4D8VA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8vA00
3PNPA 3DDOA 1T8SA 1YR3A 3NM6B 4D98A 1C3XA 5I3CA 5CCDA 1TD1A 1NW4A 1M73E 4F2PA 2AC7A 1JDVA 4LKRA 3UAVA 1ODLA 1T8YA 3PNSA 4LZWA 2HSWA 3ENZA 1OTYA 3BSFA 3FB1A 3KVVA 2OC9A 2QTTA 3P0FA 1JYSA 3EUEA 4GLJA 3UT6A 3ODGA 3QPBA 3GGSA 4JP5A 3MMSA 4L5AA 4R31A 3E9ZA 1LX7A 1A9TA 3KUKA 4G89A 4LNAA 4KN5A 1VHJA 3P0EA 4L5YA 4QFBA 4DAOA 2I8AA 3PHBE 5EPUA 4WKNA 5CXSA 5F7ZA 4OGLA 4DA7A 1PBNA 2AI2A 3LBAA 1ZOSA 2HWUA 5B7QA 1PR2A 3U40A 4DANA 4DABA 4MCHA 5K1ZA 3KU4A 1ZL2A 1K3FA 1I80A 3OPVA 1YQUA 4D8YA 3E0QA 1Z5OA 4G41A 4EB8A 1PR5A 1Y1QA 1LVUA 5CCEA 3FUCA 4U2KA 1TGVA 5KB3A 4TXNA 4L6IA 4M7WA 1LV8A 2AI3A 2OXFA 3K8QA 4QEZA 2A8YA 1U1DA 4TTAA 4IP0A 4QATA 4DA8A 3OCCA 4UC0A 4TS9A 1V3QE 5F77A 1FXUA 5IFKA 3DP9A 4R2XA 3UAZA 1VHWA 1VMKA 3DPSA 5CYGA 2PGAA 4FFSA 1ODKA 5CXQA 1SQ6A 2GUWA 3D1VA 3ONVA 3K8OE 3LA8A 1U1EA 1G2OA 1Y6QA 3NBQA 5F7JA 4TTJA 1JE1A 1JDTA 4M3NA 1A9OA 4PR3A 3OOHA 1OVGA 4WKPA 5F7OA 4GMHA 1N3IA 4YJKA 3GB9A 1Z33A 4YMLA 3SCZA 1A9PA 4MCIA 2XRFA 4QAQA 2Q7OE 5B7GA 3EMVA 5F78A 1B8OA 2QTGA 3INYA 1Z5PA 1JPVA 1U1CA 1RXYA 3PHCA 3IEXA 3KVYA 1RXUA 4F3KA 4PNPA 4TXJA 1K27A 3BJEA 3MB8A 1A9QA 1U1GA 3EUFA 5F76A 1V45E 1A9RA 2A0WA 2H8GA 2B94A 3NM4A 1Q1GA 1ULAA 1JDSA 1OV6A 1PK7A 1PK9A 1PR0A 2OC4A 4D9HA 2QSUA 1K9SA 5JPCA 1TGYA 3C74A 1V2HE 4YNBA 5C80A 1TCUA 2P4SA 3F8WA 3OOEA 2A0YA 3OZDA 3DF9A 1ODJA 5CYFA 1A9SA 4OGKA 4D8XA 3FAZA 4NSNA 1VFNA 3TL6A 3UAXA 4X24A 4OJTA 1JP7A 4F3CA 1RXSA 4WKBA 2A0XA 4GLFA 4LDNA 5EUBA 5B7NA 3UAYA 1CB0A 1NC1A 5EFOA 2QDKA 4DA0A 4WKOA 1RR6A 4R2WA 1QE5A 3E9RA 1PR4A 1SD2A 4YO8A 2HN9A 1PWYE 1WTAA 4QARA 4WKCA 4RJ2A 3LGSA 4E1VA 1ULBA 4DARA 1RXCA 5F73A 4JOSA 1JDZA 1RCTE 4TTIA 3O4VA 3FOWA 4BN0A 1CG6A 3OZBA 4TXLA 3UAWA 3OF3A 3BL6A 1PW7A 1JDUA 4BMZA 1Z34A 1SD1A 1Y1RA 1T8RA 4NS1A 1B8NA 1PKEA 