4D8VA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 79
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8vA00
4BN0A 1NW4A 3INYA 4P54A 4DA7A 4R2WA 4F3CA 5KB3A 1T8WA 3OZEA 4TS9A 3UT6A 4G8JA 1K27A 5JPCA 1A69A 3ENZA 3FUCA 4R31A 3K8OE 1TGVA 4NSNA 2I4TA 4BMZA 4PNPA 3EUEA 4RJ2A 1T8RA 3U40A 1CB0A 3FOWA 1B8NA 4OGKA 2A0WA 4WKNA 1PR5A 1PR4A 1V3QE 1VFNA 5CYGA 3PHBE 4I2VA 1Z38A 4IP0A 4TXLA 4MCHA 3LGSA 1PR6A 4F1WA 3BJEA 3KVYA 1Q1GA 4DA8A 4NY1A 2A8YA 3OPVA 4D8YA 4LNAA 5CCDA 3E0QA 4L5YA 3KVVA 4TTIA 3UAVA 2BSXA 3UAZA 3NM6B 3UAYA 4YJKA 1YR3A 4JOSA 4DA0A 4QEZA 4L5CA 2QTTA 4OGLA 1YBFA 5CYFA 4M3NA 4OJTA 1V48A 2B94A 2AI1A 3K8QA 1Z5NA 1N3IA 4MCIA 4M7WA 5B7GA 5CCEA 1TCUA 2ON6A 3OZBA 4QATA 1Z33A 1ODLA 1Z34A 1VHJA 2HN9A 1SQ6A 5F78A 1NC3A 4GMHA 4OY3A 4QASA 1VHWA 1G2OA 2IQ5A 3P0EA 5F7XA 1PK7A 4WKCA 4DA6A 2AI2A 1XE3A 4LNHA 4QFBA 1JP7A 3DP9A 4LZWA 5DK6A 4GKAA 1ODIA 1VMKA 3DF9A 1PR2A 2AC7A 5EUBA 1ODJA 1U1DA 1PWYE 1U1CA 3SCZA 4TTJA 4QAQA 3KUKA 1JDTA 2OC4A 1LVUA 3UAWA 4WKOA 4F3KA 1A9TA 1RXUA 3KHSA 4YNBA 2HRDA 1V2HE 1Y6QA 2A0XA 2OECA 3E9ZA 1U1GA 1OTYA 1ODKA 5F76A 1A9QA 3F8WA 3FWPA 5IFKA 1ULAA 1Z35A 4DAEA 1TD1A 1YQUA 2OXFA 3LBAA 3PHCA 2XRFA 3OCCA 2P4SA 5IU6A 1Z36A 1PR1A 1RCTE 3ODGA 4GLFA 4EARA 1PKEA 4U2KA 4GLJA 5B7QA 1PK9A 3DJFA 1JDSA 2QDKA 4TXHA 4ECEA 3DPSA 1U1EA 4YO8A 3OOHA 1B8OA 1JE0A 3TL6A 4F2WA 3OOEA 1K9SA 4KN5A 1JYSA 4WKBA 4EB8A 5CXSA 1U1FA 4G89A 3LA8A 3PNPA 3IEXA 1Y1QA 1ZOSA 5B7PA 4L6IA 5FAKA 1JDZA 4MARA 1Y6RA 3O4VA 1RT9A 4G41A 1OTXA 2I8AA 2OC9A 4F2PA 1ZL2A 4LDNA 1M73E 4JWTA 1YRYE 4LKRA 3E9RA 4TYMA 1Y1RA 4D98A 4BMXA 5ETJA 3NM5A 3OF3A 4NS1A 4D9HA 1Z37A 1OUMA 4D8XA 1Z5PA 5B7NA 1NC1A 5F7JA 2H8GA 1V45E 4TS3A 1PBNA 3EEIA 3ONVA 5EPUA 3EUFA 3MB8A 1SD2A 2QSUA 4BMYA 3BGSA 3D1VA 5EFOA 3O6VA 3FAZA 3KVRA 3P0FA 4L5AA 1JDVA 4DABA 1TGYA 3T94A 1Z39A 4TXJA 1LX7A 1OVGA 1RR6A 3GB9A 4OF4A 3BSFA 3UAXA 3BL6A 4DARA 4JP5A 2ISCA 4QARA 4TXNA 1JDUA 3DDOA 4M1EA 3FB1A 2QTGA 3PNSA 3EMVA 4X24A 5F73A 1PW7A 1T8SA 4L0MA 1V41E 4DAOA 2Q7OE 2GUWA 3KU4A 1OU4A 2HWUA 1CG6A 1T0UA 1T8YA 4UC0A 1WTAA 1RYZA 1QE5A 4R2XA 4YMLA 2QPLA 5F7OA 1ECPA 2RJ3A 3QPBA 1RSZA 2AI3A 1SJ9A 1Y1TA 4E1VA 1OV6A 1K3FA 3GGSA 1JE1A 2A0YA 1C3XA 5I3CA 1RFGE 1PF7E 4WKPA 3IOMA 1I80A 1RXYA 3FNQA 1A9RA 1RXCA 5CXQA 4DANA 4TTAA 4OEHA 2PGAA 1JPVA 3C74A 3MMSA 2HSWA 3OZCA 1ULBA 1V4NA 1PR0A 1A9OA 4PR3A 1Z5OA 4D8VA 1TCVA 4FFSA 1Y1SA 3OZDA 1A9SA 5F77A 3NM4A 1RXSA 1SD1A 3NBQA 1YQQA 5K1ZA 1FXUA 4K6OA 4TXMA 5C80A 5F7ZA 1A9PA 4H1TA 1LV8A
chains in the Genus database with same CATH superfamily
4FU0A 4IHKA 5IX8A 1N7IA 1CIJA 3A3NA 3DDSA 1E2QA 1G21A 1YB7A 3NBXX 4M0FA 4QO7A 3LOQA 4ZGWA 1E6EA 4MDHA 3EEFA 3MMNA 1H2RS 2FPXA 3AF3A 5B37A 4RA6A 3WHLA 1OH6A 1J2JA 3DMTC 3GWGA 3T9CA 5D00A 5TRTA 2C92A 4D43A 1QBKC 1TVMA 4D79A 1YNSA 1HI9A 3O8LA 1W5AA 2KLBA 2YBEA 3IXMA 3R3XA 1HSZA 2JZNA 4WEQA 3VHXB 3ERCA 2UKDA 3PC8A 1I1OA 5G3YA 4Z2YA 3ZV4A 4EJ6A 1L5GB 5K7SA 1FP4B 1P0PA 4LYYA 1O54A 1IIBA 1X0XA 4GAEA 1RYDA 3PXBA 1RJGA 1DQPA 1YNOA 2HNAA 4WOBA 5A4FS 4HG2A 2HLHA 1PS8A 3KSBC 1Z2DA 1A04A 4HB3A 1AZSC 1ENZA 1TGVA 1W87A 3RANA 2RGGA 2HV8A 5B12A 2I4TA 5DX8A 1FCJA 4E4YA 4LJ7A 3LCMA 3L7DA 2R62A 4QOEA 4ARBA 5I4IA 4QPDA 4XWYA 1FQJA 1P91A 3FPCA 3CZCA 2JL1A 2QVBA 2ZSFA 3TPCA 1FVFA 3U9LA 2ZM6B 3PI6A 3MTAA 3IAM1 1ZHFA 4UFOA 3F3YA 2FSFA 2GCNA 4OHKA 4LSWA 3ILVA 5JI3E 1YASA 4I2VA 3HVUA 3WWDA 2IS1A 4HH4A 1MT3A 4IP0A 4MVJI 4ZOEA 3TLGB 3HYNA 3IQWA 5C1IA 2JBWA 5C4MA 2JGNA 4QFMA 2Y77A 3ABQB 3N76A 1W0JA 3KB6A 1GDDA 3KYJB 2YIMA 2I2BA 4Y1RA 1Z0DA 1GUZA 4X1KA 2FW7A 1E1LA 2PRIA 3D6HA 4XE5A 5F33A 1R64A 1FFGA 2VQ6A 3R9WA 3SSAA 2LXNA 5JNWA 4TQUS 5JW6A 3AEKB 3PL5A 1LKZA 1GPBA 2C2KA 3P8ZA 2WIBA 4D4LA 2B0CA 2JAUA 4E2ZA 4DUZB 3EIFA 3OAAA 2VOEA 2OBNA 1KDYA 1WCV1 3WMGA 3WRXC 1I13A 1QVVA 2QVXX 4YCJA 4FYKA 3VZPA 1E1MA 3ANTA 4Z0PA 1J0XO 3U1BA 3V1YA 3SZLA 4MJLA 2R7LA 3JQAB 3PGKA 1PZNA 4F93B 4L78A 3GUUA 4J3NA 5TARA 5LZ4A 1J1ZA 3G5TA 3IH5A 4B6QA 1G3QA 2FOIA 4MAMA 2CT8A 1EDZA 3E8MA 3EZFA 3R5TA 3I73A 2VJMA 3AINA 4PFKA 1EFPB 3ESXA 3V1LA 1QM5A 4P2BA 4LQ4A 4XB1A 5IDWA 4G1MB 4X00A 1N3IA 3DEYX 1FSPA 3GAAA 1AT1A 4DIEA 4DLTA 1NI4B 1JGTA 4HEJA 5AO9A 3QK7A 3R2JA 4XRRA 1TL7C 3ITNA 3PE3A 4AYXA 1J5PA 3BHIA 5DI3A 3H5LA 2RK3A 4AG6A 4AY4A 2ZDQA 5JNLA 1FNBA 3ZV7A 2PLFA 2GZAA 3A58B 5AHXA 1EXVA 4RS4A 5EJ6A 2DWCA 4JMLA 5K0SA 5K99A 4OJNA 3KLNA 3RSGA 4XEHA 3V2UA 4AF8A 1XPOA 3HKDB 1X19A 2IQ5A 4ZP1A 1SCDA 2FW1A 4JYPA 4C5AA 4UJ3A 4PZEA 1YS1X 1Q1EA 3HN6A 1HV8A 4D82A 4FFMA 5ERYA 3LTNC 2O8FA 1MQAA 1KJ9A 4MOWA 1WBBA 4JVOA 4ETMA 5LZ2A 4P6VF 5G3ZA 4MAAA 2H4YA 5ESXA 1H2YA 5JCOC 3BUSA 3GXBA 1Z45A 5LKRA 1Z4JA 2Q3MA 1Z07A 3RREA 3UA3A 2YV1A 2EFEB 2YWBA 3AP1A 2HMAA 5C3UA 5JCPA 5KJCA 1GPMA 1SVMA 1EVIA 3DF9A 4TYPA 3TE6A 4YPFA 4X63A 1WCWA 2WU0A 4NECA 3UGTA 4Z8YA 1B73A 2QSJA 3B52X 3AJ8A 3CNLA 3MCUA 1M1ZA 4RLSA 1WZEA 3I05A 3MUFA 3CX8A 5KKAA 2XQFA 3GFFA 5FNVF 3UC5A 1ZMRA 2EW8A 2JIDA 2Y1FA 1DAOA 2P2SA 1LJLA 4ZJZA 5KYWB 3O47A 3TAHA 4PANA 2Q5EA 3BVPA 4I9HA 5HDQA 3AQ4A 2RFLA 3KKPA 1JQEA 