4D8VA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 79
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8vA00
3KVVA 2I8AA 1A9SA 3FB1A 4TXNA 4TXLA 1U1DA 4MCHA 1RT9A 4BN0A 4L5AA 3C74A 1RCTE 4DA0A 3EUEA 1ODJA 2A8YA 4TTAA 1A69A 1Y6RA 3UT6A 2A0YA 3OZDA 1V41E 1LX7A 1YBFA 5CXQA 4R31A 4EB8A 4P54A 1T8YA 1T8SA 4DABA 1Y1TA 4LKRA 1ZL2A 3E9RA 3ENZA 5IU6A 4YMLA 1NC1A 4TS9A 2IQ5A 2I4TA 5EFOA 1Z34A 3NM6B 1ODIA 1SD1A 1B8OA 1JDUA 1JPVA 1G2OA 4GKAA 4JWTA 1TGVA 3KVRA 4OF4A 1A9RA 3OF3A 3T94A 3PNSA 1WTAA 3OZBA 4R2WA 1Y1RA 1I80A 5CCDA 1A9PA 4LNAA 1K3FA 2Q7OE 5CYFA 2HRDA 4F3CA 3KUKA 3BGSA 3MB8A 3ODGA 3DJFA 4WKBA 1LV8A 1A9QA 4NS1A 1PR6A 5F7ZA 4GMHA 3E0QA 4WKCA 1YR3A 1YRYE 3QPBA 4LZWA 4DANA 1ODKA 1Z36A 1V45E 3K8OE 4DA8A 4TS3A 2AC7A 4YJKA 4K6OA 1T8WA 1Z5PA 1JE1A 1NW4A 4BMXA 4F2WA 1C3XA 4WKPA 3P0EA 1JDVA 1TD1A 1TGYA 2AI2A 1Z39A 3E9ZA 5JPCA 1JYSA 1SQ6A 1PR2A 3P0FA 3DDOA 5ETJA 4QARA 3KVYA 3GGSA 1RXYA 4G41A 3OZEA 4NSNA 3KHSA 1V3QE 4L6IA 4YNBA 1YQUA 1FXUA 3INYA 4WKNA 4JOSA 2OC4A 1PF7E 5CYGA 2PGAA 2QPLA 1ZOSA 2QTGA 5DK6A 4QEZA 5B7QA 3OOHA 1Z38A 4BMYA 1PW7A 1V2HE 1OUMA 4M1EA 1OTYA 1PWYE 5FAKA 4IP0A 3TL6A 3UAXA 1JP7A 1RFGE 1U1FA 3K8QA 3LA8A 3GB9A 4F1WA 1VMKA 1RSZA 1OV6A 2HSWA 1PR4A 1Z33A 2QDKA 3UAZA 2P4SA 5B7PA 3DP9A 3FWPA 2OXFA 2BSXA 1ULAA 1PR5A 4GLJA 1NC3A 5F7XA 4WKOA 3U40A 4M7WA 4E1VA 4GLFA 5F78A 1Y1QA 2AI1A 5KB3A 4D98A 1RR6A 1N3IA 1B8NA 4R2XA 4D8YA 3LBAA 3ONVA 3O4VA 1U1EA 4H1TA 3FUCA 1K27A 4DA6A 2QTTA 4M3NA 3UAVA 4X24A 3EMVA 4TYMA 2ON6A 4LDNA 4OGKA 4D9HA 3FOWA 1CG6A 5B7NA 1JDZA 2B94A 3PNPA 1PKEA 4D8VA 1PK9A 4FFSA 4QASA 2OC9A 4OJTA 5F77A 1JDSA 1TCUA 3OPVA 1SJ9A 4MCIA 4PR3A 1VFNA 4G8JA 1M73E 1K9SA 1RYZA 4YO8A 2AI3A 4NY1A 3OZCA 2ISCA 4L5YA 3FNQA 1VHJA 3BL6A 4BMZA 1VHWA 1JDTA 1SD2A 4EARA 1LVUA 1U1GA 3MMSA 4TXMA 1ECPA 4OEHA 2QSUA 1JE0A 1PBNA 1ULBA 4L5CA 1RXCA 1Y1SA 4F3KA 3O6VA 5IFKA 1RXSA 2HN9A 3NBQA 3IOMA 2GUWA 3UAYA 3EEIA 3DPSA 2RJ3A 1V48A 4PNPA 4TXHA 4DAOA 4RJ2A 1OTXA 1PR1A 4TTIA 1OU4A 1V4NA 4QFBA 2XRFA 1PR0A 3PHCA 5F76A 2HWUA 3F8WA 5I3CA 4DARA 1TCVA 4ECEA 4OGLA 2H8GA 3IEXA 4LNHA 5CXSA 5CCEA 4JP5A 5F7JA 5B7GA 4G89A 1A9TA 1RXUA 3BSFA 1PK7A 3UAWA 1ODLA 3EUFA 5EUBA 5F7OA 1Y6QA 1YQQA 3NM5A 4TTJA 1XE3A 4TXJA 3NM4A 3D1VA 3OCCA 4KN5A 4UC0A 1U1CA 1T0UA 1Z5OA 4D8XA 3PHBE 4F2PA 4OY3A 5C80A 5F73A 3BJEA 1CB0A 1Z37A 3KU4A 4DA7A 3LGSA 4QAQA 1Q1GA 2A0WA 3OOEA 3FAZA 2OECA 4U2KA 4I2VA 1Z5NA 3SCZA 1QE5A 5K1ZA 4QATA 1Z35A 1T8RA 4MARA 4DAEA 2A0XA 5EPUA 1OVGA 3DF9A 1A9OA 4L0MA
chains in the Genus database with same CATH superfamily
5K0JA 4XFDA 4A8PA 3QUTA 1ZESA 3JATA 1LY1A 3JQFA 4ZZ1A 5C7OO 2WEKA 3N2IA 2Q46A 2QGZA 4HQFA 5CDSA 3W6NA 2WTNA 1M1UA 5FB3A 1GZVA 5GJBA 1B0UA 3CUEF 4YRLA 3ZHRA 4EW3A 5KVCA 2GR9A 1RCTE 1WZEA 1FLAA 2XMPA 3QBEA 4I50A 2WC1A 3JQBA 4GX0A 3IOYA 3PSAA 4EL0A 1F5NA 1SOVA 3PLNA 2BD0A 2PV7A 3NWEA 3OJLA 3KYBA 2PGDA 4FSHA 4G84A 1HI9A 1ZRMA 2J0EA 5D3MB 3HRKA 1N8NA 1M0TA 1U99A 3ILVA 5HOQA 2G3YA 3I9V1 4TMWA 2RKBA 1GNTA 2B21A 3OMWA 3GUHA 3ELUA 4QU8A 1HNXB 3IDQA 2ESRA 3V34A 3UT6A 2CN1A 1Z4QA 3ZPXA 4F6CA 2Q4DA 1QKIA 5GPBA 3NHBA 1FUEA 3FHOA 3WL7A 3A3NA 4C6RA 3RRYA 3TZBA 3SQOA 2H2AA 2ODNA 1LC3A 5B3LA 4S2UA 4CMKA 1T8YA 1A4XA 2X41A 3HBAA 3UJCA 4DMFA 1IPHA 1VJTA 3T5PA 2J5RA 3STUA 3I9OA 1YA8A 4JOBA 4UTZA 3V1NA 2I7TA 2QE7A 2EJVA 4O4LA 1U94A 3DDZX 3G49A 3HE3A 2R62A 4JODA 4R0VA 4TL8A 1AH2A 2IYPA 3FW1A 3RVBA 3UANA 1JQDA 4IUDS 2FW8A 3OFVA 3C6MA 1SRQA 3F71A 3QX7A 3ASVA 1WKCA 4LQCA 1B14A 3HU1A 5E0OA 4LNUB 3O0DA 4C3ZA 5BP7A 2P9TA 4XJVA 5JTTA 1YDEA 1YZGA 3G5UA 1ACMA 4N8SA 5DF1A 2XCTB 4IWYA 1F2DA 3IKMB 3H7IA 3VNUA 3IVAA 3A1VA 2PD6A 1LW6E 1WEKA 2ZRCA 1YJAA 5BSHA 4D4JA 1Z8NA 4F97A 4DNXA 1PSWA 4HMQA 3HWX1 4DUPA 1HTTA 2VI5A 2ZIWB 3HJUA 1W2HA 3AX6A 4EB6A 4G23A 2BIFA 3AP1A 4XVHA 2PS1A 1UBFA 3REFA 3ZDBA 3OF3A 2ZZNA 4M0LA 5HW0A 3PHIA 1OX5A 4X00A 1IVNA 1P77A 2B0CA 1PHPA 2DFDA 2Y1FA 2B5WA 1RPNA 3AGQA 4HRVA 4O1MA 1IJKA 1RMQA 2OP1A 4NDNE 1B76A 1TLFA 3PNSA 3C3WA 1TCCA 3ZDQA 1KGDA 3MQ4A 1V37A 2DTEA 1HSZA 4G97A 1X7HA 2LKDA 4ZWNA 2B35A 4CTJA 1E8DA 4MV1A 2R7LA 1GTSA 1AK9A 2C9MA 4F5ZA 4ZOLB 3UMFA 4LGVA 2BGJA 3TOSA 3EEOA 4RESA 3TB4A 4JR0A 4OHWA 3TSOA 3UMYA 3AEYA 2XE6A 3I72A 2IHVA 3S2GA 4BRWA 4E14A 3MJVA 4RLFA 1P5ZB 2GCIA 2RHJA 5JH7A 5AVRA 1ZBDA 1BMQA 4X90A 4ZEOA 3MB8A 2QN2A 2Q2OA 3TR6A 3PGA1 1QH0A 3K53A 3X1MA 2VK4A 2K7FA 4NS1A 1C9MA 4PNHA 3WK4A 4DYHA 4DCOA 3DHWC 4Z9BA 2VTBA 5F7ZA 1DEKA 3IXMA 3KB2A 2VXCA 5DYNA 3AGPA 2PLAA 5JS8A 3S6JA 1CIPA 1OWLA 1IM8A 3TOCA 5D87A 3VC3A 3PX7A 1MRSA 1JR3D 1NW3A 2QG6A 3C5HA 4A2CA 3HBFA 2IEZA 3WL8A 1DXHA 1M66A 1ONNA 1YR9A 4MVJM 5EPOA 2B8EA 2Y66A 3A1SA 3UOWA 4B3IA 3MAJA 1BKYA 1AOXA 1UKVY 2D7CA 3JQAD 4N65A 3DMPA 3Q0IA 4TWZA 5AI0A 3THRA 1WB9A 1OZHA 4ZGGA 3U48A 1TK9A 2OL4A 3ZHQA 4DIBA 2VYFA 3SE0A 4O4JF 1GYPA 3C3EA 4JI7B 5KMGA 2J3QA 4CUZA 1USWA 2Q3BA 3DM5A 4I5GA 3T52A 5LZ8A 4BV9A 1E6LA 1BQ3A 3PRYA 4N8EA 3LSTA 2ZI3A 2GLXA 3EHEA 4ER7A 821PA 7AT1A 5L3SB 1A8SA 4M1QA 1ZS9A 1GZ6A 1M33A 3IP8A 4EDHA 4R0MA 1NMZA 4HLUA 1VFPA 3NYIA 