1PR1A 3FWPA 4L0MA 1JE0A 1NC3A 3NM5A 1Z39A 1RSZA 1Y1SA 5IU6A 1T0UA 2OECA 1U1FA 1YQQA 4JWTA 1OU4A 4DAEA 4D8VA 1OUMA 4EARA 1Z36A 4BMXA 4TS3A 1OTXA 2HRDA 2RJ3A 5B7PA 4OEHA 1YRYE 1XE3A 1V4NA 2AI1A 3KHSA 1Y1TA 1RT9A 3FNQA 2I4TA 3EEIA 1Z38A 4NY1A 1YBFA 5DK6A 4L5CA 4OY3A 5F7XA 2ISCA 4G8JA 3DJFA 2IQ5A 4DA6A 1V48A 4GKAA 1Z37A 4F1WA 1ODIA 2QPLA 1Y6RA 1RYZA 3BGSA 1ECPA 4ECEA 3OZCA 1Z35A 5ETJA 3KVRA 1T8WA 4MARA 4BMYA 4P54A 4OF4A 4TXHA 4LNHA 4F2WA 3T94A 3O6VA 1TCVA 4H1TA 4QASA 2ON6A 4M1EA 4TXMA 2BSXA 1SJ9A 4I2VA 1RFGE 1PR6A 3IOMA 3OZEA 1PF7E 1V41E 4TYMA 1Z5NA 1A69A 4K6OA 5FAKA
chains in the Genus database with same CATH superfamily
3OY2A 2AKYA 1T8SA 1YR3A 2PU7A 1JV2B 2R44A 3DMDA 4GQIA 1EP9A 4GZ3A 4TLBA 3VZRA 5E2AA 4WK4B 5I3CA 5CCDA 2EU8A 3GVHA 1P5RA 2H2FA 2A5FA 2PZKA 3U2QA 1ADCA 2ODTX 1MJNA 2X19A 4BGIA 4E2ZA 2A1UB 121PA 3FUUA 4PYRA 4R01A 1PVVA 1DXOA 2CCJA 3BE8A 4DV0B 3DXZA 4FHZA 3QX7A 3QBTA 4K3VA 4RK5A 3E3NA 2PJUA 4IUCS 1CUWA 3BS4A 4NCAA 3QWIA 3KBBA 3CLVA 2HSWA 3GC6A 4BPBA 2BMWA 4MR8A 4XD2A 3K53A 3WVNA 1T9BA 5K05A 4DCJA 2OHJA 3L4BC 3MZ0A 2B4TO 3I3SR 2N47A 3C8DA 3OTIA 5EMKA 4ZCMA 1ZBDA 5IX8A 5JJKA 1QO0A 4B0PA 3WGQA 1SC6A 3IVCA 2N75A 1DBSA 2OKGA 4MV5A 3DGEC 5FWNA 4NV0A 4QG7A 2VOEA 4G67A 4KDEA 4HEJA 2JH3A 3GVXA 4XX1A 2GQ0A 3QEMB 3GOHA 3QUTA 1ZEMA 4G0YA 3CX6A 4HXEB 2BY4A 2IDMA 1P8AA 2ZG6A 1NDUA 4INAA 4MQFB 3MILA 5TQVA 3TBKA 5CEJA 1CJKC 5TMBA 3WLAA 4LNAA 1XZFA 3LLUA 4CCYB 4EKDA 5CDHA 4KR3A 3IEPA 5KU7A 1V1MB 4N5IX 4R9UC 5KREA 1SKYB 1RE1A 1FCJA 3GG9A 4CU2A 1RJEA 4DR1B 1BZYA 2FCAA 3PCTA 3PHBE 1SBCA 3WR5A 3TSYA 5AXCA 1X19A 4CF4A 1Z0JA 5DKFA 1C30B 2PE5A 1NI5A 3ER8A 1C50A 1FTWA 2I3GA 3JTEA 1VL8A 3LBAA 4N40A 4XVRA 3U6BA 1LRJA 1MX1A 3CLSD 2FG6C 3DCIA 3EYAA 3M49A 4GBMA 4NNOA 4RJIA 9MHTA 1TYDE 5E6SA 1EFDN 1P62B 2AV6A 2OZLA 3KYCA 1X80B 1IAVA 4U1RA 5DNCA 