4D8VA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8vA00
1PBNA 5KB3A 2PGAA 4F3CA 4LZWA 4DA7A 5CXSA 1CG6A 1RXUA 3DPSA 4P54A 4JP5A 3C74A 1RXCA 1YQUA 3IEXA 1OTXA 4G41A 2I4TA 3EEIA 5JPCA 2OC4A 4EB8A 4WKPA 1A9QA 4TXMA 4L5YA 3ENZA 1TD1A 2IQ5A 4TXJA 1JYSA 2BSXA 1PR0A 2A0XA 1PR4A 4L6IA 1QE5A 1OTYA 2RJ3A 4H1TA 3GGSA 4R2WA 4QFBA 4L5CA 1K3FA 1Y1RA 2HWUA 4IP0A 4X24A 4DA0A 4TXLA 3DDOA 4DARA 4ECEA 1Z33A 1Z5PA 4LKRA 3QPBA 4BN0A 1TGVA 1K27A 5IU6A 2HRDA 4LNAA 3OZDA 3KVVA 1ODLA 3NM5A 4PR3A 5EUBA 1JE0A 4QAQA 4D8YA 3NM6B 4F1WA 4OGKA 2B94A 4G8JA 5K1ZA 3EMVA 1RT9A 5ETJA 2AC7A 5CYGA 3FAZA 1ZOSA 2QPLA 4TS3A 3FOWA 1I80A 4GKAA 1V3QE 1JDZA 5F7OA 1Y1TA 3KUKA 4DABA 4NS1A 3E9RA 5FAKA 1LVUA 4LNHA 2A0YA 1V48A 1V2HE 1OUMA 1SJ9A 2XRFA 1ULBA 1OV6A 3PNSA 4YO8A 1A9SA 3BGSA 1JPVA 3SCZA 2HN9A 3FB1A 2HSWA 3KVYA 4DANA 5CCEA 1RR6A 1Z5OA 3UT6A 4F2PA 1G2OA 4R2XA 1ODKA 1VHWA 2OECA 1Y1QA 4QARA 3UAYA 1B8OA 1SQ6A 3PNPA 4WKOA 1Z36A 4G89A 1WTAA 4JWTA 1YRYE 4F3KA 3D1VA 1PKEA 5B7GA 5B7NA 4M7WA 3OPVA 3DF9A 4QASA 1B8NA 3ONVA 1NC3A 3NM4A 3TL6A 1Z34A 1A9OA 3DJFA 4WKBA 4DA8A 5CCDA 4TXNA 5F77A 4BMXA 1LX7A 3OZBA 4D8XA 3OCCA 4D8VA 2AI1A 5C80A 5B7PA 4OEHA 3P0EA 2Q7OE 1VMKA 1FXUA 4L5AA 1ODIA 1NW4A 1JP7A 1PW7A 5EPUA 1Z38A 1VHJA 4GLFA 4K6OA 1YQQA 4UC0A 4WKCA 3O4VA 2OC9A 4GMHA 4D98A 1TGYA 4OF4A 4DAOA 4KN5A 3T94A 1CB0A 2AI2A 3OZEA 3BL6A 4QEZA 5F73A 1U1GA 1ODJA 3K8QA 3BSFA 1Z35A 5I3CA 1A9PA 1PK7A 2A0WA 3E9ZA 1N3IA 1JE1A 5IFKA 5F7XA 3LGSA 5CXQA 3ODGA 2A8YA 1ECPA 4JOSA 2AI3A 2ISCA 4TTJA 3UAWA 4I2VA 1JDUA 3MMSA 2OXFA 1VFNA 3LA8A 5F7ZA 1Y6QA 4M1EA 1V41E 1PWYE 2GUWA 3U40A 1U1DA 1Q1GA 1M73E 4L0MA 1SD2A 4BMZA 4NSNA 1ULAA 4MARA 1U1FA 1NC1A 3NBQA 4YNBA 4OGLA 1PR1A 4QATA 3PHCA 4NY1A 4FFSA 1PR5A 4TTIA 5B7QA 1TCUA 3FUCA 3OF3A 1PR2A 4E1VA 2QSUA 3UAZA 1RSZA 4GLJA 1YR3A 3E0QA 3MB8A 4M3NA 1A69A 4F2WA 3BJEA 3KHSA 2QDKA 1K9SA 3KU4A 3DP9A 1Z5NA 4TXHA 3IOMA 3OOHA 3UAVA 5EFOA 3LBAA 2QTTA 1C3XA 1YBFA 1V4NA 4OJTA 1Y6RA 1PF7E 4DAEA 3FWPA 4D9HA 4RJ2A 3F8WA 1PR6A 2H8GA 4R31A 1A9RA 1RCTE 1Z37A 4U2KA 4YJKA 1RXSA 1LV8A 1T8YA 1JDVA 1OU4A 4WKNA 1JDTA 1RYZA 3P0FA 1RFGE 1JDSA 1RXYA 2P4SA 4MCIA 4OY3A 4PNPA 3KVRA 3PHBE 3FNQA 1XE3A 1V45E 3GB9A 4YMLA 4TTAA 1A9TA 3UAXA 1PK9A 3K8OE 3EUEA 3INYA 4EARA 4MCHA 1OVGA 4TYMA 1T0UA 5CYFA 1U1EA 1Z39A 5F78A 3O6VA 1T8WA 1ZL2A 1SD1A 2I8AA 4LDNA 2QTGA 5F76A 4DA6A 1T8RA 3OZCA 5DK6A 1Y1SA 4TS9A 1TCVA 3EUFA 4BMYA 2ON6A 3OOEA 5F7JA 1T8SA 1U1CA
chains in the Genus database with same CATH superfamily
1D4OA 2X86A 2QXTA 2X15A 4R1NA 1T2DA 4W1PA 2RGYA 5GIOE 1GUAA 5DPMA 2C94A 2B9EA 2EWWA 3K20A 3INNA 4RETA 4LZWA 4J0KA 5IKOA 1M76A 1RXUA 3AEXA 1WHTB 3N70A 4P54A 2EARA 2YCLA 4RXUA 4YB8A 2EKDA 3TZ6A 4E1AA 2D2FA 3AI2A 4G84A 4L4RA 2OHXA 1GQ2A 4RY9A 5DHFA 5FL7D 2O8CA 3GYBA 3PIDA 2J85A 1M8KA 1HPLA 3KDPA 4S05A 4BTVA 4AMZA 5IM4F 2OC4A 3CRMA 3TEFA 3NI2A 3I1JA 3LYLA 1VTKA 3PWSA 4UE3S 2WD8A 4WY8A 4U9HS 1EUCB 1ZMXA 1A95A 2H48A 3SF8B 1FYFA 2AJ8A 2PUHA 4WXEA 5K0CA 2O19A 1IOLA 1JYSA 1QH1B 1MEEA 4JH0A 1QHIA 2OZLA 3CQ9A 3T7IA 5TEVA 4BFSA 4QYIB 3EXHB 5EZ6B 1CRPA 3L79A 4DY4A 4YAUA 3PQ5A 1BQ3A 1PR4A 2IKSA 1PFGA 3NWOA 2ACKA 3H2BA 3HYNA 4NCIA 1UBRS 1BKSB 1RXEA 1WDKA 2V3VA 1N5IA 2PT7A 2BTOA 2QL6A 1L7QA 3WYBA 1FZQA 3K2QA 2CLHB 4R2WA 3HB5X 1QUEA 1R10A 1ZCFA 4PRYA 4BO2A 5JAZA 4IP0A 2IITA 1VE7A 2FZVA 1KYQA 2VSFA 3LAWA 5ESXA 1F0NA 1V5FA 1DKOA 2ZR8A 1EUDB 1F2TA 2H1HA 2QT9A 4IDBA 4XM2A 5E4YA 2WU0A 3PXGA 3I8XA 1S01A 3AJ9A 5A5VA 2X0KA 4M0FA 3J7AC 4H31A 4IQFA 3DF7A 1W8DA 3JQPA 1C4XA 2FJPA 2Q4EA 2YWFA 3G88A 4ZI5A 1P7PA 1RP7A 3QY9A 3B9RA 4LNAA 2BUAA 2AR9A 2EW8A 2YNMD 4FYIA 1SVKA 3IHLA 1I3LA 2OQ2A 4WUVA 2XZDA 1KNQA 5L3QB 1NN3A 3CLHA 2GARA 2QMOA 1NLYA 4TTSA 1Z7GA 1N9GA 2O1EA 3A6KA 4JJ8A 3MJEA 3UMMA 1C50A 2EX4A 1LPOA 3GRAA 3U44B 3ZYZA 3NTOA 4ZD6A 2BGKA 3GCZA 4NTZA 4CEHA 2VDWB 4Q9JA 3WGMA 4ALJA 4DCUA 3G9UA 3LQFA 3NHYA 5AKYA 3DLTA 2B7CA 5C52B 2AKYA 2B9VA 2RH4A 4ECAA 2YJZA 1CJUC 1NVEA 2PUDA 2FPWA 4HYTA 4O4HF 5AXCA 3UJPA 3WK6A 5IDWA 1K5HA 3HVIA 4IDGA 1C5KA 2YOFA 4QEDA 3W2IA 5KYYB 1Z26A 4TKMA 1LNZA 2P2GA 4C04A 2ANBA 1Q1ZA 3ICCA 4C4PA 3NJ8A 2ZU6A 5LQSA 3G5LA 2RHTA 1RD4A 2DFKB 1NXVA 2Q4TA 1L4NA 2NZVG 4KQJA 1E1KA 3ZHCA 1DHRA 3ZWYA 5BWOA 4ZQFA 2JJYA 3GT7A 1RPJA 1GEEA 1CE8A 3B6JA 3R5TA 4ZHQA 4RF3A 1PTKA 1DAIA 2W2NA 4PPQA 4YJ3F 3U7GA 4PPNA 2QMYA 5AP9A 1YDWA 4FXOA 1RZUA 1YU9A 2ZRBA 2YIDA 4QAJA 3TSOA 4CLOB 4B3TB 2RGBA 4JLMA 2REQB 3THYB 2QXUA 5EXDA 3WLJA 1SHJA 1K9VF 3DB2A 2EXXA 3IP1A 5J4KA 1XP5A 4CE6A 4O2AB 2OMEA 2NUPB 4B4DA 1W4CA 1OUMA 1T5TA 1NBME 4G9EA 4NP6A 1Q0TA 2BKVA 3M6WA 3RYIB 1OLOA 2J07A 4UKDA 5IVIA 2YZ7A 2IOYA 1NFRA 1O89A 1DBWA 1TT5B 2C2YA 2R4TA 1OHHA 2O0KA 2Y05A 4DQVA 1K7EB 1JPVA 3JAKA 5JQGF 3WGIA 2GM4A 5A5EA 1ORDA 5ALLA 1QNLA 1IK4A 1RC0A 2HN9A 4NJEB 4X44A 3LCUA 3SEZA 2B1GA 1P72A 2GI4A 2W2OA 4RHUA 4FN4A 4G1CA 4V0LA 1D5WA 1ZUIA 2ZE5A 3MMNA 4KRGA 3G5TA 4HLDA 4EYKA 4BPRA 4RTLA 5DU2A 3RE1A 3MFQA 3T0GA 1AMNA 1MVLA 3GU3A 1OFVA 4TSFD 1ZJ5A 3MILA 4OQZA 1TO2E 2YVQA 5D00A 4JNKA 1QGZA 5ITZB 5E6SB 