2C94A 2FMXA 1F2DA 5DM70 2HBYA 3K8ZA 3THXB 1J2UA 3MTGA 3IQZA 5HFAA 3MQ4A 4DCMA 2IHBA 1G3MA 3P9RA 3B78A 5FWAA 4B2IA 1N8NA 2BZGA 1AHPA 3LC2O 5WRFA 2XAUA 2B78A 1ZM4A 2PSSA 3BCHA 1JZTA 5FJIA 1VHTA 5CH3A 2I3DA 2FZWA 4GX0A 3BAFA 2A6PA 3U0BA 3KKQA 5MN4A 3JRWA 2NV6A 1H8EA 4HXGA 2VP0A 4KX3A 4N01A 1XA0A 3NC0C 4QGFA 4U7TB 2PNFA 3TG2A 1K7EB 1A9QA 2R44A 3VOAA 4XFDA 1X14A 4PYKA 5ELMA 1YL7A 4EVRA 2FZ4A 1PJ3A 3T9AA 1WDWB 2POQX 2B4TO 2PUCA 4TT3A 1EFRA 3GI1A 2K6GA 3H97A 1M5RA 4TTRA 1K3TA 3CN7A 3ZHTA 1W1IA 2WMOB 3FCCA 1M7GA 1VCMA 2DJIA 3PHCA 2IZOA 2FW6A 2IYEA 3E22B 4MULA 5DM2A 3OQPA 5E4TA 1PQPA 4I99A 5E1BA 3DE2X 1FNCA 5FPTA 4LTNA 3FMFA 3KJFA 4CL3A 2O9JA 3KCNA 1C9NA 1JEQB 4AJ4A 4UASA 2J0QA 3HA2A 2GT1A 1P2GA 5C0OE 3FPJA 5J5VA 1UP4A 4PZYA 1RQGA 3GAFA 1IG3A 4JJKA 4MVCA 4YXFA 4JWKA 2E5LB 1PKEA 5F3RA 4OP3A 3RBVA 3JYNA 1FP2A 4ND1A 3N9IA 2OLJA 3AM4A 5DDIP 3PPYA 5JBIA 1X7XA 5BN4A 2Q5FA 3Q7SA 1O6CA 5ALQA 2DPHA 1DTSA 3GRZA 3T7KA 3ZHZA 5PNTA 4BBZA 1JV2B 4YV1A 3EGXB 4LOIA 4JP8A 3MERA 1AA9A 4TLDA 4LSGA 2F7SA 3KVOA 5J47A 1G2QA 1Z6GA 4B3CA 3PEYA 1YB6A 1TCAA 3RSHA 3TQCA 1Y9EA 4G2TA 4HFNA 2X8BA 1FNSA 1D7AA 3T3DA 2V5UA 4ZCRA 1CY1A 4M0PA 1X7GA 2QLBA 1NU8A 1X7HA 2DOKA 2Q1YA 3TTWA 2JJ8A 4AKSA 2PZLA 3EAQA 3VPXA 3CNNA 5CDHA 3ZJ5A 4EB3A 4KR7A 3AHCA 1TU0A 2DETA 3N53A 1IZ7A 3DOJA 3R6LA 5B58T 4YAUA 1XMSA 1BHSA 2R8OA 3W5SA 3HCAA 4DIBA 3Q3CA 5AVXA 5D6NA 4CT4B 3CX6A 3ILXA 5LZ5A 5BPHA 3HGQA 3FBGA 4R9NA 3DAOA 4P33A 4PRKA 4G89A 3LA8A 1U8FO 2YWEA 4JQSA 4UDOA 2P9EA 1KMHA 3N2LA 4IDCA 1E1QA 1EINA 1XCLA 3DAGA 2DLNA 5L7WA 4BU1A 3F73A 3N70A 1NJGA 2H48A 2QW0X 2VJPA 3R0XA 5CDUA 3UXYA 4P36A 1Z5ZA 4LY0A 1Z7YA 3JQCA 3B89A 4O59O 2A30A 2FWNA 3O92A 2O8VA 3CH7A 5BNWA 5F9FA 3H3JA 3PFBA 3RVSA 2AOVA 2MMCA 3KELA 1M33A 1SWVA 1R15A 1U3CA 3H0CA 5CM9C 5AJVB 1GTJ1 3RBXA 4PFSA 3W5IA 3WX0A 3PUYA 1JAYA 1KI2A 4AJ9A 4Z1MD 5THQA 2X14A 1N2HA 1CVRA 5AW6A 3HZZA 3I64A 4JWTA 3EA5A 1ZXLA 4FBGA 4JLVA 4RPHA 3OM0A 2SCUB 5THXA 4M7PA 3KJGA 2A5DA 2YR0A 4R01A 4FYVA 1AKWA 3R0JA 4Y0VA 1OXKB 1NHGA 2IXDA 2HBRA 4KODA 1ZGAA 4KMMA 1USVA 2LTAA 1JQ5A 1EP2B 2PFKA 3GHYA 1VKOA 4WFQA 2Q7DA 3WKBA 5HRAA 1A27A 2JGFA 3O21A 1KHHA 4YAKA 1DJNA 3CF2A 2LR0A 3B36A 3ESQA 1H8HA 1K5DA 2RKWA 3C24A 1VJ5A 2O57A 3DEZA 4YXWA 5SY4A 1AMOA 2BM8A 3L01A 5EE0A 5EIFA 1E69A 1I6KA 1CUAA 1OLXA 5FV7A 3DXXA 3S1SA 4RWEA 3G3EA 2XT6A 1CQZA 2XD4A 4YCCA 1PBNA 4ZOAA 4PXYA 2MSKA 4OM8A 1FNNA 2IZ1A 2ATXA 3W3ZB 3AUAA 4B6PA 4ETWA 2YWJA 1NF3A 2H59A 4ZGGA 5DNVA 3PWTA 3OZIA 3G0GA 4F5ZA 2HCTA 5CYPA 5KSWB 2MYPA 3NATA 1Q2XA 5T41A 3SEFA 2W9XA 1UDRA 1XZJA 4IINA 3ITEA 4WL0A 5E38A 2JLQA 3QX8A 3UGKA 5JYDA 4QU5A 3HCPA 2BGKA 1IJFA 3MJCA 1SD2A 1JMKC 1T9HA 4GIBA 4P82A 1Y9AA 3DLTA 4MR9A 3WWCA 3OQMA 2O8EB 4GW3A 2CL7X 2BMEA 4KAFA 4WDRA 1FQWA 1JQAA 3DWIA 4G86A 5LQSA 4D4GA 2F3SA 4Q16A 2Z04A 1DX9A 1ZA2A 1SOVA 3GZTB 5LQJA 1XTVA 2WWHA 1ZYUA 3GUCA 3GQBA 3L8FA 3NS7A 2BFWA 4LY6A 4BGEA 4DSZA 3K6JA 2FZLA 1DPGA 1XCPA 2D1SA 1WD5A 3L0CA 4D0GA 2XMDA 1R0BA 1FMTA 1K7FB 1YUMA 4Q9KA 3TTYA 2YUIA 4EPVA 5HM6A 5ICMA 3O3MB 5IC5A 3E7PA 3A6GA 1VGRA 5IJ9B 1VRCA 3JASB 3VDXA 5BQ5A 5AW7A 1J49A 1EB9A 1PTJC 4JVNA 1ZJJA 3B6ZA 2QN3A 1F2UB 3EFEA 1YQWA 4TLCA 4AJJA 4PYJA 3QHAA 1ZKDA 1VSTA 1CS4C 2FWJA 5AM0A 2GZSA 4OF4A 3L8DA 3A4YA 5U4XA 2LPMA 3MTDA 1TADA 2DBRA 5IW8A 3BXOA 2P8SA 1JFVA 4J3FA 3REQA 1EUYA 1EVKA 4UUAA 1Q7TA 2FNAA 3BL6A 1WXIA 4MDEA 1LD3A 3MWFA 1GNSA 4HDRA 3HLKA 1P18A 3PWKA 4JNCA 4RJIA 5T4FA 1NAHA 2DE0X 5I7UA 5LMNB 1J8YF 1EVQA 3PEEA 1GFWA 2PNJA 5FJJA 3QG1A 5AUQA 7REQB 2J9RA 4MUFA 2GXAA 3ZVRA 2R4UA 2HA3A 2IHYA 5C1OA 1FSSA 3EMVA 2XY4A 5EKUA 2UZ0A 3A9TA 3T38A 1Q1ZA 1DOAA 1EU1A 5DT2A 2WTBA 1DOZA 4PVCA 3ZHYA 2C99A 4DLRA 2VWQA 3GFBA 1GLNA 2W48A 2BMFA 4J90A 3N87A 4EKEA 4ZAZA 4W5RA 1X8KA 3PQDA 1OOEA 2NVWA 3GJRA 2FQWA 3DEJA 1Z3IX 1OAAA 2R68A 3DDZX 3JVVA 4NBUA 4NCIA 4BVEA 2JAHA 4CV2A 1NKSA 5IKOA 3T4XA 3RAFC 4Q82A 521PA 2ZPUA 3FVVA 5C37A 1SGWA 4YT2A 1G7CA 3N0TA 5E6UA 4YJ2F 1KFBB 1XZKA 3NIBA 4PO8A 4GXRA 1ECPA 2ISQA 1VDZA 5CCBA 3SP1A 2QQ5A 3M9WA 1NVGA 1ZN8A 3LW7A 5DK4A 3TIGA 1XJ5A 1SJ9A 1CYDA 1Y1TA 3A06A 3EGEA 1W52X 4PY2A 3BBLA 4GOND 1GPWB 5IN4A 3N8GA 1KF0A 4PSKA 3M7IA 3QF4B 2V0CA 3PXXA 4OSPA 5HVNA 5TPWA 3E8XA 1UXOA 3CWQA 2W6QA 4KQ1A 4PPNA 4Q9DA 1CZKA 2GN4A 4IHQA 5CA1B 1C3XA 5A9SA 5HKOA 3IIIA 2JGLA 3WYBA 1E99A 5JXHA 3IOMA 3ACBA 5SZKB 1T8UA 1TJ5A 3BL5A 3Q87B 1GPLA 1THMA 2OESA 3L8EA 4JBYA 4W1RA 3SKXA 1M1YE 2ZI4A 1KSFX 2O4UX 3BAZA 1JEJA 4HNQA 4KIJA 3TLBA 3TR6A 3R3WA 4ESHA 4HH0A 3F8SA 4LVUA 3LCRA 2GVDC 2K4MA 1NBWB 5G0UA 3C74A 1MUUA 4ZFNA 5JAPA 2IODA 3RYCB 2JAOA 2G1KA 3WE7A 3DZGA 2QM7A 4ZT4A 3M33A 4MQFB 1NUHA 2ZFUA 4G9EA 1X13A 5ALWA 4N3GA 4HLQB 3T06B 3W5VA 1REQA 4HWGA 4KR2A 4QRIA 2HU8A 2IYSA 1FA9A 2WG1A 3GLFE 1MENA 2A7XA 3ZLVA 3H5TA 4Q4AB 1Y5MA 4MV5A 5BMVA 2G6TA 3CA8A 4XIYA 2BL4A 3F78A 2GESA 2BHLA 1XVIA 3TLAA 4OXIA 3WMFA 1SFRA 2NXWA 3QHPA 2FQ1A 3O4GA 3O1HB 1DCTA 1C9EA 3NX4A 1MJ5A 4CKCB 3ZNPA 2WG0A 3AL2A 4C7MA 1QPZA 3D8BA 8OHMA 3G88A 1CJSA 4Q48A 4R7GA 1US8A 1T1GA 5K0NA 3W5DA 1GCIA 2QW8A 