4D8PB

Structural and functional studies of the trans-encoded hla-dq2.3 (dqa1*03:01/dqb1*02:01) molecule
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
219
structure length
193
Chain Sequence
PQPEQPEQPFPQPSPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTLLGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTISPSNLLVCSVTDFYPAQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional studies of trans-encoded HLA-DQ2.3 (DQA1*03:01/DQB1*02:01) protein molecule
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA-DQA1 protein
total genus 36
structure length 193
sequence length 219
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4d8pB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4d8pB01
4RGNB 5C70A 4QY8A 3RUGF 1GC1L 4JHZA 2VLKA 1T0PB 5KTEH 3WLWC 3OKMB 4XPTH 3VDCA 2DDQL 4HKBA 4MQTB 4LPXA 4OCMC 5ANMB 5KG9B 5JDSB 1MRDH 3RL2A 2AABH 3R8BB 3RGVB 4PY7B 4QOKE 5CKAA 4OFKA 1RZKH 5DYOB 4NDMA 4RMTA 1EJOL 4PJCA 4XVJH 2EDFA 1RI8A 4K94L 2D7QA 3WKML 3MXWH 1KIPB 5ECJE 2OS7A 3RA7H 5SX5H 5IGXL 3QHFL 1KBGL 3UBXB 1AGEA 4GLRI 4Y4HC 4LRNH 3IJYB 3K2UL 4WFGE 3JUYA 3EOTL 5I2IB 3UZEA 5IHBA 3TESA 3SJVA 5E1AA 2QR0A 5D1QD 4QT5B 1P9MA 3T0BA 1UWXK 4OJFH 4YZFE 3BKML 1IGML 1U58A 2IAMC 3T8XB 4R2GB 2BSTA 3EDFA 3D85B 2RB8A 3ZHKA 3HE6D 3M45A 2E9JA 1YEJH 4XP6H 2IAMB 1SEQL 4XI5C 1UA6H 4M7JL 4OIIH 1ORSA 4EDWH 2GI7A 3AREC 2K7PA 4X0KB 3TJEL 4DGIH 1D5BB 3EFFB 3BUYA 2I9TA 2OL3L 1FH5H 2XZCL 4KUCF 1YZZA 1OLZA 3MRHB 3QNZB 3FO1A 2X9WA 4P59L 3VFVA 5F21B 3PGCB 5DMJB 4HXBH 5EZIL 4KKLD 4Y5XC 1CFTB 5K9OB 1WUNT 3DNKA 1GXEA 1MVFA 4AT6B 1T80A 1DZBA 4YNYB 4NWUL 5DFTA 4MNGA 3MLTB 5B38G 3W81A 4JR9H 4M7KL 1J0JA 4MD4B 5FXCH 1DTUA 1Q9WA 3OKLA 5BZWB 1Z9SA 3I50L 2C1OA 3BQUD 4XB8A 3GSXB 5EU3B 4Z5RB 4P23C 4K3EL 3K46A 4L4VB 2NR6C 3CFJA 4K7PY 3VGAC 4I0KA 2UVFA 4MDJB 1DQJA 2C1OB 1KTLB 3EDDA 5T3XD 1MCEA 2JCCF 4LQ1A 4JPWL 1S7VB 4XVUD 3AGVA 4C54A 3PWPB 1G84A 2LU4A 3VXRA 4YIQB 5IB5B 3QEUB 1HN1A 4HUXA 3RKPA 2Q7YA 1U91B 3AS3A 2X5PA 1HQRB 1QPPA 3D2UB 5FYJL 2ZOKB 4YX2H 1MI5A 4NBXB 4YHNB 5T1DL 2YD7A 5DRWA 2I24N 3PV6B 1Z9MA 1AKJB 4NUGL 3EOAB 2H32H 3FN0H 4GRLB 3W39B 1QSEE 3W0WB 1HH6B 3ZE0E 2BX5A 3ARBD 2F9BT 5EIVA 3WFBH 5H37H 3PP3K 4OZ4B 1H3PH 4MXVE 4ZS7L 3FRUA 1RZIA 5D7IF 5E00B 1RIUL 3T1WA 1BWWA 4OZGB 3VXUE 1WT5C 1UG9A 3BP4B 1JHLL 3E6HA 3I2CL 4LQFH 5FYJU 1PG7W 1T1WA 1EHLH 3G5YA 1DEDA 2GAZB 5MENA 1CLOH 3VDBA 5IQ9A 1C5DA 1I7RA 2V5MA 2ED7A 1GYAA 1RZJL 4RBPK 3HZKA 2YPLD 1EHAA 1ADQA 1WQVT 1BD2B 5I1IH 2ICEB 4YHPA 3VI3F 4XNYL 4ZYKB 3R06A 4DAGH 5KW9H 5BOZG 1AR2A 1B6UA 4JN1L 1RJLB 4X6BB 1R6VA 2Q3ZA 5J4MA 2CIKB 5HD8C 4P23B 1QSFA 4Y2DB 3DO7A 1FE8H 2XY1A 2J1KA 5HPOA 1A2YB 4XXDB 5FM4A 3GO1H 2P44B 2WLZA 4MNHA 1HK6A 4HK0B 4QOKD 5CINL 3UYRL 1H3TA 3MC0A 5ANMA 1XIWD 3FN3A 4GBXC 1NGZB 3UJJH 4GAGH 4ZAKA 2HT4D 4QLRA 2NYYD 4Y2DA 4ELKA 1GPOH 3LAFA 3MJ9H 5DJAA 1SBSL 1NFDF 2E9IA 4JAMB 3MLPA 4K8RL 5I18L 4PJEF 5EO0A 5D72L 2Y36L 5GRVK 4S0TD 3WN5A 1PY4A 1U93A 3UO1L 4D2NA 2H8PB 2NY3C 1A7OL 1DVFA 3QEQE 4PJHE 4ZYKA 2Y36H 4JKKA 5IHUL 1EAJA 4Q7DA 4IRZL 2EKJA 4HUMB 1RVFL 3GMRB 4LSUH 4L3AA 4YR6B 3B3IA 4NT6A 3EYQC 5F96L 4JDZB 1J5OH 1IAIM 3P0GB 4U0RC 1D9KA 1AHWB 4OCYH 4TVPD 3T0VA 3ISWA 4M62H 1ZKAA 5FGCE 3F5WB 1VB9A 1MCBA 4BELD 4M9PA 5C0ND 2CIIA 1G7JB 1P7KA 2APTA 4KDTC 1IT9H 4CNIA 2EDQA 4ORGB 5C07B 3UTZB 3K2UH 4HT1L 5GS1C 5DJYA 1HHKA 1IL1A 4LGSB 3D18B 1JGVL 4ISVB 4I2XE 1XIWC 4ETQB 4KK8C 2QQKH 4GW5A 5JHLL 5MI0C 3AAZA 1GHFL 2HT3D 5FYJE 4NZRL 4LSPH 3EFFA 4X0KA 3QPQC 5CIPB 4QRSA 3JWNC 4KDWA 4EXKA 1A7NH 1B88A 1H8OA 1SEQH 2VUOA 1KCUH 4MSWA 2DL9A 3ARWA 3J8F7 1S7UA 2APVA 4PJ9B 2FJFA 3QJHB 1FFOA 2XQYG 3BEVA 4YXLH 1G6RB 1BZ7A 1H5BC 3ARGC 1NCWH 3CD4A 4H25A 1HOCB 1DBBL 3C09C 4NO0D 2GK2A 2QR0B 2LQRA 2ZJSL 5FGSA 1WFNA 5IM7B 3SJVB 3OQ3B 1KJVB 4U1HA 3UP1A 2BK8A 5EU3A 2DQGH 2O5XH 2BSRB 4L8SB 4QXTA 3B9KA 1XCTB 4MD5A 1WBZB 1NQBA 4JDVA 1I7UB 4D3CL 5CWSB 3T3MF 4G8IA 3GK8L 3EYVB 4P99A 5IHZB 1X7QA 4RCAA 5C0GA 4JVUA 3P4LA 3HB3D 4MCZA 4GKZB 1DE4A 4ELMF 4M9OA 3PJSA 4FNLH 4PGEA 4YK4B 1KFAL 4MJ6A 3RL2B 2LTQC 3ALXA 4JDVB 3QWQB 2CDFA 3AS0A 4HKBB 5F9DC 2XZZA 3NPSC 1Q1JH 4Q97A 4FXKB 2FB4L 1D5IH 2UZYB 3QUZA 1T7XA 2YUXA 2JJWA 3MJ6A 3MRPA 4YDJA 3NN8B 1EVTC 5GGVL 1LO0L 3B9EA 4J3TA 1JPSH 2NXYB 4MQ7A 1XIWB 2PO6A 3RKDC 5I1EH 2ATPA 4X6FB 4XH2B 4F7TB 4NQEE 4G42B 4C83A 2EXYD 3FFCE 1WV7T 2HA1A 4NCC2 3ARZA 4XBGA 5DGRA 1FO0B 1QKZL 4LHUA 4H8WL 2NY1B 5HYJD 5I76A 1DANT 3L3HA 4N0YH 2GJJA 3T09A 3PWLB 2YMXL 4GXVL 3S36X 3H9HB 2VDOH 1YMMA 5DD3H 1PX3A 5DEZA 5C3LD 5B3NA 1WAAE 3AUVA 1QUNA 2YBRA 4IRJA 3BPOB 5FB8B 3BWAA 1TVDA 3BKCL 2P8PB 1HKFA 2DOCA 4M5YL 1YMMD 2R0ZL 4QGYA 5C0CE 1KEMH 3MRLA 1ND0A 1M6OA 3FMGL 1XGUA 2Q7YB 5ICXA 1ZGLB 3SDXE 1EHLL 2EC9U 5JORB 4ODBD 4GFTB 5F9OH 4NHUB 3ZHDA 3O9WA 4ONGH 3OF6D 4NC1C 1J0YA 4U1JB 3JTTA 3OAYK 4HH9B 2VDLH 5J7CC 4NRXB 4X4MA 1X4ZA 1V7MH 3SDDC 1MCOL 3QJFA 5IFJB 3OMZA 5JZ7D 1Q9WB 3BXNA 1TITA 1X5FA 1M7DA 4OI9A 5BS0B 2RHEA 5EO0B 3O6LL 2X4NA 4PJGA 1AXTL 5KJRH 5IJVB 1NEZA 4N0UE 4JFHD 5EZOH 3HR5B 4NPYA 3BEVB 4ZUTA 2AJXL 1DBJL 2A6KA 3BP5A 1N64H 3P11H 4JRXD 1JUFB 