5EESA 1ODKA 2O6LA 2BKXA 1JHQA 1RWNA 5EJ4A 4YAIA 1Z2CA 1D4AA 4G1BA 5CBKA 1OBOA 3OFNA 1WWKA 4P08A 4BE9A 3UAYA 2BAGA 3WSWA 2OCGA 3UHOA 2HCTA 5DJ5A 3EFHA 4Z53A 2G83A 4GM0A 3GGDA 3T06B 2CV1A 3ROGA 5A3VA 3S1AB 4YV1A 5BW5A 3AKYA 2IIPA 3LPCA 2QN9A 4IV0A 1TYDE 3N76A 2G40A 3PEUA 4J3FA 4O0LA 4PN7A 2WW8A 5BV8A 5KOHB 1YRYE 3W5DA 5E7JA 4LS3A 1PS9A 2Y1FA 2FE1A 3Q3CA 4KR2A 1EWTA 3FMOB 3OF2A 4LJSA 5ED4A 5KOIA 1F8YA 2CVPA 1MB9A 2G88A 2PHZA 3N2LA 3UAGA 3V8QA 5G0TA 2AFIE 2WT9A 4HDNA 4M7WA 2EEZA 4UARA 3OPVA 1QH8A 1FNSA 1AMOA 1QIFA 5A6VA 3TSCA 1Y9EA 1T4MA 4YRJA 4E51A 1XKQA 1QHFA 1H6BA 2DUUA 4I1RA 1KI4A 5JPIA 4YFVA 4ZCLA 1Q6YA 2VDOB 3IT2A 4OCZA 5JDIC 2V03A 4G37A 4WN3A 4Z3OA 2NTNA 4LMPA 4X94A 3VU3A 5B64A 1K5DA 2PEZA 2R84A 1AS0A 3NAZA 4BMNA 3W7AA 2O5EA 2HQSA 2IPLA 4DY6A 3L8CA 4ZAYA 5EJ5A 5CLFA 4G63A 2VTBB 4DDMA 3GJ6A 3Q5GA 5J40A 4UHHA 1U3WA 1I3CA 3W2TA 1G41A 1YRAA 2HADA 3P1JA 4OAPA 4FKBA 5KO2A 4C4XA 3K0SA 1P1RA 4G0WA 1L8LA 1MMFB 3RC3A 5KYWA 1R6XA 2QTHA 5JZOA 3AI1A 4G2TA 1FP4B 4R5MA 4ZCMA 3PF9A 4KGDA 2GR9A 2ZYGA 3FM9A 3RBAA 3TMYA 3UOAB 1QRSA 5AI9A 5TF4A 2ASVA 1PW7A 1D2HA 1SWWA 3D4LA 3DKVA 4PBTA 1V4VA 5DXAA 1C80A 3BCSA 2I66A 3WSVA 4E32A 3G9QA 3IDAA 4L9AA 4GLFA 4IRMA 1ESMA 2VJDA 2IS1A 3KWJA 3D8BA 3SPXA 2PNFA 3HCPA 3BFPA 3QKUA 4I4TA 2C7BA 2FFAA 3DT9A 4MPPA 2N3ZA 3I42A 3UKOA 4R6WA 1NF2A 4GI1A 4J16A 2O5RA 2BUCA 3GXOA 3OM0A 1BMDA 2NVWA 4A8PA 4D98A 1GKIA 1X38A 3IQWA 1UBLS 3G68A 2BBSA 1ZN2A 1N8KA 3DTNA 3DYVA 4M8SA 5C32A 3L41A 5DHQA 5B1YA 4AW9A 5EMNA 1REQB 2GBCA 1WKVA 4HKTA 2ZYHA 4KB5A 4OQXA 2QY6A 3BBLA 3HWWA 5CA0A 4XGRA 4QULA 1ENPA 1ZGAA 2KJQA 1JSCA 2F3QA 4KWEA 3M2PA 2G71A 2AOWA 4H59A 2ORIA 2PJDA 3E3MA 2AI2A 3CCCA 1PS0A 3MQ2A 5H9WA 5JSFA 3JVUA 2EV9A 2Z6VA 1U9IA 4LMBA 4PX3A 4YT5A 2ECQA 4ZOLA 5DISB 4DS3A 2WU3A 2XQKA 3ESBA 1YR8A 1WAMA 3UT5A 3DWGA 4P1ZA 4LYEA 1GGFA 1MF7A 1G3IA 1RJDA 2AN3A 2VYCA 3IOCA 4G0NA 1EFLA 3DHYA 3CEPB 1NXOA 4F97A 3N8HA 1YFZA 3K9BA 4BO9A 2WJZB 2G4VA 2WSSD 3TIXB 5CB8A 3PU6A 4FFLA 4WKGA 4A73A 4LTDA 1H2RS 1CU1A 1IIRA 1QRUA 2I8CA 1MOPA 3ET5A 1NE7A 3RKSA 5L4NA 2OBLA 4M99A 3BF8A 1IVSA 3CZAA 3WYGA 4CM4B 1DO2A 2FY8A 1RXWA 1L7BA 3FNFA 2H2GA 3KQPA 3RV4A 2VPZA 4JEMA 1Z0JA 1DIBA 5KKNB 4D25A 4KTVE 1WUYA 1LTHR 3IKVA 4CMHA 3DFUA 2AI3A 3HJRA 1J25A 4D4IA 3NETA 3FUWA 4UU0A 3OPYA 3EGXA 3ZZMA 2JHPA 2IU0A 5DM0A 5LZ9A 4DQKA 1AHIA 2Y1WA 3FYUB 2FCAA 5SICE 4YAFA 5ALNA 3FBWA 2ID7A 5HQ3B 3L77A 3W9SA 5JDCC 1KZ9A 1PV4A 2PVCA 2AV6A 1SPXA 5D1HA 5HFJA 3ZWDA 4DIKA 5ITWA 1Y48E 4MUGA 4IJWA 1QYXA 5IVKA 4MKXA 1WUKS 4ACBA 4EVRA 2Q4BA 4AY3A 4ZCTA 3FPSA 4RZXA 3AXTA 1WOMA 4AKEA 3DLBA 1K63A 2H5EA 2PY6A 3ZKWB 1VDMA 1XHLA 4CCWA 1UOQA 1W4LA 2FN8A 4QATA 2NUAB 3PHCA 4PYOA 3GRVA 3OBBA 3T1QA 2E5FA 1C4KA 1BU8A 1SD5A 3CUTA 3KEGA 1SXGA 3OPXA 4KE8A 4NU6A 4TTIA 4TVBA 3I9NA 1FUUA 1QYIA 2B1QA 3PG5A 4X9XA 3UV6A 4YIHA 2I1VB 2DH5A 4DMRA 5IDVA 1NLUA 1RWVA 1ZUD1 4EH1A 5BN4A 2Q1SA 2QSUA 3PEVA 5LUBA 1E2FA 4RTPA 1GAEO 1HDGO 1S2DA 4K6HA 1KWGA 4AJPA 1L7XA 1B0AA 3C8DA 4TYQA 4X3CA 1CQXA 1VYUA 1OFUX 1R2QA 2XYHA 4HQ0A 4LZPA 3OX3A 2AFIB 2Q3HA 4WZBE 4LK3A 2PIAA 4QUDA 1A8IA 4Y18A 3GLFE 3F6SA 1M0EA 4I4NA 3ZBUA 1P73A 1E8NA 2LWIA 1EHCA 4ND6A 5K5EA 2I4NA 1N5DA 3E5RA 4JP3A 2O59A 1SA0B 3F9RA 1X1BA 5FBLB 2BMEA 3LBAA 2C4UA 3THRA 3OF5A 2HDNB 3QTLA 4OHWA 4X61A 1OIWA 4BCCA 1L1QA 1QS0A 1RVDA 3NKVA 4GPEA 2ISQA 4D9HA 3TE7A 1VHLA 2IS2A 2Y2VA 3DR3A 1XQ9A 2GLXA 4YN3A 3JVDA 4TQAA 2CDAA 4K40A 1C9MA 4L8FA 4B3GA 4G4SO 4WESA 3VBCA 1U0RA 3B89A 2EP5A 3EC2A 2FK8A 3FRHA 3F6PA 5BOVA 4Z3KA 1GT91 4YJ2A 1L5HA 2FX5A 3L7MA 4JVMA 4F4JA 1CIJA 3DYBA 1R8XA 3SZGA 3WR5A 5LQRA 1TW3A 2Y1KA 1F51E 4CKYA 2WWVD 5EGSA 5EYPA 3OU7A 1NW9B 4AKHA 4EKIA 2XYPA 5FOUA 3NP7A 2QVBA 5B55A 1JAZA 4MR9A 1CQIA 1W96A 2H1WA 2QE7A 3LP5A 1WZIA 2JAWA 3SQNA 1ZHOA 3P2MA 4BASA 3UXEA 3WS7A 3V00A 2V9ZA 3FF4A 2JD1A 2X0EA 1TF2A 4O8CA 3K6SA 2D7DA 1YBMA 5A6SB 5FPKA 1PEDA 2BGMA 2QI9F 2XV1A 3MJDA 4F3TA 2WVJA 3QVGA 1UDXA 5K2OA 4B40A 1WO8A 5HIAA 3D6NB 2X8LA 4IIJF 3U7EB 4TYMA 2G07A 3DCJA 3Q1LA 3OG9A 1XVAA 4N5NA 3RG2A 2FUG6 2G25A 2Q0XA 2UUOA 1JQAA 1T5DX 1EFDN 2HTEA 2H92A 2OG2A 1CZUA 3I9LA 5FYDA 1KDZA 4E6PA 4ZOQI 2HT1A 3EPPA 4NEQA 4R8VA 4KFUA 3A2KA 2CL6X 1FFWA 3VO8A 5C7LO 2WM3A 5FUMA 3EC7A 1MDBA 2WTMA 2DR3A 4YDRA 4CTOA 1NR7A 4PGMA 4TVSA 3VTZA 5KX5A 1ULTA 2I8LA 5BVHA 1N5KA 1GGJA 2F8LA 3AERB 2HWKA 1WJGA 1K89A 2FPXA 1J8QA 3C0KA 3DOOA 4G0PA 2QTGA 3LHDA 4UE6A 1CNMA 1D2CA 1UMBA 1PGOA 1FBNA 1OGYA 4AG3A 5AW6A 1DRVA 2JJ2A 4F4FA 4K9OA 1MX3A 1XX6A 2OFXA 3KZVA 2R1VB 1GTG1 3T5AA 3RW9A 1RRGA 3M34A 5DWVA 1TCVA 2CWDA 2FDCA 1XQ1A 1UFKA 4E33A 1AF4A 1ILEA 2FWJA 4Y9SA 4DCMA 1YHZA 4UBJA 3KQMA 3II6X 3E03A 1FMFA 1FDIA 3SJBA 3ZWQA 1UDAA 3Q6MA 1JDBB 2BFDA 2QQFA 1G291 1YVEI 3PRYA 3MINB 3VM6A 4A0SA 4D4HA 4D8WA 3D6MA 1IN8A 4Q93A 2PAFA 2PGAA 1E99A 3LGXA 1VB3A 4QVGA 2LDXA 4KV7A 4RS3A 4U39A 3M6MD 5GADl 3KPVA 2R6FA 4J6FA 4CXMA 1T4BA 1HTTA 5IUKC 2WT8A 3HU2A 2QD5A 3UGJA 4JP5A 3ADDA 3HYSA 1M2GA 4BBPA 4Y6PA 3ND7A 5EIAA 4G36A 4K8OA 3EBLA 2XXJA 4ZKDA 3EXEB 1ZI8A 3ISVA 