4ICIA 5JHGB 4UMDA 1EUQA 1BCRB 3FCOA 4EMSA 2I7CA 3KLBA 4P4SB 3KXDA 1E2DA 3H5AA 4YDRA 5JTUA 1A7KA 4BP1A 1U9JA 4E5MA 2V5AA 4HEJA 4PX2A 3ZDRA 5C51B 2XECA 3LP6A 4YB8A 5IANA 2L18A 5JWRA 3DXYA 1W76A 3SEFA 3HWWA 5LQAA 3OKAA 1M8GA 3O8DA 3UOAB 4R7ZA 2O3RA 2FPPB 4JEHA 4LOLA 3LVQE 1XT6A 3AWIA 4ARAA 2FQ1A 2HDNB 1JXOA 1SXQA 1BRMA 1QIHA 2QTFA 4PXSA 3QKWA 2PU7A 5FTWA 5KPDA 2C3OA 2BI8A 3IPRA 4ZU1X 5KSOA 3LX5A 2XA2A 3OP1A 4KQWA 1LC0A 2SKCA 3FKQA 4ABTA 1X7ZB 2RE8A 4FC7A 4FFOA 3MUFA 2QMEA 3H9EO 3MMZA 4BE9A 5JARA 3ESXA 1QHHA 5GVRA 3WK7A 5C5IA 2X58A 2BISA 1VKNA 4F6RB 1PW7A 3OD5A 5KNBA 1X1QA 3MC1A 1G5FA 5CX4A 3AW8A 1JB9A 5FJIA 2HX1A 2CHGA 1VYVA 3VU3A 2P2YA 2A78A 3H8WA 2OO5C 5IN5A 2HCBA 3FZQA 4A82A 2ZJ1A 3FY4A 5E7IA 1T6BY 1RM4A 1KS9A 4UHKA 5ALOA 3V8BA 3OZAA 2TMYA 4CLEA 2DJ5A 4YBZA 5LD2B 3TOXA 4H27A 4II2A 3THWB 2XZPA 1Y4AE 4LBVA 4F1WA 1UBOS 4YPFA 3LZDA 3SXUA 2VSQA 5G4KB 1UKBA 1YVRA 3K0EA 2H06A 1TMGE 4Q4DA 1M7HA 1W29A 2EKZA 3D54D 3IA2A 3PXCX 4CIDA 5CA0F 3L4KA 3U4HA 1DFIA 5G1NA 4C87A 1X74A 1WEHA 1WF3A 2H0AA 4OQMA 2WA2A 3NI2A 4ARVA 1EXWA 1P0CA 5F35A 4OX9B 3P9KA 5EEGA 2GO1A 4ESVA 4GL4A 4KZKA 1FBTA 5A5EA 1R6AA 3QU9A 2VSNA 4IMPA 3K7EA 4O4HF 4QGAA 4CCYA 1PFUA 2Q0QA 3CKYA 3NBZC 4QQKA 2BEVA 4TVKA 5FI5A 5BWLA 4QPZA 3IAS1 2J0UB 1NURA 4ESHA 3BSYA 3EYWA 4CYMA 2JJYA 2CWWA 1O95A 2P0EA 2NYUA 3EVZA 4NK5A 3KE8A 1TF2A 4B6FA 5BV0A 2HA0A 4XFJA 1JWBB 5DGDA 4PC2A 4TLMB 3MCWA 2PEYA 5B1EA 2OM6A 1IBKB 2GRAA 1QOPB 2A59A 4FOOA 3IUNA 1XEAA 1WUKS 1XNHA 3HU2A 1NVKA 2X4GA 4ZDJA 4OKNA 2Q4BA 4GR9A 1K7XB 2MSEB 4MO9A 1QOQB 1WOMA 2ZIZA 5JNVA 2W6PA 4IEEA 5FUQA 2AUNA 1IONA 3LPAA 5IVKA 3FDIA 3CJRA 1GEEA 1M6YA 4URZR 1VG9B 5AKGA 3UB4A 3EXG1 3HQ4O 4LY6A 4LSMA 4ZO4A 1S02A 3N5CA 1U6JA 2CHEA 3AEZA 3A3KA 4FD2A 4DIKA 1FFXB 1DRWA 2EF0A 2GBGA 3A9TA 3MWDA 4LDPA 3WRWA 4BZQA 5D85A 1N78A 2JLCA 4PO8A 1Z9BA 3O75A 3RSOA 1SZCA 2PO7A 2Z8YM 2P5UA 4FYJA 4MUBA 1L4LA 9ATCA 1UADA 2GPBA 2XDWA 1MO3A 5IHXA 2K7ZA 4NCHA 4O2LA 3USZA 4NMWA 4OFZA 3NIBA 2WU1A 4GGPA 3H0KA 1Z7GA 3TDKA 4BOYA 1T35A 2ASEA 2HHJA 3LP8A 1K6IA 1Y81A 4RCVA 4MV3A 1KZ9A 2HH9A 3PE6A 1AHPA 2ZJYA 5EZ5A 4FU0A 1V3VA 1WXXA 2Q3CA 4R41A 1HLPA 1L5YA 3KAPA 4QASA 2OKGA 2Z3VA 1HT1E 3QVWA 1YS1X 1U3TA 3O1HB 4HWGA 5AM1A 3IAS6 4ILKA 3SMQA 5E6SA 3DAHA 2V8OA 1LPAB 2X42A 3SJUA 2J9YB 4IKPA 4MZDA 2J8ZA 2X0IA 1FYVA 2FUG6 2JLAA 3AERB 3BGOS 1OXMA 2PT7A 3B9RA 3CZQA 4JT8A 1KAHA 3ZJYA 4LF9B 3HR8A 3VC2A 5COAA 2QMZA 1K9SA 3DWEX 4REQB 3W5CA 1J7JA 2RCNA 4ZQHA 1OWMA 1N9GB 1LZKA 1ZUNA 2YV1A 1SKAA 1DKMA 1MDFA 4YUWA 2WVGA 3LOQA 5CB4B 2FUG1 1P7ZA 5ICEA 1AS3A 2Q5EA 2TSYB 3OE7D 2P1RA 3CURA 1E63A 3KAQA 3ABOB 1E7YA 3I04A 4JYAB 4QFCA 2GFIA 3ICCA 1DXQA 2FE4A 2ZKIA 3CH4B 3NXKA 3VU9B 1NMSA 1SHKA 3PZRA 2JHCA 4H0CA 1FTQA 3BH7A 2OHVA 2GERA 3GROA 3O8CA 1UKEA 2G07A 4M22A 2EL7A 4OLBA 3JASB 3UC9A 3BSWA 2QL9A 3FZNA 3H13A 2ZRAA 2CT8A 4F3TA 1IN8A 2EJCA 2C2MA 2CNBA 4F3KA 1OPRA 1XDBA 1REQB 3W05A 3GFBA 1U2TA 4JJFA 3M2TA 4YLGA 5EP1A 2HPAA 4ZYVA 2HB6A 4XSHA 4YHHB 3T1OA 1Z56C 4RPGA 3ORHA 4NDZA 4C20A 1QCYA 1CBUA 5I4CA 3JZIA 3OPQA 5HF9A 3LL7A 4FMDB 1U9IA 2QL7A 1KI9A 2QQFA 3G1TA 2UYGA 4C30A 4B47A 3QPCA 1HE4A 1UT6A 2V7PA 1T5HX 4Q1EA 2V9PA 4CKWB 2EBHX 3NONA 2YW2A 4PNPA 3RU9A 3VTAA 5ER9A 1IXZA 4Q4AA 4NHEA 3CF0A 1VBMA 5JY1A 2HRZA 3VDMA 1G9TA 3GRAA 1RDFA 4FYIA 1WCYA 4PWZA 1EGVB 2P7HA 4LHZA 3RTEA 1ZKDA 2X2EA 2P4QA 2QZPA 5CVEA 1KK2A 1P7PA 1WP9A 2EG9A 4WBSA 1QO7A 3KOMA 2ZXFA 4Y0VA 5A6SA 1XRJA 1ZQ1A 2CZGA 2J9GA 3P32A 4M1TA 5B58T 3M6XA 1TADA 1DWPA 2IYSA 2W2TA 1CUFA 2NW6A 4Q39A 1OH5A 2B9VA 4Y6OA 1E9RA 1P4RA 2EKPA 3LY9A 2PA3A 3N07A 3V4LA 1QTRA 3PGLA 2BR4A 1EWVA 1UF9A 2AS0A 3DFKA 4BWFB 2YXNA 2KPOA 1EVYA 3GIDA 3KTFA 5H4HA 2H8GA 2MYNA 5CVDA 3JY6A 1KTIA 1GV0A 4I5IA 4W6QA 2M9MA 4TTTS 2JH8A 2P3QA 1TVCA 3K9LA 3DEZA 4CI9A 4RHXA 1E94E 1N0IA 1GG2A 1NMXA 4JWKA 1N3YA 4FS8A 1Z7YA 3KT0A 2AJLI 5I9SA 2X0DA 5IMSA 4POAA 1C0KA 1UMDA 3E9NA 4M0PA 3DJYA 3L1IA 5ICCA 1DBVO 4X60A 4CTOA 1HE8B 3BMNB 4OQNA 4M53A 5FBZA 5T3UA 2H1FA 8GPBA 1BMFD 2VSOA 5DX8A 1RRFA 4AKSA 1PK7A 3KZVA 4PHHA 1CY1A 3F9IA 5BQPA 3U6KA 1B1AA 4O2BF 4YRFA 3UAWA 2OHJA 1IM5A 2WJAA 1N0VC 3NLLA 1QX3A 4FFWA 1NYTA 3CXUA 8ABPA 4QSHA 5D7NA 3GW8A 2CNDA 4ITVA 4TRNA 4B0PA 2O19A 4F21A 3D7LA 3LHIA 5DBFA 1IEQA 2AG8A 2AOUA 3GQBB 3OURA 3KHKA 4TWIA 2PGNA 2Q6IA 2EEPA 1YS2X 2X8WA 3WTCA 2XHZA 1J39A 2NUAA 4HQ6A 9LDBA 3KEFA 2N0SA 2ODAA 1G8HA 2H85A 3G9UA 3ESYA 3ZHZA 1U1CA 1VJRA 1NVTA 2H2FA 2CYCA 4PFKA 1AZTA 1QMGA 1Z5OA 1ZG3A 1M5TA 3HYCA 4Y6PA 1WUTA 2G88A 4QPJC 3VR2A 4D8XA 1H1LA 4KMOA 4I6EA 4ZCPA 1Z0IA 1W73A 3GFSA 3H9GA 4EFMA 2BP7B 1E2LA 3K6KA 3C7TA 4AIRA 1YK1A 3FVRA 1L5VA 3A6JA 1OX4B 1VMIA 4JOQA 2A57A 1M0WA 4MWEA 2JCGA 1GPKA 2OYCA 3D3EA 2WJGA 3DE0X 4YHBA 3UB3A 3S0JA 4WCFA 2FQWA 3K2QA 1WZCA 3ADPA 4Q93A 3EGOA 2QQGA 2XVXA 4F84A 2AJDA 3QTLA 4RTSA 1PGPA 5AJYA 2C7BA 2E55A 3GRYA 1Y3DE 4GOXA 3FAZA 4I4NA 1QRUA 1K5GA 3VTFA 4U2KA 2NSLA 2AMJA 1ZSYA 4I2VA 1W6RA 4GD3Q 1ZNQO 1EFRA 2B9EA 1NHGA 1YJCA 2EJTA 2I78A 2R4TA 2RHOA 3IPLA 4QATA 3FN4A 4UQPA 4XVUA 5JXWA 2VCYA 1D6MA 