2DQSA 1Q0HA 5EKSA 3CRMA 1VGQA 3BGIA 3RS0A 1NF3A 4F60A 4YCLA 2TMYA 4PX3A 3K71B 1VCOA 3SQLA 1P4JA 1PUXA 5HF6A 4C3UA 2OOSA 1SBNE 2YJZA 1GFSA 2ZWPA 3GJQA 3ILVA 3L8ZA 3QV1A 1MDBA 1T9GS 3OH8A 2Z5GA 1TM7E 3DTVA 1DCMA 2ERCA 2JAQA 2Q9BA 3JWEA 3WK4A 2MWMA 4IRMA 2XR1A 1T3TA 2ZWMA 4QOHA 1BE8A 4I3GA 5SZJA 2PD4A 2JGIA 1EVEA 3OF2A 3PUYA 1TFRA 2ZE7A 3B3JA 1L3CA 3UJCA 4FVTA 4DGQA 2Q5FA 3MS4A 1Y1QA 2C5FA 1MKYA 2I99A 2JEYA 3OEWA 3H9CA 3QF4A 2WUGA 4JT9A 4ME6A 4NZOA 5AIBA 5LR6A 5F4BA 1RFLA 3V8PA 4E15A 2WT9A 4NQRA 2XWPA 5F1KA 2XCOA 3AM3A 4Z53A 1KOFA 2BT4A 4FU0A 5NLLA 4ZIRB 2F8TA 2VBCA 1AQIA 4HOYA 4KIFA 4RV9A 3E7DA 4C4SA 4JFAA 4D74A 4HRXA 2QV0A 5T7BA 2VYND 3QVOA 1OFIA 3ZE1B 4YRBA 1RWWA 3FFAA 4BNJA 3CJRA 1YI8A 2X9GA 5K3AA 4B85A 5K8LA 2APJA 3GLFB 3NAZA 1OBFO 4NESA 1UP7A 5FAXA 4HNQA 4ETIA 1U1DA 4F2GA 4TTAA 1T2DA 1QVRA 2Y6VA 2ZRJA 4MA4A 5HQ3A 4R2LA 2CJWA 2C59A 4LUCA 1JQDA 4J7XA 4LSMA 4E07A 1LD3A 4PAOA 4BWVA 2ILTA 2F43A 1J7JA 4CXMA 1XMOB 3RF7A 3RYCA 2VHCA 4O0LA 2EW1A 4WFKA 1XHLA 2PD6A 3RKSA 3GBPA 2O19A 2O3JA 4DIDA 1KDTA 5CLHA 3ZQ4A 2C4UA 2A78A 2K4MA 4H18A 4TYWA 4KOEC 3NHKA 1CUVA 5I5GA 2GBLA 3HKCA 5F23A 1WSWA 4XX0A 1N0WA 1ZD8A 3IAEA 4OHRA 4OQXA 4E32A 4EF5A 4LHXA 1XD9A 3LXRA 4JUAA 3ABZA 1MAUA 3B3AA 3BE5A 3RVBA 2QRQA 2RK3A 1FK8A 1FUIA 1VSBA 2DSNA 2ZSAA 1IEXA 2ZTHA 2FZCA 1V6CA 1NMQA 4QA9A 2C00A 3G9ZA 1A7UA 3ITDA 4YREA 1YZNA 2OM6A 1OBCA 3HG7A 2ZIWB 2WJPA 1KORA 3QLEA 1GGNA 2JBHA 4DR7B 4OLAA 1XQ9A 1FMLA 2Z0MA 4WNAA 5EMNA 1W36B 1GEGA 2PLRA 1H2RS 1TUGA 4KDFA 2CVHA 1P18A 2Q6LA 3EPPA 1YR8A 2ZBUA 4G4SO 2BDEA 4UMDA 3U37A 4A0GA 3ND5A 4ZK2A 3NT5A 3MBIA 4Q3AA 1U6JA 2C5GA 1T6BY 2R5FA 3EUAA 4RNDB 1DWUA 5LQAA 1U0EA 1V8BA 1J07A 1M74A 4I4NA 3CO5A 4HDMB 1I6WA 4CODB 1HQCA 4U7GA 4E12A 5KTKA 3EVEA 4JFRA 3BX1A 1E32A 4Y2VA 4BGDA 4IJ5A 2XKBA 2F8LA 1AA9A 1J00A 2J6BA 1VA4A 3ASYA 