3MN1A 3DV9A 1U8XX 1YOVB 4GEKA 1YF3A 1AV6A 4Q3NA 3VR2A 2MINA 3O8DA 2BEUA 4U7FA 4MIKA 3UN1A 4FJ0A 2Y6VA 3A6HA 4GS5A 4TXMA 1QSGA 3ZN2A 4JHXA 3DE6X 1H0KA 2C20A 3CE6A 3QEMA 4TMVA 3NUQA 4AMBA 1G18A 2EFGA 2OBNA 1KPIA 3HN7A 4PBRA 1KXJA 2IE8A 1PSDA 4RK4A 3U1TA 1I6KA 4DMKA 3DZBA 3U7QB 1L8OA 2ZI9A 3GNSA 1QPZA 3H1EA 3EPJA 1OTYA 2ZDQA 2O1WA 1TTHA 1V8DA 2YJ6A 1T36B 2C99A 2ZJ8A 1NHWA 3AR5A 3EG9A 3NTLA 4U4AA 2YKGA 4RYDA 4XOUA 4Q7QA 4K6FA 2CJWB 1WDLA 2R2GA 3D4OA 4ACAA 1WCIB 4Z1MD 5KJEA 3U31A 1E7QA 1G6HA 3RHZA 3X1ZA 5MN4A 4GKJB 2HMVA 3ZC3A 3AVQA 3WO1A 4G5GA 2OT3B 1SC4A 4RCYA 3SYKA 2DHCA 4DWVA 3NEPX 5DHUA 3W7VA 1CY2A 1KSJA 2C4TA 3DE1X 4D9JA 2DC1A 1Z5PA 3N28A 2XNDA 5JLAA 4H7KA 3SLGA 4B6PA 2JBHA 1P7CA 1TYAE 3EZXA 3FE2A 3R09A 4Q47A 2NTYC 5LYJF 3CNHA 4MGYR 2QQEA 3E82A 4RM3A 4D9EA 2VJOA 2P5YA 4WCDA 2P9JA 2RHOA 4JI0B 3C14C 3QEKA 2RFLA 4M60A 3BQMB 4WZBB 5B3JA 3RC1A 4R5HA 3WLKX 3BGDA 1C1XA 5KMGB 2QMZA 5J59A 4MVJM 3PUKA 1KI3A 1DMSA 1Y9AA 1S2MA 3MG9A 2ZT8A 1IONA 1ODLA 1KVQA 1N5RA 1R6BX 1S0UA 2KM1A 3DOUA 3Q9SA 3KOZA 4GZMA 4E94A 2C7RA 2XQJA 3QFRA 5EUBA 5BSKA 5K20A 4KXUA 4D8YA 1Q22A 1AUQA 1EGVB 4FLEA 3TI7A 3R6DA 4ZZ1A 5IBCA 4B3RB 3M6IA 4V3CA 3P2IA 4GKKB 2CFSA 1KVTA 4RANA 3E22B 4GX1A 4YJ2F 4CLHA 1IHOA 2OCYC 3DFKA 2NV0A 3QU2A 4P5EA 2I4RA 2JGDB 3GH1A 4RKQA 2VFAA 1TKRA 1VJGA 4HGQA 4LTMA 4POAA 1U0LA 4YDSA 1XMQB 2O0HA 3OE7D 4NENA 4JI3B 1E5DA 1QPGA 4K05A 5G3ZA 3RTBA 5CYGA 3IE1A 2A86A 1BFKA 1N75A 1QR6A 3L7JA 2DHDA 5GM2A 2BZ1A 3U62A 4FGLA 4Z6KA 2VHCA 1AT1A 4LXIA 1SXHA 5JCOA 1J1ZA 3KSZO 3ZV6A 1I80A 4YWJA 4UFPA 1F17A 3P4YA 3ZJVA 5K3FB 3FFAA 2CE7A 3Q12A 3ZU6A 2W83A 5IDXA 2YWRA 3N2ZB 4MJXA 4QG3A 4C05A 4UQLA 5JAHA 2BTQA 3OZAA 3IA2A 5AI4A 1Y8QB 1KETA 3MUFA 4K87A 3WFIA 4EJSB 2XUGA 1BXGB 3DUFA 1LKZA 4CRWB 1B2RA 2FMTA 1XTKA 4C0BA 1GUFA 3IEIA 4GKBA 2YZGA 1S2LA 2AXEA 1J2RA 3EGEA 4XB1A 4KQKA 1WMEA 1DJMA 4GH5A 1QIIA 3AUFA 1SOAA 2VQ6A 5KS2A 4IEIA 3KQWA 1B76A 5FRDA 3RFXA 1C3VA 3DYIA 3ND5A 1OV6A 3NBFA 3GLRA 1SVMA 1MOZA 3K2IA 3MRSA 1JB1A 5DRYA 2XT9A 2GXQA 3SQLA 5DYTA 4EBBA 2YCBA 5CJ2A 2FR1A 1XEWY 3NALA 4CIAA 4G0QA 1GPLA 1P2DA 3ZIUA 4A2WA 4Z0NA 1KI6A 4MITA 1Y3DE 4PGGA 4CT0A 5CLGA 2WFMA 2W6NA 4Z49A 1YB6A 2DSTA 4PPFA 4RTSA 5FOTA 4E2ZA 2OHOA 4FYHA 1RAFA 3DOFA 3DLIA 1RR6A 4N0QA 4L50A 5DGDA 3HCEA 1A82A 2IBSA 1WBDA 1Q3TA 1TZJA 2PWBA 1TF7A 2QJTA 1NBOA 3WBJA 3L1IA 4K28A 4ENTA 2QWXA 1FRZA 4DLWA 3BHIA 4A5SA 2V9CA 5C8ZA 1UJ2A 5DTJA 5JYEA 1AU9A 3C7DB 2LDBA 3W2GA 1KZ4A 1TZKA 2H5LA 2RGUA 4XIFA 3I9MA 3SLRA 1VKZA 4ILEA 1JILA 3CUWA 3IKMB 3NH6A 4ND1A 4CMKA 2Q50A 5JWOA 5BT9A 3JASA 1GYPA 2FRDA 1HQKA 1NT4A 5E8RA 1UPFA 5IYZF 4D74A 5I7VA 4BXOA 1LXCA 4OJNA 3MB5A 5JBIA 1N32B 2GCOA 4P7JA 1CUDA 3VSDA 2AF4C 3FXAA 1SXIA 1Y89A 3DBRB 3DDZX 3WSTA 4B76A 1GM5A 3ORYA 4FMCB 2DBYA 2PUGA 4PS0A 1DWOA 4MVJD 4ZI7F 2P27A 2WSYB 3DHWC 5E1MA 1JKFA 4V1CI 2QRUA 2C00A 2CHEA 4Z4IA 4NZ9A 1JJVA 1E8MA 3R3XA 5K9ZA 4KIUA 5ESRA 2XJ4A 2WJPA 1T2EA 1Z6TA 2WWIA 1ZGCA 4HXYA 4MPDA 4DG8A 1DAFA 2ZWIA 1QFZA 4IX9A 1EPUA 4P3PA 1I32A 4MJLA 2FZ5A 3TZLA 3GEGA 5A9SA 1NVGA 3KL2A 4FQ7A 4GQBA 4L4XA 4NNOA 4M4SA 4HGNA 2GJKA 4TKLA 2Q3MA 5FR1A 2GXUA 1GILA 3VYTB 3WRXC 1B16A 1QAOA 2AE2A 3HABA 1DS6A 3N2IA 3LLMA 1XEAA 4X60A 4Y1RA 1FX1A 3ZI7A 1ND5A 2HFJA 3BB1A 4DLLA 3MRXA 3AL0C 2ZS9A 3D8SA 1ZEJA 1TX4B 4GYKA 1OX4A 2UUAB 2BL4A 4M21A 1EHYA 5BR1A 2ONYA 4ND8A 2GN9A 3S8YA 4U2CA 1VRCA 1ARZA 3GEHA 1R18A 2VAVA 4RTMA 1WY7A 2YJTD 3HCAA 4MB2A 1NMQA 2ZVDA 1VPVA 4NZZA 4OBEA 5EIBC 4RDHA 4EIWA 3OQNA 4Z9FA 2JBWA 1Q0RA 5EWMB 2C4KA 3O26A 4NBSA 3DNPA 5HILA 5H4GA 4C0AC 1JQ3A 4JU9A 1NR5A 5AXBA 1QHHA 2IYEA 4WOPA 3E9DA 1YZGA 2GGSA 3VPCA 5ERXA 3G0GA 2XYVA 4IMRA 2D3WA 4BKPA 2PZ8A 2YX1A 3NWBA 3M1LA 3OC0A 4N8DA 4DG5A 3B38A 1ZVVA 3R3SA 3RJZA 5ELMA 4HT3B 1J7KA 1NW6A 3RC8A 4ND2A 3IKLA 3UO8B 3I09A 4W5WA 4AF6A 3LOPA 5BSFA 2OC9A 3RFUA 2QRQA 2FAXA 3G8CA 4Q05A 3SDBA 5KIAA 2C0QA 2Z2JA 3OT4A 2ORYA 2DBVO 4IZOA 2ZZKA 1E1YA 2QV0A 3I45A 2F8SA 1QF9A 1YRWA 2GSDA 3JAWB 4D9BA 4GOMD 1UK7A 3R6WA 3IUEA 3SYLA 5KVVA 3KIPA 1QHEA 2GRAA 1W59A 2D5BA 2WJJA 3EHDA 2G63A 3SQWA 3JQBA 4CFSA 1KQFA 2JFYA 3AWIA 5JMOA 3LLVA 1R8SA 1CETA 3PQCA 4BC1A 2JW5A 3O9VA 4LZZA 2DXIA 3BRCA 3T7DA 3GX1A 4JBGA 2GWHA 3RIYA 1UFOA 4YP0A 1DEOA 3OZEA 4Y2YA 4F4HA 5JADA 5LMZA 4QICA 2VSNA 3ZGYA 5DN6D 2IOFK 1V0JA 2BR4A 1CEEA 1SC1A 2WIGA 2HF9A 4W7HA 3OAAA 4IDQA 1E6CA 4H7IA 4NNPA 4CDGA 4DA4A 2O8EA 3BSYA 4CKBB 3ZY2A 4BNHA 4FHCA 3UH0A 3KLOA 3KOOA 3Q7EA 1QYRA 3TGPA 1QP7A 3THWA 3IHTA 2BPOA 2HC9A 2D8AA 2X3FA 4BLSA 3CO5A 1NXQA 2Y9MB 2IHUA 4AYWA 1AQUA 5A7FA 1G4HA 3ORQA 2JFFA 3Q7RA 4QXQA 1D2MA 4B3DA 2NSDA 1EMDA 1KFBB 4JB0A 4M53A 4ARUA 2P6RA 3P9XA 5F7XA 4NESA 2J3MA 1VA4A 3A6GA 3HKEB 4XJSA 1YNSA 3LWDA 4R3NA 3DJYA 1BDMA 2V7UA 3PXXA 4FSDA 4MUJA 3EDCA 4MX8A 2IOHA 4J94A 3RGWS 4YMHA 1D03A 1WXWA 1MLDA 4GKVA 2VBFA 2J6IA 4DGQA 5CB0A 2W6ZA 1JQEA 4JROA 3P5SA 1FFHA 4QOHA 4U1RA 1VOTA 3W9UA 2ZM6B 3R6TA 1QQ5A 2EBUA 4CDRA 1VFNA 4DLYA 5IXJA 3GLHE 4JHLA 4M9XA 2HA7A 4D6YA 3LCCA 5CCBA 3H11B 4YRAA 4DKJA 1KI8A 4LW8A 4Y2SA 4P58A 