1GN9A 2MR5A 3U80A 3KOXA 3OQHA 2Y6VA 4GR5A 3ODPA 2O50A 1BCRA 3DW3X 5AR1A 3HN7A 1HTWA 1DBSA 3WV5A 4TV9F 1JPJA 2QXYA 1B16A 1QO0D 5TSDA 4L9SA 4QXQA 3MJCA 1JN0A 1CUXA 1GR1A 3KVVA 1DCTA 1K8XB 1A9SA 3L8EA 4J3NA 1JAXA 4FZ3A 3ENWA 2GJAA 1BO6A 2DG2A 4PGGA 1RT9A 4CIXA 1GL9B 4G5GA 5D3KA 3K15A 1YZHA 2O59A 4YFVA 4GICA 2FDRA 5HKKD 3NATA 1EK2A 2HMWA 4MJLA 4M1YA 4BFTA 1VL5A 2AHRA 1IHOA 4BP8A 3LKZA 4TN1A 6YASA 5TVKA 1JKXA 5IH3A 4X62B 2R1TB 2I3GA 4PLGA 5EMMA 1NLUA 2VHTA 2NYAA 4FEAA 4HNUA 2LIVA 4BO5A 3GFOA 1PU2A 3CGWA 1U9CA 3EXEA 4JGIA 3KLMX 2HGSA 2JBAB 3T7DA 4A0GA 3GXBA 5KNDH 3W5VA 1P1RA 4H1HA 1TIPA 2XEDA 3K32A 4I81A 5U4XA 2XMGA 5A3QA 4EO9A 3DE5X 4X45A 2G5TA 2ZYHA 4BVAA 3L6BA 2IGTA 4P0PB 2XWBF 4QVKA 3WGOA 3NC4A 3ENZA 4AY6A 1ZA2A 2O8FB 5FJJA 2AK2A 2ZI9A 3D5TA 3D7KA 3KOWA 3IVCA 4TGLA 2V1XA 2RGRA 2O6LA 4MLZA 1GSHA 1T9DA 3I2HA 3GEMA 5CHYA 2PT9A 2JVKA 2I4TA 2BWJA 3OFSA 4I8XA 4FOPA 2Y1OA 3RC1A 1J1UA 1ODIA 1SD1A 4IRXA 2Y0PA 4HD8A 3N5KA 5H70A 2FZWA 1J42A 2C98A 4MUGA 2XNDA 5LXTA 2AF3C 1GSAA 1OREA 4ZZIA 1NT4A 1LPOA 1W0JA 4RABA 2JCXA 3KTDA 3H9BA 3B7WA 3P7MA 2A84A 4CIBA 3EVNA 5MHTA 2QTNA 1YQXA 1P4HA 4RKRA 3I0MA 5FPTA 4CM9A 1G5RA 2B1RA 5FYQA 3RRJA 1K66A 5EJ9A 1EWQA 2ZBVA 3DFFA 1WTAA 1X19A 2C4TA 4ALKA 4OYRA 4H18A 2QX4A 7GPBA 4R2WA 1NQAO 1FU7A 5AHXA 5IJ0A 1SB8A 4BC0A 2PXHA 3IPCA 3PQCA 4KJXA 5KOHB 2IOFA 3BE6A 2PGIA 1QIJA 4HX2A 4XD7D 4AN0A 1BN6A 2VP6A 3C14C 3RJMA 2RB4A 1NFFA 2GOYA 4HLUC 4M1OA 3VR0A 3VQTA 3ZNPA 2ZJAA 5LU9A 4WOJA 4FI3F 2A1TS 5ALDA 4XW2A 4KNWA 1N5KA 4MR7B 3L6CA 1D7OA 4JROA 4PWYA 1OFVA 3P4XA 4ED9A 4LDZA 5IAOA 1QIGA 3D4NA 3NO4A 3SOZA 2DLNA 2CDAA 1T26A 2X8AA 2WHQA 3MM4A 4RFVA 4O1IA 5CK4A 3UYLA 1VSUA 1IPFA 1GT91 5ARDA 1NLYA 2OCLA 1GUFA 1KEPA 2F17A 2HV9A 3PWSA 4NRDA 4ETNA 1H5NA 2GA8A 1UFVA 2TRSB 4YP5A 4M9RA 5HPYB 2OSBA 1RTTA 1QBGA 2IHKA 4X1IB 4YR9A 5AKLA 1XKQA 3WLRA 2R60A 2QRQA 1T9CA 2AC2A 2FFHA 4G4SP 5JAPA 1OAKA 1WV1A 2POCA 3H2YA 4Z0TA 1LJ8A 1FUKA 2C9YA 3BILA 4ASUA 1EHCA 4EGAA 5DBGA 3GP8A 2CW5A 3AB8A 1SIWA 3QYPA 3QSYA 1YCHA 3DTVD 4FHDA 4HJXA 3NB0A 4LMRA 5DP1A 2B4QA 3SNKA 1ZU5A 3F3KA 3RVOA 4RY9A 1NG9A 1KI2A 1CJUC 1J4AA 4YPVA 5IM5A 4C1NA 1M7BA 5SZHB 1C9EA 1W6UA 2B61A 2WSMA 3CR3C 2R8EA 4IIEA 1I4LD 3KQQA 4FFBB 3F7OA 2ORED 4ZKEA 1GITA 2D3WA 2BKVA 2C1XA 3THYA 3VI4B 1E6EA 5CB4A 4XARA 5ECWA 2YV3A 3LQFA 2ZRKA 3ZXUB 3SPXA 3ILYA 4BMXA 4J7AA 1XN4A 4X8MA 3BIOA 1FJHA 1YB1A 3EXHC 4RDIA 3K0KA 5DM1A 1DT3A 1V8BA 2HA4A 1RWKA 3AQIA 3KDSE 3KSDO 1PJRA 1C7EA 1E9CA 2OBYA 1NXVA 2G7MC 2GCGA 3H6GA 1Y8RB 5BW6B 4BMDA 1QLWA 1W5TA 2BE9A 3TIXB 1J1IA 3MTQA 4C5CA 3AR9A 4XDZA 1L0BA 5CCXA 4CKEA 3EB9A 3QE3A 4ALJA 3WI7A 4BO1A 4BO4A 5ITVA 3K30A 3AKZA 1VXRA 1VECA 1NVFA 1E5LA 2IPMA 4IXNA 4MHOA 4XOIA 4W5OA 4EHNA 3ZD8A 3RVNA 1PJCA 2HBQA 3QBJA 3G02A 4RAOA 1QG0A 3I34X 5LB4A 1IHXA 4AJ2A 4B7AA 5CFPA 1VRCA 3NUQA 5DM4A 4LGMA 2IWHA 3FCEA 8OHMA 1TJYA 2FEMA 3TZHA 2GZSA 4KXVA 2C2ZA 1RQPA 3AF5A 3MTBA 4D4MA 3I5XA 1H4QA 2VXBA 1ZFNA 4K87A 5KWEA 1VHLA 1ZVJA 2YBDA 1GN8A 1ZY2A 3HB7A 3N2KB 1Q11A 1B93A 5JYEA 3GH1A 3KKMA 3AFGA 4OGWA 2OXTA 3ZCRA 2GBFA 4BLQA 4OI0A 5CVTA 3U44B 3FFAA 2ZP1A 1ENOA 2P2DA 3D6NB 3DHVA 1V1JA 2C9DA 2FWNA 5E6UB 5EUCA 1KVRA 2CNNA 1QM5A 3KSMA 2O5EA 3CF4A 4XPIA 2AQIA 2YCLA 3EC2A 4IP0A 3ZN2A 5AWFC 5C37A 4V0RA 3A4MA 1PJBA 4ND1A 1HURA 3C7KA 2WFZA 2J46A 3RK1A 2RAUA 1PUXA 3IAFA 3BHNA 4QWWA 1K88A 1IAQA 1RLOA 1T2UA 2PZJA 4HAUA 1RYYA 2G9RA 1Z0JA 2C5LA 1D6JA 5M3BA 2AR9A 3AY7A 2G70A 3X2SA 1UOOA 3T1TA 3T9AA 4E31A 4O2AB 3V8NA 2A7XA 1EZ1A 1M76A 1P7VA 1OXXK 3A9RA 4PCLA 2XAUA 1MJNA 3GRZA 5KVSA 2QN6A 4LK2A 4JXXA 4WINA 2YZ2A 1N0WA 1Z18A 4EHJA 3A9WA 4ZAYA 5E95A 3DTYA 1QFZA 3W8DA 4TL9A 1MB2A 2JB9A 3DP9A 3PA6A 4PRLA 4PYKA 2AFHB 3CG4A 1Y9JA 3FCYA 5CVVA 5DW0A 1TM2A 2GHRA 1YBVA 2P9JA 2QTLA 1OLXA 2WSIA 1ZUNB 3GNSA 4HGNA 4OJNA 4P3XA 4TSFA 5HFAA 2R00C 2WWGA 2A88A 3T54A 4YY3B 3DT8A 3NS7A 1DWQA 3OOYA 1A5ZA 3DOUA 2LTAA 3OICA 4J0CA 5B3JC 1Q22A 2GPNA 4QDUA 1NAHA 2I7XA 2PKWA 1Z29A 3BREA 4FYYA 2IV3A 4EI8A 2IUUA 3PGXA 1EVLA 1CUUA 2XUGA 3IODA 4PO1A 5F78A 3KOZA 3T12A 5KHLB 2POQX 4FE4A 2W2KB 1NVUQ 3PD0A 2XMCA 3F7TA 1XTQA 3IUJA 4UHHA 3JAKB 2PL1A 5KB3A 1GILA 4W5WA 4BFYA 2V7XA 4RLHA 3ZNOA 5JC1A 5IVDA 1CV2A 3C5WP 3HBNA 1B8NA 4QG7A 3ZGVA 3NASA 3GFQA 3UCFA 2YBEA 4JHXA 3N75A 2UZIR 4I14A 4J1NA 3UJHA 1OH7A 2Q2QA 5A4KA 4H6XA 1EFLA 3NAGA 3EXEB 4XYMA 1YHZA 1BEZA 1Y63A 3BM5A 3TM5A 4GBED 1YONA 1U0GA 4W7IA 1SBNE 5FLXA 4NQZA 1EBBA 1UL1X 2A9PA 2QTTA 1J21A 1YF3A 2XVAA 3FOFC 1XROA 4H3VA 3UT5A 2JC3A 2DKFA 1K98A 1O9BA 1LF5A 1RKXA 2CVHA 5SY6A 2ON6A 2GEJA 1M2NA 2JIPA 1QTIA 1QK4A 4EYEA 2FLWA 3U7GA 4KAFA 3HABA 4YUYA 6NULA 2NYRA 4ER0A 2X86A 2WB4A 1K4MA 1TC1A 3T7IA 1I33A 2LWIA 3IA7A 5EQFA 1JT9A 3PNPA 5C1BA 5JC8A 1W94A 1PKEA 4ARIA 4A1FA 3U3KA 1U8CB 2YZ7A 1NJFA 4D3DA 1RKQA 1ZINA 4JP2A 4KGXA 2JGIA 5BQXA 2DTDA 1JG1A 2OXCA 4Q01A 1N34B 2FWAA 4HX5A 4C03A 3DCNA 2Y9PB 2GCPA 4EY4A 2R66A 3IPXA 1I94B 1Q1QA 2ZITA 4I9NA 4TT3A 4CLOB 4M99A 1Y4UA 3H4IA 1J6UA 1RYZA 1Q1NA 1W25A 2Z9BA 2QMYA 1EE9A 4NFLA 3WLHA 4RQTA 1R3UA 4IHAA 