3CIOA 3KK0A 1UQTA 2FSIA 4HPWA 5BW5A 5K2OA 1NNSA 3F6SA 4JV5B 1L4MA 4G1CA 3PT9A 4E5SA 3Q3GE 4JYBA 4OYRA 2VRCD 1P0CA 4I1VA 3PF9A 1EGQA 4LQDA 3M83A 2NXWA 3JQAA 2QORA 2Y99A 1AE1A 5CFLA 4AO6A 3F6CA 5EJGA 1M2GA 4RDXA 4JI6B 1OIWA 3W0LB 4LFBB 4CMHA 5TPWB 3VR6A 4OQFA 2Y1WA 3JTMA 1PLJA 4YCJA 1WVGA 1YFZA 1WPRA 3BZUA 4POAA 4R1NA 3WS7A 1MHPA 1XZNA 4B2YA 1ISGA 1XWFA 1YCGA 4QC2A 1MLDA 1O97C 4H4DA 3ILHA 3VU0A 1UADA 3RUAA 5JJLA 2VWPA 2PKEA 5FPSA 3B6IA 3KKNA 2YX1A 4F0JA 5KOYA 2X7XA 4ZGGA 3NZEA 2OQRA 1TF5A 1XU7A 4W9NC 2OV6A 1DADA 1SCIA 3PWZA 1L7QA 2VHZA 4RZ3A 4WXHA 1RPAA 5EIHA 2XGOA 1R4AA 5CYOA 5GGYA 1BWPA 1Q17A 1UODA 2A0WA 2QMHA 2V4UA 2X22A 4HB2A 1L5YA 3H6KA 2XPCA 4PSDA 4YUVA 2EX4A 3QVXA 2BM0A 3QE9Y 1IBSA 3KJGA 4J1QA 2ZR8A 4WSOA 5BORA 3HNOA 1DUIA 1RI3A 1SRQA 2GDZA 3ANTA 2D1TA 4MAFA 1M33A 1ZRNA 1N8NA 2FFQA 3KEGA 4ILEA 1S3IA 3GFOA 3JQQA 4P5DA 5DBOA 3I05A 5AFSA 5CB0A 5JYEA 1CEEA 4R81A 2ZSKA 5I9SA 2DZDA 1ZZGA 5FEMA 2ZTVA 4DILA 4EUKA 2WVAA 3C7KA 3RK0A 4O2LA 3E1KA 3GYGA 1A71A 1P1IA 1WV0A 3ODPA 4DR6B 1QHFA 4NCIA 1FFXA 4R71A 4V3BA 3K9WA 3DZKA 2P4SA 3ON5A 1ZI8A 4ZC8A 3Q1LA 1D5CA 1Y5RA 1Q12A 3E4DA 1NXQA 3IR5A 4DREA 5HKKA 3OEHD 2VDRB 3QYPA 3R77A 1QG6A 2IHNA 1SVUA 3N76A 3TF5A 4WW0A 4KWHA 5AW9A 3SVLA 1A1VA 3SIWA 1ODJA 4K3UA 7REQB 1J0CA 4KAAA 1ADJA 2CVPA 1CHDA 5JNSA 1EQ2A 1PGQA 4A36A 2HO4A 3JYOA 4P4NA 3C85A 1D9ZA 5TIIA 2HV8A 3IP1A 2B78A 1MQSA 2EL9A 4FFVA 3F5DA 4NWIA 5DBHX 3DAFA 5DLDA 3SZOA 3WFZA 5KJCA 3UAXA 1YJ5A 1G5TA 3ZWDA 2QRJA 3C5HA 4FHGA 4HFRA 2NUBA 3OJWA 2PIDA 3EXHC 4OBXA 3FTDA 2TMDA 2CHEA 1KC1A 4AF6A 1EFPB 1V1RB 3D8HA 3R5SA 5C8YA 3W2HA 4IYRA 3T7IA 3WHKA 1M76A 3QY0A 5FBWB 1VOTA 2EFDB 3P9ZA 1QYWA 1C0EA 1Z73A 2RBEA 5THKA 1DJOA 1Y89A 2PUEA 4JXKA 3RU2A 2QTVA 2DCMA 2ZJYA 5B57C 4YRKA 2QPAA 1USKA 2CHVA 3C6ZA 4PW0A 4HLCA 2W6CX 4Y6OA 5LIPA 3BKXA 2GFIA 2VDNB 