5BP7A 5BYBA 3ZV7A 2P67A 4HEHA 4L3VA 4ENUA 2FK7A 2PRZA 2MSNA 3HWRA 4GU5A 2I1QA 5FD8A 1WEKA 3WGOA 1Q1GA 3MWDA 1Z8NA 1O7JA 5FH9A 4RPCA 1U90A 2ZYRA 5JJ5A 3GROA 1G8YA 4PICA 3V4PB 1EG7A 1Y3HA 4L28A 3TIIA 1XO1A 1YH3A 3E15A 3PE6A 1SNYA 3T5MA 4MV9A 4PFJA 2HPAA 2MOKA 4F6RB 1OWLA 3AGQA 3ZDAA 3KPUA 1ZO8A 4K2HA 1NX9A 2CVZA 2ZTSA 4MHOA 2JIQA 3QVJA 4I4LA 4PE5B 3DMHA 4BWGA 5KPJA 2ZSHA 4BE7B 5JH7A 2DVMA 3GXBA 2VT3A 1V96A 5KYGA 4TT8A 4MSUA 3MRTA 5B7QA 2X23A 2B4YA 3ZNPA 3RVQA 2N47A 2P79A 5J58A 2YBDA 5SZKB 4DL9A 3T15A 3FUCA 3TSZA 2QY9A 3T5PA 3HNRA 2DHQA 3DL4A 5A2GA 4A8JC 1GR1A 1X8XA 4J2HA 2AL7A 4ZODA 4NAUA 3EB9A 1F2UB 2J5RA 2GLTA 2R7LA 1T0HB 4NH0A 3PCXA 4YRDA 3WYDA 1IZ9A 3LG2A 2QRZA 2VDRB 4GE0A 5BN5B 3NS7A 3RS3A 5TMBA 3PEFA 1YO6A 2V65A 2PAAA 2CEAA 3O5AA 4J0GA 4KK3A 4Y2GA 3X1XA 3RAJA 1RM4A 2ZUSA 1E2DA 4GVLA 4B7ZA 4DMMA 3AILA 1BVHA 2ZWMA 1N0VC 3IOMA 3Q41A 4YRNA 5K0SA 5MGNA 4G5SA 1E9FA 4L4SA 3FVQA 3DMNA 4XXHA 3UAVA 4LYHA 1JHOA 1U81A 2ZG6A 5ERYA 1DEHA 1FNDA 4IINA 4FP9A 4Q3KA 5A4JA 1U7TA 1W19A 2HWXA 1D2EA 3EWNA 1PDVA 2YRFA 4BLQA 5KWJA 3AUAA 4WIAA 4C21A 1LDEA 1NVAA 2OZKA 6NULA 4TYYA 2GZAA 1DOHA 3TNFA 5AW1A 3D3WA 1EQAA 2PKCA 3UKJA 1NVVQ 1DBRA 4BTLA 4GI3A 2WOJA 1QCZA 4LWZA 1QOPB 4M0LA 4UPDA 1S2NA 1RJWA 2J5KA 4URHA 1TTQB 1CF9A 1IATA 1FX0A 1RFLA 2AK3A 2I7XA 3VKWA 1YS1X 5JJCA 4Z4QA 1VHDA 3WAGA 2CLEB 4XSGA 3ZJYA 4BNFA 4L15A 4RORA 3OURA 2ZAMA 6GPBA 2B2NA 5IEJA 2N1BA 4M6WA 3DEFA 2WKSA 3OQIA 5CB4B 3FWKA 1U8YA 1OILA 1U02A 1Y0BA 2I6UA 5LBIA 2GYUA 3ICVA 5IZ4A 3OZUA 1Y9JA 2HIMA 2ZJOA 3HLYA 4EHNA 1JFFA 2IU4A 1AHPA 4C7XA 1Y4AE 4MVJE 1WSDA 1HYBA 2Q99A 3NPAA 1XAIA 4YRLA 3UJAA 4BNYA 1UPBA 2AHRA 4S1OA 4X7MA 4CHGA 1NVBA 1V25A 3H9UA 2QM7A 5M3BA 2FPKA 1MJGA 4RMGA 4Y0AA 4TWAA 4RZQA 3CE9A 4JGBA 5AM5A 1PL7A 3GRRA 4FNAA 3UOWA 4UNPA 4ZVSA 1B43A 2DPXA 1QBKC 3HRKA 2GVDC 3OOSA 3ANSA 3K9NA 3RSHA 4PZLA 3SSMA 1SC6A 2QN1A 2YWGA 2ZAOA 1P6UA 1DXOA 1QCYA 4HVCA 3IEPA 1BGWA 3A1FA 1F0KA 1BN7A 5KWVA 3ZY3A 2GO1A 2P6UA 3FETA 4QUEA 4B74A 1IHDA 4F96A 1PNTA 2A5DA 1S4QA 1DDIA 1GCIA 1LVHA 2I8AA 2WUEA 4Q48A 1KDPA 2O2ZA 2WJ6A 3UQYS 3DDCA 3ZXIA 3I0ZA 4DCCA 4ZZ0A 1ZAKA 5C46F 3JD2A 3HTXA 3CONA 2Z3VA 4MLPA 1S2GA 3W5JA 1YCGA 2G4CA 2J9YB 2VK1A 4JNCA 3CCBA 4V02A 4MGHA 2DOKA 4NULA 1GNLA 1NVXQ 3WLOA 3ETGA 4AQYB 1C9KA 4HNRA 4CN9A 2O0MA 3ZHXA 1GAJA 1HRKA 4B7AA 1X7YB 4QXOA 5G0UA 3D43A 5DCWA 4JKYA 5KVQA 3QVTA 2FPOA 3TLEA 4LDPA 3RUDA 1E4YA 3DZIA 1A98A 3EXFA 2HSGA 1MXFA 5LIRA 2XUOA 4P83A 2AQ8A 2G77B 2VTVA 3OOEA 5DP2A 1JXQA 4BX8A 3GAAA 3PFFA 4XAQA 4RIEA 5KOJA 1W5EA 1D1SA 4A3SA 4BZQA 4QVKA 3T5CA 4ALIA 5KPDA 5DM60 5TQ2B 4BJ3A 3L0IB 1ZICA 1DOAA 5ER6A 4I66A 1CUSA 1LF0A 1RXCA 1USUA 3N7AA 3N7UA 1CUHA 4FCWA 4FILA 1DKRA 4RPHA 4WD3A 3S5JA 4DV0B 2G09A 1QVVA 1Q6ZA 1PZGA 1P29A 1UZMA 1NSFA 1S1CA 1WPQA 3GLHB 2VDVE 4LRXA 4EW1A 1IUKA 5JPCA 4MPTA 2GHQA 3C41J 3U4DA 2V9PA 4YMVA 1KQGA 4HEA1 1HKUA 4FEAA 5ADWA 4O2BB 3AUUA 4IGIA 3HVHA 2FZCA 5CDUA 3RS5A 4H3KB 4OGFA 1QHGA 2VF5X 3VO9A 2O7RA 2YV5A 2BEWB 1YJ5A 3AL3A 4JVSB 1IULA 1XMPA 2GEKA 3CLRC 4YMIA 1CVRA 4HDRB 5LZ8A 2M1XA 2PE5A 2GD1O 1QE5A 1LJLA 1L9KA 1P9OA 4R6XA 1A4IA 1C2YA 2JLAA 4OU5A 2HCFA 1EH5A 4IWYA 1P0IA 4Z86A 1GZ6A 4AS2A 1HA3A 3T3PB 4HP8A 3DD5A 4HHEA 2WDZA 1Y1RA 3DXFA 2R9VA 3WB0A 1KY5A 3B1WA 5FBWB 5KOYA 4LISA 3ZDFA 2CLFB 2X0JA 4MW7A 3S2IA 5DDIP 3EQ6A 3EOAI 3K0BA 1KQ3A 2NSHA 3PI7A 2WPNA 1R8QA 4HX9A 3ZWOA 2C7GA 3UG7A 1OAOA 2CSXA 5SZHB 4KPUB 2IELA 4MQUA 1YS2X 5FNVB 3PEEA 1GTZA 4MW5A 3GARA 1QGDA 2WM9B 2JFVA 2ZJ3A 4D1YA 3D0KA 3C6ZA 3K8ZA 4LDZA 5FYQA 2I2XB 2M2IA 3KLNA 3QF4A 3MZ0A 4KE9A 2YWXA 3DT8A 1TQ8A 3KVVA 4CYMA 1E5TA 3D4IA 1X8JA 1J2YA 2I4MA 3HJGA 1NPYA 3OZIA 4AZ0B 1LZLA 5K0ZA 4KO4S 3PIIA 2JIZD 1C3OA 3OT1A 4ZT7A 3UH1A 5EJMA 4R1LA 5JNRA 1UBSB 1T4DA 5ALEA 821PA 4D4MA 1FLDA 1GZVA 1FPQA 3EASA 3GQVA 1TEZA 1ZWKA 4LVOA 4X8MA 3QPCA 3OUZA 3TUIC 4YLYA 3U19A 4E5NA 3LT1A 4Y2JA 5KDOA 4U2GA 4R40A 4RZ3A 3V7YA 4HQLA 2WMOB 4I5DA 1FQJA 1R0WA 3AIMA 3MTGA 1G21A 4UNNA 1G19A 4HI0E 1A4RA 4IIBA 1BGVA 5KNCH 3MWGA 3RU3A 3ZZ0A 3FA2A 3GVCA 3KE9A 1KMHB 1PDWA 3LO8A 1UBHS 4MPRA 5DF1A 3D02A 4CQLB 1KY4A 1RJGA 5BSGA 2AT1A 5DH9A 2ZI6A 4LJ5A 4LPSA 4LHYA 1STOA 1UWKA 2FSUA 4GR4A 1IUPA 2QAGC 4NKRA 2I54A 1GO2A 4WGFA 4ZRDA 1KEZA 1RAHA 2V55B 3Q98A 4MA4A 1T3HA 4TKVA 2EQBA 1F2DA 2I29A 3FCUB 4NU0A 1TO1E 3BCHA 4Z0TA 3E9NA 3CVOA 3PR2B 4EGFA 3OTGA 1R88A 1XQ6A 1H23A 3KJFA 1E96A 2EDCA 2OVFA 2HSZA 4AQ7A 1KSFX 1ZYUA 5REQA 3OQOA 2J32A 4JIMA 4MRSA 3EODA 2IE0A 1QNFA 2B4TO 2GNPA 2VOEA 1PHPA 4PLHA 1YZNA 4BNNA 4G97A 1T8PA 3L04A 3B9QA 4HATA 3F46A 2X3YA 3V1KA 2I80A 5DLEA 1Z6PA 4YO8A 1WW8A 2ZBVA 3D4PA 2TSYB 5AVZA 4JYAB 2D06A 2OO7A 2WNIA 4UUPA 1OVMA 4TKUA 1W0JA 2ZBQA 1DEKA 4RD3A 1W36C 1HFWA 1NXXA 3R3UA 3EVNA 1AZWA 1E32A 2JJ1A 1Z3CA 3TW6A 3P32A 3CGWA 2FWAA 3LOQA 1Y1LA 2MYPA 1M0SA 1HE5A 3EXG1 4EITA 4NZYA 3K7EA 2F3PA 2QTVB 1EVEA 3QI7A 3N74A 4R2XA 4IR7A 3BK1A 3IHWA 2QPTA 1XPOA 1E59A 2E5WA 2IHJA 3G0HA 2XLBA 1GG9A 2F43B 1ZHFA 1FYDA 1K6JA 4PW0A 1C9EA 1D0IA 3PJEA 5ARBA 3EE6A 2LVBA 1PLLA 1EVIA 