMB 1YY8B 1PKQB 1CFSA 4RGOH 1MCPH 3IU3A 4J1UB 2XXMB 3V8OA 4WFEE 3OR6A 1UKTA 5KAQG 4PLKC 2X89A 1PY4A 4PLJC 5C08A 3BPOB 4XMKL 4M7LT 2AI0H 3PV7A 3BP5B 5JZ7C 1BD2A 4JFDD 5DRZA 3MNVA 1RVFH 1LEGA 2EICA 5DVOA 4GG6F 5IVXA 1QFWL 4LPTA 5C86A 4U0RB 2BVOB 4HMCA 1XF2A 3K81A 1WWWX 5KVGL 1GGIH 3SE4A 3DXAA 4Z7VB 4NFBA 2A2QT 3BWUC 4D3CH 1WTGT 3WXWL 2XQYK 5IJKC 4WVRA 2F53E 4S2SB 3SBWC 2WK2A 4C55A 3INUL 4YDVA 1IGCH 3BYYA 3V5HB 2DLIA 3X3FH 5LXGH 5J12B 4QRSA 5BO1H 4WWKC 4DZBA 4MA7L 2FH6A 2BDNL 4YLQT 4PUBH 4F57H 4LVNB 2YMXH 2HJKA 2R29L 3DMMA 1KXVC 1R5IB 1I4FB 2VE6A 4D0DA 1YUHA 3CH1B 1FBIH 1NCCL 5D7JB 2BX5A 1KJ2H 2NXZD 3JV4B 4JO3L 4PGBA 5DJYA 4FOMA 2IC2A 2NY0B 5C0NC 1FC2D 5FGSA 5FYLH 1IFHL 3BRFA 1UACH 3QULB 1QYGH 2JKXA 3WKML 2XWTA 3GMLA 3TBSB 3WJLA 4BZYA 3SE4C 3I02B 1NGWA 3NFSH 1KEGL 5GS3A 4X6DF 5CD5D 5BZWB 3EJZC 4XPGL 5K9JH 2IPKB 4LDOB 4L8BB 3N1FC 4PJDA 1I85A 3C9NB 1PEWA 43CAA 2Q87A 3ULVL 1C1EL 4NWUH 1MIEL 4PB0H 5I9QB 5DGRA 2LFGA 1MJJA 4L5FL 1HXYB 3TT1H 4XXDB 1AGDB 2VABA 3SDAA 5F6IB 4KQ4L 5IEKA 3NABL 2F15A 4ZQKA 1N26A 1U8KB 1YEFH 2OJEB 4PLOB 1DL7L 5FDWB 3KLAA 4JM2B 1T7ZA 1JI1A 5I66B 2NY2D 1Q0YL 4I3GA 3TGXA 1N59A 5KN5B 3DMMC 1S9VA 5GJTH 5EUOB 4PGEB 4GG6E 2EIBA 4G43A 1AD9A 4LPXA 4Z9KB 3U1SL 3IJHB 4NQVB 1M6OA 2GUOB 4JANB 3L9RB 4R9HA 3S97C 1RUMH 2EYRB 1NEZA 3NMEA 3OKLA 3FONB 4YHMH 5B38A 4HG4K 3CSYB 3ARUA 3OKMA 3WJLC 1RZJH 4TVPL 4JFHD 3QDGD 4P3CH 1PJ9A 4E41B 5DJ2A 5FF6A 1WFNA 1G7PA 1EPFA 2MTPA 4LRNL 4F7TA 1RHFA 3O6ML 3QYCA 4NNPL 5EU4A 2DD8L 5EPMB 5DI8B 2IADA 1UZ6F 3C5ZA 2O5YH 4XNUH 5IBLD 3SDAC 4CVZB 3FB8B 2UZXB 4OF0A 1P84J 5JOEA 4ZO6A 4NFDA 1CFSB 3IU3B 1XGUA 4FQIH 5TGBA 1FIEA 5IHUL 4DGVH 1C5DA 5FB8A 1OB1A 4WI4A 