2YJ5A 3V2GA 3JD3A 5JPDA 2DT8A 2Z2XA 4EF6A 3QYAA 3VZSA 3NAQA 4E5MA 1YMUA 4AC9A 3GCDA 4H1TA 4XUEA 1XWFA 1OXSC 3RSSA 2F3PA 4XUCA 3VPCA 1U0HC 2PWBA 2ZRCA 5K45A 2X13A 1W49A 3ISTA 5FBKA 3ETEA 4IG4A 3KBOA 3DOHA 1IUKA 4XCVA 4I50B 1AZWA 1ESNA 4PXSA 3T9EA 1Y6GA 2LD4A 3DNFA 4CUZA 4KR0A 1P7YA 1T6XA 4P54A 4G23A 2N42A 2XODA 4JT9A 3IQFA 4BNXA 4ESOA 4HMPA 4HQFA 3R8FA 2ES4A 2X86A 2X9QA 4MKIA 2GHQA 2GK3A 3LA6A 3SE0A 4KO3S 5IMBA 4CM9D 3TXAA 4NNJA 3VR3A 1E2LA 5CA0B 3PFFA 1M34E 1DIBA 3R20A 1X2EA 4U6QA 3H1BA 4MWZA 1E1YA 3KPYA 3QEMA 1OXUA 3V7FA 2DUJA 3PPVA 4HB4A 4M9XA 3ZWMA 1IB0A 4E7PA 2WJGA 5JFOA 1S01A 4Q4HA 2ORWA 3F71A 3LY9A 3E1SA 2OTCA 2VHCA 3LBHA 4XQ9A 3EUEA 4CR6A 4XXHA 3ZD9A 5KX5A 3WISA 1E2BA 1HMYA 1VMIA 2Z0MA 3WP1B 1E59A 3SFVA 4ZYWA 3K30A 2PMFA 2WSMA 1UK9A 3H1AA 2PPLA 3L7LA 1U3FA 1EIWA 2A3RA 1YZ3A 1RCUA 3VU9B 4II2A 4AJPA 4BRZA 1BMFA 4F6LA 3KWMA 3G2HA 1XIVA 1XQ9A 3DHYA 4NDZA 1OAKA 3ONEA 4DN6A 2Z3VA 1KY3A 1RBMA 2C77A 3I2JA 4NCXA 4HYYA 5C3MA 1D04A 2XXJA 4KPGA 4Q9NA 5T6MA 4W5NA 4FEAA 4GP6A 3K09C 1JTFA 4IDPA 2PT6A 4XVRA 3RQSA 4DR7B 3CBQA 2ILVA 4ZU6X 1J8MF 1XNQB 2P67A 2QR3A 2VK4A 3CM0A 1YCGA 1O87A 4EO9A 2CCKA 2KMLA 3I83A 4BPRA 2P30A 2QVZX 3KVVA 2ZI3A 4HWTA 4KIWA 1YAHA 2PAAA 2RAFA 5HCIA 4DM7A 4F4FA 1NPYA 4ZDWA 1QU2A 4YV2A 1XTQA 1BJRE 1MOPA 1FMFA 4DG8A 2BMJA 1QZZA 2R79A 2WP0A 2XSZA 3T95A 5DHAA 5KDDA 4XVCA 3D4LA 5D84A 3BFJA 3QLVC 1FOEB 5CMLA 2VO1A 1OROA 5DV9A 4JDPA 4XGRA 3NFYA 1SCUA 2QZPA 3MTIA 1V48A 2W4IA 2GI4A 1NSYA 3WNBA 1JVSA 4RMHA 1POXA 3PNVA 4U3JB 4DILA 2UVDA 5AI6A 3KO8A 3KB1A 4TV8F 4KMRA 4MWTA 1GCOA 5FBHA 5H70A 5BT9A 3WC4A 5I4KA 5LU9A 1FDSA 4BIMA 1COWD 5IH7A 1NJ5A 3G89A 2I6UA 1MB9A 4NYJQ 3WL7A 1VKNA 4WCVA 3A1VA 1NP7A 3DXZA 1GAXA 1Q57A 3WB2A 1QFYA 1Y5IA 2ORED 1AMNA 4G25A 1XMOB 1RJWA 4X8OA 1ZI9A 1W9HA 1GFSA 3R5JA 4QLOA 1FQKA 2I4MA 2P2CA 2YRWA 3QLTA 4FMDF 5JHHB 1ECCA 2YCLA 1DCFA 1KKMA 1VI6A 3HG7A 4PU0A 5AXCA 3PWZA 1IRIA 5DSXA 4BTEA 3O3NB 4Q3KA 5JSKA 3PQ3A 4F97A 1GHTA 3WS7A 4DLVA 1YJBA 1M67A 2ZWAA 3IOBA 5GONA 1XE3A 3SNHA 2VDOB 4MWDA 4N8SA 2FX3A 2BGNA 4JS0A 1LW7A 1EVJA 4QFBA 3L6UA 4FLEA 4Y6QA 5TMBA 2XB2A 1QHXA 3DP9A 1AQLA 5LC1A 4G4GA 4YUYA 2B6NA 4MIYA 5FB3A 4C14A 4F4DA 1YR2A 3OD5A 1N1EA 2I6GA 4OA8A 3HB9A 4KWIA 4MUGA 4BQRA 5AW4A 4P38A 2LDXA 2DTDA 3BQNB 4BJ6A 1C7ZA 4BEVA 3ADDA 4DEVA 1F0PA 1M8KA 2VAXA 5JXIA 1R4MA 3F96A 4Z4GA 4HDRB 5B3LA 3CZQA 2Z8XA 2Y1DA 2HQSA 1QRRA 1EFHA 3OKAA 4ER7A 2V6GA 4Z9YA 1L8OA 3D4NA 3HMQA 2HF2A 2FEWB 5JJLA 5DW3A 3I39X 1ZJWA 3LOPA 2R6GA 1SKQA 3MN1A 1IAVA 3LKVA 2DQ4A 3GEPA 4Q39A 4J07A 2VKQA 1YK1A 1E0KA 1G8KA 2Z1MA 3E0XA 4KQFA 2FRDC 1NBMD 5LCXA 4DB4A 1IEXA 4M53A 5C53B 1DRJA 2HRDA 1Y6QA 1LS6A 3I52A 3L7MA 4N6OA 4TRJA 1F6WA 3W0LB 2AWOA 4JD5A 2CC2A 5DTRA 1IL0A 1HG1A 3EPJA 2GAOA 7ADHA 3MYYA 1TOAA 1H23A 3PI7A 1D8AA 1U8UA 1WLSA 1VL6A 5AP9A 4FM9A 4AN1A 5ENDA 3UATA 3ZCQA 3I0MA 4O8CA 3DZDA 3TOZA 4TVSA 1GIAA 1ONNA 2B7LA 3DVRX 4DHEA 4LF6B 4JA2A 1A2OA 3CSUA 3EF3A 5J4LA 1V1RB 2H5LA 1E92A 2SHKA 1N2EA 4NZ9A 4JJGA 4Q4JB 2JI6A 2PRSA 3GLRA 2WKWA 3IO5A 4DIKA 4Q02A 2Z95A 5DX0A 1L5NA 5CDTA 1A4IA 3H2SA 1FVHA 3B9BA 4N0PA 5DZSA 1P2SA 1UPXA 1EXNA 5BNTA 3NAGA 4QPCA 5K0CA 1HOTA 3N05A 4JUFA 4RD0A 4DQ0A 1C7IA 3KLMX 3E05A 2P3QA 4V3BA 3N8KA 4PPQA 4UOEA 4BGDA 5IYZB 2NU8B 4ITVA 4UU8A 4OQLA 4DYHA 1FXSA 1CS0A 2HT6A 1K89A 1Z2EA 1PGQA 3PENA 1JSXA 3T54A 2CLCX 4HO1X 4YRNA 4E15A 4EQ6B 1CQIB 1OIXA 1KYVA 1Z7GA 3PDHA 1UQTA 3RK0A 3VQTA 1ZEJA 2V7GA 1IBCA 5JRDS 1GYPA 2F59A 4FTWA 2O2JA 4WZBB 4WY2A 4ZARA 3GRKA 4XD7D 1ZJZA 3DT6A 4JAVC 4AJLA 1GUBA 3EEQA 1NLZA 3H5OA 3SHOA 5JC1A 3PGJA 1I51A 4QQRA 4F6CA 1UQRA 3CEMA 2CFCA 4KXNA 1DQSA 5E2AA 1WDMA 2JD2A 2X23A 5FI3A 5D5PA 4EI7A 4OQMA 3N3BC 3UHPA 5L51A 1R74A 1WMFA 3LZDA 1A72A 1U0RA 5BN5B 3TI7A 3CB2A 4RHXA 3PLAE 2QZ9A 1J07A 1I2CA 1QYIA 1NTOA 4HLUC 3ASYA 1K4YA 3CEPB 2Z9BA 4NMHA 2FJ0A 2RG1A 3RS2A 4J6FA 1DV1A 3LJKA 1ZVVA 2CJYA 3OH8A 4UMDA 3RTAA 2IPNA 2HGSA 1GKKA 4B7ZA 5M04A 3R5SA 2AZ4A 4MDFA 4KNYA 1P1HA 1XF9A 3LU1A 3PNMA 4D3DA 1U2EA 4RK7A 1QOQB 1NVBA 1YI0A 2ZVPX 1PYDA 1KARA 3K31A 1XZGA 4O3MA 1E2GA 3KKLA 1CDDA 2FR1A 2I3AA 3NTXA 1PNVA 4HZGA 4O4IB 2WOOA 3FR8A 1N6KA 4Z2AA 4QNRA 3A2MA 3A4LA 2QRLA 4OYHA 2NMVA 1XZLA 4JP1A 4IXMA 4G41A 3RUEA 1XK6A 4UBIA 1CRZA 3FCYA 5EJIA 5FTLA 4X61A 2RMKA 4UAGA 1Y9ZA 1XPRA 3ND7A 2FR8C 4ZOCA 4ALMA 4LDNA 3ZCVA 621PA 3JQGA 3RKSA 1ONPA 2XYQA 4FKBA 2NSHA 4CLEA 3FRIA 3ME5A 1JJ7A 1H2XA 4MR9B 3B8EA 3D8UA 5ER6A 3S5UA 2IP1A 2ZIAA 1I2ZA 1UEXC 3KQPA 5IZCC 4TYMA 1E7QA 5U9CA 2XA2A 1XDSA 9ATCA 3O0DA 5A7FA 2C2YA 2WA2A 1Y89A 1PJLA 3NTLA 5DGDA 4EHAA 5ETJA 4ZZ2A 2P9YA 1KI8A 3N75A 1AXEA 2HA5A 4PSVA 1ITZA 4OHWA 1XDUA 1DAPA 3OF3A 3Q3HA 1SVUA 4IKOA 2Z4RA 3TMKA 4B0OA 1Y1KE 2OHFA 4D9HA 3LZ6A 4I3HA 4EP1A 2XMQA 5CFQA 2PMWB 2QLMA 2AFVA 4B46A 5JBQA 2FJPA 3WB9A 1SC6A 3WWZA 3GDFA 4NBTA 3RPEA 5ED4A 1GA6A 2IT1A 1AUPA 1ZD4A 1F2TB 1KZ4A 1MB4A 2PKEA 4J9UE 4K9RA 3V00A 2ZS8A 5YASA 5DLYA 4DKJA 1SUIA 2O50A 2C2XA 2AFRA 3NTUA 4Q3DA 2YYAA 3M5PA 4OYRA 4B3JA 1NW6A 1Z6QA 4XSVA 1VSBA 5G0SA 2OHVA 5KOJB 3ZCUA 4NOLA 