2WK1A 3JCZA 4WY2A 1R74A 3P9SA 4ZHQA 2FGKA 1HZZC 2GF2A 1X0VA 2DECA 4F45A 1K3TA 4QTYA 8ATCA 5KYGA 1SBZA 4NX2A 3PFKA 2ZUUA 5BOSB 2WYVA 4BKMA 4H0FA 4BV8A 4DXAA 2UUAB 3WNZA 1QZZA 2P2GA 4GKKB 2P9BA 1QF6A 3CEMA 1JHXA 3E5NA 3WG9A 3R6LA 5DBIA 5BT8A 1E2IA 1D2EA 3RT1A 1A97A 2LE0A 5TQ2B 4LDQA 4MSUA 1TAUA 1X14A 3R7WA 1I9CA 1BKDR 2NPIA 2QAGC 1NW5A 1RXSA 4K88A 5AIBA 5I7HA 4RJJA 3OVMA 4AZSA 5DE3A 2DPGA 4QO8A 4E5DA 2XMDA 4LA4A 4NNPA 4IDFA 1MGOA 1LWNA 1QUEA 3DW1X 4QOJA 5LMUB 4L78A 1X9GA 1I4WA 5EIEA 3UAYA 2EV9A 3M4XA 1X38A 1NV8A 2HKIA 1V6SA 1KRHA 2OGUA 2WU3A 2ZU6A 5FDFA 3IDSA 5GY7A 2Q6OA 3H2IA 2JLQA 1XX6A 3EMBA 4A4DA 2BGLA 4DAOA 1YMUA 1ISFA 4DYVA 1SOUA 4TMFA 2H2WA 4LJ5A 3LYHA 2XUZA 1M8FA 1SU6A 4XCQA 2HXSA 4M49A 4BQIA 1LDEA 1GPWB 4NMLA 3Q41A 2AZ4A 2JEOA 1R8QA 1AXRA 1YD7A 3ZOKA 4XEHA 2UUPA 1YZYA 1H2HA 2MMGA 4HDKB 5F76A 3C70A 5FI0B 1JJAA 3LY7A 4K0KB 1JILA 1UK7A 3FOBA 3FKJA 3R7LA 4D7AA 1JYEA 4LG1A 3BXOA 1JTEA 3NHPA 4HZIA 4E13A 1OA1A 2QLLA 2ATCA 2YIMA 3B6EA 3MGKA 4Q6WA 4EX6A 3KFVA 2VG8A 3VMMA 4JJAA 4IIJA 3A6FA 2D7DA 4UNRA 3BMCA 1E9AA 1XCBA 1VG0B 3PFNA 3SOPA 3U5TA 4M0FA 4LY9A 3LX4A 1L7DA 1SCUB 4QBKA 1AM4D 3RBAA 3GVIA 2R68A 1L5MA 1IBMB 1F9EA 3WBBA 1F3LA 1Z88A 1HQDA 2FR8C 3FH0A 1A5TA 2HOQA 3OCZA 4P22A 4YCBA 5AK3A 5B1DA 4DMGA 5LLTA 1JG2A 5GVSA 2OBNA 3BSFA 1Q21A 3IERA 3HGMA 1QPGA 3FPAA 3M5PA 4AJNA 4HNTA 1C9NA 3TKAA 4BNFA 1SCIA 1V0JA 2HJVA 3WAJA 3KBBA 1JIJA 2XWPA 4A8JB 1QS0A 4OL0A 4RORA 3LUKA 4ZALA 3WDKA 1NXPA 2LBPA 4FX5A 3ZIAA 2X9LA 4X84A 4ALIA 3SQWA 2HTFA 1GKKA 4AP5A 4P92A 4D5GA 4WNAA 4FHEA 3FXAA 1ZD4A 4RA9A 5DBOA 3GLUA 1WXGA 2YJ4A 3EEBA 3EDYA 1RP7A 5DW3A 3WYCA 1KYZA 2ZE6A 1X7YA 3C41J 2QE7D 3MWYW 4K5QA 1Z2DA 2G09A 3E3AA 1K4YA 1Z5ZA 1GTMA 3EWAA 4MYSA 4O29A 2O8CA 3KYJB 4R84A 2C7QA 1C3OA 2YS7A 4GPBA 4HOYA 3COJA 1SBCA 3CH6A 2G1PA 4FGZA 3B12A 2I33A 3HDYA 2OQ2A 5FD8A 5LJIA 4OH7A 4DJJA 1IZ9A 4WQMA 2BBWA 3F5MA 1N2SA 3IR7A 3PEFA 2EP8A 4NH0A 5BY2A 3HSSA 1DXOA 2QSZA 3PF8A 1JZSA 4GRDA 4JB0A 2NO4A 1T3LA 4WECA 3UWDA 4OLFA 3OIUA 1Z37A 3SBOA 5JS2A 1GD1O 1KOJA 2VLBA 3SE7A 4A2QA 2EL9A 4DIMA 5LLDA 4E2ZA 2YNMA 3OCWA 3TW8A 2DFNA 4C14A 3V00A 4IIGA 3AVTA 5KYYA 1ZR2A 4N48A 3EPPA 2GM4A 1C5KA 1SC1A 2QB5A 2WF8A 5KX5B 5EI5A 4MYTA 2CEKA 2OECA 1QIMA 3KKPA 2QW0X 1DX6A 4JB3A 3H0EA 1VOTA 4HTFB 4D42A 1N2OA 1TPZA 3EGCA 4UM8B 1GRNA 1OWPA 1II8B 5HBGA 1OASA 4RTQA 3OLCX 2EZTA 1M2WA 2HQSA 1DG1G 1XDDA 4KPYA 1NATA 3LFUA 1MB3A 4HDMB 3VOSA 2PUBA 2OCKA 3CM0A 3A7DA 4U2FA 5U1PA 3NDIA 3STHA 2HD4A 1LK7A 1POWA 3SFZA 2O20A 4IJWA 4LEIA 1MMFB 2H1IA 3S55A 2V4ZA 2P30A 3ZOZA 2DAPA 3KZXA 1O94A 4KR6A 3I52A 1ZXLA 2GB4A 5HIMA 4IZHA 4ENRA 2KBEA 1GGKA 1B15A 1FNMA 2XKBA 3TSAA 1THZA 2FF5A 3UF0A 4NXMB 2BUCA 1C80A 1T25A 2DX7A 5KTTA 1DEAA 1G63A 3RJ9A 1PYGA 3L9XA 5JVDA 3I5YA 2UVQA 3BGIA 3L7BA 2P90A 5AUPB 2OILA 4HVCA 3TQHA 4GPIB 3M6UA 3ONNA 5DCUA 1XP8A 4RNDB 1H5UA 5IKEA 2WM8A 3M3DA 4X1IA 5CXQA 5ENDA 4GE3A 2XGJA 4TWAA 5FWDA 1L8QA 4B4DA 4TYWA 4CV1A 1U7WA 1XCJA 4F86A 3FNIA 4FGLA 4H16A 3UGKA 1P6UA 3BJRA 3OO0A 3F78A 3WGIA 5ALHA 3H4MA 4RL4A 1KE2A 5KS2A 4CM1A 1TZ2A 4WBNF 1Y4DE 4IHJB 4MHSA 1OBVA 1W0KA 1T6YA 1CNEA 3OTWA 621PA 2PH3A 3MT0A 1E6WA 5IU6A 3IBCA 5KC9A 1OYYA 4FJ1A 3Q0TA 5GJWC 3B3AA 2P6NA 4NU6A 4XCVA 4B48A 4FEEA 1G6Q1 1VB5A 1J24A 3OLXA 4J0GA 4O8ZA 1B8OA 3K8YA 2X3FA 3H2SA 3U9SA 4JBNA 2QBYA 3S7TA 1CW2B 2CDRA 2NTVA 4QUAA 1W9HA 1R6BX 2F1RA 1FSPA 2PRIA 4L4RA 3RKUA 3G0DA 5A2QA 1B26A 3NYRA 2REXB 4MO2A 1KFCB 4IX1A 1RI4A 1BGVA 1ZJWA 1KMHA 1GCIA 1ANKA 4RMIA 1O3YA 1U8AA 1SHZA 5G53C 2ZUSA 1XDGA 3G13A 3JU3A 4FCVA 1XQYA 1E7SA 1OLSB 4UVHA 2IYNA 2ALJA 4Y9DA 3OQMA 3I4CA 2W0SA 2YWJA 3HVIA 2ZU0C 4MQEB 4S1VA 5D01A 5KOHA 4KHZA 4DQVA 5FPSA 2C96A 3QK7A 4TTRA 1J8VA 2P9HA 4IFBA 3WQSB 3AEKB 3KEMA 1GU1A 1P1CA 4O4IA 5DHQA 3VPSA 3ZD6A 4HB2A 4DDVA 4R05A 3QEJA 4NIMA 2CHVA 4G5OA 3X2FA 3DJFA 3EA0A 4CM5A 1XJCA 3IVXA 1NUTA 4U6SA 4XYGA 1UZUA 4ATNA 1XUOA 1V5EA 2GESA 4JSTA 1TKAA 2FX5A 1P1IA 4EHFA 2W4IA 1YRYE 1G41A 4FFRA 4NENB 2AXPA 2CE2X 5MN4A 4MDEA 1QGED 4DY6A 1ODKA 4X3CA 2WD7B 1SQGA 1KYYA 1V45E 3WLSA 2W6ID 2R8ZA 5FWYA 1L5OA 2VJAA 3PBKA 3SSMA 4WKGA 5FTMA 4K7JA 4WZAA 3LBFA 1ESMA 1Z7EA 2CZQA 1TO6A 1O5TA 1XCPA 4BO0A 4MWOA 1PQ4A 2GEBA 2WF5A 3CJQA 4MQFA 2XH8A 3ZEAA 3WHIA 4RIHA 1XQXA 2JKZA 1T1SA 2ZZKA 4KWEA 3UCEA 3EW7A 3W2IA 3P9ZA 1KP2A 4KAJA 1DBIA 2MINB 3VTZA 5E2BA 1W48A 1WKVA 1M34E 1P1BA 1SC9A 3HJGA 3RRBA 1RQLA 1Z6QA 2G5PA 1XPJA 3V2GA 2ZB8A 2SECE 1Z6XA 2HF2A 2PS3A 1YS4A 4EG3A 3BRWD 1GJRA 4TRMA 5JRJA 8LDHA 1OR8A 3DAFA 1Y9AA 2VP3A 4ZVOA 2OM2A 5DTJA 3B1FA 1SUAA 1C7QA 1SA0A 1SO8A 3E8XA 5EHQA 3LQYA 3DZCA 4MV8A 3C3AA 4YRAA 3DKPA 2INGX 3I8XA 2UZ1B 1DAOA 2YXDA 3AEKA 4Z7QB 2QPTA 4F4FA 1Z12A 3LV8A 5TLSA 1JJVA 1PSDA 1T2NA 1K86A 4DHWA 2WTMA 3QMWA 3PGMA 4FE7A 1TPYA 1X1TA 3MJDA 4J2TA 4QGSA 1OKKA 2C83A 5AW9A 5JMWA 5J1SB 3KQWA 2BM1A 4FINA 4BLWA 3UICA 4WLNA 3QKSA 3EVAA 1DO2A 3OZEA 4FHFA 5I7SA 2VJNA 2XTZA 3KHSA 1FUUA 4R1MA 4CXMA 4MDFA 3KPYA 4L6IA 4W82A 1JEAA 1Q0UA 2XODA 2HF8A 2BBTA 4GZ6A 1YB4A 1A95A 1Z8HA 3K09C 1X1DA 3MYRA 4P8RA 