3U6RB 5IROC 4JFYA 4PREB 2HP4A 5DXWA 2IH3B 3LKQB 1R5WA 2WIMA 4PY8I 1IC7H 3UPRB 3B9VA 3MBEB 3X3GL 4F15B 4R3SA 1QSFB 1KIQA 3IT8D 3QZWA 3TEUA 3FO9A 4ORGA 3UTZA 4C55A 1CGUA 1ODAA 3CLEL 1MUJB 3QNXA 1CG9A 4F3FB 5F8QC 1U2HA 4NO3A 2ORBH 1A1MA 3V6OE 3G6JA 5J3HC 3L3JA 2BVOA 1ETZA 4OZHA 3TGXA 1CN4A 2J6EH 5ADPH 1JK8A 4LVOC 4JQXC 2E7LC 5FA4A 2B20A 1IEBA 1SQ2N 4MX7A 5IB2A 1OPGH 3OX8A 3CLEH 4HV8B 5E99L 4NM8L 2X9YA 2X9XA 1JYXA 2VQ1A 5EUOA 3SE8H 4P2YA 2WIIA 1X5AA 3K8LA 1DVFB 2QSCH 2B2XH 1NFKA 4N0UA 5JQHC 2W9DL 1S5IH 2H45A 3ET9F 1CQKA 4X9BA 2NY1C 3EHBC 3P0VL 3DOSA 4OGAC 4M6NL 3GRWA 4TOYL 5IROA 3WMSA 1QACA 4RNRA 2ADFL 3ARBA 5C0BD 1IAMA 4R2GC 2A6JB 3GI8H 4HKXB 3SO3B 4QOKA 1WEJL 3CVHH 5IW1A 5E5MB 1T2QL 4TSAH 1JWMB 1KB5B 1L4IA 4HUXB 3RPIA 4HQQH 1OAQL 1JPST 3C60A 2JJUA 4G80B 1OSZB 5FYKL 3WFEH 4NO2A 3JZ7A 4OSUL 2P8LA 3BH8A 1M7DB 5F9AC 1C08A 3MLYH 2XXCB 3SE8L 5CD5D 2OI9B 5CLWA 4N90D 2DQTL 1I1AA 4CW1A 2ZCLH 1FIGH 3E2HC 4JQIH 1WZ1H 4UAOC 3QCTL 3RGVD 3O9WB 3E6HB 4Q74A 3U83A 1QFWL 1UJ3B 2FJFB 1A6ZB 5DC0A 3GNML 1QSEA 4EIZC 2J8UA 2R4SH 2I60H 1NAKH 4G42A 4UZGA 4E41B 2A0LD 2W0PA 2VZUA 1D5MA 1U95B 1MCWM 3MUZ1 4LARL 4HWZA 1GOGA 1MI5E 3B5HA 5BS0D 4EZMA 3CLFL 3MRMA 1Z2KA 3FT3B 3JTSB 2CO6B 2FATL 3S97C 5DJDA 4PREA 5E8EB 2R0ZH 3STBA 3X11A 4EBQH 3LKQA 2CKBL 1MHPH 3PJSB 3G6AA 3D2UA 1PQZA 2R1XB 4FFWC 3VXUA 3U36A 3KYMA 3KR3H 4X7FC 2JB5L 1JPTH 2XRAL 3CH1A 4GMSH 1FNGB 2Z0BA 3V7AE 1JGUL 5B39G 1S5HA 5MHSE 1XGTA 3MCLH 3FZUC 3NN8A 1I1AC 3MRNA 5EU6B 3B8SA 3HPLB 4OT1L 43C9B 4PTTB 1DEEA 4WEUD 3TFKC 4QO1A 4NRXA 3T4YB 3SKJH 1XGTB 3VFGH 3PWVA 4K94C 4GBXD 3RZCB 2XA8L 5M95B 1NCCH 1U8OA 2YZ1A 1JF5A 4NP4H 4QHNA 1DUZB 1R0AL 1N64L 1NGZA 3ZL4H 4DGIL 1ZVHA 3QIUB 2VDRH 1NMBH 2FGWH 3RRQA 4CBPA 3PWVB 1GC1C 1YPZE 4FZ8H 1YMMB 4ACPA 4PP1D 1S78C 3DIFA 2YBRB 3EFDH 1CL7H 43C9A 1MQKL 4OLUH 4P23A 2DTSA 5FO9B 2Y23A 4LKCA 1MRCH 5IBUG 5T1LD 3T65B 1L9NA 1FRGL 4JFZL 1TIUA 3EDEA 4JEGB 3GBNH 3LV3A 2BOCB 4HPYL 2ZG2A 5D1XB 3HZKB 1IM9A 3L9RB 4L4TB 2OTWA 3QXDA 1BJ1J 1WFTA 4ZOBA 3KLHC 1N5YH 2Q20A 5HYQB 2OR9H 4MSWB 4RIRB 3H9YA 4PRIA 2AK1L 4JDZA 2WQ8A 2ATPB 3ZL4L 5DI8B 3BD5A 1G7PA 4DGYL 1CICD 4YO0A 3QYCA 1ZHBB 3D39E 1OW0C 2VXVH 1MEXH 3MGTA 1X5IA 5KSAA 4ERSH 2QQLH 5GISH 3KNBB 2FEDC 4OV5A 5C7XH 2KBGA 1G0YR 3UO1H 3OJDB 5EBMB 2J7LA 3K4DA 4XP5H 4NDMB 4HIEB 5DYOA 1BQHB 3FQWB 5CJ5A 5M7QA 5F3HA 1A3LH 1F3DH 1ZSDB 4H88H 5GGTH 4NGHL 1I7UA 1SMAA 5F96H 2ATKA 1QD0A 4P2OD 2ZUYA 3AM8A 1JUFA 1NBYB 4WFHE 5I16A 4YJZL 2Y4SA 1LHZA 4HKXA 2A6JA 1C5CH 3L5HA 4XNUH 3BKJL 1JTTA 4RNRB 4ONOA 1N4XL 1P4IL 1AI1L 3I75B 1ITBB 3D25A 2R8SL 2H8PA 4Z77A 3WS6A 1FFPA 4HAGA 1EBPA 4NBZB 1W8NA 3MRIA 2V17L 2WBJA 5IIEA 2FYYA 3I75A 4G80A 4JAMA 2R56H 3LH2L 2CRZA 1BQHG 1SYVB 3BI9X 3IAQA 5B38A 3X14B 1I7ZA 1OF2A 4OI8A 1AY1H 1RZGB 4WWKC 1A7NL 4MLSA 1BBDL 1WTLA 5FA4B 2GAZA 1B2WL 3WSQH 5B3JF 3TO4D 4POZD 4LBEA 2GUOB 4NWTL 2YRZA 2LU7A 3HNSL 5L2KD 4UNTA 4K3HA 1RK1A 3DRQB 4D9RE 5I9QC 5ITBL 1DQLL 2MFNA 3QCUH 5K9OA 3MV9E 1HDMA 3MV8A 1RSFA 5DMYA 4IMLA 1S7TB 4LLAA 4HWZB 3Q6FA 1PKQE 1HHKB 3MNVB 4YDIH 2WUBH 1XGYL 1AD0B 3R1GH 4CNIB 2ZUQB 1EH9A 3TBWB 2HN7A 5IK3B 4F8QA 3S6CA 5IEKB 5FDYA 4WFEE 4MD0A 3UTSB 1AGCA 3TJEH 2F5BH 3JWOH 4JPIA 1KELL 3GKWH 4L4TD 5FYKD 3X14A 1D5XA 2A6IB 4LSQH 3LIZL 3VG0H 1A1MB 2W0KA 1I8IA 1JF1A 1G1CA 1KELH 1CG9B 1BOGB 1MCNA 4O58L 4OM1L 1JNLL 4HUNB 5IW6B 1GIGL 5D6CB 5IW3A 4RFNB 4GRMB 2V7HA 3BRFA 1QLRA 2FH8A 2VXUL 5SWZA 3SGEH 1A9EA 4G6KH 3VGFA 6CGTA 2ZSWA 1JP5A 2V2XB 2XYCA 4P9HH 4PRDB 1KIPA 3ULVD 5A2FA 2P8MA 5D1ZC 5LXGL 3PNWB 4WW2F 2C5DC 5BS0E 3HNTL 3RWHB 3RQ3A 5MI0B 5C0AA 2GK0B 4R2GD 3VMNA 3WCYA 1Q1JL 1VFUA 4R9HA 4QCIA 2FRGP 4OLXL 4OCSL 1L9MA 4OV5B 4LL9A 4F33B 1RQ5A 2AJVL 4G6FD 2EEDA 2XKNB 4M8VA 4BFGA 1LVEA 3EIFA 4FS0A 4PG9B 4LLDB 1A0QL 4GRMA 1DLFL 2JF1A 4PJ5E 3WEXB 5GRVL 2IFFL 3H42H 4XCCL 3BEWA 5EU6D 2RJMA 4OFYD 3QWOB 3U0WL 3ES6B 1P53A 4R90H 3DVNA 3EJZD 3AXLA 4PRID 4F7TA 5FF6B 1NANH 4ODWA 1UZ8A 1CFVL 3QA3A 3PWPD 4V2BA 5E2TL 4CVXB 5ICZB 2Z91A 5J9PB 4NHCH 2NTSP 4HUKB 2LAGB 5E2WH 3WFHA 2AK4E 3W0WA 3WUWB 1KTDA 4N0RA 2E7CA 2OMNA 2DWEA 1ZA3B 1OD9A 2AJSH 4KRPD 2X6MA 3L3HB 3QUZC 4U4BA 4PRPD 1KPRB 1T0NB 3REWA 1V7ML 3QUMA 3UAJD 3SDDB 1R3HB 4XP4L 3ILQD 4LCYA 3U6RA 1FVDB 2PO6C 1EZVY 3QWOA 5E5UB 4CVUA 1VACB 2XOTA 1NFDB 5A16B 2P7TA 5IT2H 5E24E 4NP4L 1A6VL 5GZOC 1V3KA 4WY7L 3ES6A 1UACH 3DX7A 2VZ3A 1IC7L 1MLCA 4YFLI 4H26A 3O9WD 3AC0A 1HEZB 3X12A 4LVNB 3OB8A 2ICCA 2X1WL 4M1GL 3WLBB 4JFFA 3JV6B 1S5HB 4HH9A 4NUGH 2QEJA 4V1DE 3PWNA 3L3KA 4RX4D 3STLA 1Q9LA 4U7KA 1A21A 5ILTL 1NCUA 5DGQA 2XQYK 1F3JA 4JREC 3WN5C 4OB5L 3VDAA 3QUMB 2BHYA 3IGAB 3LQAL 5FCUH 4AT6A 1WCBA 5H2BA 2OXGA 5CIPA 1PY9A 4G6MH 3EAKA 1QLRB 2IG2L 1NCBL 4Z7UB 2NX5B 1N0XL 1H3UA 4JB9L 5FKAB 3PP3H 4APQC 3WNPA 1J1OH 4HIEA 5T1LA 2ZG1A 3ARBC 4ESKA 3ZDYF 2NMSA 4JG0H 3OX8B 3B6SB 4YHZL 2GEEA 4MJIE 5BW7A 2BVEA 5I17B 5I1KL 2GITA 4N8CL 4LSDA 1BQSA 2VDPL 3HC3L 4HV8A 1D9KB 2FWOB 3BKMH 4GT7A 4H88L 5CZKA 4MD0B 5FO7A 3U79A 5JR1L 2BVOB 3AFLA 3L3OA 4YR6A 1IMHC 5I1CH 2NCMA 2GW5A 3U4BH 4LPVA 3IJYA 4Z7VB 1WFUA 1OGAD 5FYKH 3WFEL 3MFFA 3WFZA 2GITB 1FYHB 