5EN2A 3FO1B 3MLXL 1RJLB 4WUUE 1HINL 1HXMA 4NQDE 5ISZB 4LSTH 5DRZB 1XGYH 2ZJSH 2PXYD 4E5XA 4JRXE 4WFFD 1IAMA 3GUTA 4HPYL 5IG7A 2EDWA 1XF2B 4JPWL 5E99H 2X4SA 3C6LA 5FM5O 5FV2A 1QSEE 5DD5L 3OKYA 2RBLA 5J1AA 2P8MB 2DDQL 2Y4SA 3T0EA 3MR9B 3UPCA 1I3VA 1MNUL 3QQ9D 2VLJA 4YDVB 1MEXL 5JW5A 2VISA 3MV9D 2R8SL 1DVFB 3B6SA 5JDSA 3SEPA 4I3RL 2DIJA 2GY5A 1CK0L 3C5ZC 1EK3A 1FO0B 4QRSB 3TA3D 3CXDL 1BBDL 5C0CE 1T80A 2QJDA 1UM6L 1YPZF 4KZEH 4NQEA 1RV6X 4PJ7F 4WU5A 1IAIM 1RI8A 1ZGLP 1FZJB 2VKXA 2XICA 2VXQL 1XEDA 3EZ8A 2ICEB 3O4LA 3WUWG 3RFZC 3DMMB 4NC1C 2YBRB 4UT7H 4D0DB 1A1OA 4POUB 2PW1A 3SQBA 4DJMA 5BQ7A 4QRPE 5IVZB 4NWTH 1QRNE 4PGBB 1GYAA 5DJYB 4HJGA 1LO4L 2YOCA 3LKSA 4PJAE 3VWKD 2XKNA 3CPLB 3S34H 4JM4L 5L8JB 4KK8C 3ULVD 5C70A 1KLUA 2X4OA 2BSSB 1EMTH 1RZJC 3N06B 3GMLB 4HCRL 3BQUA 3WNNA 4XBGB 1JPSL 2JJWA 3WIFA 5F7EH 4G42A 4TSCL 5CIPA 1S3KH 1MWAH 4PJDB 3DSNA 3T0EC 43CAB 4GLRI 2OMBA 1KTLB 2EE3A 3QEGL 1GGUA 3D9AH 1MJJB 4Y88A 2VDOH 5GGVL 3SDAB 4PJCF 5IEKB 2A0LD 3BAEL 5DJXA 4L1DA 2IAND 1NSNH 4Y4KD 2DM4A 3KLAB 5GGSY 3LEVH 4YE4L 1JPTH 3GMPB 3LKPA 3MODH 4KJWC 5T5NF 2W60B 5E9DE 3WE6B 2DTML 1K8DA 3TH3T 4MNGB 3H9YA 1HILB 5J0BA 4FTVB 1IAII 5KANG 1RUQL 4JG0H 5GRJL 5JQ6H 4TVPD 3GB7A 4Z77A 1MPAH 4UIMA 5FHBL 3UBXG 5D7LD 2ZPKH 2FRGP 5FUOL 4K71C 1AQKH 3T3PF 5JHDB 1OARH 4B0MM 4D9RD 1NEZB 1TJIL 2EDBA 4KKLD 2X4TB 3E6FB 2E27L 4F37F 5B38B 1G7QA 4O4YH 3K8LA 4HQQL 4OFVA 3BQUC 1V3MA 2EO1A 4JY6B 3OKKA 1MCIA 2HA1A 5FF6B 4CUCA 4HUUA 1MWAA 3IRPX 1NBZB 2D7PA 2ILLA 3LS4L 3D0LA 2BVTA 1NGYA 2P8PB 3JUZA 4M1DL 3B5TA 4PV8A 3TT3L 3ZKSD 3VFVA 1YPZE 1TQBB 3C5ZB 4ZD3L 3ZE0F 1B88A 1UJ3A 2JK5B 3GGWA 4MJ6A 4I77L 4PJ7E 4UIKL 1L0QA 4LMQI 4PIRF 