1WG8A 4PWZA 3O3CA 3L6DA 1A5AB 3R0VA 2X40A 4IUYA 5AI8A 5C8YF 4ZCSA 2HHJA 1M2EA 3ROMA 4R9SA 1TJ4A 2J5QA 4KQGA 2V1UA 5ABPA 2AN9A 1SCUB 1IBSA 5PGMA 1OLXB 2AOWA 2AJDA 3BGWA 1YMQA 5E7JA 4BXOB 1CW2B 2Z2JA 2QT0A 5CM2Z 1P6XA 4LV5B 5CBPB 3BHJA 1AKQA 3ZWPA 1OYYA 2C1ZA 3ETLA 3RIHA 2VYFA 1YT5A 3TUIC 4D56A 1Z5GA 4BZWA 1X38A 2V9PA 2D5LA 2ZUBA 3PRHA 4UFPA 1JYEA 4XSGA 2H16A 1VE1A 3T35A 3IHTA 4BJ1A 4EB6A 2CJXA 3UKJA 1X1CA 1QGZA 3RVJA 3ESAA 3ROEA 1RPTA 3BJMA 3U26A 2R5NA 2V59A 2DFLA 5TJHA 3WNDA 1VA4A 1EJ2A 2FXVA 1K68A 3PRKE 4ND3A 3HU5A 5EP2A 4KDCA 3W3AD 4FMDB 1XL0A 1N1GA 3V48A 3UAXA 4PS0A 2QTWB 2HIAA 1G2PA 2ZS7A 4UULA 4V3CA 2VP6A 1ZCBA 2PMKA 5KQMA 2XF8A 1YRWA 3OT5A 2WIGA 4R9VA 3UOWA 2GUGA 4PQEA 2ZJ8A 4L3OA 1Z0UA 2OK8A 1QNFA 4POAA 4RVNA 4X0EA 2D3WA 3D4OA 3OURA 1SKYE 3SQNA 1VP9A 4XX0A 4Y0AA 2AT1A 2HK9A 3UJAA 1HF3A 1R8JA 4N1AA 1P2DA 2NVBA 4YUWA 1ISGA 1L4GA 3IFSA 4EG3A 3VKGA 1H5UA 2H06A 4JJFA 1M2NA 2BAGA 3U5TA 3AERB 3MRVA 4B75A 4HL6A 1SG6A 4WN3A 1VSUA 4RZ2A 1JBKA 1BQ3A 1WSAA 1MX3A 2I7DA 1GM5A 4JI2B 2LKCA 1E9EA 5CIYA 2CB9A 2Y3IA 5DNWA 1CRPA 4N9QA 2PGOA 4AO6A 4JC4A 1I8TA 4JP2A 4K1LA 3O8OB 4OSEA 1SHZA 2YHIB 1JKJA 2X3FA 3QA3E 1HE3A 2Y6VA 3TTXA 2WM3A 4X7PA 2JFWA 1H2HA 3GXOA 5ALDA 2HZBA 1TUBB 2E3JA 4IGEA 2P9JA 1L3CA 4IIJA 4Z9XA 5GGYA 5CEJA 1WP4A 4HQ0A 3BKXA 4WJZA 3CISA 5AKZA 1ZPDA 2XKJE 1I6WA 4W7HA 2AQIA 1RM5A 3BGIA 1BS1A 1E7SA 1JXAA 3GLHE 3HUEA 4KHZA 4MS3B 3ZX5A 3DO8A 5LMCA 2RHRA 1T36A 4ZKDA 2CVFA 5E9AA 1QAOA 3ZNOA 2RAVA 1K4KA 2VNHA 3IEUA 4TWIA 3R74A 1US8B 3JW8A 3FNQA 4OHBA 4OHRA 2BKXA 1SB9A 3HB7A 3UUWA 1K88A 3MEQA 2YTZA 3OTWA 3H4TA 3JV7A 2EHJA 3L7OA 4GVLA 4AROA 4DNFA 3KR2A 1Z0SA 3KQMA 5I9LA 1VMEA 4HYQA 4NC9A 3HKCB 2J6IA 4DV0B 1ZN7A 4RQAA 1IDN1 2ZAMA 4NOKA 1A71A 3HZOA 4L73A 5KDLA 2CV1A 2Q1XA 3QA9A 3GAMA 3MJSA 1A9OA 1Y7LA 3G0DA 2BR4A 2QQ0A 3BMOB 3D7SA 3HJCA 3IMGA 4WCFB 1J8QA 1MGPA 2BDEA 1NX9A 2UZ1A 4OCZA 2POCA 3LTEA 1UAGA 3TZEA 4C7OB 1IN1A 1UFQA 1DDOA 2AHRA 2PMCA 4EHHA 2G5TA 4GR4A 1DUSA 4M9QA 2G5GX 4Z7JA 1AQYA 2WWIA 3HWWA 1AS0A 1Z13A 4L9WA 2XGMA 4FEYA 1ZU5A 2CNBA 4GPAA 2QJWA 3L46A 4GNKA 5EY5B 2XNCA 5INTA 3IUNA 4JDUA 1HLGA 2E6KA 1XU4A 5EZQA 1CIVA 2C7VA 3TGWA 4WGFA 3REOA 3GEEA 1CU1A 3QTTA 5GAJA 4JJAA 5KHOC 1EWQA 3C5HA 1SBYA 5AESA 2G9NA 4JNKA 4RULA 1WU7A 4ZOLF 1EAMA 1QO9A 1T4DA 1Y8AA 1ZN2A 2FF7A 3O2SB 5KVQA 7GPBA 1M7BA 2QXTA 4MW1A 1E3MA 1J8VA 2YMMA 2GJKA 1B8PA 2RHTA 3UNXA 4B9EA 4DYVA 1P8AA 1F0NA 3ROZA 1RAGA 2CLDX 3C5CA 1L7VC 4E7OA 2HJVA 1FYEA 1N2BA 1T2UA 4IIJB 2IV3A 3H2KA 2C84A 1COZA 3TOXA 1R6UA 2PWYA 4R2WA 2JH3A 3VBEA 1E5TA 3TH5A 2FPWA 1T8WA 4JOCA 5DE3A 3RWMB 4DVJA 3UW3A 5ICEA 4GI2A 5JSFA 1QH1B 1PRYA 1RWXA 2VZLA 3E3AA 3LRPA 3ZBPA 4ARUA 2MCFA 3T7IA 1P31A 4BE7B 4DC9A 5JR3A 3BIJA 4G8JA 4XYMA 3SJUA 2B92A 4EFMA 5JRJA 1QIIA 5JPCA 1OBCA 3T1QA 4QUJA 1KI6A 2AKAB 4G5RA 2ODTX 5CB8A 1YZNA 2CBXA 1LV7A 5DNUA 1JEOA 2NZYA 3B9QA 4ZJYA 2GTHA 2HQRA 1NA5A 3QI7A 4I9NA 3UYLA 1R5NA 3AV0B 1BXKA 3A8TA 2QD2A 4NE7A 2E4ZA 3ZXUB 3VVCA 1AU9A 1UBFA 2PSJA 3IPCA 1KSJA 4MZXA 1N3LA 3T7JA 4P3OA 3E84A 3WDMA 2O8DB 2EBUA 3VSAA 1E3DA 4WBSA 1DBRA 4WACA 5SYAA 4BFWA 2QI9F 2D74A 3SBEA 3ZZUA 2PV7A 4IVPA 4OGKA 2QN6A 4RHYA 4YIHA 4C6SA 1XVUA 5H4HA 3K4HA 2ZPTX 3P9QA 4Y2SA 4OHUA 3VU0A 5MGNA 1BXZA 2G04A 1QQ7A 2KHZA 4LJAA 1QQAA 1ECLA 1E3EA 1T4GA 2PIAA 1TT5A 3D2BA 3ZQJA 4KDRA 2R66A 2GXQA 3U13A 4Y9RA 3TMYA 3VVBA 1TDJA 3GCWA 2PXHA 4YI5A 5K4HA 1WZ2A 1KQNA 2GK6A 2VNIA 4BLOA 4LV8B 4F92B 4Y2XA 3QTLA 1IUPA 4MYUA 3KXLA 4F9GA 4W7SA 4IQ4A 2SBTA 2FPKA 3M6UA 2M2IA 4YAFA 3SX4A 4BFVA 2I87A 3C7AA 3ZJTA 1U7WA 4TTIA 3QY9A 4B47A 3TJMA 4YDQA 1XDZA 3JQ7B 2HPAA 1M2VA 3PR3A 5A4DA 3PD1A 1VB3A 4YJ3A 3RRNA 3W1WA 3NM6B 5KVSA 10MHA 3Q10A 3PQ7A 4JVMA 5JXJA 3J7AC 1H42A 2VSOA 3H7IA 1ONBA 4L2IA 3SYMA 4US2R 2QZSA 1ZGHA 1MJGA 2OPBA 3GYBA 1XMQB 1RWWA 2YNMD 2GPWA 2YOFA 4GE0A 4KUGA 5EWJB 4LF8B 4JI6B 1V95A 5IEBA 4ZIRB 1DP4A 4Q1DA 1SBHA 3WJ2A 1SQGA 3TNJA 4ZANA 3KKZA 3KR1A 4QUDA 4TSKA 1YA6A 1YGPA 4DMGA 4ZVQA 1PLJA 1FJXA 1ZR4A 4H16A 4JXJA 1K2WA 4LECA 4CG1A 2I2CA 2GNPA 4FCWA 1UFRA 1JJBA 1B0AA 3IURA 3F4BA 3OEYA 3P4YA 2PYIA 2H85A 1ABEA 3H3XA 1OJLA 1RCFA 2YFQA 3CT6A 5HF5A 2SICE 2O2DA 1KEWA 4Q1BA 2DPMA 4KQJA 3MD9A 4OUKX 1UQUA 3QSGA 4MW9A 2NO6A 2VUUA 1PP4A 3I2GA 4Z4QA 1A2BA 2G8LA 1YHNA 4G2NA 4XTRA 3P0EA 3QM1A 1N6OA 1BGVA 3VC1A 4B3IA 4GX5A 3TCNA 2VDNB 1G4AE 1EDEA 2WA1A 5IJAA 1Z4MA 3L05A 3TAUA 5FDFA 4P81A 4ZYVA 4H6WA 1L5YA 2QM0A 3DLPX 5KTOA 3F9CA 1KRHA 3EZXA 3I30X 2QX6A 3HWRA 4R05A 2UUBB 1IYZA 1M6NA 2PZMA 3CNQS 1O6BA 3F67A 4HN2A 4HQRA 4QBKA 4PG5A 3VR3D 4UCFA 4L15A 5JVDB 1C4OA 1K8XB 3T1OA 3IT0A 1SVKA 4C2UA 4IDNA 3MF4A 3MELA 3AZOA 1OD6A 3P5SA 2Z5VA 1VG8A 4K3UA 1I4TD 3TQHA 3LQ4A 2B4AA 3R8CA 3C4JA 5LZ9A 1YRLA 3EIQA 1F8GA 5LP6B 3HDVA 4B4VA 5CVEA 1QTRA 3AJAA 3JWHA 1Y4UA 1KDVA 1BH2A 3R24A 1HOXA 4U2CA 4DWWA 1NYQA 4JQOA 5DN6D 3FKJA 4F2HA 1U3DA 1XRPA 4MYRA 3IOYA 1M2GA 4LF4B 3RYHB 3GLUA 1HSOA 2BM9A 3H5AA 3P2EA 1CV2A 1EBFA 4I66A 4QFCA 2ZYSA 5JMTA 4C30A 3G8CA 4HVCA 2Q0XA 2DYKA 4Q5IA 4R8VA 3T3EA 1J25A 1VLHA 2ZPAA 3HABA 