1FBIL 1Y6NR 2VLJA 4JANA 1X5YA 1WTGT 1U9KA 4ISVA 3VD9A 4K7PL 5F1KC 4B5EA 5I2IA 1GCFA 4KKCD 4Z7VE 1IVLA 5DJYB 1LNUB 2NY6B 1EHNA 4OLWL 1ED3B 4OAWB 3CSPA 5C0AE 4M43L 5EZLA 1DE4B 4YXHH 2HYMA 3NIGF 3O41A 1CS6A 4M48L 4OZFB 4PJIA 2OR7A 3SE4A 2OI9C 2W9LA 3QQ4A 2E6JA 1FIGL 3RPKA 4XPTL 4R26L 1S8DB 2OCFD 4GRWB 1DLHB 3HAEH 5JHDA 5I8OL 4BM7A 2BP3A 4JFPB 4LDOB 1J0KA 1U93B 2KQMA 4A6YB 1BF8A 3BXNB 1G7MB 4JRYB 1VEMA 1ZEAH 1NFIB 3QJFB 5ANME 4N0UB 2X4NB 2IQAB 4KQ3H 4PRHA 2DMKA 4KJQD 3SDAA 3T77A 3TJHD 2BHUA 4JM2F 4U1SA 1NKRA 1ADQH 3H6JA 5CLTA 1MF2L 4UTBL 1TVBB 3TBVB 2XTJD 1A02N 3VFMB 4FFVD 5F71A 1I85A 4LMQI 3ARQA 3SQOH 4R90L 3CDCA 2V5YA 5TJWK 5CS7A 5EOTA 5DMKA 2D0GA 5IVXF 1ZT1B 1BQHA 3FQWA 4J3XA 2DJ4A 3DETD 4HLZH 4TVPE 1U8IA 5TFSH 5K9JL 1S9VA 1CD1B 2W92A 3RIFK 2XN9D 5CEZL 4XP1L 2R0LL 3CGTA 4GG6B 1UKSA 1GAFH 1AC6A 5LVEA 3WUWA 4HUUA 5C0EA 3A0OA 3DXAA 4MNQE 1CLYL 4KJPC 4N0YL 4HEME 1D5IL 3VE0B 4AY0A 5F88A 2AGJL 2IPTL 3V6FB 1U91A 3ZKQD 1GVIA 2ZSVB 4MNQB 1IM9B 3L9RA 4L4TA 4C83B 3RNKA 4XH2A 4XP1H 2FDBP 3OZ9H 1YMHA 3G6DH 4TQEL 3C6LA 3OV6A 3NOIA 4XC3H 3ULVL 5ACMA 5AYQA 1TQCC 1HH6A 1G7HB 4XTRC 4LLDA 1CFSA 3U82B 4AEHH 1OQXA 3MRCB 5BO1L 1NBVH 3SDXF 5CUSL 4NQSA 5JPNA 1GJIA 3SEPA 4ZFFA 5EORH 1A6AB 5B4MD 1KACB 3LCYA 5JOEA 3PL6C 4OD1L 3GGWA 3IJSA 4HGKC 4CRPA 3MACH 4GKZA 5TDPB 5CJ8A 3V6ZA 4MLIA 4B41A 4PJBF 1YNLH 5EU5A 3AREA 5BOPA 4M7LT 4Z0BL 2IADB 3P9LB 1INEL 2N7BA 2VTFA 1IM3B 1Q9LB 2P8MB 5FKPB 1RZFL 4HIIA 4GAYB 3RVUD 3MLWH 3V0WL 4P4RB 3HPLA 4ZTOL 1FL3A 2DB8A 2ZCHH 1R3LB 3OKMA 4LF3A 4IIQA 1F90L 3S5LB 2FLBT 1P1ZB 4ORZC 4K9EC 1P5VA 3RWGB 3SJVD 2DI8A 4PJ7B 4LHUB 4XBEL 5I74C 1PQZB 4OZGE 1A7RL 4TNWF 5FHBH 4JM2C 3VXUB 4FFZH 3W9EB 2AERT 2XTJE 4FQCL 5KW9L 4J12A 4G7YL 2F54B 4XHJC 3C5ZD 4WV1A 1NL0L 5D96C 3N0PB 1FG2A 2DI7A 1KLUA 3CVHA 4HUWB 4QEGA 1JPFB 5IMLA 3U0TB 1UCBL 1YQ2A 4MB4A 2E7LA 3BE1H 4HCRH 4LHUD 5HYJA 3MNVA 4C59B 1MUJA 4HIJB 3L95A 2PCPB 1ZLUK 1JYNA 1LGVA 5LQBH 2VH5L 2J88L 3CVIH 4KC3B 3G5VB 3HUJA 2IAMA 3WO4C 4CMMA 4Q9RH 4HJ0D 3U9PH 4QHNB 1G7JA 1P7KB 1ZT1A 2AJUL 2BXYA 3O6LH 4I0PB 4XRCB 1F2QA 3LDBC 5DEFB 1BD2E 4LCWD 1HI6B 5TPWH 3RGVA 3GO1L 2DQCH 2O5YH 3RWCA 1FNHA 2ICWB 3ZLQC 1QLFB 2BNQD 2D03H 4IDJH 3SOBH 2BNQE 4F37F 4K71C 1AD9A 5I8OH 1F6AB 2R4RH 4IRZH 3P4MA 4PJCE 5BRZD 3QDME 1MPAH 4NQCB 2HTLD 1W72B 3WE6B 4NKIH 5EU6E 4Y4FD 3FTGA 2W91A 4JRYA 5CHNB 1PVHA 3LS5L 4Y4KB 4JQIL 5I75C 2X4PA 4M5ZH 2ED9A 2O5ZH 4QOKB 5IW1B 1CLZH 4U6VH 5EPMB 3IDYC 3R1GL 1XF2A 3F58H 5I16B 4KKBD 4LLWA 3DMMD 5E5MA 1X6LA 3O45A 32C2A 4GXUM 4CVZB 1RULH 5D4QA 3ZMRA 2APWA 1ORQB 1LDPL 1RK0B 3QDAA 1FZJB 1BD2A 1LEGB 2Q8AH 1G0XA 3BIKB 1R5IA 1KIRB 1H3XA 2CIIB 4LK4A 4UOW0 2ZOLA 3CC5A 4I1NB 3SDCA 5CMAA 2EE3A 4GW4B 5IMKA 1I8IB 4U1LA 4OCYL 4XCFH 5J1AB 1FH5L 3TCLA 5TH2A 1T7YA 1N6QH 3IXTB 2NTFB 1BFOB 1NCAH 4RZCB 3E3QC 1FC1A 5KBNC 3OR7B 3P2TA 1MIML 4TQEH 1KYOK 1OTSC 3FFDA 3FRUB 4PJFE 5E00A 5TE7H 2I5YL 2HLFC 3VXPA 1SYSB 5J12C 1QFUH 1RK0A 1HHIA 1GC1H 1S7TA 1AIFB 2CLRB 4DZBA 1KIQB 3BD4A 5FOBA 3H7BA 4WI8A 1I9RL 3RPIB 4M61B 1A8JH 1MJ8H 4QXUL 1ZWIA 5E8NA 5EC2A 4JM2D 5HI5D 3SDCD 1ZAGA 3NIDF 1DDHB 1DBAL 3PXJA 3I6LE 1B4JH 4H1LB 1NDMA 3GMPB 3QEUA 4Q2ZB 4UINL 4K07A 4FFYL 1QFUL 3DPBA 2V2TB 3Q3GA 1NMBL 2FGWL 1NC2D 1F58L 1JL8A 2I07A 5KZCB 4R6UA 4JKMA 1X5ZA 3W11C 4YIQA 1T89A 5IB5A 3CNKA 3FHQA 3EYVA 1OP9A 4WIQA 2EDBA 1BZ9B 5E2UH 3QULB 4D0CB 2FYYB 1F13A 1EBAA 4P2RD 5DWUL 1KCVH 2WUCH 5HGDB 2R15A 5DJZA 4ZQKB 3DTXA 2OMBA 4UILH 2VR5A 2BY3A 3HZMB 4LSQL 4L4VD 3MLRL 1P4LA 4RAUA 3CZFB 1KEGL 4MD4A 4XPHL 2ADIA 1XZ0A 4QHKJ 5DC9B 3B2UD 3FQXA 3BPCA 5C0DA 5IBLC 4WU5A 1T66C 1MFEL 1T1YA 3QFJA 4TSCH 4U6YB 1MQ8A 5E2WL 2C4FT 3D39D 3F7VA 1WWCA 5B8CB 4ZOAA 2F53B 3QNYB 4I4WB 5HGAA 1FO0H 2IBZY 4JQXA 2WMPA 1X3DA 4L29B 1TJIL 2YD4A 3UTSE 3PWUB 5B39B 1K8IA 1FYTA 1TLKA 4FTVB 3V4PH 3TVMB 12E8L 5HDBF 2HWZH 5IG7B 5I19L 3DECA 5IMLB 5DK3A 2A73B 1I9EA 1DQDH 2FJGB 5CILL 3EO1B 5L8KB 3QPXH 4LVNC 2VB5A 4GLRH 2IAMD 1FSKB 3VRJB 4LCCB 5DQDH 4Y5VA 5HGHB 5HYFA 1BZQK 5IOPA 4Y16D 2R0WL 4XPBH 2EZ0C 2AJVH 4DOHB 4U3HA 4PGCA 5L88H 3I2CH 5HBBA 3SBWC 4IOIB 2OYPA 2NY3D 4IIQB 2R2HB 2VDQL 2W9EL 4GS7C 4IM8A 3AB0B 5IVXA 4MA1C 1M7XA 4XNUL 3MRFA 5SWZD 2BERA 2NLJA 3GM0A 1FZOA 2JIXA 3HI6H 4PPTA 2WSKA 2GK0A 5JORA 3DMMC 4MCYB 5DD1H 3MRJA 5AYUH 5HHOE 2A74A 5IKCB 1U3HC 1U8NB 4CU7A 4N9OB 5C0FB 3O3BA 1OW0A 3CFDB 3LHPL 3F6IA 3ZKXC 5IVXE 1U3HB 2BSSA 1YEGH 2D7OA 3BH9A 4NRZA 4QXTB 4QTIH 1KC5L 5HPMB 4ZXBB 1XF5A 3U2SA 2VDKL 3DO7B 3LKSA 3TLRA 4U1IB 4FQLL 5I30L 2FR4B 1LK3H 4J3SA 3ZDXE 3PIQA 2FD6H 3TVMC 2AEIT 3HC0A 1BOGA 3TN0D 3TH2T 1ZLVH 3L3IB 1UXWB 2R0KL 2X4TA 4UQ2A 4M6MH 4K23L 2IQ9L 3LQAH 3HE6A 1XH3A 4QRSB 3T2NH 2ADGA 4P9ML 3QUZB 4AEIH 2NY5H 3CFKB 3I6GA 4JN1H 2Y5TA 1K4DA 1EXUA 3HAEG 4PJBA 1FLTX 1RUKL 2MJWA 1A6UL 4Q6IC 2COQA 2B1HH 5DC4B 1TENA 3QXUA 2XNAB 3KHOA 3Q6FB 4PRBA 4O2EA 5KN5A 3GSNA 3TA3C 1IEAB 1VGKA 4DKEH 2AEQL 3GIZL 2R2BB 3MREA 4TPRH 3WKMH 1AO7E 1S7RA 1YY9C 5MEOB 5HXMA 1JYWA 4E41A 4AEIL 8CGTA 1QFWH 4UIKH 4TNVF 3RX5A 4G8IB 3G5ZB 1IQWH 4KTEH 5TE6L 1QFPA 2MQ3A 5L6YH 2E8ZA 4YXHL 4YHLH 4JFEE 3BP5B 3BX7C 5SWSB 