5I7RA 2XOXA 3X1WA 3R9WA 2WWGA 4JSRA 3M33A 1UT5A 2LIVA 3IPAA 4CL2A 2IYXA 5FEMA 2V1XA 1MB2A 2EBHX 4NF2A 1W5FA 3C3XA 3CJRA 4ENQA 2R7AA 4JI6B 4KACA 1SVIA 4KX3A 4YT4A 2BJWA 3H6HA 2JCGA 4B0PA 1DDOA 3PKJA 4WW0A 1Q57A 5DNYB 1PW5A 1U7WA 3F78A 4OLBA 3KYBA 1TVKA 1T5SA 1V6AA 3MJSA 1PEAA 3ORRA 5JSKA 1WSWA 2D2EA 3P9NA 1GPDG 1M6HA 2I67A 4XQGA 3GCWA 3G6KA 1LGYA 3R3ZA 2OXRA 1UAAA 3CPHA 1V3UA 5AHOA 3M1YA 3U4MA 1P7YA 2XB8A 4P5DA 4ZALA 2NGRA 1AS2A 3PKZA 1VBKA 1AKVA 2WIKA 5F1OA 5THQA 1AKYA 1F8UA 1DTSA 4N7JA 3VYUB 3NC0C 4AWBA 3DCNA 5HZHA 4C7KA 3QZUA 1ETUA 2HAEA 5CVCA 3EF0A 4JITA 4KIWA 1NYQA 2CDNA 2YWDA 4NYMQ 5AJYA 4B3HA 3JQ9A 3V2HA 2ZUEA 3VMFA 3P9KA 3KSUA 1SUSA 3DE4X 3A7EA 3TR6A 5DEOA 4A6PA 5G40A 1PT5A 2ERYA 3KL4A 1RYNA 3H19A 2H17A 2XEDA 1CRZA 2PMCA 3EGDA 4OQFA 2BMFA 2G1PA 2EX0A 2WYIA 2AW5A 2QVXX 3BWVA 3GJ5A 4D9GA 2R8EA 2ETXA 4TPKA 1OGIA 1NJ8A 2PZBA 4IF6A 5FA6A 5KTYA 3LLCA 5CFNA 3SE0A 3KEMA 2HQ1A 3HHPA 3KT3A 4WDRA 3SZLA 3ZOZA 5G0SA 1SUIA 1B00A 5EUMA 3L7YA 4IIHA 3T4PA 1NQ5A 4YCSA 1YB1A 4QYTA 2QRVA 4ZIRA 1F2VA 3HRHA 3TW8B 2XF2A 3ETHA 4AWAA 3C3CA 4BDSA 1QMPA 3O4VA 4C03A 4CIYA 3DPUA 3SJAA 2DBQA 4UDOA 4CQMD 3K70B 3VSCA 1W4BA 5FOSA 1J33A 2XRZA 1OYOA 5LL6P 4HQRA 1ZK2A 4N1AA 1TGYA 2XCIA 4UASA 4F60A 1CUYA 1F06A 1T1JA 1T34A 1IY9A 1E9BA 2WKPA 4JBXA 5LMNB 3LRTA 1DFGA 1TZCA 4U0KA 3WWDA 3RYCB 2AA3A 1CHDA 2R79A 3AM3A 4N40A 4RXTA 4L85A 4XEHA 1U8EA 2Q0QA 5CT9A 5DKFA 1L2TA 3CF4G 2HH9A 4UXJA 4XM0A 3WBKA 2WHXA 3DHEA 3D2CA 3HG7A 4HXEB 2JHGA 5EPOA 1NBEA 2YIVX 2QRJA 4B84A 3N2KB 1CR6A 1DRKA 4C20A 5L3SA 4WOBA 1VCMA 2PWAA 5KTMA 1L7DA 2QYHA 1N5LA 1NRWA 2NO7A 1PFQA 1A9YA 1E9AA 2QU7A 3GAFA 3HCOA 1U8CB 1Z7EA 4FVTA 1WBJB 1Q1BA 3TSAA 3PUYA 4U6QA 5J1SB 2GCEA 4LRQA 4TV8A 2NXNA 4YRQA 4IJMA 1MX5A 2PZFA 3DZHA 3ZJTA 1SURA 3NOQA 3HGMA 2WYWA 5A0TA 1SN7A 1ELOA 2CD7A 1QFYA 2CCKA 3NXSA 4KIFA 3OCVA 2VRCD 4AL4A 2P9HA 4PQEA 4GVXA 2G67A 2L17A 1NTOA 1UBMS 1W25A 1JUDA 3O9MA 3VZBA 2O48X 5IBQA 1GZHB 2EZ9A 4A1OA 2R44A 5U9CA 3LVFO 1GQSA 1I0LA 3DONA 3RUHA 4QPDA 5FJJA 1WHSA 1XYYA 3E8MA 1EGAA 4EL0A 3PYXA 4JOSA 5F5LA 5JNUA 1P1CA 9MHTA 4J4BA 4M88A 2YN2A 5JS6A 1QRAA 2NN3C 5HMLA 5C1IA 4GZ5A 5EJFA 3K0AA 1QLJA 2AZTA 1XLWA 3PC3A 8GPBA 4FE7A 2PX0A 1ORIA 1IZ7A 3CX4A 4FINA 1TE2A 2Q49A 4UTXA 3EQZA 2OG1A 3F98A 1JXMA 2E0IA 1ZZGA 1H22A 1NQWA 2WTAA 4PC6A 3V6LA 1RLJA 4UOQA 5AK3A 2QLFA 2WPDD 1X8KA 1T3TA 4HYQA 4I9HA 1I6LA 3IA7A 4QOFA 4DR7B 3KQOA 4ZGWA 1SCQA 1Z82A 2GZRA 1XKXA 4EELA 4XJXA 4C08A 4EAAA 1R0YA 2CE2X 4H7EA 5JYDA 1R4NA 2OUIA 1YBVA 3W78A 1GGMA 4L9RA 3T7AA 1RQPA 4A6EA 3PHGA 3QYJA 4RTRA 3WYCA 4N4AA 5JECA 5LWQA 2L82A 4Q66C 4UJ5A 3B3AA 3PJFA 2R8BA 1T5LA 3LPNA 2QBYA 4YCMA 5A4MS 5K0BA 5GOZA 1UXJA 2R47A 3EVBA 3L05A 4X1YA 1F8XA 2Q3JA 2HJ9A 4KQEA 4LSMA 2PS9A 3WLPA 1RPAA 4FGWA 1O8CA 4UM7A 1PR5A 1RBMA 1LJUA 5F1YA 5D84A 1JHUA 1UCFA 4ARZB 3LWZA 4JJFA 2Y2UA 2XDYA 4UOEA 2HA4A 5HIMA 3RJMA 2C2XA 3OF3A 1XZNA 1D8TA 2ZRNA 3QU4A 3DZCA 4L8GA 4AYXA 1ZLYA 4KJXA 4LHXA 3TLBA 3HPQA 4F2WA 1V37A 4AUKA 1EVKA 4F91B 2CMKA 4PXSA 1YD7A 4G81A 2C57A 4WBXC 4E7OA 5C7IO 4F93B 3LF2A 2CXNA 1ISRA 2J0UA 3DBLA 2JIDA 3N86A 4JL8A 1GV1A 4MUKA 4D9CA 5CAEA 4G26A 3RTDA 3QH4A 3C6YA 2W93A 1UBUS 5AKIA 1V16A 1P19A 4NCAA 3OFJA 1XZDA 3OEHA 5D3MB 1UJMA 1C3XA 1BYIA 2GKOA 3ZHQA 3BFXA 2C07A 1LW7A 3LECA 2I62A 2VDKB 3F90A 2JRLA 3MRVA 3U3RA 3BZUA 4QBFA 1XOIA 3EIHA 4ZQEA 1MIOB 2A57A 4RIHA 3TN7A 3VX3A 4HEQA 3ZEIA 4CPDA 2LIPA 3OA0A 3AVUA 5JS1A 4RZUA 2GD0A 3IJEB 3BRWA 4M9RA 3BXZA 4D4GA 1SG6A 1T3GA 3TL3A 1LV8A 2UZ3A 2G9QA 2MJLA 2AFHE 1HLPA 2ES4A 4N5DA 4LMRA 1XXHA 3C3BA 1WKCA 3PC6A 3UJ7A 3T35A 3AUYA 3F73A 1I13A 1I10A 5D7NA 1TO6A 1WNTA 3ETEA 4YGYA 3W7BA 1RYZA 3C3MA 3HI6A 3COYA 4TYNA 2QLBA 1BOOA 2QX7A 4XCVA 2WWYA 3IPLA 2WEKA 1YQTA 1UMDB 1YTLA 1YI8A 3V7NA 4AU1A 1Z88A 4BRUA 5KVAA 5B1IA 1ONBA 3TD2A 2P9FA 2QUAA 1L4KA 3JRNA 1YWGO 4R51A 4TM7A 1Z0DA 2W8ZA 4L75A 3CX6A 4NFLA 3I64A 4YASA 5DNAA 1IZ0A 1NNI1 4X8LA 1L5LA 4F5DA 1C14A 1IN6A 2ZJ4A 1DX9A 1ZX1A 1GRQA 5ARDA 3KCNA 4NMHA 5BUCA 5B58T 4Q1VA 3NP9A 2FSPA 2FEKA 4YCJA 1M34E 1MFPA 3CISA 1QHXA 4BEBA 1EFAA 1GL7A 4LXYA 4L9WA 5IN5A 1WMDA 2REOA 4YJHB 1JKXA 1Z2OX 1Z4KA 3DULA 3L7AA 4JJKA 4P98A 5GJVC 5HDQA 3DLHA 3K1YA 1XR3A 4RWEA 3T1TA 2OCKA 3G85A 2HPZA 1T0UA 3MTJA 3OFND 3UJHA 4HG2A 5DOZA 3ZDRA 4BNWA 3GZJA 2JVIA 1X70A 2ZRKA 4KMRA 7ADHA 1KS9A 3LQYA 3RIGA 1Z39A 2QUZA 3W5HA 1K6MA 2G17A 4RGYA 1DJQA 1OXVA 3EZNA 4P32A 5D3QA 3ZHSA 1Y5LA 4Q9AA 1Q0UA 2FVYA 3PR1A 2JCXA 1JR3A 1N9ZA 1NNUA 4MP3A 5LP6C 3VVLA 3OX4A 1C1DA 4Y6RA 5LDHA 1GA6A 2IEDA 4FR0A 4B81A 5F2EA 4Z54A 4KLRA 3UMSA 4BP1A 2Q3DA 2RGGA 4L0DA 3VUEA 3FYDA 3LZDA 5G4KA 4AM8A 1QZUA 1Y1SA 5JXIA 4DCNA 2GAOA 1L5MA 2GCNA 4PPGA 3AEKA 3PRKE 1J9EA 3DTVA 5BO5A 1QB7A 4C7OB 5HCNA 3RT1A 1C9JA 2P0EA 2X7HA 5LZ2A 4LOIA 1X80B 3RWMB 1E7YA 4X20A 4UUMA 1VIAA 1ODFA 3DM5A 4JYMA 4II3A 4NC9A 3K31A 4CFYA 5A03A 1HYGA 4L6AA 5G0WA 3AB3A 2X7XA 1U3FA 1MFZA 1YCHA 1XWIA 1Z4QA 3FSJX 4HAZA 4RJTA 1OX5A 1ZJJA 1HI9A 3UJ9A 4F11A 2X6RA 4Q34A 3G1TA 3PLAE 5AM3A 1SXJD 2UYQA 5JDIA 2IF0A 4NJMB 