3PWSA 4ZYYA 1G8FA 4TLAA 5EQJB 2VQDA 5HA5A 1AIPA 1C0PA 2R96A 3UJHA 4BVAA 4HN4B 1M74A 2CLEB 4FDTA 4PVDA 2Z57A 3V6LA 2QG6A 5FADA 4P98A 2D59A 1MC5A 3V42A 2ZJ0A 1TMOA 1OASA 1RKXA 3A3PA 1K6EA 3B51X 3KT8A 4LTDA 4UHEA 2F62A 2OB2A 1Y63A 1UM8A 2ZTVA 4DQDA 5A1JA 4NNOA 4IAOA 2GFIA 3CRQA 4DEXA 5C1DA 4JIGA 5IBRA 3C3YA 1W35A 3C3DA 2P2YA 1H3NA 3VYWA 2VZEA 4UEOA 3HA5A 5LYJA 4KPYA 1N33B 2P4SA 5JOQA 2QSZA 4WV3A 5CLJA 4NBLA 4UUOA 2AF4C 2H2DA 3U9TA 3PF9A 3JQ9C 3CMMA 3TM5A 4R68A 4KNVA 2XCIA 3GLFB 1ZITA 3HSYA 5BSRA 5LNK1 3F6CA 4FFNA 1WKVA 1IUNA 2VCHA 1ZNWA 3DCJA 3LT5A 2Y9PB 4MIOA 4O4LA 1EK2A 4PO9A 5AM1A 1F0KA 3WKEA 4DXDA 3J81A 4AS1A 2W00A 5HZHA 4AULA 2GRAA 2MJLA 3OOYA 1PFVA 1Z0JA 1E2IA 4ZO4A 2HXSA 3ER6A 5KI6A 3E9YA 4YACA 4KVAA 5KPJA 5IYZA 1SXGA 1TJPB 1JXQA 3UWMA 4UHFA 2OCPA 2WAOA 4KGZA 3BE5A 3W1VA 1ELOA 4R1UA 2ZT6A 1E3JA 1K8QA 4BQOA 4NHEA 3HGMA 3THYB 2CUNA 4YO8A 3OPYI 5JANA 5JO0A 5EP3A 5F51A 3D59A 3N2KA 5HK9A 2JHCA 1KJZA 1UMCB 3ED5A 2JHAA 1CNFA 2CXHA 3OOEA 2P4HX 3OSUA 4OQNA 3IESA 3QEKA 3FBTA 3JQFA 3FHTA 3SKYA 5EP4A 4BQFA 5HWSA 5K20A 1PGNA 2EFDB 3NHBA 3NFRA 3OQHA 4BO5A 1MB2A 4L9AA 3SICE 1N3YA 4DIOA 2HDOA 2JH9A 3BSWA 3GMIA 1P73A 1Z25A 3P45A 4KQCA 1SCIA 3TRHA 3B12A 5FQOA 3ZW8A 5IVPA 2IQIA 3LX4A 4HDSA 1H4QA 2AKEA 4JQCA 2JGIA 4EX7A 4L6IA 1YOBA 2RHHA 3H0EA 4AIIA 4BLUA 2B5OA 2VPXA 2E4XA 1GTRA 1Z6ZA 2A9OA 3T5BA 1FBNA 1ZU4A 2VHYA 1KAHA 3TTVA 1OI2A 4PIPA 4Y6RA 3V4ZA 5ALLA 3EH2A 3UMSA 2B1IA 1XLWA 4H4EA 5AK0A 4ALLA 4LG1A 1L1RA 3Q41A 2OA0A 3Q2KA 3SYRA 1A5SB 2CEAA 5JIBA 1VCHA 4BBAA 3JWIA 1NQ5A 1JSRA 2L17A 4D81A 1AK2A 5C4GB 5CLHA 3WGQA 3IV9A 3AGQA 1VLLA 3Q98A 4GYKA 5FLEX 3WMWA 4PEVA 2ODWA 4U00A 1TT5B 3OIYA 2OHXA 4JLKA 2NO0A 2AJBA 4BL5A 2J5BA 5ALJA 4BMXA 4TMWA 5DFAA 3FA2A 3ADCA 5DHTA 6AT1A 4I46A 3NHFA 2QSYA 1EUDA 5EJAA 1XEFA 3C8UA 3ICPA 3KUXA 4I5EA 3BD8A 4M22A 2X8AA 1U4NA 3QU5A 4CL2A 1NZJA 1Y8QB 1BHJA 3QWBA 4W1SA 2GS9A 1EZZA 1RTTA 3U4AA 5JNUA 3JD0A 5LL6P 4RLQA 4PONA 4F5EA 4W5TA 2NU9A 5I7HA 3RTDA 1G1MA 1K8ZB 4PC3A 4FN5A 2QUZA 5GVRA 2M1XA 3MWEA 4PCVA 2B36A 2L18A 3IODA 3KHKA 1KNQA 2P1RA 1V1MA 3PFWO 4QUBA 4BNTA 1PZEA 1BWPA 2QAJA 1TEXA 1RFLA 3W7AA 4C6TA 1J00A 1GZ6A 3EA4A 3WJ1A 1LQUA 3ZWDA 1DRVA 1BXGA 2WD9A 3CSSA 4IKEA 4RE5A 5DBEX 4RTKA 2UUCB 2VNKA 4RIIA 3PE6A 1XTSA 3S28A 4N4AA 1MKYA 2QJTA 3FHJA 3KQLA 4I1VA 4O2LA 2PXCA 3QXJA 4GLBA 3AF1A 3G8BA 5ITSA 2LZ0A 4S1VA 3WZMA 1C4WA 1E3TA 3F8TA 3N86A 4TV9A 4CIVA 4Q3EA 4BFZA 5IT5A 5KNBA 1THGA 3HR4A 2AMVA 4R3WA 4TT8A 1UP7A 1FEZA 2G0NA 3DPUA 1JG4A 3LPCA 4MI9A 4P31A 3AB7A 3OKFA 2VXCA 4BO7A 5LKAA 1EK5A 3AGPA 1YI1A 4ZRDA 3T3OA 1PT6A 2FQQA 4I5IA 4IOJA 3R76A 1RI1A 3OPNA 3SS7X 3LG2A 3TD9A 2NX2A 4KN8A 2BTEA 1HL7A 5FYQA 1S3GA 4JZKA 3V4VB 5GV7A 5IN5A 4F1JA 5AW0A 4R0MA 1DQNA 4AF6A 4ENRA 2WLTA 2FW0A 5DHFA 3RWBA 4DOMA 4Z3KA 3NWPA 1J21A 5LQMA 4IO0A 3W8NA 3ZWYA 4LOHA 4D26A 5SZJA 2XWSA 4YMIA 1UR5A 1IOLA 1HMPA 1XEXB 4OHZA 1T9GS 3SMVA 4RK4A 1BDHA 3DD5A 1OC4A 1XELA 3D6AA 2IZ7A 3O94A 5ADVA 1Z2CA 2E85A 2GN9A 4BZXA 1BKSB 4C08A 1KHTA 2VDWB 4XB6B 2F8TA 1X7YA 3M1IA 1KO1A 1E3LA 4I6JA 3MT8A 4HNUA 4ZT2A 2JLRA 1IM2A 4OP1A 3CINA 4DM3A 2G6BA 2PG3A 4RVDA 3IMFA 5HIAA 2QG9A 3UHAA 2I6QA 2HSEA 2PA0A 4RCVA 4YX9A 1ZM2A 3GHHA 3MMZA 4F91B 3BULA 3GJSA 3W4JA 1LB1B 1NW3A 2ZIUB 4RELA 3NC1C 2E1PA 5GPBA 3GT3A 1HTWA 3G02A 5LBTA 3H42B 3T5TA 1PW7A 4FHFA 1T8SA 2ZIFA 5JWHA 1ZSYA 2AUNA 3LRXA 3P1JA 5I8ZA 5ALOA 3RRFA 2XXAB 2CXOA 1Q83A 5JC8A 4HCJA 2XBLA 2I22A 2RCNA 3KU4A 4CIAA 2H51A 1EG7A 3CF6R 1YFZA 1CG6A 2DX7A 3UZUA 1W4CA 1WW8A 3OM9A 2W6PA 1EWTA 1ISHA 1WEKA 2EZ9A 1XD2B 2XB4A 3HFRA 3BICA 1HZJA 2R6JA 3NUGA 5AJHA 3SJZA 2DB3A 3UAOA 1R4NA 2DWPA 3LY7A 1USIA 2CLMB 3G2LA 1H0RA 5BXYA 4OJYA 5GIPE 3KYCB 5ARBA 2X6RA 4ABTA 5REQA 3JRNA 2RJ3A 2EX4A 4N0DA 5B1EA 1SXJC 3VC2A 3FHLA 1JR4A 3AX6A 2D0DA 5ITWA 1EJBA 1I2MA 1X9HA 3A6HA 4H6VA 3EDQA 1K08A 1N6HA 2CHVA 3F46A 3LIPA 5E4FA 2PSFA 5A3QA 3BZUA 3ELWA 4EHLA 1DV2A 1OBVA 1SN7A 1U0EA 2OWDA 2CHGA 5H59A 2YHIA 2IYTA 5DGIA 4PSAA 4CTJA 3K32A 5FORA 3QXGA 1DX4A 4O4LF 2ID8A 5FOSA 1YOVB 4KPFC 5BYAA 1MIOB 3NGMA 2IPAB 1RXYA 1PJTA 4PTLA 5IAKA 3THWB 3JYLA 2ALJA 1DT5A 3MLEA 3QELA 1KGDA 3T15A 1QGDA 2SKEA 4DCVA 2W0SA 3P4XA 1X7WA 1KXZA 2OHGA 2C1XA 4FE4A 4IKPA 4MVWA 4Z0NA 1UMBB 4ID9A 3UXMA 2R86A 3DEKA 4KYIB 1I7PA 1MVLA 1XTBA 2REXB 3OZCA 3GBSA 5KS2A 5J3JA 3TVYA 4B2PA 3S7ZA 1I94B 2DWUA 1GGNA 2PKCA 4PCAA 1C2YA 4Q4AA 2HADA 2R60A 3KD2A 4BFUA 4RTLA 1QWSA 4TLBA 2I7XA 2W5UA 3EMKA 3NH9A 2X58A 1E79D 4JOBA 3HK2A 2FYTA 1AQUA 1C1DA 4BFSA 1QB7A 2IH5A 4JT4A 2HGZA 2IUEA 1GTVA 4HQ6A 4JJ6A 4LWZA 2WYVA 4PQGA 5KNBD 1JR3E 1EVZA 1Y1SA 2BFDA 4JL5A 3Q6IA 2ZG6A 2K2QB 2VZ8A 4OYLA 3RS8A 1T0JB 3SC6A 1VA5A 1AG9A 1XFDA 4R51A 3SIPA 3WK4A 1GPDG 4FX2A 2VPYA 3RS4A 1P60A 1SD1A 1RQ2A 3FNGA 3OP4A 4IIUA 4XDYA 3EMDA 3TNFA 3VX3A 2ZUUA 4PPGA 5K1ZA 5HJ5A 1CEQA 2BKEA 2ZZMA 4KREA 5TPZA 4HNAB 1G7SA 1LPBB 4NAVA 1DMSA 1CUZA 1UKAA 4ZCLA 5BWOA 3QF7A 4K6OA 5HHTA 2W2KB 4IX9A 2YJTD 1G3IA 1WPXA 5F7ZA 4YIKA 2H2FA 3AC0A 3HJUA 4MQLA 3I34X 4J6EA 2A5LA 3OMLA 4TL7A 4FC6A 1RACA 2XYGA 