2E7BA 2EDHA 1WZKA 1S9YB 4X5LA 1W0YT 5AAWA 4UU9A 1H8SA 3Q3GB 1TCRB 2DQUL 4P2OA 5IGXH 4Q2ZA 3MCLL 2DQFA 4QXUH 3WUZA 4OSUH 1WICA 1DQJB 5GGQH 3MNZA 4JFPA 4PJGE 4NZUH 2CKNA 3AU1A 2EXYC 1F8TH 3W9DB 4HKZA 1PG7L 2OM5A 2XPGA 2EE2A 2AKRA 4K3JH 1GAFL 4G8FA 3OKLB 5BZWA 4FQXA 3PV7A 3TBYA 4GSDL 3OKNA 4G7VH 4U1MA 2ED8A 3RTQB 1TTFA 3VA2C 4LSRL 1X5KA 1WWAX 1DP0A 3ARDC 1W0WA 4BK4A 3UTSD 3V7MA 2P5ED 4UAOB 5HHXH 4MA3B 1C12B 3ZYZA 1MHEA 3GB7A 4ODVL 3I3DA 2HVJA 1TZGL 2WNGA 4Z0XA 5E6ZA 1SJEB 5AWNL 1RURH 5ACZA 3QI9A 4W6XB 4BJLA 5SX5K 3NAAH 5EUOF 3KPOB 3EYFB 4L4JA 3ROLB 4WFFD 4PY8J 1AXIB 3SDCC 5HI5C 3S4SA 3OAYH 4FZ8L 1XGPB 2YSSB 1G9MH 1RZJH 3EYUH 4HULB 3RVVD 2GSIB 1LEKB 1NMAH 3SHSA 1AP2B 1FVEB 1MWAL 3MRPB 4KDVA 2CJUH 3P73A 2VL5A 4IRSC 1TJHL 2FB4H 5DD5L 4OKVA 2HJKA 3U7WH 2MNUA 4GJTB 3UTTD 4O9HL 3TBSB 3D69B 4BSWB 4K9EL 1RZFH 4NPYB 1C1EH 4RGNE 4UQ3B 3VXRB 2DRUA 4PJ8C 1A6PA 5E8PA 4X6BA 1JGDB 5KS9F 1QLFA 3FO2A 1G9NC 3E6FB 1LEIA 5C09A 4QYOA 4ZUSA 1I8LC 5FAAA 3FT2B 3LEYH 2MCPL 5DD0H 3EO9H 3QDMA 4L3EB 2GJZA 3BN3B 1A4JA 2YPLA 2GSGA 3GSOB 3QO0A 3VFNB 1K8DA 3TO4C 5JXEC 4JHWL 5I1KH 1U92B 1ZHKA 2G2RB 5FM8A 4U1NA 3MZTA 3PHOB 2BNUA 5GJTL 2QHLA 3K80A 1YEKL 5HYJB 3NCMA 1A5FH 5JR1H 1J05A 1KPVB 3QIWC 1J1OL 2OSLA 4J3OC 4X4YB 3U0TA 4YPGB 4JFDE 5EO9A 2CUMA 5GS0H 1CXHA 4X7TB 3WSQL 4OFYA 3SQBA 3T0EE 2Y06H 2P46B 1QSFE 4QXGH 2IMNA 5GS0L 3DVGA 1LWRA 5EDXA 2F74A 3AAZB 3PQYB 2IGFH 2M1KA 2HVKB 5AD0A 3U9PL 4WTZA 1C7TA 2GYSA 2VAJA 5ID0B 4NQDD 3QA3B 5C0RL 3QZWG 2YPLB 4KRPC 2QADC 4YUEL 4YWGL 3ULUF 2C1PB 2PW1A 4QXGL 5DJCB 1B90A 2R1YA 5HY9B 3D39B 35C8L 4MWFB 2KPNA 1CGVA 3X3FL 1Q9OB 5HGBB 2BCKA 3O3BB 4PD4K 1UXSA 5E1AB 9CGTA 5KVMC 4X7SH 4KUCD 3DHMA 4MXWH 3V8OA 2EIEA 2A1WH 4PJHA 1CZ8H 5FOJA 4AH2B 4L4VE 4M00A 3QUKA 1IAKB 3QUYB 4LU5H 5IVOA 1T2QH 4TSAL 4XCYA 2VABA 4PD4J 4PV9B 5FHBL 1AR1C 4WHCA 5TDPA 4QCIB 1UVQB 3DX8A 5DZOA 2P8LB 2C7UB 2F58L 3BH8B 4TRPL 1OSPH 4OQ1A 1NGQH 1OHQA 1GOFA 4TN9A 2LVEA 3MOQA 4JFHE 3F8UB 4MS8C 2XG5A 2VZSA 5GGRA 3OGOE 5LGJB 4OLWH 5FM5O 1OAKH 1LEKA 3V6OC 5D1ZB 4PV8A 5D70H 1IGCH 3HUJE 2WP3T 3FO0H 3L3GB 3HNTH 5L7XH 35C8H 4ZAKC 5TQ0H 3PGCA 2EIZA 3CXDL 3O6KH 1DSFL 4PJDE 5J12B 3MNWB 4QRPE 4D94A 4A6YL 3V6FA 2F53E 4N8VG 2OP4L 2AV7A 1PFCA 5GXBB 5ITBH 3NACH 2X4OB 5MEQA 2WBWB 3VMPA 5T1KB 4KVNH 4X8JB 2DYPA 1C8PA 2G75A 2WQRA 1CT8A 3GB7B 1JNLH 2X4RA 3OKDB 1MHEB 2YA0A 2E9WA 1DANU 4AIZA 1B2WH 5GS2D 3T8XA 3N1FC 1KNOB 2YS4A 4RSVA 3V5DA 1RUAH 1KJ3L 4R0LB 3TA3A 1AGCB 1BBJA 2EDKA 3RWEA 1K3ZA 2NR6D 3G6JB 2EIDA 4U6YA 3ULUD 3EO0A 1U8KB 3VFTB 4D9QE 4XMKH 1MCIA 1CCZA 1UKQA 4GSDH 4NHCL 5L0QC 4P5TD 1I4FB 4ODXA 2XPGB 4DCQB 3QHTC 1IBGH 1IGIH 4ONHA 4GRLA 2O5XL 3W39A 5L0QB 1LE5B 3V6OA 3MBEA 5K9QG 4AL8H 3QEHB 1D3CA 3UDWC 4JHAL 3LSOB 3CLFH 1R3IH 1X5JA 3OPZL 4GAFB 2DLEA 3QFJD 1RZGA 1GGIL 1G7MA 2CRMA 2ICWJ 1BFSA 2E5EA 1ACYL 2X09A 4CL7A 5DVOA 4M4RA 4G8GB 3WNLA 3HFML 5I1EL 2V2TA 2D4DA 2XFXB 3ROOB 5KVFH 1F3DJ 5TDOB 3VFOA 4YGVA 3TF7C 3MRBA 2HH0L 1SJHA 3W2DL 3OBAA 2E27L 3ZE2E 3ZZ1A 5CILH 4RMUA 4O02L 3DO3A 2VXTL 3G04B 4IRJD 4JGJA 5E56A 3V4PL 3CAFA 2XNAA 4PRBB 4EI5D 3FFCD 4K8RD 4OM0H 2G60L 2NNAB 4WVRA 4AH2A 3ARFB 4X6DA 2X4UA 2JK5A 1QLEL 1AQKL 3L3OB 1KT2B 3D9AL 4YHMH 1UH4A 5EC1B 1LO5B 2CDGA 1L6ZA 2IANE 1CT8B 4Z7UF 4YX2L 5L2KE 4UUJB 1ZHBA 5BJTA 3VW3H 1RZ8A 4TUOB 2DJSA 4BQBA 1XR8B 1GZPA 3ZTNH 5C07E 4ZNEE 5JIKA 3TYGL 4WWKA 2R69H 3M17B 3DGCR 3QQNA 3QQ9C 4NUJB 4Z7QF 3QDJE 5MENB 15C8L 3VXNB 1II4E 1T1WB 3HR6A 1FAIL 3PHQA 1XR9A 1DVFC 4G6ML 3DX9B 1T03L 5K9KA 1IEHA 1MFNA 3HS0B 2GY5A 3TP4A 4WO4B 3RY6C 4M93B 1CF8H 5I1JL 3BMWA 3RVXD 3D1MC 5T3ZD 4UI2A 4S1SH 4FQHA 3TNNB 1D9KC 2BJMH 5IESH 4RFOH 1MCFA 5I30H 3B9KD 3B2VH 1EAPB 1K5NA 2BNUB 2PF6A 5FUZH 1XF4B 4X6CE 1QSVA 2VABB 4QTIL 5JMOC 1YYML 4GG8A 3JV6A 5CZXD 2C7UA 4DAGL 3QUKB 2JJVA 4HMDA 2OK0L 2AEPL 4JZNA 3CVIL 1JWUA 5CP3A 1NGYB 4LLYA 5ISZE 3CDYA 5E2JA 5C0AD 4V1DA 3LN9A 1T6WA 3LS5H 2CUIA 3RWCB 3DX7B 3C5ZC 5GS3A 2OL3A 3GI9H 4WI9A 4PB0H 5F9JB 1NGYA 4LLYB 4KJYB 3NA9L 1D6EB 3H7LA 5I8EA 4OGXH 2HJFB 3UJJL 3NCJL 2QJDA 3DXAE 4F80A 2Z8SA 4ODUA 5DQDL 1WLHA 2R1YB 2Z31A 2PW1B 1YEIL 4K8RH 4YDVA 5JPMB 5CP7B 3RWFB 5GGUA 1RIVL 4G6AD 4U7SA 5H35A 4PJAB 2A38A 4XCFL 3VG9C 3HG1E 4UT9H 1JPFA 4S1RL 1D5ZB 2VAAA 3MRQA 5AZEH 1IILE 4PJAE 4P2OC 1XF3B 5F3BB 4OUUA 4V1DD 5DUPH 1C16B 1QBLH 1TZHB 3MA7B 4ZUWA 4G9DA 4HWEH 4M03A 5TE6H 3RDTC 1CVSC 2QSVA 3TZVA 2F5BL 2X1PA 1RIVH 1KPVA 4G43A 3VWJD 3MTRA 4LNRA 3RU8L 1P84J 1W0VB 3UBXG 5ACZB 4ZODA 2AQ2A 4FQXC 4LPTA 3GSVA 3VJ6B 5DUPL 3FT2A 5E08L 5KS9A 1A4JB 2KH2B 3QULA 4C56B 1MELA 4U7MA 4P3DB 1EJ6A 3L3GA 4UT9L 5BZDB 5E8DL 3FFCA 1XGQB 3SN6N 2BNRA 1TNMA 4LSSH 3KPSA 1F4AA 5EO1B 5C0AB 3DRTA 1FVCB 5LXGH 4XC3L 4NO5A 3O6KL 3TT3L 4YDLB 2PYEA 1FGVL 1FNAA 1DQLH 1BM3H 1UGNA 2G5BA 2Z92A 1BGXL 2DLFH 5E5RB 4DKFL 3RX8A 4XMKL 3EJZC 3AU1B 4QNPE 1LO4L 5H94A 1KXVC 1ZGLM 1YEDA 2CLVB 4XVTL 1F00I 2BY0A 3N06B 2B1AH 3NIFF 4M7JH 4PGBA 1A1OB 1B4JL 2L7UA 3ZDXF 4K2UH 3QP3A 2HLAB 4HKJA 5F7MC 3E8UH 3VRJA 4TVSa 4D0BB 1CDHA 3C6LD 5IMKB 3T0EB 1T4KB 3EYFA 3QCTH 5B22A 4KMTH 1BQLL 1LP9B 4C58B 1QFOA 4OCRH 2DJUA 4MJ2A 3T0EA 