5L3QA 2ZBRA 2GPAA 3ZC3A 4LDJA 1KMNA 4C7OA 3ZDCA 2PKQP 3CB4A 4DOMA 2OC4A 1PF7E 4Z4EA 4IXTA 1QAMA 5KJ1A 2PGAA 4EJFA 1ZEJA 2BGRA 4OUKX 2AFVA 2WZQA 3VR5H 4BNMA 5F2NA 3B1WA 4PLPA 1IIBA 1R12A 4A6DA 5IG2A 2PT6A 4J0FA 3O4RA 2EBWA 2MYUA 1FMLA 2A7QA 1U6KA 4CKYA 1BH2A 3CF2A 1PWYE 3U1VA 1E5XA 4YXWA 1H6AA 3G8DA 4WX2B 5AVKA 2V7UA 1IIRA 1ARZA 3T3HA 4BTEA 4YX9A 4TPKA 4RMNA 2F1IA 2FJUA 2WG0A 3HRIA 4W1QA 3ZWDA 4BFSA 3ESCA 1F2TB 2ZUCA 1UMCA 4I4IA 3PDHA 1AZSC 3JZMA 4W5TA 3GUYA 2YFHA 4E4RA 1PUIA 3NJRA 4IIBA 3N2ZB 4HUQB 3W5UA 4RDCA 1XRLA 5KNCD 5KWJA 5LC1A 1LDMA 5HFJA 2IDMA 4KQ9A 1HDEA 5HS4A 3L0IB 2QD4A 1NQOA 1NUUA 2QZ4A 3O3OB 2ZRFA 4KTVE 2QHXA 4LHEA 4W5JA 4RQAA 2ECFA 1JPUA 3PTZA 3QWAA 2G1UA 1JTFA 1YS9A 4MWBA 4Q12A 2A9VA 2G77B 3NIDB 1WSAA 4PFQA 5DIFA 4BBZA 1W4BA 4HGPA 1TM3E 4LISA 3RODA 2I8LA 1ENPA 4IFTA 5A9TA 3MF4A 5FOXA 3RWOA 4AMYA 1L5QA 3KJIA 2IELA 4PYLA 4EB6B 3FTDA 3G5AA 5IF3A 3B3QA 1XMOB 4BXOB 4HNGA 3W7AA 3GHHA 4EPRA 4R2HA 4BB0A 1WHSA 3TNJA 1S7GA 2BJVA 1D2HA 2Q1UA 1A7AA 2PCJA 3MELA 3VNAA 3CF4G 5JI2E 5KNBH 3AWDA 1F2VA 3W1EA 2FTKE 3WWOA 3NMUF 5BQOA 3BRQA 2C2GA 3JZAA 5DEIA 2F67A 5A05A 1YGPA 4C4XA 1X7YB 4Z1MD 3DVRX 3CS3A 3FIUA 4MUIA 1T9AA 5A1JA 3BXFA 3C6YA 2HQRA 4M0MA 5JFGA 2PBFA 1E1RD 3U09A 3VJKA 4ZTZB 1RR6A 1UBTS 2FCRA 3IBYA 5AT1A 3VOBA 1EFPA 1CQIA 3NHSA 3CNHA 1CRQA 4MB2A 1HOTA 2OE2A 1FIUA 1AUQA 5AKEA 5H8WA 4NMMA 1Y9ZA 4QYSA 3P1JA 3NRJA 1KO4A 3O4VA 3VR3A 1N5DA 1RPAA 3U26A 4ADSG 5P21A 2HSGA 4CEJA 4JVOA 3UMGA 4P3KA 1U6IA 5AJXA 3VBEA 4LYGA 4ONEA 5HDQA 5L6MB 3AF6A 5IVHA 3TH5A 2ICAA 2E82A 2PMWB 2IHZA 5CFOA 2CLCX 4B3MB 3RT9A 4UTNA 2A4KA 3B6MA 4D92A 1TMYA 3AJDA 3KR0A 4TV9B 1G8YA 3QNMA 1QNLA 1X8XA 5FFMA 1XD2A 2CUNA 3QQPA 2PJZA 3JR7A 4Q3BA 1TUIA 1L2TA 1A1SA 2OXIA 2IV2X 1JFFA 2FQXA 1SU7A 1HMPA 2ZVDA 3KDPA 5DO9A 3FOWA 5FBWB 4XX0B 2IS6A 3QIAA 3GLQA 1TYDE 4BVKA 2R3SA 4FSDA 3PJFA 4KO1S 1Q91A 1GUYA 3CO5A 4O5OA 4YUVA 4V3CA 4ZEMA 4NYJR 2YWXA 4MAAA 2RJOA 1SVNA 3TWOA 3WRYC 1YK0A 4JBHA 4MVXA 4LF6B 4CN8A 4GOKA 3DZHA 4CN9A 5ESRA 1TCUA 3PXGA 3GMIA 4N0QA 4OJKA 1Z2EA 4IHJF 1T6NA 5TT0A 5IK2D 2DR0A 1V7ZA 2Q3FA 3J7AC 4GMKA 4FWBA 1TK2A 1S8OA 4YJFB 3RT7A 2CMDA 4AAYA 3E70C 1CC1S 3UGQA 2W71A 4TVBA 3OUZA 1H8HD 2HC9A 3AF1A 3NHWA 4EDFA 1P9OA 1NNI1 3HV0A 1YMVA 3CC8A 4KACA 4YO8A 3KKOA 3VO2A 4B82A 3FYHA 3EK2A 3C4JA 5M5BA 2CNLA 2H16A 4J16C 3V2IA 3GMSA 4D02A 3KJNA 3KJXA 3GLIB 3FBGA 5B6PA 4B3JA 4Q24A 4ZCTA 2A94A 2GJKA 3FZYA 3FCCA 3FMPB 3KIPA 3L8FA 1GNLA 2UUOA 3QV2A 4JP1A 5FR2A 3SZUA 4AICA 1SPBS 1VHWA 4R5HA 5EIFA 1MVOA 1S1MA 5FOUA 3VV3A 1LVUA 4UVEA 5CDFE 4HDNA 1B0PA 4NZ9A 4EG0A 3B51X 3QWHA 4MP8A 1W96A 1ECPA 5B6IA 1SEPA 5KYVA 1C7IA 2O57A 3R5KA 2JFBA 2ZAYA 4D9KA 2WAXA 5I3ZA 4L5CA 4MWDA 3LG2A 2QSJA 4Y18A 2O48X 3MWGA 4RZ2A 2RJNA 4WE3A 1NW6A 2H4ZA 2VIIA 2WYOA 3OX3A 3D1LA 3BPSA 3O6VA 3LDAA 4MA5A 2OPHA 5KIAA 4AKGA 1EDOA 4G0MA 3PB3A 3HA7A 4MUMA 2CC2A 3JYPA 1A27A 5IM4F 3D6VA 3ZVNA 3KJHA 2VHZA 3C39A 3INRA 2H7VA 3MVEA 4MQ4A 4QOSA 4PAOA 2YC4C 4HV4A 2FY8A 4KO2S 1E9DA 5CRIA 4TXHA 5KYTA 5ADHA 4L28A 2Y1XA 5TE9A 5HUHA 4KR2A 2DVMA 2H2GA 1NNLA 1EVKA 4U63A 3DAOA 3PC8C 4ZK6A 1R4AA 3NHYA 1PR1A 1TNDA 3GYBA 1GTG1 2B3DA 3WLFA 2OYRA 2VOJA 1NRWA 3SF8B 1TVKA 1J9GA 1SPXA 1TYZA 3ETJA 4FMPA 3GN2A 4IZOA 1KXJA 4TTVA 3RS8A 1VA5A 3ET4A 2I3AA 4F8EA 4YXFA 4PX9A 5I7EA 4NBRA 1B43A 1RJGA 2P5SA 3FETA 3IKLA 3NORA 1GYQA 4ND8A 3JQ9C 3OBIA 4D9EA 3QE4A 3NAMA 2RGNA 2VHWA 2BFNA 3D7NA 3NX4A 1QORA 2VRWA 4NOJA 4Z7JA 5I3CA 3OZSA 5FUVA 3PFGA 4MULA 2WD9A 3WGKA 2MSLA 5K0TA 2WRZA 1NDHA 4XIIA 2JAUA 2O14A 4ZIRA 2D4HA 4PG5A 3B8HA 4FNAA 5COQA 4DUYB 3N76A 1DZ3A 5ITSA 4WL0A 2ORIA 5FR1A 1ZO8A 4MMXB 2ATIA 1RZRA 2XIQA 1E98A 1KPIA 4L0QA 2H1SA 2RCYA 1EAYA 5J9FA 1KWGA 1YNOA 3KQUA 2R7AA 1J0XO 1FDRA 1GCGA 5EWMB 2BBSA 4OP3A 1ENZA 2E3JA 1RM5A 4E2XA 3Q2KA 2IYTA 5CX1B 3L1HA 1WB6A 2FN3A 1Q12A 4KN9S 3ZW9A 3QKSB 4HVLA 4P6VF 3DV0A 3CW8X 2CNWA 3BWXA 2QE6A 3K0SA 4WMLA 5A5GA 4MB0A 4B6QA 3T1QA 2FSVA 2BR3A 2GH1A 2IU0A 3WGVA 2BDTA 2OFWA 3NIGB 1WQ3A 1AIPA 4TQ9A 1QONA 4P82A 2XF8A 4AO6A 2NO5A 3N2YA 1V1MA 3TI7A 2WA1A 4LSGA 3TW6A 5BWMA 3H1PA 5TJHA 3VSDA 3VPBA 3C5VA 1ZPDA 1WD5A 1P2SA 3M33A 4J1QA 3NJ4A 3K9BA 4FHGA 4CW7A 4RK5A 5J43A 2JBAA 3A7EA 5HXAA 1EJ2A 3OCCA 1JH8A 3PF9A 2DM6A 1HT0A 4L8GA 3DE2X 3W4KA 4RDXA 2CBGA 3F8TA 4WCVA 1U28C 3ORFA 1B6GA 1P19A 2GJ8A 1WUJS 2D59A 4LOHA 3UAOA 5M29A 3JVDA 3ADDA 4WVLA 4MQFB 1SNYA 4X7RA 5JVDB 1R5NA 1QWOA 2GF0A 1L4UA 4JJGA 1IN7A 1H94A 1KDTA 1UC4B 1PDVA 3UMCA 4JGGA 3PNOA 1NSFA 3C15C 3CW9A 4JELA 3VV2A 1K9VF 4LECA 2DF8A 4ZHQF 5EJ8A 3BULA 4BQOA 4DIDA 1XXHB 3RC8A 3F98A 2R1ZA 1CUEA 2WJVA 1K7YA 5K0GA 1NP6A 1DO8A 4EA7A 3JQ8A 3JRNA 4QOFA 2OBMA 4B31A 1Y8CA 3T5CA 4CGZA 4NV0A 4OIFA 3EGWA 1C9JA 2GEKA 3SN6A 4CFZA 3LQ1A 1YO6A 5BUSA 1M5RA 4QJ5A 2X14A 1UAAA 4Q1BA 5LL6P 3K1ZA 3WMEA 4XD7A 4N39A 3I61A 3ABZA 1UKZA 1O0CA 4V2UA 2A0XA 1A4UA 3C24A 3VO9A 3SIXA 2OO5A 3KTOA 4CMAA 4R2JA 3O7MA 3IUMA 5K3FA 2Q6VA 1KY2A 3QLTA 2QA5A 3B1VA 1FX0A 3RC7A 2R6DA 3L01A 1IXYA 4PHCA 5IJZA 2VNKA 4KYIB 2DBVO 2GSWA 4H7KA 2D7JA 2V98A 4M8NE 