4Z5RA 3QDJE 1J0YA 3O11A 4J3VA 1VADB 5SX5K 3DJ9A 1FP5A 4YC2C 3CFDA 4C4KT 2DQGL 5F7YC 4G7VH 5EN2B 1A21A 1K4DA 3NIDF 1HXMB 3FCTA 4K3EH 4I5BB 5T1KD 4CMMA 2F58H 1TJHH 1OGAD 3VD4A 4F9LA 5IG7B 5TDNA 5I8OL 2VO5A 2IH3A 2ICWB 4XNXL 3O2WL 2AJUH 2X4SB 3UTSB 1BF8A 4JZNA 3QCTL 1NMCC 2GSGB 4XCCH 3VGHA 4KKAD 5FKPA 1WF5A 4M7JL 5GGSB 1QLEH 5EORL 3T0EB 4NYLA 3WXVH 2H41A 2IPTL 3LB6C 2IG2L 2VLJB 4Z7NF 2HH0L 3B6SB 4HIHB 4KWUA 3KLSA 4PJ5E 1MREH 1OL0A 4LOUC 3WL9A 4JG1L 1UJ3C 1P4IH 1LMKA 2OK0L 5KS9A 5K9KA 2FO4A 4ONOA 4MVBD 5A2LH 3U0WH 4NQEB 4QTHA 2OR9L 1KENL 2BOCA 3CZFB 4NM4L 1O5DT 3KPNA 3O4LB 5I15L 2Q76B 5JQHC 3LDBC 3PWJA 1A1OB 1JIBA 2PW1B 4E42A 5BQ7B 5B4MD 3T3PE 2V7NA 1WWCA 4KK9D 4S0TD 3PNWB 1I7ZA 3X11B 2C1PA 3DHMA 2BVQA 3GJEA 4HJJH 4ZPTA 2XKNB 1PLGL 1G7LA 4KAQL 4PJ9D 4F9LC 2WIMA 3VXMA 1KLUB 3GRWL 1LO5A 3PJSA 1FZMA 4JQIH 2BERA 1HWHB 4P4KA 1BFSA 5I1AA 4GMTH 2ICWI 1UB6A 3P2TA 4NQXB 5CIPB 1NFDB 4S1SL 4LK4A 1KIQA 3CXHJ 5IHZA 1K8IA 1V3KA 3C60A 3GDBA 3TFKD 4WFHE 3RWGA 3LEYL 1SVCP 3VRIB 1S7SA 1F97A 4OLXH 5KSAD 2Q8BH 4HBQA 4P9MH 5DJXB 3UPRB 3HPJB 2C3GA 3WLWC 2KBGA 3EO0A 4P5MB 1KYOK 1WZ1H 1FRGH 3RWFB 3GMOA 4YC2B 5F97E 4RWHA 2W9EH 2FECL 1K8DB 2DQIH 3NZHH 2BHUA 1M71A 5DHXB 3FOLB 3GB7B 3SDCB 1YMME 3UZVB 1NLDL 4RRPG 1NAML 4KK5D 1TZGH 3GSVA 3D3VD 4HAGA 1FZKA 5DRXA 1G7QB 4ZXBD 1QSFD 5CD3A 2P5ED 3V52L 3BGFB 5IW6A 4GKOA 3CLFH 3TP4A 3VDCA 4IRJD 4YHKH 1YNLH 4UNTA 4P4KC 4Z95L 1NMCB 1M7IB 1K5NA 4AEHL 4HUUB 1T0MA 2DQCL 1ZMYA 4GQPH 3W9EA 1DEDA 4OZFA 2NY7L 3FN3A 4FQXB 1ONQA 1NGYB 2PTVA 3C60C 2DLGA 2DYPD 4PV8B 3FZUC 5E6ID 3QPQC 4RMTA 4HAFA 4YWGL 2GSIA 4F9PA 2DIBA 2ESVE 3CFEB 1UJ3B 3GGWB 2D7OA 4WHTA 3SQOL 1FFQA 4Z5RB 3MOAL 5F44A 