4W4NA 5IP4A 2EDLA 4KHXL 4L8CB 4NNYA 1N7ML 4BYHA 4PJEA 1PD6A 2VJXA 3CFKA 3I6GB 1U36A 5GGQL 4BKLB 4QWWC 3QR2A 4NQED 3ARDA 1KOAA 4DW2L 1S9WA 4P3CL 4GAJH 3BE1L 1B4RA 2W65B 5DWUH 3V8CA 2AK1H 4UBDC 4UOJA 1S9KC 5CUSH 5CGMA 1YNTA 5I66A 1NFDE 1SY6L 4X4XB 4IEFB 4TSBH 3T3PE 2FR4A 2W07A 3QIWB 3C8HA 4F57L 3KYAA 3LKSB 3MACL 3DRTB 3RIAF 5SWSA 4GAJL 4XCNB 3DYPA 5E03A 3X13A 1MHHB 2YD9A 1IGTA 4OT1H 5F89B 5I66B 3QBTB 1MJ7H 4HDIB 3SO3C 1AE6L 3IFNL 1Q0YL 3JV0A 4KDTA 1NBZB 1DQML 3OB0K 4N5UA 3TIDB 2D31A 1P7HL 2XA8H 5JOFA 4S0SD 1NUGA 4KI5D 3VRIB 3VXMD 1EERB 3SY0A 1I9JL 2N7AA 2W65A 3MROA 3QDMD 3C5SB 2JIXB 1RJZA 4QRPB 3ULVF 2NLJB 2C3VB 5C1MB 3VD4A 1I8KA 1JNHB 1K4DB 3GM8A 2VZVA 1EX0A 1PZUB 2BNRB 4V2CB 1V8HA 1VGEL 3OHXB 2O61A 4XGZB 3TO2B 3ZKND 3TCLB 2F8VA 5F3BA 2A9ML 2BFVH 1NL0H 3O4LA 4FP8H 4X83A 4Z0XB 3HCVA 4E0RA 5DJCA 2DQCL 2O5YL 3UTTE 5IOPB 2JKXA 3VXTB 4Y1AE 1TZIA 4Y5VB 4BZ1H 4QHLA 4XBEH 1CE1H 1YYLH 3RWGA 3MRDB 3EYSL 4AYFA 2GTZB 4FQ2H 3MV9A 1CE1L 1YYLL 3VWKB 3QRGH 1E4XI 4PTUB 1WJ3A 1Z0NA 5E2VH 4KHTH 2NX5A 1EO5A 1H15B 3MLUL 4X80H 4EUPH 5I73B 4G9FE 3JUZA 4I18A 5IEHB 4OD2B 1J1PH 5DR5L 1OTUC 4PYGA 3VXUD 2O61B 5D1ZD 4OCWL 5C0NC 5JW5B 4MA1B 4MCYA 1U8OB 4O5LH 3UBXA 4KROD 1K85A 2ZUVA 2JIXD 5BMFL 2ZPKH 4NO5B 4HFWA 2Z35B 1UVQA 1W72A 2BRRH 4O2CA 4DKEL 1INDL 5DJZB 2A9NL 3TNNA 4M6NH 2GY7B 3RU8H 4OIBA 2CDEA 3I6KB 3EOTH 2B0SL 1EVUA 2FO4A 2DQTH 3O6FC 3LRSB 1YMME 5C0CD 4JPKL 5C6PB 1Z5LB 3CH1B 3HB3C 1IC4L 1JWUB 1RD6A 4PLNC 4K94H 1JGVH 1AQDB 2ID5A 3U36B 4ZUUB 3MXVL 3T0XA 4K3DH 4PRAA 3GSVB 2PYFB 2HRPL 2AEWA 3GMLB 5FGCB 3GKZA 4YGAB 4TOYH 1YJDC 5DUBA 2P4AB 4Z78B 2JB6A 4U1KB 4GG6A 3KPPA 1WEJH 3CVHL 2ADGB 4LARH 1IAOB 1J0HA 2B5IB 3SCMB 5F1SA 5E08H 3I50H 3MJGX 5EZJB 5ICZA 5FYKE 5J9PA 1D5MB 1QFHA 2LFGA 3HS0A 4K3JL 1UJ3C 2HFGL 3HZYB 3OAUL 1AXSA 4L8CA 5DVLA 1IZKA 3Q0HA 4KAQL 3FRPA 5HHMD 3TA3B 1X5LA 4XAWH 3BEWB 5EBGA 3HZMA 3MRGB 3VG9B 2ZCLL 3C9NB 4ZS6D 1SJEA 1L6XA 4O2FA 1JRHL 2Y9RT 5FK9B 5L7XL 1IE5A 1YUHB 4F7EB 3MR9A 3E6FA 1LEIB 4YAQA 4MXQC 2DD8L 1JGLH 2J3SA 1ZK9A 4PLKC 1FLRL 5HGDA 3WIHH 3TO2A 2WWKO 4Y5VC 2J4WL 1RUAL 4AQ1B 4WHTA 1UZ6F 2BNQA 4JR9L 2IADA 3P9LA 2RAMA 4K7FA 1QSED 4HIXL 3U30B 1G7QA 4NYLB 4WTZG 4ZFGL 4JFED 5IFAH 1CK0H 1NDMB 3GMPA 1RU9L 4HW6A 2R39A 4ODHL 3FQRA 5FV1L 4KRNA 5ESAB 4FQXB 4XX1E 4OZIB 4UT7L 2Z35A 1JI2A 1OAUL 4NKMA 3GIVB 3O11A 4UT6L 4OZIF 4I9WE 1KCRH 3IFLH 5D7JB 1A6VH 4ZAKB 3TIDA 2ZNXA 1SJHB 2GJ6D 4JFFE 2MWCA 2D7PA 2HFFA 3GSNH 5KSAC 4JFDD 4E41D 3RGVC 1LO3L 3EO9L 1J0IA 8FABA 1EEQA 2G5BB 4MNGE 2XV6B 5IVNA 1TNNA 3ALWA 5T5FH 1N5AA 4WHTB 1CFVH 4PJEB 5ACLA 1NCCL 5DRZA 1RFDL 4NYLA 4WWKB 3IJHB 3GBNL 4NNPH 1B0GB 1XR8A 2F15A 4S1SL 2ICEA 4LVHB 4BQ9A 3H42L 1N8ZB 5BRZA 2DKUA 5DFWH 3TBWA 5I17A 2EICA 2WK2A 4JKWA 4OLVH 4BH7B 3K3QA 4JG0L 3MREB 5D7IB 3G5VA 3VJ6A 3TT1H 2OZ4L 1IEAA 1VGKB 2BSED 2EIBA 3NMEA 2LU3A 4KGJA 3PDGA 1GGTA 1AXSB 4EN3B 2X10A 4FTVE 3ZDZE 1U8LA 3MA7A 4JPWH 4ZUWB 2C26A 2EYTA 8FABB 3O6FA 1YEGL 3KYKL 2QQNL 5D71L 2YUWA 3ZYJA 4PJ8D 4U6TA 3T1FB 5LGJA 1I3GH 3DX6B 4EOWL 3KXFE 1KCKA 3RWFA 4IDJL 3SOBL 4F7PA 3FTGB 2VDQH 1T22B 4Y7MA 1J5OL 1GPOL 3GJEB 3MJ9L 1N26A 4R8WH 3C2AH 3ULVE 1OP5H 5HHPA 4NQUA 4W6YB 1PEWA 1Q9KA 4JCMA 4UBDD 4KJQC 4HC1A 1MCJA 5JHDB 5J3HD 4ODUB 4PJ8B 3MOBL 2NPLX 3HE7C 4PJIE 4K7PX 3FAWA 3BP7A 3H3PH 1O7VA 1UXSB 4JO1L 1U8NA 2VXVL 4MXVF 2FO4B 4GQPH 3QPXL 4M61A 2BY1A 1YUHA 2Q7NA 4BFEA 5TF1L 3B5GA 5CKGA 2X4SA 1PYWB 4POYA 2R0WH 1P4IH 3QWRD 4XPBL 5HHOB 1FDLH 4LEXH 2IPUG 3MMEB 3MRLB 3QG6A 3N85H 1G9EA 4XMLH 3GJEA 4NZUL 2XN9B 1BJMA 2Y5TB 4HFUL 3WFBL 3M07A 4JANB 4BUHA 4Y0GA 5MHSD 1XGQA 1L7TL 3IF1A 1BFOA 3ARPA 3RVTC 3P0YL 4MGXA 1CXEA 2WUBL 4JFEA 5EZJA 5FO7B 5A2IH 1IAOA 3C5ZA 1JMZA 2X4TB 5LGHH 4LLUA 4PR5B 3E1F1 2ZZUT 3OKOA 3P0VH 5EBLA 4HC1H 3V6BR 2BZDA 5HVWA 3OWEA 4X8JA 4G9FA 1FPTL 5F88B 3TN0B 3VFRB 4G43B 5JHLH 4U6XB 4LLUB 4LF3B 3M17A 1U3HD 1Q72H 3UX9B 4YC2B 3RWIA 1CBVH 3O45B 4TRPH 3REVB 4X6DE 3Q6GH 5DS8A 3HCVB 3VXQB 2AXGA 4L29A 3O2DA 5ETUB 3RNQB 1I9IL 1IGFL 3O8XD 1MFAL 5EULV 4PGEB 2PKDA 1LO4H 4JFEB 1J8HB 4YLQT 2PNDA 1X5HA 4RQQA 4N1CA 4KKNA 5GGRB 3QH3B 1IQDB 1A6TA 1R3IL 5HI4C 3BKYL 1MJJA 4ODVH 1F4YH 4LRNL 2QHRH 3VH8B 1A6AA 3V6ZB 3BPNB 3JXAA 3VRIA 1KJMA 3GSOA 1IQDA 3G6DL 5JW5A 3MNZB 5D7JA 3VGDA 2CXGA 1M1SA 3KLSA 1FAKT 3BP7B 5ETUA 3KPRD 3RNQA 4V1DB 5E9DB 3F12B 2P7TB 5C08E 1KLFA 4ZDHA 3GIZH 2IPKA 2MQ0A 3QDGA 1Q9OA 4AJ0A 3V4VH 4CMMB 4FXLA 3C8DA 1IGTB 2FX7H 2DQEH 1FVDA 5F89A 2R1XA 3ARUA 5J89A 3RBGA 4RGNC 1L0XA 4Y5YB 3ROLA 4F7PB 1I3VA 2VXUH 1XEDA 4P5TC 4YAQB 5DQ9B 5HYIA 1FL6A 3U7YH 4FTVA 3U7AA 5DT1L 4MHHI 4FQHB 2R2BA 2UWEE 3EBAA 2VIRB 1FORL 5IG7A 2PTTB 1OTTD 4LDLB 1NGPL 3ZO0A 4ODWB 4Z95H 5FYLH 2FX9L 1EMTL 1W2KT 3UTTA 2VLJB 4JFZH 4CDHA 2XG4A 2VLKD 3M1BA 2OL3H 3WNKA 3BDYH 5MEPA 4Z8FH 1U8LB 3H3KA 1X44A 5GQBA 5EOCH 1KTKE 1KB9K 3BAEH 1K6QL 4XP4H 2I27N 3DTXB 4J3WA 3BPCB 1S7XA 3MRKB 2ARJA 1U92A 1ZHKB 2P24A 2M8XA 4CW1B 1QSFD 4FABH 4G6JH 4G3YH 3D9AH 4NO0B 1A22B 4S10A 5IIEB 2PW2A 4URTB 5I8EB 2VDLL 4Y1AA 2Y07H 3PABB 2GTWA 3W2DH 2OL3B 4KROB 1NCNA 4H8WH 1F4WL 2VISB 3MLXH 4PGZA 5F44A 3KS0J 4Q9QH 2R9HD 