1TTPB 2QP3A 5G53C 3WGGA 1NJ6A 1OTHA 1XD9A 2RAVA 3RVOA 4Z7QB 1L5FA 4G0YA 1ZBDA 3PI6A 5C2JB 1ECLA 2F9FA 3GLSA 2AX4A 4UZFA 1VJ5A 1OT5A 3V4FA 5AR1A 3LP8A 3C24A 1PZFA 3ZWAA 5TE9A 1TUBB 3COZA 4ODIA 4D43A 4FLMA 2DGDA 4TVOA 4W5QA 3QSYA 1JKJB 2EZ4A 3C6XA 2FE4A 2H4XA 4KRYA 4PNZA 2HU7A 2AOTA 2N9UA 3DOIA 1OWMA 2QMQA 2Q1XA 3N2GB 4IVPA 4JC0A 1XT6A 1CX9B 5DYYA 1A7KA 2YIJA 4IHJA 1PD0A 5GONA 3D2LA 3U3XA 5TQ0B 2WFLB 3L40A 3W6NA 4URUR 3M8KA 2W00A 1P6QA 2Z2YA 3R20A 4NZNA 3AP2A 1EUYA 4JXKA 3MT0A 5BW4A 1DFIA 4BO3A 1COZA 1E0SA 2EWMA 1THGA 1BWSA 1V1RA 2ZRQA 3K1AA 4DMUB 4JI4B 5BRNA 1J0EA 3CJQA 3R3HA 5ALHA 3E7FA 1FLAA 3WDLA 4YUXA 4FDVA 2VKTA 3FCXA 4TMYA 1RU3A 2VH1A 5IKXA 1WP9A 1PWZA 1K66A 5A5GA 2NP7A 1C7EA 1YCDA 3S55A 2YXNA 3Q7TA 3TOZA 1VP9A 3NNNA 4ARAA 3BDIA 3JQ7A 4QHTA 2HWYA 4BP8A 2WWHA 3OIFA 1C30A 1GPAA 2AZDA 4GAEA 3OZDA 5AIAA 3ELDA 5KQLA 1FFGA 5B53A 3I6QA 1IRXA 5KI6A 3E5MA 2V5AA 3VBEA 2UUPA 1L8AA 3L0DA 4ZVLA 4YJGA 3AEQA 4KKXB 3K0CA 1M5TA 1VJRA 1Q5PA 1SBZA 1VFPA 2OK7A 2OV2A 3C8UA 4LRWA 4MZDA 3UWDA 1NPTO 1HZJA 2OM6A 1UFRA 3A1WA 4PG6A 1GZUA 4AYTA 1SOVA 1E6EA 2B83A 4PHHA 4DLXA 2QHXA 3LUPA 1KK1A 2WV9A 4R1UA 4J43A 5K1ZA 5B2EA 3NT5A 1FXWF 5JAPA 3TYXA 4M83A 2ZIWB 4NE7A 4ESHA 2O2JA 3STVA 2W2LD 4ITUA 5EHQA 3X1JA 3WQBA 3F47A 1EFTA 3LP6A 1N33B 2AFHB 2ZT7A 1UPCA 3TX6A 2OCPA 1NMYA 3QUCA 3THXB 5C4GB 4C1NA 2FQXA 3CMMA 1B41A 3OE1A 1XZBA 1H3FA 3FCSB 3BTVA 2BFEB 3IULA 4IBOA 3FYSA 4B79A 3SDSA 1E6UA 1JALA 1DAOA 4QTUB 2EJCA 4Z4HA 3DNFA 4XRGA 3NANA 2VXCA 3HS3A 4GLOA 4PC1A 2Z98A 1E1RD 2X9QA 2I6FA 1BD4A 4HMOA 3TLKA 5CDFA 2Q0HA 3R7WA 4ONEA 4PGAA 2YXBA 4YAKA 4CMIA 2XCQA 3OZXA 4LXXA 4NONA 2MYTA 3RO7A 2HMAA 3BMQB 4BFYA 1UK6A 3TUZC 4MW4A 5J4LA 3WMXA 3LUGA 6ABPA 2B0CA 4K9QA 4O4HB 2P5TB 3RIMA 3DUWA 1Q1AA 4H1VA 2QGNA 3BEDA 4MV0A 4R54A 4JP2A 4YH1A 5I4KA 3UMYA 3BD6A 4BGEA 2W22A 3SCZA 1HG0A 3V1UA 4D02A 1QIHA 1ZY2A 5JDCA 4I8IA 1TW2A 2ZT5A 1I5EA 3U16A 5HTOA 3RVMA 2ZYVX 1PNRA 3B70A 3L8YA 2BMJA 3W6UA 4DRXA 1R0KA 2ISSD 4QT0A 3UMGA 3LZCA 4CQNA 1Z5OA 4IJQA 4EMSA 1T6YA 1YMVA 1FS4A 1KAMA 1A71A 2GTPA 1B0PA 3JWJA 4XX1A 4YJ3B 3UT6A 4DB2A 2ZROA 4YEDA 2FEPA 3KQVA 4DSUA 3W3AA 2HLDA 4IDHA 2DX7A 1KJZA 1T24A 4FDUA 3U60B 3W1WA 4EJ2A 5C7OO 4NATA 4HDCA 3DO5A 1OGJA 4R7TA 2PUCA 1BTOA 3AJAA 1ACMA 4M1KA 4RJLA 3H9JA 1EFRD 3T99A 2BTEA 3E3AA 5JCJA 1P2TA 1X87A 2V1UA 2FSVC 2VT2A 2CK3D 3F5QA 3QV1A 1EAYA 2F3RA 2A0KA 3D1VA 5ALFA 1WUTA 4J0FA 5F5XA 5JQGB 1BW9A 5AVSA 2BBTA 4EZBA 1MOQA 2YFYA 4CQMB 1BIFA 3VR6D 1TU3A 1F6BA 3H0EA 1RHRA 5KYUB 1XRPA 3GLTA 4BQOA 1J8FA 4Q9DA 1JR4A 3GW8A 1PWXA 4ES6A 4QJ3A 4RTJA 2QK4A 3SGLA 3UM9A 2O8NA 4BU0A 4X65B 3DTTA 2W6MA 4DWOA 3QIVA 3OPNA 1OLUA 1R9MA 1T3SA 2VNKA 2R68A 3CLSC 3O3OB 2V7QD 3LK7A 1ECGA 1U0JA 1ZH6A 1AQYA 3C3EA 3IBGA 4V0NA 5I4BA 1RZRD 2A58A 1CR0A 1BXRA 1W88B 2JHAA 2PGLA 3B6KA 3P9IA 5J5CA 4CM8B 1LX7A 4XW2A 4YPOA 2I9KA 3QBJA 2JI8A 5AK4A 3SJ7A 3B20A 3CPJB 3MTQA 5B12A 1KEUA 2R7KA 3PDWA 4IV5A 4DMCA 4XYGA 5FBHA 1C9DB 1VE5A 1X15A 1X7XA 2GHTA 3EZYA 4OEHA 3QX3A 2DCMA 1Z4MA 1J99A 1FNBA 3T54A 1Q2UA 4ZCQA 1UEIA 2BF4A 3PPWA 2O8CB 2A84A 3H1PA 4MHSA 4Q4CA 2HMWA 4ZN6A 4FI3C 1V8BA 2IXEA 1ZK4A 3I8SA 2Z3WA 3LXXA 4LXTA 1A76A 4XUDA 2PO7A 1ID8A 1ORTA 4Z4GA 2P65A 5BVGA 2I71A 1JF8A 4I55F 3N0TA 3R44A 3M3DA 4C78A 4RD4A 3Q9LA 2B0JA 1TAQA 4HDKB 1SU7A 1ZK1A 1MC4A 1ULZA 2PXAA 4TL9A 4RENA 1G3UA 5C1OA 1QHYA 1ZKMA 4TL7A 2R86A 4MMZB 1Z0AA 1XI2A 2UYOA 5TC4A 4HB0A 4FKMA 4JLOA 4BDTA 1WMFA 4KQWA 3DMGA 3ZUGA 4ROTA 1XMOB 1FOEB 2JFQA 3TINA 3R40A 1R5BA 4MP6A 3IODA 1IOVA 3T9AA 1PIWA 3ZY4A 4N12A 3M81A 2X40A 3GEDA 3ZU2A 5KNDA 4URWR 2XUQA 4ZZ3A 2FWNA 3SKXA 3WK9A 1B2LA 2Q8NA 1W30A 3W90A 2ODQA 4KYUA 3U4AA 2Z4RA 4MGZR 1INLA 4C0WA 5DHRA 2CXSA 2PKYX 1NVTA 5AKEA 3L8MA 3V4VB 5BW8A 1EM6A 4NPCA 1FUKA 2XWJI 2GDZA 3EPKA 1BHSA 3TCKA 4BNZA 4CW7A 4BE4A 3G2NA 3ZE2B 3D6AA 4KI0A 1G8MA 5AVTA 3DVSX 2E6UX 1ODJA 2A9KA 1PVDA 2VP3A 3PDHA 3R5HA 1Z7BA 4YR7A 1ZK0A 2AH5A 1QG0A 4FD2A 4BMVA 3L06A 1FJXA 3JVIA 5LJIA 1SELA 1YDGA 3HB7A 2QLJA 5ESDA 3KHTA 4QEKA 1DC4A 1PYDA 4M38A 5E7MA 2P9GA 1SY7A 1PK7A 2IDZA 1FMTA 1QFMA 1N9GB 3QPAA 4EEZA 2PRKA 3WK8A 3F1LA 1N3IA 5DCYA 4ZMBA 2CKMA 4IDAA 1NXTA 1AQIA 3GC6A 2CHVA 2O8VA 1I6WA 4FWTA 4HY3A 4YUWA 2HXYA 2JLZA 1LPNA 3JVVA 4HNUA 2O5CA 4F8EA 3BK7A 3VPSA 3QLTA 4W7IA 2GD6A 1FDVA 4DT1B 3DL2A 2VP5A 3DC7A 2QR2A 4MXDA 4PONA 4EVQA 4DLRA 2WAXA 3VYRB 2PH5A 2XGSA 4BMOB 1U63A 3RROA 3FKQA 1HE4A 1TZ2A 2IK8A 4NICA 2QYSA 2VYND 3L1JA 2YDXA 3NHJA 5H1YA 5LN1A 3RHTA 3ZQUA 3D0OA 4OMCA 1CRLA 4H1WA 1RQXA 5JD3A 1XNGA 3MNFA 2B7LA 3C98A 4M0UA 1ZUHA 5E2IA 1O94A 3KZOA 5BSTA 3SP1A 2Z6AA 3PTAA 4BNTA 3OOYA 4IHQA 4PPYA 2B35A 3H75A 3AV3A 4AZVA 4EHBA 1K5PA 1XVVA 2DFNA 2PJUA 4U00A 1ZD4A 4IDNA 5JAQA 4I08A 4C6HA 4TZ6A 1EWRA 1P45A 2VPPA 4LVUA 2BR5A 3JZDA 4LQDA 1F9EA 1MGOA 4MQFB 2CLCX 4L76A 1GDHA 2NTJA 4RGQA 4EAQA 5DI3A 5HXAA 5FLEX 1C8LA 3ENKA 1SD2A 1ZK3A 1CSEE 4AURA 4NSNA 2D00A 2WA2A 2YZKA 1T9KA 1U1FA 2XUKA 5EE9A 2PX2A 4RLFA 1THTA 3AKDA 3Q15C 1G9XA 1YJCA 4MKRA 5DHSA 4C22A 4E13A 2P40A 4DC0A 4EHDA 2R5FA 