4F2MA 4ELKB 5IESH 1I8IA 1CYGA 3CFDB 3D39E 3MJGX 1L9NA 1QD0A 5KVFL 3LDBB 3GO1L 4RMQA 4LVOB 3QNXA 3FCTB 2Q6WA 2F54E 4WY7H 3VW3H 3KR3L 1P7KA 4ZUVB 4HPOL 1XCTA 1WWAX 4PJIA 5F7HA 1DQDH 4X4ZA 4P3DB 1JRHI 4KHTL 1S9WA 4JFEE 5F21B 2IH3B 2YD4A 2ID5A 1I1AA 4XP6H 4ZDHB 1AO7D 4HWBH 2GT9A 5I73C 4QRRB 3HG1B 4QXGL 2XWJB 3TNMA 3IJYA 5J57B 1I8KB 3TN0D 3K1KC 1Y6KR 4UT9L 4N0CD 3SE8L 4NRYA 1U36A 1QKZL 3ARQA 4OQTA 4ALAH 2CK2A 1U8QB 3EKCA 4PD4K 3QEHA 1F4YL 3X13A 1IQDA 5C92A 4BA8A 5D2NE 5ACLA 5KS9B 3QUXB 2FO4B 1EEZA 4QTHB 1I9JL 3L7FA 2WM0A 4HUMB 3KPNB 1AR1C 1JMXA 3QJFA 5C0FB 2RQ8A 2G5BA 2BNQA 4YHLH 5JW4Q 2PCPA 1G6RH 1K3ZA 4E42B 1YEJL 2C3HA 5GGRA 2MPAL 3WS6A 4ONFL 1L7IH 4WEBH 1I7ZB 1JHKH 2BVQB 4MDIA 3GJEB 4ZTOH 4ZPTB 1NAKL 3OKNB 1ZLUH 3O6LL 3KPTA 1G7LB 1P4LB 5F1IA 3IXTB 4CDHA 4L4VE 2AV7A 1UCBH 4CNIA 2CKBL 3VXMB 3PJSB 2WW8A 1I1AC 4HWBA 3QBTB 2O5XH 4QHLB 4LCIH 1AD0A 1AGBA 4P4KB 1HH9A 5I1AB 4X5LA 1KCUH 2G75A 2ZOKA 3UAJC 5F7DA 4XNYL 3LKRB 4MAUL 1L6ZA 3RI5K 5CEZL 5IHZB 3KPRE 1ZWIA 4NCC2 2AEPH 4TNVF 4DTGH 1QFWM 2ZUVA 3C60B 2WZPD 4Q7DA 3RWGB 4C54A 1IBGH 4K9EH 2DMBA 4YDKH 3RZWA 2D3VA 1CDUA 3AM8A 4EN3A 3EO0B 1MFBH 3NTCL 3JV0A 4PB9H 4EOWH 3RKDC 2EH8L 4U05A 3BT2L 3BZ4B 3OBAA 2NY4D 3GMOB 2AAVA 4U1NA 2G5RA 4U6XA 4JRYE 2HN7A 1G6RA 2Z31A 1H0DA 5C9JA 2GK0A 1D3CA 3WS6C 4AIXA 4Y19E 3RNQA 4LHUD 2I5YL 4Z18A 3QO1A 3DOSA 3UTPD 3G08A 1Y0LA 3GSVB 3QHFL 1FZKB 4XHJD 5I2IA 5CD3B 3T2PA 4ZODA 2ZUSA 3M8OL 2WINA 5IW6B 5IIEA 2A6JA 3BD3A 4HULB 3KYKL 4OCLC 5H2BA 3UBXA 2AK4E 4ODHL 3ARDD 3HZVA 3OSKA 4AK1A 4JGMA 43C9A 1T0MB 4JZOA 2JJTC 1QFPA 3UDWA 2PYED 3W9EB 4OZFB 1PEZA 1ONQB 4P2RA 1I1RA 1HZHL 3D87B 2BRRL 5BVJB 4MLIA 5I1DB 2VJXA 2DQTH 2CGRH 