4ELKB 5HHPB 1FCCA 4U1MB 1YYMH 3LRSA 5DMGC 4JDTL 3RAJH 3MUGB 4F58L 2RGSA 3HRPA 1MRCL 3G04A 3BWUC 3VA6A 4MAYA 3NABH 2I26N 5DK2A 4U05A 3P4NA 4JM2B 1F3JB 3PL6A 1HYSC 1SYSA 4ZAKD 5ADPL 4XBPA 3FQRB 4IRJC 4R4BA 1A7BA 2DBJA 3CJJA 3UYPA 1XFPA 4XP9H 1QYGH 5D93C 1ROWA 5EN2A 1FSKC 5I1HL 5JQ6H 1LNUA 5D1QA 1JFQL 5ESAA 4DEPB 4JO2L 4P4KD 3QH3A 1VDGA 1T7VA 4XCYB 4TUKL 2H2PC 5IB2B 3IU3A 4ZO7A 2QBWA 4LRIA 4MX7B 3RWEB 1MSPA 1XH3B 2EDOA 3QDHA 4MDIB 4NUJA 4YFEA 1N4XH 3I3BA 1E4JA 4IIQC 5HY9A 1DN0B 3L3DB 1HSAA 5I6XC 1TJGH 2DLHA 3AB0C 3IVKB 1KPUA 4Z6AT 1WT5A 3MRGA 3ARRA 2VH5H 4QHMB 4ZFZB 3RDTA 4QRPD 2FNBA 1I4FA 4ODXB 5EZOL 5GGTL 1O7SA 3GSNB 2PCPA 4EI5C 5IFHL 3QHZH 4WUKL 4CVWA 4IJ3B 4MQXC 3VXTA 4X6CF 3OXSB 2ZCKL 3DMMB 4BQ6A 5MEPB 1WGOA 1DBMH 2J2ZA 3CXDH 2P48B 4AM0A 5TE7L 4N90E 1LQSR 4U6VL 5CZVL 1PZ5A 3ARGD 4PG2C 5JIIA 5BV7H 3GI8L 3L3IA 5GRZA 4PS4H 3SBWA 2G75B 2DQFB 4WUUE 3UAJC 3BUTA 1WITA 2JCCA 3MRBB 2R2CA 1NBQA 3QG6B 2C3VA 3MRIB 3T2PA 5CBAA 1P4BL 4XNXH 4NQCD 1DEEB 3KJ4B 5IB4B 2ESVB 1S8DA 4XI5D 2HTKC 3HNSH 1Q94A 2AK4D 2HKHH 3UTQA 5T3XL 3QXAB 4HDIA 5C09E 2LTQB 1J1PL 4MNGB 3D69A 4P9MH 4KJPD 1UJTA 4XWGH 5KSAD 3UTPE 3MLYL 2A2QT 1DDHA 1OPGL 4BSWA 4GRLD 3HNVH 3STZA 4RMQA 2HH0H 1PBYA 2FBJH 4L3ED 5D8JH 2ZUXA 1EZVX 4DVRH 2JE8A 1CZ8L 1EAPA 1K5NB 3TZVB 3RVWD 1F6FB 2KKQA 3DX6A 4M62L 5L9DH 3PWLA 1S9WB 3SCMA 2P5WB 1RVFH 2Q87A 1NEUA 3HNVL 3S96B 3FONA 4BQCA 2RBLA 5CP3H 5T3ZL 5K9KB 5IJKA 1IC4H 4OJFL 4KQ4H 5D1XA 4FG6C 4WCYH 3FQXB 5DUMH 2QSCL 1R3LA 2N56A 1N59A 3PDDA 4JG1L 1U3HA 3MOAH 4GAYA 4M1CC 4NFCA 4TTDD 3OKOB 2R0LH 3G08B 3QUYD 1XF5B 1UKTA 2WM0A 1BQLH 2R4SL 4JCLA 4YH6A 2JELH 2X4UB 4TVPL 5GS1B 4YFLF 3QIUA 3MJ7A 1C12A 3GMNB 4CDGC 4UQ3A 5DD5H 1E0OB 1GRWA 3T4AA 1JNHA 1RK1B 4JZNB 5BXFA 3N1GC 4H20L 4NCC1 5C6TH 3N50A 4O51A 1LK2A 1F6LL 2X44D 2AXHA 4HPYH 4LIQE 2DAVA 5BVJA 1FZOB 4XT1C 1VSCA 4PP2B 3LKPA 1CK0L 1OGTB 3RUGE 2GSGB 3V0VB 1YEEL 4PRHD 3SDAD 1VFOA 2R2EB 5JA9A 3SDYL 3QDMB 3MSPA 3VFOB 4NN7B 3ARGB 1DUYA 1HILA 5JMRA 4PJHB 2WBJC 4GMSL 1JPTL 2DD8H 4P4KA 4ZTOH 3X13B 2PYEB 3QIUD 4LQFL 1U41A 2V6HA 3IKKA 4PTUA 3CDGA 5IB1B 1GZQB 3MBEC 3HI1A 2A77L 1R3JB 1ZVYA 2EO1A 3KAAA 4OTXL 4PG2A 4XZUA 1NBVL 5DEFA 3RVVC 3X11B 3L3JB 4GXUN 3FB6B 5JO5A 2GTWB 1KGCE 2FECL 3OKYA 1QR1A 1ZT4B 1KGCD 4GW4A 4F3FA 4HAFA 2HVKA 5A40E 1S3KH 5F1OB 2F74B 5F7EH 3GSQA 4U31A 1OLLA 1U8IB 3GRWL 3BFOA 2VO5A 1EGJA 1VPOH 2KUTA 3UC0H 4RWYL 3BPOC 4IMLB 5DURB 3NZHH 4RFEB 4HS6A 1H0DB 2ITCA 5SWSD 1A6ZA 1H8NA 5D72H 1XGRA 1I3GL 5ID1A 2VXQL 3TWCL 1MAML 5FGRA 3OZ9L 4G8FB 4U1NB 4TNVK 3BISA 1FV1B 4R0LA 1FFRA 2EH7H 4OGYL 5HDQH 2CO7B 1ZHNA 3IDXH 2Q76B 2RCSH 2BFVL 1MCHA 2MCPH 3BKJH 1MREH 4XPGH 1MFCL 3FB6A 2MOVA 1OAYH 3N9GL 3B2VL 4OBSA 4HH8A 4Y5YA 2O26U 4BFBD 1VKXB 1NEZG 4NGHH 3O3DA 1RMFL 1FL3B 3GSUA 3TPKA 5EBWB 4ELMA 1GH7A 1F11A 1AD9B 4S1QH 4UV7H 4KI5F 2YWYA 3WUWG 4PV8B 2NZIA 1ZANH 3NFNB 4GH7B 5KVGH 4PRDA 3X3GH 1EUUA 3O81A 1BF2A 4M48H 1DBKL 5EZLB 5C0FA 5C9KA 3QEHA 4X4ZA 3AREB 4UIKL 5F7KC 3S3PA 1NCTA 4P2CG 1MFDH 4Y4KA 1KJMB 3LEXB 3QAZB 5DQJA 3MLWL 2YXMA 3V0WH 5SX4H 2DLFL 7FABL 4AG4L 4O2EB 3ESUF 2DF3A 3KLDA 4JO4H 1G7PB 4I18C 1T83A 1IAKA 2ARJQ 3QUYA 1TVHA 2UWEB 4OZFG 4LVHC 4JPIB 2JTDA 1NGQL 1OAQH 4HQQL 2FWOA 1MLCB 2ZUSA 3UJIL 3LRGA 5KS9B 1EFQA 1KNOA 5I8KH 1J9CT 3KPTA 3RWIB 1R5IB 1YEIH 2YD5A 3W9EA 2GCYA 3WFCH 5B8CC 3G6AB 1KBGH 3O2VH 3LB6D 3MV8D 1WCQA 3VRLE 4KWUA 2IBBA 4N1EA 2RFXB 2ITDB 4LSRH 1OB1A 2DWEB 5AD0B 3RIAK 1A1OA 3T0AA 3WFHB 2M26A 1CD1A 4ZNCD 3IDJA 1IRAY 4Q9BA 2VAAB 4DTGH 4EUPB 2XTLA 1LP9F 5DSCA 1KB5L 4OQTH 5H94B 3U30C 1EPFA 1GHFH 4H8WC 1C5CL 4AIOA 3O4OB 2D03L 4LSSL 4F9LA 5INDB 1VEOA 25C8H 4XCCH 3QFJB 3VCLB 2VC2L 4MD5B 3OKEA 5D7SH 1BIHA 4GKSA 4ZPTA 5CD3A 5IV2B 3RZCA 1P1ZA 5T3XE 1KJ2A 1HWHB 1AQDA 5C0IB 4BQ8A 2WWKT 3B9DA 1G0DA 1MHPL 3BZ4A 4PTTA 1PGRB 1MOEA 1S7SB 2DQJH 5IHLB 4P3DA 3SE9L 3U1SH 2FX8L 1CE6A 1JGDA 1HXYA 4WHYH 1OVZA 3N1MC 4OCNC 3HMXH 1JHKH 3HMWH 5C6WH 5ICYB 5BV7B 1BGXH 3B83A 4PB9H 2JJTC 3LKOA 2X1XR 5E0QA 3V7AG 4X4XA 4LCWE 4D0DB 1DQMH 3TBSA 4XP6L 5A3IC 2YN5A 3WO4B 4NRYA 5CIPH 5DMIH 1I7TA 1SM3L 2NW2A 2DQIH 2VC2H 4YXKL 1AQKH 2YRLA 4D3CH 5DZLA 1Q0XL 4OZHF 5SV4A 1WAAF 2DYPD 3P73B 3SGKC 4NKDA 3NZ8B 4PRIB 2P47B 4G3YL 3V9FA 1FHGA 5IW6A 2L0DA 5B8CA 3UDWA 3RVWC 1QO3A 3O6ML 2D7NA 3VXNA 1TQBC 1EUTA 3WHE0 4WO4A 3O3UN 4HJ0C 2YA1A 1XR9B 3PHQB 5TH2B 5JPMA 4WEMB 4M4PA 4QRQA 1V7NH 3P77A 1FNLA 3IXTA 2A73A 3IDIB 3WIIH 4A2MA 3MLRH 1KEGH 1KPUB 1JTOA 2BOBB 3CXHJ 1AD0A 1OAUH 1UM4H 5HPMA 5KSVB 1F58H 1FJ1A 1RUML 2E6PA 4DN3H 4QYOB 4O02H 3B9AA 1N7MH 3ARFA 1DQDL 4Y1AD 3FO9B 5IWLA 2XZAH 2F19H 1C08B 2OTUB 1Y0LA 3QUYC 4TYUA 1YY8A 3RHWF 2X05A 2EDNA 4HMEA 6FABH 1G7IA 1CQYA 2ESVE 4Y19B 3GBML 3GSWB 3MO1A 3ULSB 4MQXD 2ZCHL 4XC1H 5E8OB 4ODSL 4S2SA 2DTMH 3QQ4B 2HFFB 3FRPG 4JE4B 2VXTH 1BLNA 4HIHA 3TCXA 1F11B 3GJFK 1T21A 5DJXA 3VFUA 3MBXH 1T5WB 5E9DE 1A9EB 2VQUA 4FA8A 4DKDC 3VWJA 4JO1H 2IQAA 4PRHB 3SDAB 2ZNWA 2M2DA 5D5MB 1I1AD 2WIIB 2Y07L 4YGVB 3BW9A 2CK0L 3WE6A 3TYGH 3UPCA 2YUVA 3IETA 1E27B 2NX5E 1P7QA 3PHSA 1FFOB 4PJ9A 4NQVB 3CFEB 3THML 3L5XH 4G8GD 4GRLC 1I8LA 4FMKA 3T0WA 