2QN3A 4MUBA 4CEJA 3M6AA 2HHLA 1XZDA 1I51A 1M34B 5ALQA 3WQSB 5C1DA 3HTXA 3FWNA 1DBVO 3QKUA 3LFTA 4KQFA 5GJBA 4X8LA 3AI1A 1LNQA 1T0JB 1VYHA 5FWYB 1L5ZA 3PRHA 4LXIA 4U9HS 2UVPB 3EGEA 1NLUA 4QODA 3BDAA 3NDRA 4JBIA 4CKCB 4YGXB 1G2IA 4DWJA 3ZHBA 3S2FA 3B1VA 4ALKA 5TQ0A 2JFZA 4U7PB 2QZPA 2R48A 3SZLA 5DSTA 3LBHA 2XV1A 4LYGA 1J9ZA 2IDJA 3L9XA 1OI2A 4NNJA 1HQKA 2XX3A 3NYQA 1TZ2A 2Y0BA 4K2AA 2E4YA 4JA0A 4QJIA 2O23A 1QRDA 5IKPA 1QANA 3DUWA 3ZZUA 1XJ5A 3EG9A 2D8MA 1OXTA 4CM6A 1KVTA 4LJSA 1Z7YA 2QL6A 1C8BA 2J67A 3LLVA 3NHLA 4KUEA 4N0EA 2ZE8A 4CLXA 5ICEA 3ADDA 5AVOA 5EQDA 5C52B 1O08A 2DFPA 1L1EA 2KLHA 3BWXA 3HGQA 4DIFA 5JD5A 3QG1A 2WMYA 1NVXQ 5D5HA 4BMZA 1I4DD 3X2EA 5K9ZA 3NFRA 5COQA 1EFAA 1PX2A 4EA7A 4ITRC 1YK1A 4FW9A 3CLSC 4Z8XA 1VKRA 1BRMA 3FF4A 1XNHA 2QENA 3CSUA 4NH4A 4B3BA 4CYMA 4YASA 4E08A 4GC5A 4KJZA 3K30A 2HEGA 1PR1A 2D5AA 3TZHA 3ICOA 4WBNB 1U5BA 2BLNA 3VHRA 4DUYB 1JE0A 3A6PC 1NN1A 4TV9A 5H9WA 3UA4A 4OQ4A 1VIMA 1L5GB 2ATEA 3RVNA 2WY2D 1Q6YA 3HBJA 1PFYA 3L92A 4ZVNA 2I3AA 3H5TA 3TTSA 1VBNA 3KXPA 2WVHA 3TMYA 4WZ6A 5IW8A 3WKBA 1Z39A 3PEUA 3IR7A 3ETNA 1MXHA 3ENNA 5F3RA 1PGNA 4MCJA 1MJGM 1N7GA 1K5GA 2B8EA 3QPUA 3V3KA 1NXPA 2VRNA 3NHYA 1BKYA 2EW8A 2Q3BA 3NH6A 2CUTA 1X92A 3C3WA 4NBWA 2XA2A 4BB9A 2GWRA 5DYIA 1SUDA 2H2IA 1IHPA 2UYHA 2O48X 3F4LA 2WAXA 4G0WA 1I3CA 1C8LA 2V6FA 3LM8A 3TSCA 3WWEA 1RC0A 4X6UA 1GM5A 2X6TA 2XRYA 3KJIA 4PYMA 1AS2A 4WXRA 1OUMA 5KS2A 4AY6A 4FFDA 3PFCA 4GUDA 1JEQA 4M36A 1REQA 2XOKD 3DE2X 5FBLB 1J2RA 1FNSA 1KAHA 4OXNA 2AWNA 5DXFA 1JB9A 3U7JA 4EBFA 2XODA 2XYGA 3W7BA 1R88A 1QDUA 2XTJA 2Q3JA 5CDSA 1IZYA 1WD5A 2DJ5A 1AUVA 1GUAA 3IALA 3RPEA 3W8FA 5E6RA 3JYLA 1SU6A 1UT8A 1ZP6A 4M9XA 3ZJUA 2JJ1A 3B5IA 3LNTA 4O3FA 3HP7A 1KO1A 4CV0A 1OBHA 1MIOA 1XIVA 3COZA 3O21A 2FGKA 1US8B 3EIWA 3KZ1E 4H7HA 4PPYA 3UBMA 3A2NA 3KWMA 3BL5A 2VYVA 