2GSIB 2X10A 1BBJB 1QFWI 3AM8C 3QDMA 3QO0A 5MEPB 4EN3C 2MQ0A 3LHPL 1I8IB 1FL5B 5IMKA 5I1EH 3GI8L 3MYZA 5BMFL 3V2AR 3PQYD 5IMOA 1AXSA 2NXYD 1H3VA 5D6CA 1U3HD 3HFML 2Z31C 4Y1AB 2A77L 4JR9L 4LASL 2Q6WB 4LCYA 3TJHC 3U9PH 1PZ5A 1MJ8L 5IROA 1P7KB 4H0GA 3HMXH 1NEUA 2P8LA 5KJRH 2EDOA 5DDHB 2X05A 3U2SA 1DFBL 2WBKA 3IDYB 1NC4B 4Z0BH 1QVOA 4PY7A 1S9WB 2XZCH 4WJ5A 3TIDB 5CEYA 1VB9A 2Y23A 1FFOB 4U1MB 1FL3A 2ICES 4M6NH 2NY5L 2DWEA 5T1MB 4I4WA 4L8SA 3TNMB 1BMGA 4HK3J 3CVIH 3UDWC 1ZS8A 1DLFH 1KCSH 4NRYB 3QT2A 1IQWH 4I0PA 4OZHE 4WHDA 4RGOL 3C8KB 4AQOA 4K9EC 1CE1L 1J8HE 5FYJL 3QEHB 2NY0D 4JHAL 3L95A 5CGMA 3DLQR 3I85A 1EEZB 4GJTB 5H37G 3FT2B 1EO5A 4B53A 4M5ZH 4FG6D 3H0TB 5IBUG 2G5BB 2PO6D 2BNQB 1DR9A 4Z7WF 3GJFH 2PCPB 4U3CA 4PY8I 1I3UA 1A0QH 5IROC 3HMXA 2OR8A 1CLYL 1HCFX 4MDIB 1AXIB 4XPFL 1GGIL 4XAKE 5F1IB 5JXAL 4FQHB 4UMGA 3ARSA 4CNIB 3QUYD 2IEPA 4YXKL 5BCAA 3SDXA 4NN5C 1AD0B 5EFIA 3RVWD 2ZOKB 4EI6B 1C08B 4MD0A 4L8SC 5GGVY 4PLJD 4L4TA 5HHQB 1ZWIB 1QQDA 2VH5H 1IM9D 4I0PC 4U1KB 2OLDA 4JLRA 1FPTH 4XP1L 3VCLB 4X5XA 1UM4H 1FORH 2YMXL 2HT3C 1S9XA 2WBJB 4EN3B 2GAZB 2YRPA 3GZKA 5SV3A 4X9IA 5DD1L 4CVWA 4XNQA 2NZ9C 3PGCA 1A47A 1KJ2L 4U1NB 3BKMH 2HN7B 1G6RB 2Z31B 2ZP0T 3BO8A 3OXRB 2C1OA 5AZ2H 3ZKNC 1AE6L 1NCWH 5HGAA 5HSFA 5FYLL 2NX5A 3DI2B 1OT1A 4GKSB 4Z0XB 5CBEB 4FA8A 1T66C 4MMXC 3W9DA 1MCWM 5GJSL 3QO1B 4KDVA 5D70H 2FB4H 5L0QB 3ZYZA 4QXTA 5DK2B 5I2IB 4WWKD 4X9BA 3JZ7A 3BVNA 2WINB 5TE4H 5IIEB 4FFZL 3N9GH 2AJXH 2EDHA 3STZA 2QBWA 3ES6B 3HZVB 4NDMA 43C9B 1T1XA 5C08D 3W2DH 3H9SE 1F2XK 3P4MA 4JVUA 5HDOA 1BD2D 3B9KD 5F8QC 2AXGA 3QZWB 3H3PL 4OF8A 1WV7T 4Y0GA 5C0ND 2OR7A 5A3IC 5E5UB 1OAYL 2GJZA 3G6DH 5DMGC 3BIBX 1J0ZA 