4WWID 5IK3A 1NBYA 4ALAH 4HWNA 1Z6JT 3ARXA 2H1PH 2P5WE 4FQIL 4DJMA 3CSBA 1I3UA 1R3HA 5GJTH 4ZSOB 1WAAA 5IEKA 4XXCC 4N8VB 2HRPH 2UV3A 3C9NA 5KSBE 1W0VA 3B9KC 1SVCP 3VXSA 1MCDA 4JFXA 3RX7A 5CSGA 1MCQA 3EW3B 1MRFL 2G9HB 2IC2A 3ABZA 1FRGH 5DFVC 4WWKD 2AXFB 1CLZL 1BBJB 5EU7C 1MI5B 1RZJC 4HS8L 4PJ9D 3TBYB 1INQA 5DRXB 2AKRB 2MQCA 3MLVH 4W6WB 1HSBB 4MJ4A 3SDCB 2C4XA 3ZDYE 3CUPA 1CXLA 4R26H 1VADA 3MQIA 5GGUB 5IWLC 5TGBB 4DVBB 4X6DF 4MA7L 3BIBX 1B0WA 2D7TH 4U6HA 3T0EC 1ORQA 4RISL 5A1AA 4LP4A 4HZAA 4KJWC 4Z5RA 1S9YA 1JGLL 2RQ8A 4MB3A 1EGJL 4ODTL 4NCDA 1ACYH 1G7LA 1K4CB 4LU5L 4GMTL 2Y6SD 3Q1SL 3RWJA 5IR1B 2CLVA 1YEDB 1LK2B 4ZFOA 1J12A 4JHAH 1ZWIB 5AZ2H 2HLFD 2ESVD 3FOMB 4KY1L 4DFIA 5DVKA 1M6OB 1ND0B 2SEBA 3L5WB 3RI5F 1YECL 1AI1H 4PJ9C 5FEBA 2OJZL 1XGUB 1ZLSL 1CLCA 4P59H 1CD9B 3EO0B 2MKLC 3RJDA 3MYJA 2N1KA 2V7HB 1T04B 5KSAB 1NC4A 1CFQB 4JO3H 4UIMB 1FG9C 2YD6A 2FHBA 5C92A 4AL8L 2XA3A 4OZHB 1HYRC 4A6YH 4GG6E 5BCAA 4R4ND 4WUUD 3O3EA 2DL2A 3BP4A 3S98A 2DICA 2OX5A 4OFPA 3KPRB 1OWWA 4YDLC 3S96A 4YHML 4WV1C 3SDDA 4DQOH 1WIPA 1FBIH 3F7YA 3SPVB 1UT9A 3PF2A 4OD3L 5D1XD 3SKUD 4KKBC 3MV9D 1WZ1L 2BRQA 3OGCA 4TTGA 3S5LG 4JVWA 3VXMA 2XKNA 3BP6B 3D0VB 5BQ7B 2IH3A 5I9QB 4OF7A 1QG3A 2C9AA 4DZ8A 3AY4A 5DTFA 5GRJH 3U0PB 3MCG1 3WIFB 2ERJB 4KUZL 2VLME 1NAKL 3UXFA 5IQ7L 5C07A 3ZKMD 4WW1A 4ZNEA 4P2RE 2BVQA 1JZ4A 1V7NL 2I25N 3BT2L 1T0MA 5EO9B 5E6IB 3PHOA 4D9LL 2FX8H 4Y4HD 1NSNL 3SKOB 4YHLL 1T6VN 2HG5A 4RAHA 1K9TA 1J05B 1T1YB 3EDKA 3SQOL 3WLBA 2AJ3B 3HUJF 1OM3H 3K2MC 1YEJL 5ALBL 1F2XK 3RZCD 3S5LA 4KXZH 1QFWM 1WIUA 4FQCH 4WI6A 3UCRA 3RUGA 4R96A 2Z8RA 2D31B 4DW2H 4NQCA 3IFPA 4WNQA 4XX1G 3WN5B 2UVEA 1UM5H 4G5ZH 4KVCL 4Z7WF 5IMMB 5LAXA 1MVUB 4DUXA 1E4KC 5EU4B 5E8PB 4H25B 4CN1A 4WCYL 5I73C 3VFGL 2C1PA 4NN5C 5D1QC 5HGHA 3C6LC 3IFOB 1UWGH 3SE4C 1NCDH 4NQXB 4RA3A 5I6XB 4AM0B 4LASL 1N0LA 4RGND 4GUPA 3ARBB 3IDUA 1WK0A 4YBQC 3TVMA 1PSKH 2RFXA 2JJSC 3QDJD 3WS3A 4HEPG 1TZGH 4HG4K 4X7TA 1IC1A 1CU4H 4XMPH 4J3UA 4Q6YA 1ZT7A 3MFFB 5INCA 1DBJH 4JN2B 4YHOL 5JQ6L 3N9GH 5D5MF 4Y88A 5JW3L 3GMMA 3MCKA 4WJ5B 2VDNH 4FQ2L 3DUUA 3EFDL 3NZHL 4J6RH 1E6OH 4JVPA 4YDJB 3KPOA 4UQ2B 3SKNB 5I18H 1S9XB 4WJ5A 4APQD 1NCDL 2VN7A 4M6ML 4NQEA 5KVEH 4JN2A 3IRPX 1FYTE 3NCEB 3CX5K 4EI6A 4YHZH 3V0AC 2WLYA 2FZ3A 3W5NA 1IKFH 4KPHL 4XPFL 4U1IA 5DEGB 3OG6B 4PJCB 1WISA 3QB7C 5GS0D 1KENL 2YC1A 3KGRA 3LMJH 3EOAA 1CTOA 3D48R 3P4NB 4JM2A 3PG2A 4DGVH 3L5IA 4QGTA 3WHE1 3C8KA 4DK6A 2DBLH 1KJ2H 3O2WL 1P6AB 4FFZL 2DS4A 1XCTA 3JV5A 1OCWH 5IBTL 2VWEC 2AQ3A 2FH6A 5C08A 5L6YL 4HWBL 1JVKA 4EJ1C 4IDLA 5T3XH 3VFPA 3FB8B 1OT2A 3MRCA 3QEQB 4J8RB 5IMMA 1TCRA 3FB7B 3VGAB 5GZND 1FDLL 1KTLA 3V4UL 3P4MB 4LAJH 5SX4I 1S7UB 1BVKB 1CIDA 1CR9L 2NTFA 3GHEL 2CUHA 3IDNA 4PJXF 5I1AA 4BZ2L 4C56A 3P0YH 3D39A 2I9LA 4PJFF 3DETC 3BQUA 4F37K 3REWB 3VMOA 1IC5H 2EH8L 5CZVH 4YNYA 4KZDH 4G7VL 1FZKB 3WS3B 5J6HB 2VUYA 3CMOH 1W0WB 4PJBE 3JWDH 1E4WL 4YFDB 2IBGA 3MV01 2D2OA 2K3TA 2GJ6A 3T2NL 3U1SL 4KUZH 3QQ3B 1IBGL 4YPJA 5K59F 4Z7WB 1M4KA 4WFGD 1KLUB 1BAFH 3UPAA 4OCRL 4MXQD 1WBXB 1PLGH 5EH1A 4JPKH 3CFBA 4X99B 5HYSB 4UINH 1NAMA 3EGSB 1S7VA 3F12A 3V52H 2VLKE 1EK3A 3OAUH 3A6CH 4U49A 3S8WA 1ACZA 1CDYA 1JJUA 3S35L 1UWEH 1KLGB 1NC4B 5IFJA 4PJHF 2K9UA 4M7ZB 3SCMC 3GMOA 4JRXE 5JOPD 1BVZA 1TETH 1T2XA 5ISZD 2YKLL 1MNUL 2WWMD 1TJHH 4F7MA 7CGTA 4JKPL 3FAXA 3QAZC 1QRND 1K6QH 1NFDA 5A16A 5J06A 1A7PL 4ZPVB 3Q5OA 1EFXB 3IXAB 4PRPE 1MF2H 4FABL 1NLDL 3BWAB 5FB8A 1B3JA 4QRRA 5F97E 1G7LB 3LVEA 3A6OA 5EWIH 3OGCB 5DTFB 4GKNB 1OB1B 3KWWA 1QBMH 1ES0B 1ZOXA 4DZ8B 5LKNA 2AJSL 4ELME 4ZSOE 1AE6H 3MUJA 4ZFFB 2VQTA 2NY3B 3QUXC 5E94B 2VMFA 1FG2B 5HHMB 3PXHA 3VXPB 2DQGL 1FFNA 4EDXB 5FA3A 4YHYB 3HE7B 4K3GA 5T33L 1FO0L 4N5EC 2VERN 4MJ5A 2A9MH 2ZUWA 2OTWB 1JF1B 3IS1X 1T89C 1H3VA 2H32B 4LFHG 4J4PD 4I5BB 3U0WH 4S1DD 1D5XB 2A6IA 3O4LD 1QVOA 1NJ9B 2OJEB 5EOCL 1CDCA 2BMKA 2PYED 4QRRE 3O4LE 2NXYD 4CADB 1DLFH 1MAKA 2XWBA 1IFHL 4JLRA 4Y4KD 3LY6A 4LHQB 3CC5B 4ETQA 4QRRB 2G9HA 2FX7L 4KXZI 1ZGLP 1T3FB 1AGEB 1KB9J 1J7VR 5IKCA 3QFJE 4P0DA 3FT4B 4JZJB 1HDMB 3WD5L 2F53D 2EDEA 3MZGB 4IMKA 5C0CB 4BZ1L 1S7WB 3RWHA 2P49B 4WO4C 2CH8A 1CGYA 1I8KB 4YXKH 4NC1E 3KXFB 4H0GA 3CK0L 4Y4FA 3LKNA 4Z7NF 1JGEA 3GMRA 5LBSH 5EPMA 1FGNH 1ZS8B 1AJ7L 1CXKA 5FUOL 4KRPB 4RGMC 3B9KB 3LOWA 4JFFD 1P7QB 5I1DA 2IWGA 4U1HB 1M7IB 3B2UC 4F33A 2IMMA 2E27H 1IZJA 1S7QB 4PFEA 5JW4N 4OFIA 1FFPB 1YNKL 3RY5A 2CMRL 3FB8A 3MBXL 2Z93A 1CD0A 5FO8A 1T5WA 1ZS8A 4XNZC 3I3EA 1KEML 1CIUA 4L5FL 4NN6B 5FUOH 3T1FA 5I74B 3WHXB 1T1XB 4CN4A 2V5TA 4OZFA 1MI5D 3GBMH 4OLVL 5JXED 2ZCKH 4OZHE 1S7WA 1KG0A 3CFCL 5CJQL 3DUSA 4JFDB 1KIUA 1JN6A 2XN9E 4FQJH 2W1NA 3Q48A 1A3LL 3HPJB 1KTDB 2KQNA 3FZUD 5IBUB 1JV5A 1QHPA 5E95B 5DO2C 5LGHL 3MRMB 5E4IA 4GQ9H 4Z7VF 1CF8L 2JCCE 2HT3C 1CD8A 3EYQD 3PQYE 4YBQD 3CMGA 3VD3A 1L0YA 3UBXI 2D7TL 2AK4A 3LD8B 15C8H 1V05A 4MJID 4NNXB 4I5BA 4NJ9L 2IBZX 4PGDA 3L5XL 3VFMA 2CRIA 1RZKC 2ZP0T 1HHJA 5J1AA 1HCFX 2AK4B 4RBPH 5DRZB 1YEHH 1QBLL 4P5TA 1EDQA 5JIHA 3FB7A 4HBCL 1I1AB 3QQ9D 3LH2H 4J8RA 1OGAE 3VFPB 5D2NC 4KVNL 4KY1H 1CFNB 5HGGS 4H0HB 4F9LC 1LO2L 2BVPA 4X9GA 