1FTNA 2WF9A 1XVAA 1BX1A 1E66A 5T4FA 4TTPA 3R40A 3TCXB 3TFOA 2HK7A 3CH7A 3P9XA 5K0CA 2WTUA 2CVPA 3QF7A 4EB0A 4RZSA 1DARA 1XP5A 2QGFA 5AW7A 4G5RA 3REOA 1KP3A 2VNIA 1ZEMA 5CDFA 3TTSA 5LQJA 3LLCA 2I76A 1CE8A 4WY8A 1XCGB 3ZV7A 4YJ2A 4BQFA 3RARA 4FC6A 1K7SN 4MGYR 3UUWA 4BFZA 1SN7A 1U8EA 3AKYA 3D4IA 1KI4A 3DMTC 1F6WA 4TS1A 3TQFA 4DB4A 1KYVA 2CUZA 2EKBA 2BHSA 3AM3A 2QAIA 3QVGB 2CVOA 5LQSA 2DFVA 1QJ4A 1V8PA 1HL7A 3CV3A 4V03A 4AS2A 3CLUD 4V0ME 4L4SA 4U8HA 4TLDA 2GILA 2H54A 3H1FA 5GINE 1LPNA 1QANA 2A0YA 4MUKA 3U1TA 3MTJA 1FLNA 2Z30A 1L7MA 5ED4A 1Z62A 2R44A 1HEYA 2WYWA 3GDGA 3H4TA 5CT8A 4PLYA 4WK2B 4PAMA 4X41A 4AROA 3OU6A 2BKLA 4O2AA 1JHUA 3I32A 4EB8A 3QUSA 1VMDA 1N0HA 1P1HA 4O4LB 1H1LB 4XWKA 1Q0LA 3UUEA 3BMOB 3FGOA 2EYUA 2DBQA 1OWNA 2HIHA 3D3QA 2R6FA 3PQDA 2X9QA 5TF4A 1OX4A 5TEVA 1ZN8A 2YHUA 3GGJA 1Q50A 4HXGA 2HYIC 5DNUA 3W2GA 1DKQA 4HN2A 5MN6A 4Z9FA 5JSQA 1FX0B 5EP3A 1GL3A 1W59A 1PVOA 1PGQA 3RYHB 3B78A 4JLVA 1NLZA 4GO1A 4JLJA 4Y9TA 3JTEA 1FRFS 1JPVA 3R7DA 2FRVA 3MLEA 2X0EA 3AF3A 4JBGA 5I5GA 5TF0A 1X2BA 3LDFA 3PQ5A 3PQ3A 3T5TA 1A9RA 2WJIA 4FOSA 3EZ7A 3GVXA 3TUJC 5K0EA 3F4KA 3R9IA 1YZVA 3ASUA 4MGHA 3BBPA 4XXHA 2WJPA 4ZEXA 1YOVB 2VZ0A 4RTRA 4A73A 3BCRA 1G19A 2OHGA 4WSOA 1H6BA 3UIEA 3H8SA 2ZUBA 5A3SA 1PFWA 1ZM7A 2GZMA 1BSVA 4ZOLA 1IQ0A 1FYDA 4J0IA 5HHTA 3P8ZA 1LU9A 1QR2A 1QLJA 4LNAA 3B5JA 3I2IA 4NKRA 5IXYA 4DR4B 3RBZA 4CTKA 4XQ0A 4LYJA 1RPZA 1QKJA 3RU3A 3KQVA 2AWNA 3E61A 1LS6A 3WGUA 1E4YA 5AW6A 3OQVA 4DCTA 1KAGA 1Z28A 1PIWA 2ZEJA 2EZ4A 2ZWPA 1G66A 4UZSA 1XMJA 4BAUA 4YMIA 4IH9A 2WIAA 3V4SA 4G9BA 1WRBA 4LC0A 1FEZA 4R8MA 2Y1WA 2FN8A 2GRUA 5E9WA 4FYVA 4E08A 3WJ7A 3LLMA 3HYNA 4GHWA 3KXLA 3MBOA 4LJKA 4NK4A 1PD0A 4JLAA 2V97A 3GARA 4TT8A 1F51E 3VR4A 4EOGA 4Q3AA 1IEVA 4AU1A 3PWKA 1DV1A 4OQ4A 2HRRA 1MPTA 2ZJZA 3IKJA 5HIKA 5JDIC 4UMEA 4TS4A 4F72A 2BKAA 5I45A 2IH2A 4TX1A 3GEBA 3IHKA 3M6VA 1L4HA 3MHTA 2OR3A 1X86B 4M0EA 4GGMX 1YQEA 2HNKA 3JQQA 4KR7A 2OZLA 3FX2A 2PZEA 4MW0A 7MDHA 1N1EA 5CDYA 4BIIA 1NXOA 4F4HA 4JSRA 2AEFA 2C3YA 1UJCA 3DBLB 4QELA 3H1AA 5EG5A 1X1CA 1Z15A 5DWVA 4ARSA 2CJFA 3VYSB 3SXPA 1KDPA 1EWTA 4LY3A 4YO7A 5HEKA 2AJCA 1QGDA 3ENNA 4X6YA 1TRKA 2REBA 3WWEA 1KL7A 1W19A 5EL0A 4RA9B 1R0YA 5EMJA 1D7AA 1L5WA 4BZPA 2FP4B 3A6HA 5UKDA 1Z47A 1ZJJA 2NPFA 3UMVA 4WDRA 1M75A 3R76A 3CVUA 2CLKB 3D8SA 3ESQA 1CQXA 4KRXA 2IY8A 2XNCA 5A2GA 5JPCA 1UBMS 2F1KA 3WLIA 1PR2A 3A3YA 2BM0A 4MJ3A 4OQQA 1PKXA 4GDFA 2VFAA 4O8CA 4HFMA 2D54A 3MWDB 2CYBA 2WAAA 2PRSA 4HSEA 4YT4A 1LEHA 4P84A 3TZKA 4QZVA 3EPLA 4BLVA 4MPJA 2XXBA 2JZNA 3ICOA 2QRLA 3BD7A 1FXUA 2ZSUA 3GAZA 3TZQA 2F4NA 1WULS 3INYA 1J00A 1XYGA 4DLUA 4GDMA 4HXEB 4MGIR 2AYYA 1RRVA 2WJHA 5JECA 3N0VA 4ZMSA 2BMEA 4Y3UA 2ZR7A 2FB9A 2MHCA 5C18A 2VTEA 3QNWA 3IURA 4XE5A 1VL0A 2QTGA 3GLGA 1GRQA 4K9DA 4KU4A 2ASVA 4E70A 1V2HE 1CULC 721PA 1D09A 3DR5A 1CQIB 4M1EA 1I24A 1WDTA 3UAXA 3VU8A 5D5PA 2NSHA 1LLDA 1XD2B 2ZWAA 4RMGA 4WEOA 1U1FA 4OHBA 1GAXA 4CMEC 3NBYC 2R65A 4HAYA 3ZVKA 3L7CA 1C8KA 5KKAA 2O2XA 1XGKA 3O4HA 3MS2A 4YDQA 2H9AA 4K3UA 2C5FA 5ABPA 1BDJA 3KVOA 3FBWA 4NYIR 2E5LB 3OQ6A 1L7PA 4HUQA 2GJ4A 2YWFA 3Q1LA 4DJFC 2V7GA 3LKBA 1DRJA 2AR7A 2V4UA 3SF8A 5I7FA 3MCTA 5K0LA 2QZZA 3KL4A 1Z4IA 3P9QA 4GYJA 4EGQA 1IM2A 1U2ZA 1CUZA 1SBIA 2NWQA 3CLSC 1JLMA 3Q8XB 3EXG2 3O3MB 2IUEA 4MGKR 1Z0SA 1AGXA 2JIOA 3F3YA 3P9YA 2M6KA 4DCNA 2JRCA 2DQYA 5CX1A 5C1OA 1KOFA 4O2RA 1BDMA 4C43A 3OFNA 2J6IA 3Q12A 4ZJUA 1P5FA 1CETA 1DKOA 2P41A 4U02A 1RLTA 4P3PA 3EC1A 5ALXA 4ZIRB 1C0IA 1CY8A 1JJFA 2ZSDA 3QBDA 1NUHA 4NCNA 4RY8A 4DC1A 1NG1A 1O9HA 4E15A 3L84A 1JG7A 3DC7A 4Q66C 1DIBA 3FDJA 3RVQA 2EARA 2SICE 1OGYA 3RS0A 4AYXA 1CQPA 1JI0A 1JB1A 3C4VA 3IESA 2DHRA 1VGVA 1RADA 2DJIA 4TRJA 4OHZA 5KYUB 4KTTE 1U7ZA 4PYNA 1NPTO 1TK3A 1ZMOA 2HADA 3H9UA 1VYHA 3LUGA 1J99A 1XLTC 2AFIE 5EJFA 4BBAA 4B71A 3GT3A 4MWCA 3T06B 4DCJA 4QM7A 1NTOA 4X7PA 4A0HA 2PRKA 3KHTA 4HFJA 3AUXA 5K2MA 5DHFA 1NQUA 1HV8A 5FRDA 3LBAA 3QYAA 2QPOA 1ADCA 3IALA 3TRFA 3GAFA 4GMXA 4TKMA 4Z86A 5IC6A 4E1AA 1K6EA 3GV0A 1ZN9A 2I91A 3K4QA 2W2OA 1DKUA 4OQLA 1IB0A 3NGXA 5GM1A 3ORQA 1N5JA 3QUQA 2G7ZA 3QW2A 3KQYA 2VDUE 2HFKA 5A6SB 1JV2B 2VNHA 3TPCA 4AMUA 1EFVA 1EJ6A 1HDRA 3EVFA 2CJWA 4N7RA 4YCDA 4DT1B 5KYYB 2FWIA 3ZWXA 2BY4A 2RHBA 5IARA 2XITA 4KFCA 4G0VA 2RHWA 4GNKA 2V3WA 3DF7A 3EVDA 4X91A 2ZT7A 2W2XA 1ZLXA 1YQTA 1PL7A 1M2KA 5HK9A 4N5DA 2OHXA 1KJNA 4G4JA 2I87A 5F9FA 1OYVA 4F9TA 3TX2A 1E3EA 4M46A 2ZRQA 1JFLA 1LFDB 2COEA 2Q1TA 3D4LA 4LK3A 3HBLA 3QX3A 2YVQA 4JKIA 3UC5A 4MA4A 3ZBPA 3R6DA 2IYYA 3NNSA 4GF5A 4C0WA 1CDZA 1XQVA 1SHUX 3JD4A 4XGKA 1F12A 2ZETA 1JIXA 3OZVA 4OJTA 4XR9A 4B3BA 2A1IA 5HUJA 5LQNA 1I36A 3EIHA 1SJ9A 2IHNA 2WWWA 3JQ7A 2FPMA 4NFHA 5CT6A 4E33A 3THOA 1T5OA 4EYSA 1BNCA 2XCLA 3JASA 1TM7E 4AULA 2BCEA 3PR2B 1M2JA 2B99A 2OHIA 1XMQB 2OBBA 1FS6A 3T61A 3ADKA 2QY6A 4F4DA 1KI6A 4I5FA 2XD9A 4ZVRA 2ANCA 4IDBA 3DMFA 3IIKA 2XW6A 4ZARA 1PGOA 3LLVA 3DR3A 3HU5A 2IE8A 3PYMA 1FCJA 1CCWA 2V55B 3OZ7A 3PDJA 1TT5A 4UE3S 4D4IA 1JEJA 4MAMA 5D3ZA 3H84A 4ZI2A 3PQEA 2ZIAA 4FZ5A 3VH2A 1GZDA 