1DBQA 4PAOA 1B6TA 3ZHRA 5DW3A 4U6NA 1Y6GA 3VPXA 2NVBA 3GELA 1VPLA 1Y5RA 1WB5A 5DNWA 1RAAA 1NASA 3OHMA 3SI7A 4BVJA 1FIUA 4O0MA 4HBGA 2OXEA 1YJ8A 1IPFA 4XI9A 5EEGA 2GPTA 3E0QA 3MB8A 3SU8A 1XLTA 2IJGX 3O83A 1N2IA 1Z75A 3P45A 4AMUA 2AXNA 3FJOA 1CV2A 1UDCA 2VEOA 1IXYA 1MD9A 4GBED 1R5NA 1VKOA 1UBOS 1RBYA 4AFNA 3KFLA 3H87A 4KGXA 2C2MA 2WZBA 4TXHA 3RBXA 2AOUA 1ZP6A 2O3RA 3TRHA 1BDIA 3RBVA 1TYZA 1D09A 1Z17A 2QTZA 1L4FA 2E1PA 1RE0A 2IPAB 3WGNA 3IP6A 6CHYA 4PZDA 3KETA 3CG0A 3FUXA 4EUSA 3ZQ4A 1TEXA 1SVWA 4O02B 1A2BA 3SS8A 3DV2A 5DYNA 4P3KA 4DTIA 3K2BA 3E7DA 3WRYC 5DYWA 1FY2A 3F6CA 1ML3A 5FA5A 4EPVA 1L7MA 2ACVA 3GRPA 5BR7A 4R9SA 4I50A 2BY4A 1R37A 4Y2HA 2RHGB 1RCTE 1YJAA 4N6NA 1FL9A 3A6DA 4E5KA 4DR5B 4P2BA 3K5WA 2BFBA 2ENUA 5F51A 2RCYA 3HVKA 3HJHA 5I9MA 1KMCA 1KEKA 1G6Q1 4LC9A 2G9RA 3IAS1 1DPFA 1M1ZA 3T0FA 1E1QA 3EJWA 1I0ZA 4PZ0A 3WGHA 3Q0TA 4MQ4A 3T4XA 5B30A 1ISFA 2IXFA 2WVGA 2PJZA 4RH0A 4ESVA 5C81A 1VLJA 3EYAA 4YR9A 2BI7A 2OGUA 4QYSA 1Y3BE 2DQ4A 3PHBE 1ZEMA 2UUCB 4I1OA 3LX4A 2F1OA 4QUGA 4UULA 1S96A 2ZI5A 2ZUVA 3T7EA 4AS3A 3IMGA 3PPYA 3KLPX 4NBTA 5C1DA 2VXYA 3KG2A 3TZCA 2XUFA 1NDQA 2YWEA 4IFTA 4HXGA 1I3MA 1R16A 4I7EA 5MN5A 3BIWA 2DQZA 3AEYA 1WKBA 1Z07A 4P4SB 3UAXA 4WBNA 2W4IA 2GM9A 2ZU0C 4NOKA 2H11A 2HEGA 3K8OE 1NNLA 3LYUA 1OZ0A 1SXJB 1RLOA 3A6JA 1E1MA 2PKQP 4O2RA 4X93A 3QK7A 4ZAXA 4A8TA 4GPIB 3AHEA 1I4EB 2ZULA 1P8JA 1JBKA 4KK4A 3FYUC 5IAJA 4A9AA 6REQB 2QJWA 2RHBA 4IYRA 4I9NA 4V0SA 4AROA 3HVRA 1QORA 2OKCA 1HV8A 1AKEA 4B43A 2E49A 1L1EA 2V97A 3DE2X 3G2IA 4BX9A 4FGUA 1CY0A 5K8TA 1RRCA 4FCTA 5AVKA 3RSLA 4G5OA 3WLEA 3VH2A 1GU7A 2AJDA 2C98A 2C8KA 2FU5C 4WCFB 4AJ1A 5ICFA 1BCSA 3CZRA 2NSLA 4OQ4A 3IL2A 1A8PA 1U6JA 3ED5A 1EP2B 1L5ZA 1VDZA 3DMRA 3R2JA 4PYKA 4RWZA 4CNQA 4X1OA 2UZ0A 4K5QA 5CVEA 2VP2A 3IT1A 5C1BA 5LQDA 4DSTA 1BCRB 1XEXA 3WJAA 1VZ3A 3P71T 2ZITA 1ZRNA 3FPEA 4Q9LA 1QIEA 4C7BA 4JGIA 3LV8A 1MHTA 4WEOA 3VKUA 4RDIA 5LQJA 2E4UA 3GPIA 3KYCA 1BRMA 2PZJA 4HRVA 3JV7A 4DIFA 4IQGA 1QQAA 1UJ5A 3F7TA 1FC0A 2KX7A 1NI4A 2AZMA 3OUUA 4H4DA 2VKQA 4WOKA 5JUWA 2QUKA 2HGZA 3I1IA 3X0DA 4MR7B 1ABBA 4IIJB 3BXFA 2IZ6A 4DILA 3SVLA 5IBPA 3ZXYA 3CCFA 3H5AA 3C39A 2FZWA 3R5JA 5LBTA 1O97C 2XNJA 1IXRC 2G0TA 3R23A 2F3UA 4H7PA 5HIIA 4X7PA 2V0GA 3E2PA 4M22A 1JN0A 3PDIB 4K9SA 1RKVA 2DUWA 3UHPA 3WZ2A 4L1KA 3QFFA 3A28A 1NXWA 1CQJA 1MNQA 2PDAA 4MJ3A 1C7ZA 4N3BA 1QVAA 4C43A 1WW3A 4HTFA 4OUDB 4YRIA 2OYRA 3EWSA 1TQDA 2PSJA 3PQ7A 4BZZA 4XCQA 5K3OA 1QB8A 2XZPA 1NN1A 4YCBA 2IPNA 4FGKA 1WD7A 3BJMA 3NAGA 2R1TB 3NBAA 5EE1A 3WRXA 4FWIB 2J7KA 4UUNA 3SJZA 3W79A 2NVUA 4RU1A 4UBOA 4BNIA 1WXXA 4OGGA 1DCMA 1EINA 3MYYA 5EE5B 4KPEC 3MYRA 3W0LB 3MGAA 4LHVA 3VC2A 3BTSA 4QBKA 1FS6A 4FMDF 2IP1A 2AN1A 1PL8A 1ZOPA 2OUKA 3F5DA 2OVBA 2FUG1 3CW9A 4WAUA 2UZ1B 3O4IA 1ADGA 1Y3AA 4E0BA 2QZ9A 4LZOA 4R7ZA 3UQZA 2IOFA 4JWKA 1SOUA 1G4AE 4OJMX 3DMFA 1NIPA 4OQQA 3S2FA 1NOJA 5FOQA 2IIVA 1HYHA 4C76A 4BLPA 5ECWA 3JD1A 3WGTA 2JA1A 3SXUB 1NXPA 1WLYA 3CNOA 4OXQA 2WY2D 1EJ0A 4C3UA 2WE8A 3IRUA 4CV1A 1KAQA 3CLUD 3O3MB 4JYBA 5DM70 1OLSB 3L6RA 5E3JA 5EG5A 1V1MB 3KP1A 4DSOA 5K3AA 4E7PA 4GLLA 3KJXA 2ACWA 2CXUA 3P5BA 4JKOA 1IQPA 1JA1A 3JQ6A 3GT4A 2VHTA 3JQQA 4RX1A 5GV7A 5TPWB 4DNXA 4EGCB 4TOIA 1FTSA 2JD2A 2GDJA 4LYDA 5L51A 5U1PA 1V9CA 4HVAA 4P7BA 4UZSA 5LB2A 2EFYA 2PQ0A 2XCTB 1VSVA 4EGAA 4L2IA 5IASA 4LI0A 2OR3A 4R16A 4WA8A 4O2LA 3NHSA 2ZKLA 2FYTA 2QF7A 1BYUA 1SAYA 3QGMA 1PE0A 2WAMA 2R6ZA 3ZGVA 1J0DA 1KTIA 1JYFA 2DY1A 5K6RA 4MVJP 4YACA 4DC9A 3DH0A 1HNZB 3TAHA 1BOFA 2AYXA 4G0VA 1RKBA 3RASA 2TMDA 1E9CA 2C1EA 1Q44A 3MW8A 2YHIB 5LYJB 3TSYA 3B1XA 1VCIA 1AM4D 1VYVA 3H5NA 3QTTA 4JIGA 5D5QA 3DAPA 4KLNA 1N4AA 2J5BA 2YQ4A 3CRQA 3VKVA 2F4VB 4LRUA 5U4QA 4A27A 4AWXA 2DZDA 4S04A 2AMJA 3BICA 5EIHA 3A4VA 3DQPA 3MAGA 4UE2A 5CVVA 4QXAA 4BQRA 5T67A 2CZGA 5I9TA 4CG1A 5ALZA 2NZXA 1B0ZA 2C3UA 2C04A 3D7SA 1KZ7B 1T2UA 2Y3IA 4HNHA 4MUIA 4ND4A 4NZMA 2AFVA 4RPKA 4ABYA 5JD4A 1BX3A 1BE6A 2WP8J 3PQ8A 4R1PA 3LDGA 4UFOA 4YXWA 1CYEA 5K8JB 4OHXA 4YJ2B 1A4XA 3VO1A 2BDEA 2YUTA 4CKCA 5BNWA 5C0OE 5J2UA 1FW8A 2N0SA 1PNVA 2WWXA 4B4VA 5K09A 4LY6A 2PVSA 4RF2A 4EUFA 4KE7A 3BQ9A 3VYVA 1XZEA 4TN5A 1ZD8A 2GJ4A 2B3TA 3BGSA 4RF4A 1Z0ZA 2QVLA 4UBNA 2QE6A 4A92A 4LBYA 1ZSNA 2IUUA 1R6AA 2NO6A 2VWPA 3EUWA 4C6TB 4CDNA 5J4HA 2ZT6A 1R15A 3FPJA 2JGFA 3IH5A 4HDMA 5ALQA 2XUPA 3KUXA 4DBZA 3NBYC 1FUIA 3K6SB 3EIXA 4ZVQA 2EKQA 3U3DA 2QUIA 2YVAA 2PX3A 3B1YA 1M6VA 2PANA 4YAWA 4YXFA 3VNRA 3WBFA 1I7LA 3ST7A 5A05A 4CU5A 3TG2A 1M2VB 3H9GA 4ZMRA 1M75A 2O6HA 1KBOA 1ADYA 2HA3A 4YRKA 1E18A 3SG0A 1OSNA 5H80A 4AZ3B 3T3HA 1SQ6A 1XZ8A 4WBSA 5UKDA 4BMPB 2UZAA 2ZVJA 3HR4A 4DJJA 4EF4A 2GCGA 2IEZA 1QVZA 2BZSA 2E4ZA 4PG5A 1M7GA 2BT4A 5SYNA 2LPMA 3JQAD 1Z2PX 1ZM4A 2XSZA 2G72A 5BOSB 2Q41A 4I36A 3PC8C 4LEIA 4TZTA 5KJ1A 5AW9A 2W2TA 4GL2A 5CDYA 3MHPA 4A8JA 4F3KA 4GPD1 1JU9A 5L6MB 1CY8A 1KK0A 4D9NA 3KQQA 1WIWA 4RTNA 3NFYA 3OSZA 2I2CA 5F12A 4FONA 3FKSD 1EYZA 2C61A 4PZCA 2IDJA 2XBUA 5IMSA 5MGBA 3E48A 1JLHA 1Z4LA 4MWTA 4J0QA 2PSHA 1AHHA 2V4MA 3A2NA 1K3TA 