3HPJA 4W70A 4K23H 2YR3A 4GW1B 25C8L 4Q0XH 1AH1A 4P4RA 2CDFB 5ISZA 3EOBA 4ZOCA 2OK0H 4K55A 5E8OA 3ZE2F 4WUUB 5IHUH 3WNOA 3LKNB 4OZIA 5EC2B 5DHVH 4XPAH 1JRHH 2EEBA 3MXWL 4P2RA 3MUHL 4RWHA 1D6VH 5DEGA 4MNQD 1CXFA 3GSUB 4JY4A 3TFKD 4HWBA 4UMGA 2F8XC 1I75A 1Y6MR 1JF6A 3BHBB 1OGAA 3JVGA 3Q5YA 4J4PA 3CU7A 4WFED 3PUCA 4KAQH 4NQDA 2Z31D 4H5SB 4HBCH 4PRNB 4X9IA 4RMRA 4HLZG 3JBG7 4PRHE 1KJ3H 3B4NA 4JY5H 3IDIA 5ESQA 1RU9H 3GUTA 2BNRE 1I7RB 5HD8D 3HG1D 3PWJB 4D9QD 3GZKA 4XCEB 3RL1A 3LS4L 3AS2A 3VXOA 4LSVH 2ENYA 3L1OL 1PX4A 4MAYC 3G9VA 3BJLA 4RFEA 4I0PA 3UTTB 4HWEL 5D7LD 3OAZH 4OTXH 4FQQB 4LCCA 5D7LE 1FFNB 2IH1A 4G6KL 4JFXB 3BPNC 2P5EA 4B53A 2XTJB 4NM4L 4UTBH 1I9RH 1AKJD 3W82A 3MGTB 3PQYA 1FNFA 4LSVL 1I7TB 2NW2B 5ITFB 3W0WD 1IGFH 4FQPA 1TFHA 3F6LA 1CL7I 2VSCA 3DVGB 1FYTB 4J3VA 3FKUS 4QXWA 4Z9KB 2XICA 2VLJE 5J6HA 4OCLC 4OM0L 4WEBL 1WCBB 1KG0B 3V2AR 4RA0C 3IGAA 3SDYH 3LQAC 1TETL 4LCWA 3O8XC 1XT5A 2DQHL 2X4PB 5K9JH 3D5OF 4ODHH 1UM6L 1YEFL 2F54A 2GIYA 4R7NB 1E27A 3LQMA 4L1DA 4J1UB 2XQBL 12E8H 4H20H 5C6TL 3BZ4B 3T65A 2JJSA 1RFDH 4XNMB 3QO0B 4KTDL 5EA0H 5T33H 5M94B 1A47A 5FHAH 3SKJL 5HHQB 2ZG3A 4XPGL 2JELL 4TVPH 1JGEB 2QSQA 1QP1A 4PJXA 4H0IA 3LKPB 2FJHB 5DJ0A 4E5XB 4M93C 1KF9B 3CFDA 3GSXA 5BO1H 2PYEE 4GRWE 5SWQB 3TWCH 5MERB 3FOMA 3WNNA 2IAND 3T4AB 3WKNA 1WC7B 3VXRE 1BIIB 4FXGA 1HKLH 4YQXL 1ZANL 5KVGL 1YEEH 2PXYD 1OL0A 3TYFB 4MQSB 2DLTA 2BDNL 5EBMA 3OJDA 1E28B 2D9QB 3S35X 2XWBB 3H9SD 4GW1A 1NMCC 3ZT7A 5GIRA 1CU4L 3BUYB 2I9TB 3BO8B 3FO1B 1CLOL 1A4KB 3MRRB 2A0LC 1NMCB 3MJ8B 1A3RH 5HVGB 1HOCA 2VQ1B 4M1DH 5EUOB 3MA9H 1U3YA 1BP3B 1W72L 3R0MA 1FO0A 4PR5A 5EOCJ 2GKIA 3FL7A 5EUOE 3VE0A 1FL5B 4JJ5B 5I8KL 3QRGL 4MNQA 1IM9D 4FQJL 4HCRL 5CSBA 4EOWH 2C3HA 5K33A 5T5NG 1J1XL 1JI1A 5TQ2L 2QSTA 4FZEH 4QT5A 3JTSA 5C7XL 1R3KB 4NN5B 5D1QB 1TVHB 2UWEA 4IOFD 3LPFA 5EG6C 3BO8A 4JFOA 2K7QA 5D93B 3TH3T 1LEGA 3V4UH 1UCTA 4MCZB 4OFDA 1OAXH 4Y89A 3D6GA 3ZE1E 4NO2B 4HK3J 3MBED 3O2WH 2ARWA 4HGWA 3DLQR 5DMKB 1A3RL 2CMRH 2GUOA 1F45A 4TSBL 4OF0A 2ZOKA 3IU4H 1N0XH 2OBGA 3PNWA 1T1XA 4X8XA 3MV7D 4QNPF 4NKIL 4WUUA 4UV7L 3SGJA 1XF1A 3HI1B 5ISZB 3HAEA 3KJ6L 1MHHA 4LCCC 2DBLL 4KGLA 4HKZB 3RA7L 3LN5B 2AEQH 5GRUH 4U6HB 1KJVA 1KLGA 3L5JA 1EEYA 3IFPB 4P48A 2FZ3B 5D6DC 3ROOA 2HMID 1CDIA 1U8PB 4BH8B 4KZEH 3C6LB 1NFIA 4JY4B 5I8CB 1AY1L 5D7JD 5DHVB 5T3ZE 1KXQE 3F58L 5EOQL 2D0FA 4OQTL 4YHKH 1HEZA 3X12B 4NZJA 3PWPE 4YUEH 4PP2A 2XACC 4N0CD 3OR6B 1F4HA 3ARDB 4I3SH 1DFBL 3SDXA 5CZXC 4BKLA 3EYSH 1ZMYA 5F7LB 5BV7C 3E2HB 1MRDL 3FT4A 4PJEE 5IBTH 4X7SL 4XPFH 4KK5C 2YA2A 1ZLUH 2BVPB 3I6LD 3MGOB 2AAVA 3WIFA 4DCQA 5C71A 1UENA 2X89A 2KZWA 3DSFL 3O9WC 4JGUA 1MJUL 2YWZA 3L95B 2P5EB 4HIJA 4F7CB 1HINL 2DMCA 3W0WE 2APXA 3DSFH 4XNQB 4JGMA 4NZTL 1MJ8L 4P57A 1JN6B 5HTSA 3A6CL 2N4IA 3MV11 1G1YA 4JFDA 5D2LB 3DXAD 3BZFB 1UB5A 5EU7E 1BFVL 4RIRA 4TUJA 1A9BA 2QQKL 1QR1B 3TA3D 5GZNC 3HZVB 3KPRA 5I1AB 4M6AA 1TQBB 5FIEA 2X1QA 4DTGL 3IU3B 5B38B 1NEZB 4PLKD 3OKKA 2X4RB 1NLDH 3L6FA 3TC9A 5LAXB 2VNCA 1F8TL 3WEXA 4NKDB 3LEXA 2ILLA 2MMXA 4WRLA 3J7HA 5FDWB 5F70A 2XZQH 3VWJB 4ZXBA 3V0VA 2IALA 1BX2B 2AW2A 2BSSB 3K4ZA 1CFBA 1CDGA 4GKOA 3TBTB 3VWJC 1OTUD 2NY1D 1YEFH 2XKUA 4X5WB 4C4KO 2SEBB 2YZ8A 4NHUA 3QCVH 1XF2B 4PLJD 4IOSD 1I1RA 5C2UB 2CR3A 2D3VA 2NY2B 5E6IA 3O3DB 5DJ6B 3RFZC 4YHPB 5GRWA 3QXAA 5SWQA 4CJ0A 1FJ1B 4X5WA 4QY8B 3S88H 5KVDL 5DRNA 1I1FA 3DI2B 3CSYB 2CKBA 4R96B 4JG1H 4BSVA 1JBJA 4QHUB 3BD3A 3P77B 5IB3A 4YDKL 3IFLL 3QT2A 1SY6H 1U6AH 3SKNA 3DBXB 2H32A 3QXVA 1F4XH 2ICWA 1WWBX 2VDNL 3CFIC 4J1UA 1N6UA 4P3CH 1NAMB 1WF5A 1G6RA 3K74B 5HVHB 4FMFA 4HBQA 2QL1A 1INQB 1C16A 1TZHA 3P3YA 1QQDA 1JFQH 5ID0A 3MLZH 5D1XC 4LSTH 3TZVD 4BFIB 1VGEH 3MRHA 5DLML 1JV5B 1CDUA 3S34H 5BVPL 5E8EA 2CK0H 4PGJA 1KCVL 2GJ6B 4AENB 1I1CA 5I75B 4J2XA 3D87B 5C07D 4BFIA 4FQQA 5HHOA 1ORSB 1PYWA 2WBJD 5HHVL 4AK1A 1DL7L 1BIIA 2AGJH 4FNLL 4UNUA 4XP9L 2VKWA 1UADC 5HI3D 3MFGB 2NY0D 5CINH 4ZPVA 4PJDF 1X7QB 1HQ4B 3DBXA 5BVPH 5L2JA 4WENB 2FD6L 4PLOB 3OJ2C 4WNQB 1OD7A 4YHOH 1KCLA 4XNZB 3ALPA 2W59A 1FE8L 3UEZA 3NTCH 1S7QA 1I7ZB 1OF2B 5KOMC 4M1GH 1JZ7A 3V5HB 1KSRA 4NQDB 1YDPB 4F57H 4OLZH 2P42B 3T77B 5BVJB 2B8OT 3JTTB 1EEYB 1U0QA 1Y6KR 1UACL 1WSST 1V5JA 1PKOA 4TUKH 4NZDA 1QHOA 2A77H 5F93C 3LQZB 1KB5A 4B50A 5C9JA 3QJHA 5C0CA 1GOHA 3QFDA 3C60B 3Q1SH 3S9DB 4TPRL 1MCSA 1CWVA 1T0NA 5AUMA 1MRFH 1F97A 2VSDA 3EZ8A 4N9GB 4GO6B 1YEHL 2AXGB 1YQVL 3VXQA 4LLVA 5GSVB 2BSRA 3DMMA 4EI5B 1MCCA 4IRJB 3K1DA 3C08L 4NJ9H 5IM7A 3W5MA 2IALB 4HGWB 1RJLA 4NOFA 4R4NC 3TH4T 4QHMA 2APFA 2ITDA 1BD2D 3KJ6H 1SVZA 3VXSB 1XGYH 2J8OA 1EO8H 3QPQD 3GSRA 4IOFC 4P5TB 3EGSA 3AXLB 2FL5A 5HYSA 2OXHA 5EUKB 3G9AB 2XT1B 1B6DA 4OV6F 4XHQA 3FOLA 4I48B 1FQ9C 1UJ3A 3VXSE 5IQ9B 2P24B 2BY2A 4NQEB 5DI8A 3RL1B 3BZFA 4YE4L 5EFIB 1A6UH 1UYWL 4IHOA 3IDNB 4Y19D 2A83A 5FFLA 2FGZA 4DVRL 2IANA 1A9BB 2YK1L 2JK5B 4LSUL 4NO3B 1XGRB 4OZGA 3K81A 4Y2DD 4NNXA 1CFQA 4UIMA 3MLVL 4XVSH 1UZ6E 5A43C 4GAGL 3WV0A 2R8SH 1S78D 3NA9H 4YBLB 3F7RA 1IAIL 4NKOA 4U3CA 1KYOJ 2VIRA 4UTAH 3EYOB 2H1PL 3DIFB 1GGCH 2VYRE 2R23B 3GK8H 1HINH 5I0DA 4N8CH 2A6KB 2B39A 3EJJX 4ZUTB