2CDCA 3H2BA 4OEHA 4DIEA 4UVDA 2XD4A 3EXIA 4PAQA 5LKRA 1PJ2A 2G83A 2W9XA 3L9WA 5H3LA 4ZRDA 1VJDA 2IP2A 2Z8XA 1U7XA 3OPYI 1W5SA 1BJTA 1IOLA 5AW3A 1DOZA 1V71A 2QIPA 2YZMA 3NBQA 4NCXA 1LA2A 4QUGA 5BVHA 2GUWA 3M6FA 3PFIA 3VPDA 5K7SA 1ZW6A 1A7JA 1QHNA 2H5JA 3GRFA 4GVLA 3CW2A 3EQ2A 1V48A 3JWPA 4F4CA 3VUFA 1PR3A 1VM6A 5JO9A 1R8SA 2CL6X 1KVUA 2RSLA 5ULLA 1JLSA 1WBDA 4LX0A 4KK4A 1L8AA 3SEQA 1TX4B 3VR5A 2CFIA 4HTAA 3TW8B 1GPDG 3O9MA 4LYFA 4JUFA 3PJDA 1DEHA 2JDIA 1K8ZB 3FTNA 1N75A 4EJSB 4NFSA 2VO1A 1UM9B 1GAWA 3SNHA 2YY7A 5C4IA 4C04A 3VA7A 2CGEA 2O3QA 3GWGA 4HQKA 1NPDA 4KK3A 1F38A 5H9VA 5IEJA 5HGJA 4AKIA 1IEWA 2MYTA 3FWZA 2PD4A 3MMPA 4N1AA 4TMTA 3TEJA 4OXRA 4D8TA 1TJ3A 5FWXA 1OHHA 2RIRA 1RWBA 2MOKA 3H86A 4KFUA 2P0AA 4E5SA 2Q2VA 4DLZA 4CDNA 2C5AA 2C4NA 3RYHA 4DMRA 1U0FA 5B2EA 5BNZA 4OFBA 1KETA 2SHKA 4GFDA 3K1AB 4JLDA 2REOA 2XGMA 4JP5A 4Z2YA 1C8VB 1W49A 4DC0A 4DG5A 3QLEA 1BA2A 1XHFA 2IF2A 1ESZA 1NVBA 3LGAA 2VAMA 2CSUA 4G2TA 1PFYA 4M1MA 5AJZA 1MBZA 5DHUA 4Z9AA 3EH1A 4WZZA 3UV3A 1J49A 4ARCA 1A2QA 3IDOA 3ZI7A 3DOJA 4H15A 2J7PA 4UFPA 3ZK9A 3LM8A 3DWGA 2O7SA 4YLYA 2NX2A 3AHEA 1FSGA 2NQ2C 2ONYA 2QVLA 3L7AA 4JX8A 4X71A 1E6UA 3ZWVA 4E5UA 4QD3A 2PIDA 3U19A 2CD9A 1Z6PA 4Q7MB 4RTPA 2JI4A 4OBBA 1Z26A 2P1DA 3NHRA 4IL5A 2RKWA 3AZPA 3MJSA 3ROFA 5DT2A 5BSVA 2BFOA 5J2TF 5LN1A 2GQ0A 3V97A 1Z5WA 1BXGB 2VRCA 4FYXA 1KF0A 4BN5A 2ZROA 1QAOA 4YAGA 5HZHA 2G4CA 3IUEA 1LPMA 1PZXA 4TYPA 3TVTA 3BH0A 1NQXA 2AE2A 2IJGX 3ISJA 4DKJA 1IZ0A 2DWOA 2RC5A 3UMMA 2C8KA 1HEUA 1ISMA 2ATVA 5AM5A 2HIAA 3RS9A 4WVFA 3FUXA 1ELOA 2OAGA 1T5DX 5C80A 2ZJ4A 2P9YA 3X2EA 1G7CA 2Q5LA 2D3TA 4KQEA 1G7TA 4PG7A 3U3XA 2M1XA 1N57A 4N3AA 4JQOA 1BE0A 2WIKA 3GA0A 1YVUA 1GQOA 1XQWA 1NE2A 4UEWA 4IVQA 5KYWB 3PVSA 1O89A 1GUAA 4JJ7A 1E2BA 5H59A 1U31A 3YASA 2O1WA 3L6RA 3I1IA 3LXUX 3DKVA 3L7KA 2DE0X 4BO9A 5E0KB 4NBNA 5CFLA 2VJQA 5AJTA 2X4LA 2LDXA 2WM9B 4KB5A 4UAUA 3STXA 3J81A 2P2LA 4CU5A 4GM0A 4IO1A 1QP0A 4HATA 1YT5A 1C9YA 1JXAA 4RBNA 1WMSA 3F1KA 3A3OA 3GHYA 1E96A 2DPXA 3BGVA 3FHTA 1M1YB 5JXHA 4EVSA 1E64A 3G0HA 4IQFA 2XZLA 5DLEA 1MRNA 1PFQA 3B70A 1I7LA 1T8RA 2H2IA 2IUTA 4WESB 4FMCB 1BJKA 1FTWA 4XGRA 1ZM2A 1I2AA 3T7AA 1E1QA 1N33B 3QLJA 3QEKA 1WW3A 5DSTA 3ZLJA 2AKEA 2Y6UA 1YE3A 1NMEA 2HI0A 5I4BA 1KVQA 1E0DA 1L7NA 3JQEA 3K2BA 3R6TA 5TMPA 4TQGA 2J9FA 3CYFA 4NCBA 2YJNA 1Y82A 2WU8A 3OE4A 1KH3A 2CVQA 2QMUA 1E92A 2LUOA 4YQZA 5DCWA 1P1FA 3AT1A 1Y7LA 4JUDX 1CNFA 2OPBA 3CRMA 3GEHA 4ZOCA 4ZI7B 1DMRA 3AR8A 5JW6A 2QD1A 2VK2A 3EQZA 3U4IA 4KDCA 1DSSG 3SZMA 5HRUA 3U7FB 2X0KA 3TBHA 1FP4B 1E32A 4FSXA 3VVLA 3C74A 3S3TA 4CLXA 5KMGB 3E1GA 2BTEA 2RG1A 5BT9A 1E7RA 1UWKA 2C5BA 3UWPA 2ZXUA 4MUFA 2O23A 2ST1A 2BGWA 4XD2A 1M67A 5FFFA 1A69A 2IIBA 5M34A 3TRIA 2O8NA 1INLA 4KAXA 5CDTA 4EG7A 5BSGA 5JHHB 1VJ1A 1T9HA 1I3NA 4N54A 5E9JA 5L9AA 4DM3A 3FMFA 5L3VA 4UFOA 3RVMA 4LOKA 3C3MA 3F5DA 2CLHB 2GJ9A 2J67A 3QXCA 3HC7A 3NC1C 4MA0A 5TS3A 4P1ZA 2RI1A 1P44A 1X1SA 1NFQA 2OXRA 2J87A 3NTVA 4KNVA 4BECA 2CJPA 4OTZA 1KAMA 2B92A 3H2GA 3PFHA 4NPCA 1BDBA 4OQYA 1KEZA 3NHFA 4ARZB 5E3IA 5EIAA 1UBSB 1PNOA 2GETA 2GN2A 1FQKA 3TLXA 4GH5A 1HM5A 3QGMA 3QU2A 3ZY2A 3CRZA 4DRXB 2AG5A 4PO9A 1AMNA 3ER8A 4HNVA 3QVSA 5B4TA 4H4DA 1MHTA 1VGRA 4WCFB 2OZLB 4JBWA 2GAOA 2WW8A 4G2NA 5K3BA 3OTQA 2COKA 3HB1A 3NM6B 3GD7A 1T13A 4YP9A 1TQHA 1ZCBA 1ISHA 4MV6A 2DCUA 2VP9A 3TLBA 4AJ4A 4TM8A 1NPYA 1SVIA 5ICGA 3WGZA 5KYKA 2QP4A 3C1UA 1BQEA 5DGTA 4EHBA 4D97A 3RWMB 3DM9B 3ESBA 4RF4A 3VR1A 4ZMBA 5HYVA 5JH7F 3WOVA 4KUHA 2ZXEA 2FP4A 3ZI4A 4W9NC 3QITA 4BZWA 4LWPA 1S0UA 2GZAA 1IU9A 4CG3A 5HKBA 1NU8A 1NT2A 5HF6A 1UJ5A 3QVLA 1Z08A 1UWCA 2ZRPA 3EIXA 5CPFA 3ELWA 1E4VA 1GIAA 4HPJB 3MLBA 3KLOA 1A77A 4W99A 1C8BA 5DCLA 3SSNA 1CY4A 3WA7A 1NQVA 3GP5A 3HKEA 1SC3A 4UDYX 4O02B 1XU4A 2BMAA 4RPCA 4JXZA 5FOQA 4KXNA 1UEXC 1E3SA 1BOFA 2MSWA 3RUDA 5FOVA 3ULKA 1A98A 3V1KA 3RK4A 4G0XA 4MI3A 4YDHB 4R7TA 3WMFA 1FFBA 4Z0PA 4KPEC 4YAUA 2P9ZA 2W2NA 2GEFA 4WXEA 2FETA 4JDPA 5TVGA 1IXKA 1SWWA 2ODBA 3BFJA 5F9MA 1NVDA 2CXNA 1H0HA 3KJQA 1B0ZA 1PR6A 1LQ2A 3UXHA 4QXOA 3SDBA 1L7OA 1QVAA 1MB9A 3NP7A 4PQFA 4S04A 4N5HX 3R3ZA 2PKRA 4YS6A 3U7RA 1OI3A 3LRXA 2IY9A 4JL8A 1WY5A 5LNK1 3DB1A 1CRLA 1XO1A 4ZC8A 1ZH0A 1YU9A 1AHIA 1VL2A 2X2FA 4RO0A 2NV0A 5MGBA 2C42A 1K4KA 1NBHA 1CYEA 3I01A 3Q3CA 4KUEA 4Y7CA 5BW8A 3HFRA 3KHUA 4YJKA 3ZWNA 3IB6A 4DMCA 4FW9A 5IFLA 1IJFA 3AL2A 3HXMA 4YP1A 3GLTA 5CUQA 2VYCA 2JFFA 4KDEA 4COOA 4X65B 4WNIA 3WYGA 4XTRA 4XDYA 1EDEA 4B6OA 3DV0B 3EAFA 4ZICA 4JH0A 1JE1A 5FWXB 1RWQA 2Z98A 3N59A 3B20A 1IJEA 4QREA 4RAQA 3HU3A 2HW8A 1M83A 3M6MD 4YAFA 1H2RS 4M76B 1J2TA 3L79A 2BLLA 4CGYA 4A26A 1IATA 1E7WA 1ZWKA 4IO0A 1NX9A 4U7WA 4E94A 1UPXA 4YJFA 2OCYC 1BDIA 2R97A 1PT8A 1GZHB 3JYNA 2I4MA 3JR3A 3UHPA 2OD2A 1Z39A 4JR2A 3R8FA 2R25B 1C1XA 3PRKE 5LMNB 1F20A 3AI2A 4B6EA 1NBMA 1ORRA 3DDOA 4I6JA 1PS8A 4N0MA 3GJTA 4R3NA 4AO8A 5ETJA 4R9NA 4BDSA 1WNTA 1TB4A 4QARA 1RXVA 2AFIA 2FSUA 1KO8A 4DRYA 4OQXA 5HKOA 3CRRA 4DE5A 3BK2A 4N82A 2FUKA 2JJMA 3IJEB 3BTSA 4BO6A 4TL7A 2OFXA 3ZNNA 4PYIA 5AFSA 