4LXHA 2N0SA 2P6UA 3R9KA 3UTCA 3K70D 4F84A 1G8FA 4HDCA 3DBLA 3JQ9A 5DK6A 5BSEA 4PRZA 4L5CA 4YAFA 2AMVA 5K0BA 3M2TA 1TRHA 4YDQA 4LOKA 4J0KA 1NJ6A 2QRZA 3QUQA 2RGWA 5GQSA 4R2HA 3HCCA 1HX7A 1NN0A 4D46A 5HIAA 1H93A 3ELUA 4B71A 5B3JC 4LDRA 2VNSA 4G8JA 1FXSA 3VR4A 4BLQA 3DNFA 2G70A 3LX5A 4FYPA 4OXKA 1XNGA 5KQLA 1DAEA 1Z74A 2B4QA 1XP5A 3DAOA 3L18A 3MAGA 3D6TB 3DNMA 2UZ1B 3T4PA 2ZBGA 3CX3A 3DLIA 2GYVA 2NO9A 2ORED 1E9DA 3AWDA 1IY8A 1ECPA 5HIKA 2X8BA 1FVOA 1L5FA 1M83A 2C42A 3B5EA 3BH7A 3VR5H 2G5GX 3DDUA 3ZEAA 4UUMA 1DUVG 2FMKA 4KBGA 1V7PC 2JAOA 2QTHA 4HWRA 1EIZA 4QPPA 4CKEB 1ZG3A 2FW7A 3ZG6A 2CK3A 4AKTA 1EXVA 5I4BA 4XDZA 2W93A 2XE4A 3KOMA 4GZMA 5TY0A 2B34A 1VI6A 3RYHA 1EB9A 1S2OA 4H1TA 421PA 5A3QA 5HG0A 2O3UA 4TZ6A 2W6MA 4IVNA 4JIMA 1QV6A 1R0CA 1UDWA 2DAPA 1UFRA 2KHZA 1L7OA 3INRA 4RABA 1E9RA 1C8KA 3WGZA 5BWNA 4TN5A 1A2BA 1M2NA 1Y6ZA 4IXTA 4W8OA 2JLSA 3R6TA 4CCAA 3JPWA 9LDTA 1E5LA 4BYGA 2BCJQ 3ABRB 1X39A 3A9SA 3SE0A 3L9WA 5CAEB 3AKCA 4Z3KA 4U2BA 2OE2A 4P2GA 1JHMA 1K3UB 1K2WA 1UOPA 4K2HA 1CJUC 3W8DA 4UUPA 4UXJA 2B61A 2EJBA 2G25A 4MHOA 3BMQB 3PNMA 1PZEA 3DCYA 3HUTA 3INGA 3AF0A 2NZWA 3VPCA 1EZZA 5HE9A 1M0TA 3GEPA 1VL1A 5IVDA 4OYLA 4RX1A 2AR9A 2CMDA 3DOOA 2PHZA 2GEKA 3HRKA 4HPJB 4NS4A 4M6WB 2QYHA 1E3SA 4QXAA 3OOJA 3HM9A 1ORVA 3JWJA 2PJZA 3ETJA 3RAEC 4LMRA 4F2PA 4M0MA 3G9QA 2OO7A 4FNOA 4B4VA 4EHHA 1DAOA 1L8AA 2B25A 4GDMA 2ODAA 2VFAA 2G36A 4HVTA 3PZRA 2HC9A 3SICE 1XCLA 3PXEA 3FDZA 5GOTA 3RS4A 5LB4A 1YNSA 1RTTA 2WE7A 5FL7D 3TLJA 1T4BA 4U7WA 4NK4A 1CY1A 3WL5A 1HG0A 3HB7A 1WXXA 4HTFB 4E6PA 4ND2A 3F1LA 3TLAA 1YMQA 3C3MA 2H4ZA 1M5RA 1ZIDA 1R8JA 1Q2UA 2YXPX 1B41A 5L45A 3ZE2B 2FR0A 3MNFA 1F20A 3C0KA 2X58A 5LM3A 1EESA 4OSEA 4KLRA 2CDBA 3FYUA 3TZEA 1PFKA 1LPNA 3L6CA 1U2GA 2JGFA 4MUKA 4KQCA 3AQIA 1GILA 2ORVA 1U2DA 1FDUA 1XZIA 2XNDA 3TL2A 2VUUA 