4PG4A 3SXUA 3HRHA 4KN6A 1E2KA 2RG7A 1XNGA 1X2BA 2Z5FA 5EIHA 2CVOA 4FB5A 3CE9A 5AI4A 4ZV9A 3OA2A 3ODPA 3D6TB 1U0TA 2G36A 3AMVA 3M82A 3RKRA 4BCCA 3UK7A 4B6JA 4DV6B 2AMYA 1OX4B 4LJKA 1NOJA 3RAJA 4BQSA 2P6MA 5JS8A 2ODEA 1N77A 4BJ5A 4ZZIA 4YY3B 1FLDA 3PXAA 5CJ2A 4CF4A 3DYBA 1Z6AA 3MJEA 3MBOA 5DGTA 3SOZA 4NULA 1Q77A 3FUCA 1NR1A 5TMEA 3T12A 3E3MA 2XEXA 1I0LA 5KTKA 4KFSA 2D2IA 3FUWA 4IEIA 1BEUB 2N75A 4ENWA 4ZVMA 2CXUA 4PNPA 2P90A 2AZXA 1QPGA 1L4YA 4PNHA 5F5XA 2R7KA 3CLHA 3NHMA 4H7JA 3AOGA 2P3LA 4RZ3A 2NUAA 2OCIA 2OE2A 4QUHA 5H3CA 1U5BA 4CFSA 5CGQB 5L3RA 2O8DA 2YJ3A 1DFGA 5AVOA 3H19A 4LX8A 4R2JA 4BFCA 3U2QA 3DDNA 4WKNA 4LXTA 4BEBA 2F8SA 3E5MA 5AVSA 1IK4A 3KL2A 4QYTA 5D3MA 3BJIC 1F8XA 1U7UA 1PL0A 5DLDA 4XOUA 2O0MA 4Q34A 2ORVA 1ZH8A 1G64A 2W83A 3AUUA 5EGNA 4HTFB 3SDZA 1J9GA 2CLIB 3A6LA 3INNA 1PD1A 1A9XB 3FYDA 5SYMA 3IT2A 5I51A 3L4JA 1QH0A 3MGAA 3RS3A 4PBRA 4HPWA 1NMSA 2C3UA 4B3TB 4CT0A 2JCVA 3CX4A 3GG2A 1EESA 3DC7A 1QV6A 1FFXB 3OPVA 2GWHA 1KC1A 4FPXA 2AG5A 5EWJA 4D8YA 4YMUA 4B8WA 2ODAA 4OL0A 5EIEA 1GJRA 3ZYCA 8ABPA 4QSMA 1RI4A 2QD4A 4F56A 2OAQ1 4GPD1 2ZGVA 4OUDA 3JATA 2G17A 1NVVQ 3FYUA 1NURA 3AUFA 3FTNA 4LYFA 4RD2A 1EZ1A 3A0RB 1DINA 4R9RA 4X64B 4EABA 4LVCA 3U4CA 4WLEA 4CIXA 4CPDA 3ORQA 1O94C 1SURA 1UBTS 1EJ6A 1KY5A 2I8CA 1E3WA 4KAAA 4BIIA 4JOSA 1TU3A 4L85A 2O54A 1TAUA 4FGWA 1GZSA 3L1HA 3ZD7A 3T0GA 3UJCA 3PHJA 4I4TB 4OGLA 4NH0A 4AX4A 2HO5A 1GU1A 1W0KD 4OJTA 4MPRA 4MP8A 3GPLA 4NESA 1IWOA 1GNLA 2EKBA 2O5EA 4MVJD 1XRMA 5LDDC 4WZAE 1LC3A 1N0WA 1YU6A 3DVQX 3GN1A 5TE9A 7MHTA 2J4DA 2ZR8A 2EERA 2AZTA 1N3BA 5JEEA 5ECGC 2P9HA 4Y6SA 1IIRA 4L74A 1P0MA 1P4HA 1RJFA 2E37A 4JC5A 1UZMA 4ETNA 1VHDA 1G5FA 4B84A 4LZAA 1D9XA 2Q5OA 3F74A 4G8BA 1LTQA 3BK2A 1V0JA 5BYJA 2L2QA 4YRKA 1LPPA 2JAXA 4BX2A 3CN9A 3NDJA 4Z9AA 2BGIA 2JGAA 4KYUA 1FSZA 4MYSA 4QOGA 1G8GA 2ZR9A 3OZXA 4XIIA 3TDNA 4LHXA 4NJEB 1IXRC 4XCQA 2ODBA 1WZUA 4QT0A 4OH1A 1SVIA 5F3DA 3OQVA 5DGCA 3U39A 1TKAA 2BUAA 2QIPA 2VJKA 1ZW6A 1KI6B 4A27A 2PXXA 3NKLA 1NN1A 1S8AA 1L3IA 1Q91A 1YUNA 2KYRA 2Z58A 3D8HA 3FPGA 5CDFE 2D8AA 4D3YA 1WUHS 4H3VA 1N0HA 2APJA 3M4JA 1J39A 4AFNA 1IHOA 1XVAA 2YWDA 1CR0A 1SKYB 4KIUA 1LTKA 1MV8A 3E48A 4GKAA 1UWLA 4C0BA 5FI0B 3ETHA 4FEEA 4BKOA 1K6XA 3DKIA 5LXTF 3B1JA 1ZNQO 4L8YA 1WBDA 4EO7A 4AY6A 4DR6B 4QQ8A 2OO5A 2C4WA 2DSTA 4RZQA 2I4RA 4DBZA 3NHAA 4RDCA 1DS6A 1F6BA 3ADKA 1QHIA 4KKXB 4W5WA 1R5BA 1X15A 2IYOA 4H7DA 3EPPA 4KQEA 4CKEA 5IJ0A 2YXNA 1QMPA 2LV8A 3CG0A 2UXDB 1LK5A 4UBNA 5DISB 2XRZA 1CEEA 3BTSA 1P19A 3PIDA 4GFDA 1I3KA 3GZNA 2HSJA 4I4IA 4K6HA 2BFCB 4MP6A 1PWXA 1JECA 1H6CA 1YR9A 5K09A 4ED9A 2JAQA 2P9FA 3D6VA 3ENQA 2JI4A 1F20A 4NEHB 1ZAYA 4E5VA 1RXUA 1NVFA 3EDMA 1VJGA 5IUJC 3DW3X 1GQOA 2OECA 3FUTA 3I9JA 1N6RA 3DQQA 4B4DA 4DKXA 4OYYA 1M2HA 1TUGA 5HJ7A 3KJZA 4OJMX 4WBNB 1QS0A 4M1OA 1DGQA 1XUOA 4MWBA 1H4SA 5DVZA 4XWTA 1LSSA 2WQZA 2HQOA 3QU4A 4TWBA 1XXLA 5A5FA 1YULA 1TO2E 4MV1A 2O8CB 1OPXA 4UCXA 4GX2A 5BSGA 4QJ4A 1LH0A 1XCOA 4FHEA 4MA5A 3BA1A 3OJXA 3HUDA 2BBWA 2BN4A 3KT3A 2Q5CA 2H1LA 4M1YA 2VQSA 3I1JA 3OCCA 4OB8A 3NHYA 1ZVKA 3L6BA 3C8MA 4FWIB 1HRKA 5JS1A 4MVJM 1J5XA 2HAEA 2CFIA 4LN1A 1U2QA 1OGJA 5AK6A 4CCYA 5IU6A 1SXJA 2ERCA 2DWOA 1W5BA 2P68A 4HDKA 4N8DA 4XGKA 4ZVLA 5I4CA 4UVDA 1RCTE 3QKUA 2JA2A 3Q8MA 3I6ZA 5H9WA 4XYEA 3U31A 1GRNA 4A0RA 1PDVA 1YOVA 5BQXA 3C3CA 3GRCA 1P3DA 4QGSA 4RDIA 2GAAA 1LU9A 1Y3CE 4MVJP 5A5EA 3NTVA 4YRPA 3CJQA 2L82A 2PFGA 3CEAA 1KS9A 2JBHA 2VDVE 1T8PA 3A10A 3QOXA 1AV6A 1RHKA 3VC3A 3RS9A 3B9PA 4B34A 4OPMA 2ROQA 5BURA 4PC6A 4ECEA 2GAJA 1TUBA 4B09A 2YXDA 1QFMA 4DJFC 4TN5A 2P40A 3P26A 3VH4A 2QX7A 4HDNA 2ZJ6A 3DZKA 4CL8A 2X0RA 1JG7A 1Z2PX 4R40A 3PYLA 1QKKA 2V98A 1J97A 3T7AA 3TF5A 1CY8A 3BERA 1DC5A 1JYSA 5F9HA 1LLDA 3WWOA 5HYVA 1B4DA 3RYFA 4A2PA 3D2AA 4E46A 2Z8YM 1ENOA 2WW8A 2ZI5A 3ESRA 1JDJA 2UDPA 2ZJ4A 4MS4B 1CPYA 2PMBA 5D2CA 4CG3A 3CVWA 5M7EA 2P4QA 2OCGA 1Y1QA 2R1TA 5LA6A 4O1MA 4JI7B 4UUNA 2PE5A 2WNHA 4M4SA 1L4KA 4N3AA 3IAAA 2YICA 4CQMD 2Z83A 4N47A 4KVZA 4NOMA 3THXA 5BUQA 4D74A 4GBGA 3I2YX 2XQGA 3TLCA 2JCGA 5BSFA 2ONZA 4EMSA 3HEBA 5C1PA 1V6AA 1Z2AA 4G36A 3MG9A 4AUMA 5IFLA 1GV0A 3Q3GE 1HWYA 1SC3A 1HDYA 1OAOA 4EVQA 2VJNA 4J43A 4LRSB 1UODA 4UBJA 2V6BA 4Z4HA 2HDWA 1DZIA 1YB5A 1K7XB 1GYQA 2CHEA 5ALYA 1G20A 1RPNA 1Z7BA 2CNWD 3BFPA 3CR7A 3O9MA 4D98A 1GKYA 2Z6VA 4F5YA 3C3BA 4D3FA 1EI9A 2X2PA 3BX1A 1P9LA 3NCHA 4CEJB 3CF4A 3HKBA 2YXBA 5KTNA 3QUSA 1MO4A 1R7RA 4K0KB 3SVZA 2W2PA 3PK0A 1R3UA 1QMGA 3OZUA 4P83A 1NC1A 2FLVA 2EARA 4C07A 1AQ6A 3VUEA 4B4WA 5KX5B 1M2KA 1UBRS 3PKJA 5TT0A 3RRYA 1ZZEA 3TLEA 3UJ9A 3KBBA 3L82B 2ETVA 4EYGA 2RDMA 1Q0RA 4D5GA 4LF5B 1OE0A 3N59A 4B83A 3HFGA 4J0GA 4ENQA 1N9GB 1S2MA 1VJRA 2H00A 3PSAA 4WXEA 2OYCA 4F96A 5JYCA 3M89A 1N2GA 5KOJA 3E61A 3TQQA 2PQ6A 2W8BA 3C3XA 3ESCA 1JUDA 2ZB3A 3CRZA 3GJ4A 5I3ZA 1JZSA 3GLHB 1G7TA 1DKLA 1EVYA 1MU0A 1JHMA 2P1DA 4L9SA 5COBA 4J49A 5J59A 5A2QA 2HPZA 1TIPA 2P6NA 5KUTA 3VOBA 4DMHA 3QVWA 1KYWA 1V96A 4NJMA 3UMCA 1PJAA 4ARIA 16PKA 2I67A 1XKLA 2IPXA 1ZNYA 1XZMA 4GL4A 4KYTA 3FBWA 2RBGA 