1P9MA 5DRNB 4Z7WE 1B4RA 4JN2A 1U2CA 5IMOB 1HHIA 4C59B 4R8WH 3SE9H 3OAUL 3DXAD 3HZYB 2F53A 3OMZA 3EJZD 5HYSG 2DOCA 5C8JA 4I13B 3SDDB 3FFCE 3FB7A 2P8LB 3U2SB 3OJMB 1U8JA 4MZ2A 1JK8A 3DGGA 1QLRA 5CEYB 1BIIA 1XGPA 1FL3B 1OLLA 4N0RA 1G84A 4NN5B 2DWEB 5LQBH 3MO1B 3OTTA 5ADOH 4I4WB 3O41A 4OKDA 4AG4H 2ADIA 2P5WA 1VDGA 4IRZH 2VXSH 5HD8D 1I9RL 1ZS8B 3EFFA 4IOFC 4PJGF 4XNUL 4YHNA 4LLYA 4OGAC 1KEMH 5T3XE 4X80H 2VQTA 5BV7L 5C0RL 3DARA 4FQIL 3JV6B 5TDOA 4PP2A 4JZJA 3LSOA 5CINL 3DSFL 5DD3H 5GSVB 4XCFL 3V6OE 4MHHI 1GZQA 1P9MC 2B4CL 4MDJB 3V6ZA 2PYFA 5KW9L 2EIZB 4LSTL 2JIXB 4MQSB 1XGYL 4FQ1H 2ZJSL 3SKUD 3S36L 1JN6B 4LPVA 3WFEL 2W38A 3ZT6A 5TQ2H 3NCBB 1Z0NA 3FQNA 2XQBH 4ODTL 5E99L 3EYSH 1TIUA 1I1YB 5D1XB 3SKJL 3A6CH 1JHLL 4JY4A 1LK3H 4YO0A 1V7NH 1OW0A 4HIEB 5DUPH 5EFIB 4GG6A 1FGNH 4OF6A 4X7DC 5AYUH 4DQOL 3G5YA 4Z7QE 1QQDB 3PP3K 4NPYA 1CBVL 4FNLL 4NKOA 4X5XB 3LN5B 3O6KL 1JPGA 4LSPH 3AS1A 3MRLA 4JZJC 5FYLD 1YQVL 2CLZA 4WO4A 3TBVA 4MA8H 3UYPA 4H1LG 3PGCB 1F6AA 5ESVB 4ZTPH 4AM0B 2VZ1A 1B0RA 3BH9A 1JF5A 5JOFA 1LP9F 3BO8B 1X5FA 1HKLH 2XA8L 4FP8L 5HGAB 3CCHB 3S34L 4P48A 2ZCHH 2I24N 1UT9A 3KJ6H 3W9DB 4ODWA 1P4BL 2XQYG 2YUZA 3QA3B 5F7EL 2IFFH 3BVNB 2H8PA 4WENB 1G7MA 1S3KL 1OW0C 2A38A 2EKJA 4WUUA 2LABA 1CLZL 2E6PA 1UYWL 4X9FA 4J2XA 4M7LL 5C2BH 1G9ML 1JZ2A 4JRXA 3NACL 4W6XB 2R1XA 2BK8A 1JJUA 1JPTL 2NY3C 1XZ0A 3MJ7B 1DQJB 4GW4A 4XI5D 4OUOA 5HXMA 3WFBH 4KK8D 2C3WA 4WCYH 1QSEA 4Q9QH 5JR1L 2HTLD 1MPAL 1T2JA 3C6LD 1HHIB 1IL1A 1ZKAA 32C2A 2V5MA 4OM0H 1E4WH 2F53B 2APVA 2W92A 4BQ6A 2DL2A 1VFOA 5IT2H 3PWUA 5ITBL 4X5WB 3D25B 3V0WL 3S98A 3VA6A 3QI9D 5DD6B 1NL0L 3FB7B 3EGSA 5H37H 5C0CA 3LIZL 1GZPB 2Q86A 2GEEA 2X42A 1JK8B 