5KUTA 3OHPA 4IJKA 5BVHB 4YNBA 1RTKA 3NTQA 4QGBA 3NBKA 1Q3HA 4INPA 1XKXA 2AW5A 4LJSA 4OXQA 4BB5A 3OEHA 2HU2A 2PS9A 5CLHA 4ABYA 2WAMA 3TFQA 3GPDG 4JOSA 3Q8LA 3AI1A 2OLKA 3PX3A 4IDNA 1EXDA 4CMJA 1UPBA 4PYQA 1W85A 1Z8FA 1P7CA 2H9YA 2D0PB 2E6UX 2CV2A 4BKQA 3OM0A 3P97A 3MRVA 1L7VC 4RJKA 3VPAA 2O8BA 1VE1A 3DL2A 5CGZA 2R8YA 3MJFA 3PPVA 3GPLA 1OTYA 2WMOB 4QOIA 1I7DA 2VEOA 4OA8A 4HB3A 3DTTA 3VPXA 4N5NA 3JD2A 1T4MA 3T0IA 1GFZA 1V3UA 1QHYA 5JPDA 3HZHA 5KX5F 3G6WA 3O0TA 3BK1A 1A8HA 3MSXA 1AMUA 1L9XA 1W1UA 3SLGA 1OJLA 3FKSD 3NPMA 4GKJB 4ZO8A 1Q7CA 5EIHA 5JE8A 1QHFA 1EGMB 2VQDA 3E18A 3E81A 1MNAA 3DNFA 1E4EB 2ZJ6A 1RSZA 3TAXA 4ZKDA 4OHMA 1HFEL 1SXJC 1GEGA 3FPCA 4DEVA 4F93B 1MOSA 4OCZA 1HBJA 4OLHA 4C7XA 4NECA 5B2FA 5K2OA 1EJBA 1XZQA 1KJYA 1G42A 4KOAA 2C7VA 3Q72A 4TZ0A 2GCNA 1M2VB 2Q1XA 3F6YA 3CTMA 4XR4A 1XAHA 1DFHA 3DVAA 2P4SA 4G81A 3SXJA 3VPHA 3ZUPA 4EZEA 4ZT4A 4KQGA 4B40A 5LQDA 1GQFA 4LJ4A 4G0OA 4C5BA 4E22A 1S2OA 1TA4A 2I4LA 3FWPA 1T4CB 1XMPA 3WISA 4Z1OA 1ZN7A 1LQUA 2IPXA 1SOAA 2XUJA 3OLQA 4FD3A 5IUNC 2VJKA 1PR5A 3M4YA 4LJAA 2IHJA 1MX3A 3DBHB 5JASA 4X61A 4JC4A 1HNNA 2JBWA 4KG7A 2GZ2A 2G04A 1C81A 2ZBDA 4WKOA 4XUDA 1GUZA 1TECE 1ECGA 3L7IA 1W0KD 3QEOA 4P7KA 3CMCO 3BICA 1JXQA 1MJGM 4HHEA 3IL2A 1UIRA 2P4UA 1DC5A 1N9KA 2XYQA 3BC1A 2R2GA 4GQAA 5JCJA 3VVBA 4AL4A 4F2HA 1ECFA 2F3TA 4AG5A 2GM5A 4YA6A 2XI4A 2DULA 4N4AA 1YFLA 3PXUA 2PFGA 3U31A 5K3EA 1LBTA 4D98A 3I9LA 1I4DD 2GZ3A 1CP3A 2PUDA 1TVMA 5JIBA 2B2XA 4P5PA 3UXMA 5SY9A 3SWWA 3KZNA 4LOJA 2FGJA 1K8YB 5A0TA 3V48A 2HCTA 1XTIA 3GGDA 3BXPA 2Z2IA 2ZSEA 3MCAA 5EC8A 3QRWA 3U44A 1Z2PX 1JIQA 5K6AC 5C1DA 9GPBA 4K2HA 4S1OA 1AZWA 2RGCA 3OWHA 4MIOA 4M3NA 4PW0A 5AHWA 1BGWA 3Q7SA 3W8FA 2B4TO 2HLNA 4OO3A 1R0LA 3AKEA 4XQGA 3QHQA 4JLOA 5JNSA 3HCOA 3LBYA 4QL3A 4YWJA 3ZQKA 2J4CA 1GGHA 1WVIA 3JQ9A 3VJMA 2DXIA 1T2AA 4IIJB 1EIWA 3W2EA 3HA3A 4INAA 5ILGA 4GXTA 2PBLA 3P45A 1IWOA 3RUFA 3FJYA 1NN3A 1QHSA 3AIIA 2OCDA 4YH1A 3QFSA 2XSZA 3H4VA 2Y1DA 2ID9A 2IHUA 2E5FA 3L8MA 1I0ZA 3VHQA 2BONA 2OC9A 2P78A 2JIZD 3FNHA 3PNBA 4HO1X 2VHVA 4H3KB 3T3GA 3ZIUA 3VKHA 2C04A 3BA6A 5B4VA 3BVPA 5I9IA 4ZJZA 3Q6NA 2Q8QA 1IBCA 2EDCA 4WA7A 1XN1A 5JSKA 1XDUA 3HB4X 2ZJ8A 4DPKA 5EUMA 4ZOBA 4B3DA 1M73E 3CUTA 4L1KA 3LZCA 4N3CA 3AESA 1IWBB 3LNTA 3GGOA 5DGIA 5U4QA 2R85A 4KRFA 1AXGA 3PR3A 4QX6A 3IAM1 2QTVA 3QXGA 4XI9A 3NDPA 1U9YA 1VE7A 2QPAA 4OG2A 3SAJA 3PUIA 2QENA 5BSWA 2VBIA 3NYWA 1LSOA 1WMAA 4Z4GA 4KIUA 3U7JA 3GJ4A 2PZBA 4P34A 1M1XB 3I2JA 5MF6A 4K1LA 3MILA 4RWEA 1ZZGA 5T4BA 4QG3A 3UMJA 4DLXA 1Q17A 3EEFA 2Q45A 1USUA 2WPNA 2PUGA 3M3PA 1YVEI 1N6PA 3V5NA 1FMFA 4FM9A 5EHIA 2FUCA 3FOCA 4JAVC 1SB9A 2I62A 4RK1A 1XEXA 4DV3B 5ESWA 1WB4A 3JRWA 5U9CA 4BNZA 4MLCA 3B52X 4AB1A 3BA1A 4BP9A 4NE9A 1V47A 3DUFB 3TQSA 3DD5A 5A5FA 2RH8A 3WKBA 2QN3A 4Y0NA 1G7SA 1WVMA 3AQ4A 5MDHA 3A1CA 4HDCA 3UFXA 2BEUB 4FHZA 2I3BA 3C0KA 4E7PA 2TMDA 1K7CA 2B8WA 1M8JA 4UM9D 4HZGA 4URUR 2CCGA 3FFBA 4FI3C 1XZKA 5K09A 1KK1A 4CNBA 4JJIA 3EGDB 3LTEA 3OM1A 2EIHA 1R0WA 3L2OB 4ZVSA 1OBHA 2PRYA 1NKSA 2QQ5A 4BNYA 2IA5A 2VTVA 4IDQA 1YAHA 2VJBA 4GPEA 4ALMA 2CFRA 1AUPA 3W5HA 5C7YA 3EF0A 1G3UA 4NZPA 2EP5A 1ODCA 2J5BA 3L18A 4KBFA 4LI0A 3B8EA 1QV6A 5EE1A 4BATA 2BGNA 2XMQA 3FNBA 1FTGA 1MPXA 1JNXX 1FSZA 3DXFA 4DARA 1XDSA 1TCVA 1J33A 2CDNA 4N0EA 5KOIA 4URVR 3MUOA 3MUNA 1UAYA 1A1VA 5CH3A 5TB5A 4RK6A 4Q7JB 5LJLA 3FAKA 1J2JA 1EKXA 3CE6A 3VR4H 1E1NA 3IRVA 5GV8A 1WU7A 1H8ED 1TO1E 4K6HA 2QRJA 2YUTA 1PFKA 1DIOB 1BWQA 2AMVA 1DC8A 3OFJA 3C3JA 5IZ4A 1RPJA 1V11A 3D7SA 3VGJA 3G9TA 1FXWA 2MWMA 4XYEA 2YN2A 3QPVA 2DMRA 2BV3A 2ODPA 2GTHA 1RXUA 2I6GA 1P1JA 3KR1A 4GR4A 4IM7A 1V4BA 5IW8A 2HDOA 2OCBA 2FPPA 1YCDA 2R47A 3FWYA 4RUKA 5DGXA 4OMFG 1FE8A 1OXUA 1FP4A 2NACA 2Q7XA 3DBVO 1U3VA 2F90A 2ZYAA 4MGZR 3UWMA 1MP0A 4ZXPA 1WSWA 2Z8YA 1EX9A 5EMHA 2HWYA 4FS3A 3NGMA 4NV3A 2WKSA 3NRCA 3OM9A 3VVMA 1GQ2A 4EY7A 5JJBA 2XOEA 3SC2A 1NYQA 4WV3A 1ABBA 4O1HA 1LKZA 4MRAA 3NBFA 4NH4A 4C21A 5KREA 4JVMA 1GPBA 3IHTA 4BV2A 3PCXA 4O4LF 1KO1A 1FDOA 1XE3A 4JFAA 4YGYA 4A6EA 4F6RA 3GLGE 3MLAA 2Z58A 3VI3B 4KN5A 2VK8A 3TQTA 3EQ8A 3WIVA 4F5YA 3AOEA 4DTIA 3NCTA 1QU3A 2BFPA 3A9SA 2G28A 3TLAA 3CLRC 2OAEA 3C85A 4IIFA 2CFTA 3JVUA 2DGDA 5CA1B 1G8MA 1YU6A 1XHEA 1IXSB 2F59A 3EXHB 3QTBA 1SKYE 3IBFA 4X1KA 1JBEA 3WK9A 2WQ6A 4HAIA 1GL6A 1RQ7A 1CUBA 3DBLA 1R9JA 4W7SA 1W88A 1GRRA 2JHGA 3IEMA 1U5CA 1Z0KA 1CUCA 3RRXA 3TGLA 1Z6TA 3ISTA 3R75A 3OZXA 5LB2A 4I4TA 4DRXA 2NSYA 1FYEA 2IPNA 5CVJA 2N46A 2BFAA 3LRPA 3SI7A 1ZUWA 4D9IA 3FUUA 1GU0A 3FHCB 4X6XA 1Q3KA 4XUGB 1TU3A 2LCFA 5H02A 1I9GA 4H7FA 3ETGA 4ML3A 2Y71A 1U7HA 3OEWA 3QLUA 4W8HA 5G3YA 3LO8A 3F6RA 3K5IA 5FA5A 4Q0MA 3JZFA 4ZVUA 5IAEA 5BWNA 4KXFB 1XJ0A 1TIKA 3AUAA 1A0OA 1DKPA 4JUAA 1UKYA 1IAVA 3L06A 4WESA 5HM6A 1E0AA 5T57A 2HSDA 4KXMA 4ZDWA 4M9XA 2AZMA 4L5IA 1YKGA 4JGBA 1AV7A 1NASA 5E8JA 2F4VB 2YC2C 4PRZA 2PSSA 4B81A 1DB3A 2HLHA 2AUMA 5KSYA 1FP6A 4TXNA 2C1EA 1BGXT 1JQ5A 1KORA 1P8AA 1XTRA 3E9MA 3P5SA 4Z8YA 1UK8A 4TXLA 2BOVA 5FO1A 1BVYF 2RONA 1M7GA 5IN4A 1H8HA 2QG9A 2QRMA 3GELA 1Y9DA 4F