3LSYA 4HBZA 4OQ4A 4V0KA 1ESDA 2QTMA 2NU7B 3O6VA 3RR2A 3R5XA 5AJWA 4L7VA 2BBOA 3HCEA 3VH2A 2O2GA 4EF5A 4EL0A 3KVRA 3L92A 3CIFA 2ZIEA 1FDVA 3FYUB 1EUDB 2FQXA 1L0BA 4OMUA 1GNPA 1TGYA 1XG5A 3RYIA 3HCBA 4DABA 3UMJA 4NV3A 3TLMA 4O2BF 1IUOA 1KJJA 1P81A 1VIAA 1YBVA 1JQKA 4YP5A 3OY2A 1DIOB 4EM6A 1LJUA 1G66A 4LXYA 1LX7A 1OVGA 3V2IA 5ILGA 4DV4B 4OB6A 3ZWXA 3RC3A 1D5CA 2IUSA 3H16A 1L4MA 4LJ6A 4YLEA 3KE8A 2B5WA 3H2BA 1DTWA 5A2GA 5AI9A 2QMQA 2J32A 1AZLA 2R8ZA 2FV8A 3GEHA 4QUAA 4AJ1A 5DHQA 3QEBZ 4OXNA 4G1EB 2R5FA 1W4RA 3N28A 2QF7A 3ZDDA 2DFNA 1E9SA 3AOEA 4S1NA 2V7TA 4ZI7A 2G40A 2D5BA 2O2CA 2JIQA 4Z5XA 2IYUA 2FPIB 4MPJA 4AICA 4V0LA 3CVVA 1SIOA 1B1CA 1ZVJA 3LBYA 4L75A 1Z68A 3L8HA 2DQSA 2W2TA 3LLSA 3OUUA 1NWCA 1W6UA 3D81A 3IDZA 4I1UA 3GRFA 4C0SA 3FTEA 3PNSA 1R2QA 4X24A 1Y4AE 2WABA 3AETA 3ZGVA 3N3AC 2LE0A 5JFGA 3U3KA 5BR1A 6NULA 1SU4A 2F00A 3LUDA 2E7ZA 2J3LA 2B1JA 3CLRC 4A3SA 4DC0A 4FNGA 4NICA 5HTOA 1VZ3A 4ID3A 3ZU5A 3HLTA 1HPLA 1OU4A 2C4HA 1T6BY 1O95C 3U3DA 2H54A 5C2JB 4IGAA 3AZPA 1AKUA 1ETUA 1AE1A 3IB6A 4J0KA 1ZW1A 1AH2A 1GPAA 2HWWA 3T6KA 4BMVA 4PHCA 3DL4A 1I3MA 4Z4CA 4RIFA 4BUCA 1JKIA 1CC1S 1IJKA 4PG6A 1F8YA 2P62A 5H4GA 3ZWNA 1MEOA 2Q2OA 5EMHA 2OXTA 4LISA 1H1TA 2B4YA 3RTBA 2VWGA 2BRUA 2Z1NA 3EF1A 2P6RA 3JZIA 2EU8A 4HZUA 3OIFA 1K3FA 4OAPA 2BTQB 3LC0A 2HMWA 2NUBA 3L0BA 1VG9B 2QORA 1FDRA 1J06A 3ZZ1A 4MGHA 5K01A 1YONA 2AYYA 1FFXA 1XDGA 4G63A 1U5CA 3R7LA 2E4UA 2J48A 1GGKA 1GOTA 1FFSA 3H8VA 3NHRA 4JL6A 5GZ3A 2C7RA 3KTAA 1OBOA 2NAFA 2YMPA 4URZR 3H84A 4I55F 1M2JA 1QG0A 3IR5A 4C7XA 4K6GA 5EUMA 4ENPA 2ZIGA 3U3ZA 4NMMA 3E9EA 1DJQA 1PSDA 4HWKA 3EN0A 1MG5A 2B3TA 3NEYA 1U2PA 1FYFA 3PS9A 3MMSA 1Z6TA 2DKNA 5BWBA 4RA9B 3EXFA 2AR0A 3DFFA 3H6HA 4IX1A 5A7HA 1L5HA 2Q3FA 5IBQA 1ZJYA 3H1GA 2F4NA 3ITKA 2VHJA 1O57A 2PUWA 2VZ0A 3EIEA 2PJZA 3V4SA 4A10A 4D4HA 3WJAA 3ZKAA 2Q5LA 3RIGA 1NATA 3PEUA 4EGCB 5E7MA 2C3MA 4TKVA 2YZNA 4FKMA 2ZR7A 4FFSA 4C76A 2AFHE 4ZAFA 4P32A 2D4AA 4YRJA 3MJRA 1NVKA 3OZDA 1DOHA 3N8HA 5G1NA 4RANA 2NP6A 1Q3KA 1LTHR 3C8DA 1AN0A 3H9EO 4QTUB 1NDQA 2B2XA 2Z5GA 3JQ8B 4LNUA 4A1FA 4CF7A 3T41A 5E9WA 4YJDA 1O5TA 1IEVA 4Q37A 4HN9A 1E8DA 3BH0A 2WVAA 2CYCA 4ER5A 2OUKA 1OB5A 4IEFB 4UZEA 1YJXA 4AZTA 1LSUA 3JASA 5F23A 2QW1A 3EBOA 3DOIA 1KQFA 5DTQA 1GQQA 3K20A 5IJXA 1YCFA 3ZK8A 4CTOA 5CVCA 1NW7A 4C4ZA 3D7MA 4BN0A 1ADJA 1HE2A 1AHIA 3O1JC 5JAIA 2QN8A 3AY3A 3DHWC 3D8TA 4NYMR 4XWOA 2IBMA 2JLWA 2QRMA 2GILA 1Z4OA 4X3PA 1MABA 1MEJA 2P4UA 5D1NA 1UT5A 2XEDA 4WJLA 3QW4B 4F38A 3ZCTA 1AQIA 1GZ7A 4XGQA 1Q50A 3RODA 4RIEA 2HRBA 3C97A 1DKQA 3FZYA 2XSZD 5DPMA 5FCDA 2A57A 3SYKA 3WHPA 5BOSA 4A0HA 2W43A 2JGRA 4TS9A 2OMKA 2QTAA 2B1RA 1JA0A 1W73A 4OK3A 1P2TA 5CX4A 1SKMA 2ECFA 4UPEA 1C7QA 1RWNA 2JBAA 3ZEAA 1YAJA 1U3WA 4GHWA 3U1VA 5C18A 1I30A 1VSQA 2YWRA 1ONSA 3E3OA 3ENVA 3PF8A 3EEBA 4EI8A 3PG5A 5P21A 2BI8A 2Q6TA 3FLAA 3KC2A 1XCMA 4WLUA 1WDKA 4TZKA 3GFOA 5HX7A 1NUTA 3OJWA 3PEWA 5HNKA 1EVLA 3KRTA 5LPNA 2GD2A 3HJGA 5D5HA 2XQIA 1DC8A 3R3VA 5JYBA 3MILA 4N5LA 1E94E 2QLFA 4JL8A 3T5CA 3NO4A 1ZUD1 4DT1A 1B2RA 1GARA 5JNVA 2C2BA 1U0SY 5FL7A 3U40A 3SPXA 4YRIA 2IYLD 4KG7A 1IBRA 1U0GA 3UW1A 6ADHA 2I9KA 1GZHB 1TF7A 5KQRA 2A0WA 3MGBA 4J4HA 4WX2B 1IN4A 1ZUWA 1C3EA 3WTBA 2JZCA 3VDRA 721PA 3I53A 1B26A 5DX1A 2B2CA 4N3NA 4A7PA 2VT3A 4TXLA 3RBZA 3H2JA 4W6QA 3QXCA 5NULA 1W5TA 2CHQA 2Z2KA 3IO3A 3LGSA 4IVNA 4NYIR 3DDWA 4U3JA 4V2UA 5ES3A 2J5XA 2QTVB 4RZUA 4HJXA 3LK6A 1XB2A 3ZIAD 4QPJC 4X91A 1R9MA 2O19A 1UMDA 2HWYA 4LNAA 3HJTA 2HLDA 4WNCA 1A7AA 2QA5A 2C7BA 2VS1A 3UJ8A 2XV1A 1AD2A 1MX1A 3RYTC 1QVZA 1T91A 4B3RB 4U9HS 3M1LA 5IVKA 4EHNA 2I66A 1D03A 1BW9A 2BSXA 4MW2A 2NO5A 1BQEA 1XMJA 2REQA 3B2EA 3W05A 1X3SA 3W9BA 2YJNA 4MJ3A 3U4QB 3A32A 3DL2A 3SJCA 5A4AA 2WHPA 3FE2A 2D5AA 1I32A 2G80A 2JFYA 1YO6A 2Y0CA 4EZEA 1DE0A 4O0MA 1SCQA 3R0QA 4IJMA 1IPEA 1T5SA 3LUKA 4NTZA 4QTZA 4S1PA 2WZDA 3IT1A 4MR8A 4A03A 5IAOA 2O2HA 1XV5A 2ZT5A 5IMSA 2AQHA 2Q1UA 4JOQA 4CYMA 1U9IA 3ZGLA 4FOLA 2Q9CA 3K8QA 1PZXA 2FWRA 4M37A 5TF0A 3ZHBA 3L7YA 2H4HA 4G4IA 1GU7A 4MA0A 4BC0A 4AZSA 5CCEA 2D3TA 2BGTA 4EUEA 1A8SA 1EPUA 1DRUA 4KGXA 2H2GA 1JR3A 4DGSA 3OT1B 5BV7A 3H86A 2VAWA 1SQ6A 5LDGA 1QOPB 3BH6A 1OI4A 5F78A 3B2QA 3I9LA 3RSZA 3PB3A 4W5JA 4WVLA 3RUFA 2AG6A 3DFUA 2GRJA 4RFSB 5CFLA 3LO8A 4UE2A 4ZCQA 3B3JA 3GFSA 5J1SB 4PGFA 1LPMA 1SBQA 3J7TA 3AVVA 2O7SA 1NG1A 1XPUA 1FVXA 3ABOB 1ZL0A 2I1VB 2NQ8A 3FD8A 3EWNA 3LMKA 3O4RA 3WNCA 4AJ2A 4CI9A 4M0EA 3T3HA 2MOKA 1JHDA 3WDSA 5F7XA 3AY0A 4NMXB 3S2ZA 3F6PA 4LMPA 4LI3X 3NHSA 3V3KA 3ND9A 1AQJA 1PLLA 2N1BA 3KJHA 5DHUA 2VL7A 3S29A 3JQDA 1TKCA 3K1ZA 3UTDA 3GGOA 4K9MA 3LYHA 3T52A 4YQFA 3V5NA 1ZUHA 3HJRA 2XT9A 3HBMA 2WG2A 4MHSA 2XUQA 4IHJB 4QWWA 1OKKD 3OQBA 1IQ0A 2QV7A 2WNIA 2CWDA 3ETDA 5DLPA 4ZVVA 1ODIA 2Y71A 2BCJQ 1KZGB 1R10A 1Z4QA 4DC1A 3HYLA 1L7DA 4JIMA 4O4JB 2ATCA 4RKYA 1M2VB 4UMFA 4CLOA 5ITZB 2UU9B 5EUBA 2B4RO 4YC7A 3MGCA 5EJ9A 1PNTA 1HNNA 4IIXA 4NV1A 5TQ0B 1ISMA 1R00A 3BGDA 2B6HA 1AF4A 1XKQA 4NFYA 3S2FA 5FEMA 5K0BA 4A8TA 3BOSA 3SC2B 5JSHA 4P35A 2C5SA 2IYXA 4IHJA 