3X12A 3DGGB 1QLRB 3WSQL 4U1JB 3CU7A 1BIIB 3P73A 5F7KC 4MNHA 3ARBA 4KJWD 1U95B 3RWHB 3QUMH 4MXQC 4QRPA 1QRNA 5IW3A 3EFFB 1IGFH 3JXAA 4YHNB 4LU5H 4LLYB 4M4RA 3O6FA 4PJAA 1NAMB 1PG7L 2Z92A 3T2NL 5EOCL 4N8VG 1EVUA 1PD6A 2VUYA 5E4EC 3MV01 1MFNA 4NOFA 3BRDA 1OAQL 4JZJB 4LSRH 3LSOB 4EZMA 2NZIA 4PRIB 4PGDA 1PKOA 3OQ3B 1YDPA 1NCDH 1ZGLA 1W0VA 1RJZA 4U31A 2BFVH 1IGML 1FLRL 3TO4A 5DJ8A 3BQUD 1PVHA 4NP4H 5LBSH 3VDAA 5CJOH 4L8CB 4S1DD 1TJHL 3NCJH 4OD3H 2ZNWA 1JPFB 3RGVA 3U4EB 2XY1A 1OTTD 1YEEH 3STLA 5CBAA 4PRAB 3FQNB 4LSUH 2W91A 5FO7A 4M5YH 2AJUL 4G8GD 3SOBL 3BUYB 4PV9B 4ETQB 3L5WB 1RZ8A 4WWID 1PYWB 3OX8B 1GGTA 5J11C 4LLUB 1D5IH 3G6JA 4YO0B 2X6MA 5E9DA 5FYJU 3WXVL 3UC0H 1ORSB 3ARBC 5KVMC 3VFPB 4GG6B 4ODSL 1ITCA 2VXUL 4R7DA 2ENSA 1IILE 2FECI 1NCAH 2MQCA 4KHXH 2Y5TA 3OR7B 4H0HB 2IPUG 3C09B 1NDMA 1N8ZB 1G0DA 3FN9A 3O6FC 4N9GA 1Z5LB 1C7SA 2VXVH 2VWEE 3MOBH 1MRDL 3DURB 4GO6B 1F8TH 2BOBA 4QOKE 1P7HL 5TF1H 1P1ZB 5EOQL 5CJ8A 3TBVB 3MRGA 1TJGL 3BHBB 1B0RB 4XH2A 5IF0A 1A1MA 4LVHB 3ULUE 2F74A 4HJJL 4CW1A 3RGVC 3VU2A 5GRWA 3I50L 4ZOCA 3BE1H 4PJ7A 3MMEA 1RZKH 4Y2DD 3VGDA 3QDJA 3U30B 4JQIL 1D6EA 5IFJA 1HQRA 3ZHLA 1GCFA 2H8PB 4YAQA 3S4SG 3NFPA 1CG9A 3CFIC 2PF6A 2A6DB 4XGZA 4FXKA 4NQDB 3PE9A 2EE6A 4N1HB 2Q8BL 4P9ML 3TYGH 3RY5A 3HCVA 1Y18A 4XVJH 4TUJA 5ADPH 4XAWH 3WFZA 2R1XB 4RISL 2CKBB 1XZ0B 5DMKA 4X6DB 4GW4B 4JN1H 2D9QB 2DQIL 3NZHL 3GK8H 1QSEB 4HWZA 2PETA 3QAZC 32C2B 1E6JH 2F5AH 5JDJA 4WW1A 4PLNC 3PWUB 5JOPE 5D5MF 2MOVA 4PJ5A 5C0CB 5DJCB 1C12A 5ALCH 3CLFL 5IB3A 1GAFL 3CDYA 1INEH 5DVNA 1U8LA 4X8JB 4OD2A 3WLWD 3DRQA 1R3JA 4OCSH 5EOTA 2HFEB 4MS8C 3QNZB 4MNHB 2JELL 3ARBB 3H6JA 5DK3A 5JHLH 2DQFA 4QRPB 1NH6A 3FQUA