5B1SA 1UPAA 5KVSA 1H6AA 2X8JA 1QTQA 1YVUA 1OBHA 3JRWA 2LZ0A 5CA1A 5JSQA 2QD4A 1DX6A 5LLSA 2E4YA 5JY6A 1QK5A 2PYIA 5L9AA 4GW3A 3L8HA 4ZVRA 3ANLA 1T9GS 3U4IA 4WDQA 3ZJ5A 4BLRA 5JMTA 3PNBA 2BZGA 4MVJH 1W94A 2YVLA 2WV7A 4Q3AA 2CUNA 4TXNA 3Q10A 5GJWC 1SBTA 4IPTA 3ICWA 3I3OA 2ZSIA 2P7HA 4KAXA 1E4VA 2CY0A 3V7FA 1LK0A 4AB1A 5HJEA 2WILA 3OM1A 4B2YA 1W5BA 2RI1A 3PP8A 2XBLA 3EGVA 3OCCA 4OBWA 1EEXB 2BFAA 1MAVA 3KB2A 5CTAA 1EA7A 1NQUA 2AI1A 4EWLA 621PA 5IYZB 3WK5A 2GS9A 2IEBA 1NV9A 1WZUA 3DXZA 3NCTA 5BSMA 4I81A 5DTEA 5TGTA 4KPFC 2OOKA 4KDRA 5ITVA 3KOYA 1G20A 4JLBA 4Q24A 4ZI7B 9GPBA 4R9VA 3TLGB 4JGGA 4Q3CA 2I03A 4OXYA 4ZT3A 1ENZA 4FFVA 5COBA 5C8YA 2O7NA 2DFPA 5AK5A 4BP3A 5A02A 1ZJYA 4RF5A 1G8HA 3DGEC 2YS6A 4JR0A 5E0OA 5JD6A 4EJSC 2IRWA 4B7CA 2BONA 3OD5A 3Q11A 4EPYA 3QHAA 4RAOA 1SPBS 3CX3A 4S1TA 3QEMB 3OKCA 3MTBA 4EB6A 3AF1A 1GN8A 2C5LA 2H52A 4TSKA 1DG3A 4FCCA 1GKLA 4CKEA 1QJ4A 4GMHA 1EX1A 2UAGA 3Q8XB 4Y1EA 1N2CA 3EARA 1W49A 5JJBA 1W2HA 3L1VA 2PRIA 1AKWA 1DLJA 1GGVA 1NMXA 1JNYA 1U0GA 4FOPA 2IXAA 4JLKA 1YZ3A 5JEEA 2CFIA 2IPOA 4JB8A 1XTTA 1OLXB 2WWRA 1KE2A 4O4IA 3ZCRA 4FQ5A 2A5FA 2B92A 4QFCA 1WU8A 4AO7A 2DPGA 1J2UA 2DECA 3DDWA 2AHOA 2ZJ5A 2NP6A 4DIEA 4ZEVA 3SIWA 1XLUA 4DDHA 4XVUA 2QX4A 3SMQA 1B6SA 1RKQA 1FSGA 1T6BY 1V8ZA 2W48A 5AW0A 3AVTA 4I3FA 1BROA 5GIPE 2HJSA 3TZKA 2WAYA 3NTUA 3DLAA 3G5MA 4XQEA 4XARA 2LR0A 3RTGA 1ZRHA 3LTNC 3ZNOA 3ITKA 3UK6A 4N65A 2O8FA 2FWMX 4I3GA 3EDMA 3GA7A 3T4EA 4LFCB 4Q4JA 2CBGA 2BSAA 4N3CA 5LXTA 1M10A 4QD3A 2X41A 1QGUB 2CZQA 2XIQA 1T9BA 2Y1GA 5FLYA 4YK7A 1X86B 3RT9A 1Y6FA 3V1LA 4G0XA 3ILYA 3TPCA 3K92A 1P5HA 1USIA 2KE5A 1I3OA 4Q1CA 3PD7A 3IVCA 5C5CA 4HQKA 2IZ5A 4XH9B 2F6RA 3WK7A 4ZCIA 4QUKA 4FOLA 3M4JA 1XJCA 1DX4A 1QAMA 2QAIA 4J0IA 2XXAB 1V11A 2F3TA 4XR4A 3VHRA 1G17A 3W6OA 1S4MA 1SULA 4RZIA 5E6RA 3ZDXB 3ZCSA 1ULSA 1SEVA 1UBJS 1BHQ1 3F96A 4H4EA 4PSDA 1UEJA 4HWTA 1DXQA 1A8HA 4X1IA 3X2EA 5BN3A 3QLVC 3GFSA 3VNVA 2F9LA 2AKEA 2O8BB 4PQGA 3TZHA 4LY9A 1KH2A 2ODAA 4NNJA 3ZCTA 3KZXA 3EBPA 4K3VA 4PLTA 3VA7A 1KYWA 5HQTA 4YUVA 2VRWA 1RTKA 1WF6A 1E9RA 2YUIA 3I04A 3HGTA 4OQPA 4F21A 2CF5A 4QPNA 1G42A 2ARKA 3LUDA 1D5CA 1LTQA 2AK2A 4HGZA 2I4LA 5L95A 1YCFA 1Z3IX 2O20A 3B9BA 1DAHA 3E9QA 3KCQA 3WL5A 4GGOA 2NYAA 3VI4B 4EVIA 2HU5A 5AI8A 1OAKA 1O5IA 1U0BB 3PFWO 4WQMA 1OREA 2EJVA 3ED1A 1ULAA 5HFNA 2H2AA 4XQ9A 1A2QA 3JATA 5AKLA 3TIGA 2QUHA 2EJBA 1VKHA 3QW4B 3IJRA 4OMDA 1O8BA 3AUKA 4DW8A 4ER0A 4BNVA 3P9PA 2VP9A 2XMZA 5HX7A 2DERA 3V7WA 3PGJA 3GJ4A 5H9VA 2CFCA 1WSAA 5KYXA 2ZWOA 4LJAA 5DULA 4Y6LA 3WQQA 4V0ME 1YMQA 3IRVA 4CWAA 4QIHA 1CW2B 1I4OA 1P2BA 1YIDA 3ETCA 1L3CA 3TRIA 1OXUA 3CY6A 3V6MA 4JXJA 3ZXSA 3I0NA 4K9LA 1D3AA 1VLQA 4RCZA 3PWTA 1PGPA 3FTPA 4NRDA 1J49A 3GZNA 1QH0A 1H1TA 3RREA 2BSQA 5I4CA 2QDKA 2BCJQ 3K5HA 3GPDG 1K9SA 2X0RA 2XX3A 4L5BA 4JVLA 1PJ4A 1T1EA 1GFWA 1RYMA 1X14A 3DE3X 2PCLA 5FDFA 2DWPA 2FHSA 3I61A 2NU7A 2XBMA 2FZEA 2ZWPA 1NIJA 3GLIA 2HX1A 2NW6A 4TT3A 4B6QA 3DM9B 3RVNA 3H1BA 1JQDA 1UAGA 3D4NA 1BZYA 3UXMA 4CIBA 2QX9A 2WQZA 4ZKEA 1XKTA 5DBHX 1AO0A 3ORFA 4OM7A 1IQRA 4EEXA 1RCFA 4UAJA 4U2FA 4IJVA 3SHTA 5T5QA 4IHAA 3N8IA 1VSBA 3VR3D 4CI9A 2CF6A 3FWPA 4DAEA 3O90A 1D6MA 1U2RA 1RM0A 2GPYA 4CDMA 1PJ2A 2BFFB 1EE1A 1Y7LA 2ODPA 2GCOB 1V43A 4CIVA 1T5IA 2NV6A 3EZ9A 4DB4A 1IY1A 2WYHA 5F9HA 1YZHA 5DX1A 2ZB8A 5GGXA 3VR1A 1XZKA 4EO9A 3BMNA 4BFCA 2UZIR 2XT6A 2OTCA 3Q7PA 2C9MA 2ICAA 1NP3A 1XZFA 3E23A 1LZKA 4FM9A 4AD8A 3C1TA 3I2KA 5FV4A 4TYPA 2OFFA 3GJSA 3A1CA 3FOZA 4PFSA 2JAPA 2ZB2A 4UAGA 3E9EA 3RU9A 4TZKA 3QE9Y 1Y8CA 1SQFA 2DTEA 4XWYA 5IAKA 2EIXA 4BLUA 2QAGA 1KBZA 3FNQA 3JARB 3N6RA 4XWTA 5K0EA 1TTTA 2B8EA 3ZV5A 4A7PA 4OO3A 4C0SA 3PC2A 3G5AA 4DDVA 4BNMA 4LV6A 3EDQA 5YASA 4CLDA 4XRRA 2XZOA 1NLZA 4JD5A 3JQGB 5J3JA 4QQKA 2Q1WA 2HLPA 2XNHA 3RPEA 4PQFA 2C77A 3AF2A 1FPMA 5TVGA 3H13A 5KDLA 2QJOA 2R751 2PSEA 3LQ4A 2NO5A 3FDZB 1P60A 4MRPA 1JX6A 3UFXB 5ILQA 4EKDA 1JG6A 5E9WA 4BYGA 2JGJA 4EO7A 1WXEA 3ELYA 3SLKA 3WJ1A 1PJ8A 4N7BA 2FMFA 2A9FA 3BXXA 4WNAA 3VHXB 3FSRA 2ZUCA 3R41A 3RIEA 1CS0B 3C5VA 3P2KA 1E98A 1E9SA 4EATA 1JPNA 2OD9A 2XQVA 4XIGS 3HJTA 3UVEA 4G8DA 2ZRPA 4QLBA 1R4AA 2GCPA 3U3ZA 5C4MA 2BE9A 3IIKA 3GDWA 2MSCB 4H77A 1EP3B 1U3DA 2ZUBA 3OTIA 2J0QA 3ZLJA 1XELA 3ELUA 3G17A 1M2EA 2JAQA 2QU8A 4W1QA 1MX9A 2VHYA 1G3QA 3BGWA 3HCNA 1H6DA 4RYLA 2RHCA 5CX1A 2ABWA 3F3YA 1I1HA 2R7NA 2VVTA 3LHFA 1QF6A 5LDDC 1GTSA 1NJ5A 2H7XA 3EFEA 1ABFA 2C42A 2CXTA 2H31A 1S2IA 1YHYA 2ZP1A 3LK6A 4HZUB 4JQZA 7REQA 3HSYA 2JFPA 5A3QA 4N8SA 1NZJA 2VQFB 4PCVA 1FFSA 1N6PA 2QJRA 3LUJA 1YE3A 3QMMA 4MV8A 3CLVA 3ORSA 2XMGA 4MTCA 3TXYA 3M83A 4BEVA 5ILOA 2V3WA 1F12A 4M8IA 1X2EA 2V7EA 4BVKA 1AMUA 1LLQA 2YBEA 2IEIA 1KOJA 4F3CA 1KK2A 5HYVA 5EMJA 1CG6A 1ATZA 1ND6A 2RD2A 3C74A 4O4LA 4WY5A 1IMOA 3WTCA 3HKDA 5HNKA 1JFTA 2V96A 2ZAIA 4N5IX 2B5WA 2TMYA 4ZYYA 4EB8A 3CEJA 3D3KA 1P2SA 3HR8A 2DETA 2H1IA 5HZKA 1EP1B 4OK5A 2D5LA 1TM3E 2E3JA 1XDGA 2J7PA 4A6DA 1YJBA 2C54A 3K16A 1NF3A 2XNSA 2DWOA 3MJCA 4HAUA 4E5YA 3CS3A 4TXJA 3UWKA 3ACBA 2UDPA 3BYZA 5EWJB 5KQMA