2RGEA 4RTOA 5A7GA 4JUBA 3EDRA 4ZRMA 5GGXA 2V9CA 4OLJA 2QQEA 2YMLA 3VPAA 1IMOA 1UIMA 2FZCA 3FOFC 4MWEA 2QMOA 1S3FA 1RM0A 2PZEA 4BO6A 2P9ZA 1IVSA 1V2HE 1WZCA 2PKRA 3AB3A 3L0IB 4UHCA 4CKCA 4P5DA 5D6OA 1J4AA 1YR8A 1MZVA 3DWFA 4KLAA 4RZSA 2Q5QA 3A6ZA 1U2DC 1B74A 3I4LA 2WQ7A 1JVNA 1L5MA 4HTAA 1WXXA 1YS7A 1JHRA 4WNIA 5AJXA 4AMVA 1D2EA 2CDBA 4BKRA 2XOKD 2Q07A 1VM6A 3JQ6A 3KSDO 1XFAA 3B5IA 4DXHA 4LYJA 4BLRA 3NGLA 1AGXA 1PL6A 1GN8A 4AZ0B 4TMTA 3WNQA 5T4HA 1M1UA 5ITVA 3HNOA 3CR8A 1ZK4A 1SIUA 3LPMA 5H82A 3NHLA 2D2XA 1P7VA 2JH8A 2ZRFA 3WOHA 1SELA 1VXRA 1YQUA 1XXHE 2IITA 3ONNA 3AFGA 1YCHA 3QBJA 3IJRA 4O5AA 2X0NA 1II9A 4LOLA 5GM1A 5IARA 1MP0A 1G9SA 1M8PA 3FSRA 1KSGA 3G8YA 2NV2B 2VPZA 3RUDA 4NDNE 2GEKA 1JW9B 1NXSA 3BWYA 3F7OA 3C15C 2FF5A 2GPYA 4XCXA 1F4VA 3SNKA 1PR1A 1TTHA 3L4EA 3DVAA 1B6TA 4NHOA 1YZLA 3C5EA 3SM3A 5KC9A 2ZAIA 1WUIS 3K0BA 3WB0A 1RQPA 3TB6A 5JJBA 1N8KA 4RV5A 3TW8B 1YDHA 1XZDA 2A9VA 3RHTA 1JWLA 3BFVA 1RAFA 1P0QA 3SR3A 5BV8A 3JR3A 3Q7PA 3LDGA 4XASA 4GLJA 1ZVMA 2CDAA 2X4IA 3E53A 1N1DA 2GM4A 4FD2A 2WJ6A 3FOAA 2PVCA 3GIWA 5LYJB 4A2QA 1CJVC 3T1HB 4G8CA 5C5CA 3RK4A 3TEFA 2GN6A 2GXSA 1RI5A 3P71T 3UT0A 3NG1A 3WKAA 5HKAA 3G2MA 4TXHA 3K2IA 3DAPA 3PFHA 1KJYA 3CFYA 4OOFA 3LFTA 1AHHA 1R0XA 4RFVA 1RMYA 3OT4A 2Y68A 3DMGA 4Y18A 1E4YA 5K8VA 2CXQA 5E2IA 4NI5A 3CNOA 4LZLA 2XYPA 3EG5A 3KZXA 3ZHQA 4W8HA 1DKPA 2DF8A 1HEYA 3BKWA 5FNVB 3DJYA 4A8JC 1D1PA 1P9RA 4CM4A 4EITA 3K35A 3RK1A 2JIOA 3UMBA 1WP9A 5B4TA 4DUGD 1MAWA 5A04A 2OHIA 2BH9A 4ZV7A 5I7OA 2J08A 4P3XA 3ER8A 1HK7A 1VRWA 1XYVA 3AEUB 1KOJA 3LWDA 3EGIA 3TQFA 3TQSA 3HVKA 2NUPB 5DTEA 3V34A 3VNSA 5CLGA 3S70A 1MV5A 4IG9A 3W9UA 1WSDA 1RRVA 2IYRA 1RYMA 3FH0A 1OREA 4LOJA 5ED0A 2G9UA 4J0JA 4I8DA 1M8GA 1F3OA 2DPXA 2EJWA 2XD9A 1MZPA 2HKIA 1RTKA 4OGGA 3S99A 1J56A 1NVMB 3CTMA 3HHEA 4PR0A 4KMOA 1F5SA 4Z4IA 1NZDA 2ZS9A 4U2EA 4Q9JA 5KHAA 2OC9A 1KTIA 1YIDA 1N2CB 4H35A 4NX2A 2GZDA 1J20A 3LP8A 5ESWA 4UNRA 2FOLA 4PYMA 1CDOA 3L0SA 2X4DA 3EA0A 1N2CE 2FE1A 3C7DB 4PZLA 3EEYA 2JLAA 3QG5A 3AV3A 1UKYA 3RVKA 2D5CA 1U2TA 4G5GA 4OMDA 4M1MA 1KIMA 2XGOA 3CH5A 4AF7A 4NOJA 5IASA 3ZWBA 4UMVA 4L0DA 1MGOA 2FUG6 5A3RA 3QNWA 5H5JA 2M9MA 2VHTA 1YFLA 5CDSA 4X94A 4FOTA 4KQXA 5TY0A 2W42A 4MSUA 1U63A 3WL6A 4TQAA 2AYXA 1X6VA 1V7PC 2I7VA 3W3AA 2RHBA 3FDJA 4IILA 1W29A 2MSLA 2C7OA 1DKOA 1I24A 1IPHA 2XLCA 3C5WP 4DSOA 1K0UA 3FFXA 4LX0A 3JD2A 3C6ZA 2DR2A 1RYYA 4ZT6A 4KZPA 1U3GA 2ZIWB 1Q0PA 3FIUA 3RU9A 3H5NA 4DMFA 1MH1A 3AF0A 1M34A 1S2IA 4G5YA 4HFMA 5ER9A 1W5EA 1D6MA 1KZYC 4R8MA 3ESDA 2H8GA 2XNDA 2RHCA 4PAMA 3IVAA 4J0IA 3PUIA 3NNSA 1DEOA 2GZHA 2DFDA 2WV9A 3Q72A 4Q00A 2QP4A 3F5FA 2AW3A 4ZYTA 3AR7A 4LQDA 1NSTA 4IDGA 3WK5A 1XNJA 2XVAA 5CD9A 5HKBA 1DARA 4BAUA 2YQZA 2FSPA 1MORA 1X1DA 4URUR 4MGIR 1NY6A 1VIYA 1Y4DE 1EFKA 2PLAA 1OFIA 1J23A 1D07A 1R27A 3A28A 2KQUA 3B3QA 3FFBA 4H0NA 4TPKA 4HS9A 2ZIXB 3BGSA 1MB3A 1NUSA 3D1VA 3JQFC 4G9BA 1K3UB 2DTEA 4OJQA 3K8YA 4S0ZA 5HG0A 1RPJA 5TQ2A 1KRWA 4RA6B 5IUKC 1UK6A 2LNDA 3S8MA 3FTPA 1GNVA 4B6OA 5LM3A 1CF9A 1RKBA 2UYQA 4L9RA 2VXBA 3RSOA 3B53X 1V47A 4ZRNA 1BCRA 1MO6A 1YV9A 4YJ3B 2OFXA 5LLSA 1CXZA 4PCUA 4IUBS 1CD5A 4F3YA 4LVOA 5BSTA 5BN1A 3KK0A 4EWLA 3GGJA 1MOQA 5F2KA 4HP8A 2OXCA 2FMHA 3NBYC 4HUTA 1RLTA 4WFJA 1QUFA 6Q21A 1VE7A 2PGJA 3DONA 1O77A 1CIPA 1VYTA 2RAUA 3D6UA 3E2MA 3PPIA 3VC7A 4DQKA 1G9TA 3KDSE 2OILA 5TIIA 3JWEA 3R6DA 4C7BA 2BF4A 4R2KA 2ZWVA 5BW5A 5ICGA 4GRIA 1OB2A 3F6BX 1SZDA 3PD0A 1SOAA 3W1EA 4H0FA 1M2FA 2AUTA 2CFRA 2WYHA 3BIXA 4B4UA 1JT2A 5H83A 4QNMA 2BR3A 3L4BA 4HMQA 1U0BB 3LHDA 5BSUA 4FNAA 4C7KA 2F3RA 2RI6A 1T5DX 3AF4A 5CBPA 4M9ZA 5CLFA 1HYEA 2UUOA 3DFIA 1FSGA 2ISCA 3ZGNA 3COJA 5BW8A 2V0GA 3DQPA 3VMMA 4MCAA 4PRLA 2B61A 4NG5A 2OY0A 1RADA 3IYLW 4JH0A 4OMCA 3VPHA 5AD1A 1FLNA 3DXFA 4DTCA 1AA6A 1SVSA 2BSAA 1KMHB 2OT3B 4ZXFA 5LOVF 4KHPB 2C04A 2Y92A 1GA1A 1KZ7B 3GJ5A 3K0FA 2X9VA 1Q1BA 1V41E 3RG2A 5TEVA 4N9WA 4DAOA 3ZHXA 2ZJ7A 3CRNA 3LT2A 4V1CA 5ELXA 3D0OA 2P9CA 1RXIA 1QYWA 1UT6A 3E2IA 4G0XA 1T8YA 2VHEA 4I5FA 1Z0ZA 3CLSD 2GERA 1TVCA 1ZK2A 2C7GA 2R751 3PP8A 4KW7A 3WBFA 4EYEA 5JQGB 3CURA 1WD7A 5EQDA 3ZR4B 2QPLA 4Y6GB 2H6EA 3IA2A 1H65A 2A9JA 3TE7A 3FUVA 4BFYA 2J0UA 3MWDB 1U94A 1ULUA 1WQ4A 2RAPA 1IRXA 1W47A 3NTOA 3AF2A 1MOSA 5AJZA 3IJEB 4KBFA 1ADGA 4YFVA 5KYGA 2CMGA 1A7UA 2PAFA 4QYWA 3MINA 3SFTA 3WGNA 3KEOA 4CCWA 2HJSA 4JUAA 3R5HA 1AX9A 2X9LA 2WT8A 2H0AA 1RAEA 1VJDA 4QNNA 1CJTC 2W70A 3PJRA 1I9CA 3HCFA 1Y37A 1C8LA 1VKRA 4FSHA 3EODA 4R5MA 4E70A 5TX7A 2JEOA 1CJBA 1X7DA 3D43A 2ZDHA 3R4CA 4JXZA 1ECBA 3GGDA 3ADOA 4B1FA 4GM1A 1EBBA 3FRJA 2BCEA 2NW6A 3GVPA 4RY8A 2G28A 4D4MA 5DULA 2XVXA 4L02A 3HKEB 3OEWA 2H2WA 3R3ZA 2CUTA 4TYWA 3ULKA 2EDAA 3QW2A 1A2KC 3T99A 2B30A 2YL2A 1GZ3A 2C0PA 4GOXA 2NUAB 1E1RA 2NTVA 5A4KA 1O0BA 2FDCA 3DT9A 1PR0A 3OFJA 2GHIA 1FPQA 2I71A 5HP4A 2QTBA 5DHSA 2JIZD 4CLDA 2ZSIA 4CU2A 2FB9A 3ZY2A 2FH5B 4EG0A 4G9GA 1OWLA 4NJMB 2BT4A 3A6KA 2ZRIA 4O4HF 1HT2E 3KLOA 1FDOA 3C6QA 3AB8A 2Q3DA 3KX2A 1T10A 3LNTA 4GBMA 4RFLA 1BCSB 1NPDA 3NM4A 3AYZB 2WJJA 2CUKA 2VSQA 1XBTA 2J