1RWVA 2GFQA 3DA8A 3V80A 3RT9A 4LDZA 4YX9A 3OTHA 4U6QA 1J33A 3KSMA 1VB5A 3D6UA 4ZCTA 2RH8A 4ZVLA 1AHPA 3ZV4A 5B36A 1OFTA 3Q3EA 4O59O 1S3SA 1WX1A 5EL0A 3ZGVA 2AR0A 5DLQC 1KH3A 4I55B 4LE2A 3GY0A 2FFBA 1R0SA 1RACA 3L7MA 4EPYA 2PUAA 5CT4A 1TVMA 2FJUA 4YUXA 1IUOA 3UV3A 2ZUUA 1MTOA 4QU0A 1CU1A 3QH4A 1RWQA 1E6WA 2RGCA 2WP8J 1C3LA 4MYTA 4MYHA 4WCDA 3RIYA 1MW8X 2OSVA 4HQLA 1LBHA 2FE1A 4EBBA 1FNNA 1PQPA 1ZJYA 1K3FA 3RTGA 4G9BA 2PY6A 1GUZA 2ZKIA 4JNCA 3P0JA 5T67A 2BHNA 1IN1A 4JLAA 4JD5A 3A9TA 4YMGA 4HWGA 3CN9A 4TQUS 5ALWA 5DHSA 4IJKA 1EFHA 3CCFA 2BGGA 3EIOA 1I5EA 2EERA 2NSHA 3AESB 4NCHA 2VQEB 4FC7A 5JC8A 3CB4A 2ZDHA 3MCVA 3F3YA 4I50F 3T9CA 4E88A 1H0KA 1FP4B 1I33A 3AIIA 3DMRA 3L8HA 3UHOA 3ZK9A 4HNUA 2CYAA 2Q0HA 1E3WA 1U02A 4KFTA 4MW7A 3BIWA 2I78A 2HK7A 3H42B 4IG9A 6REQA 1MG5A 2XT0A 2ZRIA 4MW0A 5JNUA 3HXQA 4QEZA 4DV6B 4UCXA 3TTUA 2OWDA 3LU1A 3QVVA 2ZM6B 1G3UA 3ZLBA 1D6SA 5IT0A 4QDJA 3LUJA 1DBPA 3P52A 2BHSA 2WHPA 1QXSA 4G9GA 5D01A 1LU9A 4K6CA 3MT7A 1ZW6A 5IDYA 4OHZA 4X71A 3QX3A 1RWXA 3T7DA 4TZKA 5IT4A 2F48A 4M9UA 1QLJA 2XNSA 5AOCA 3LDHA 1GL3A 3W6NA 4OXYA 1E3MA 1PJ4A 1FFDA 4CG1A 1NYRA 2YV1A 3FZEA 4XB1A 5ALMA 4GF5A 5M2QA 3QPAA 4BMPB 1R9MA 2BPOA 3ESCA 3QW4B 4CL0A 4DCPA 4ENTA 5HKOA 3B38A 2HK8A 2XAUA 4Q7KA 5KWEA 4PZLA 1YL7A 1VMKA 3QVGB 3ZCRA 1G8HA 1L8QA 4ZT5A 3AZQA 5HDBB 2XMQA 5TX7A 3WISA 2JAWA 1ZQ9A 3OX2A 1PEDA 1CD5A 5JY1A 1MO5A 1ZM9A 2P5UA 2YW9A 3VV2A 3G8AA 4YWHA 3OFJA 1VKHA 1I2MA 4G6ZA 3OM0A 4EGQA 5K0SA 4JBWA 1G2PA 3K8OE 1Y8ZA 4N5NA 3WXMA 3RUIA 3GJ0A 4X9XA 1MRSA 1QC5B 4FMCF 4IIVA 2Z08A 2QD4A 5F7JA 4V0QA 3THWA 1YQTA 3ZI0A 1QBGA 5H4HA 1V26A 4NP6A 1GTSA 3U5ZB 3I4FA 3CCCA 4NEQA 1KEWA 1TADA 3OZTA 5JO9A 2L82A 1DKPA 4L3OA 1IPFA 1UKBA 3CKLA 4FNGA 3H5OA 4X1OA 4WZBB 4A2WA 3U4MA 4L2IA 1FA9A 3AVPA 3EAFA 4Y6PA 1CVRA 3KP1A 1Y4AE 4LOAA 2QX7A 2WJ3A 1WZ2A 3HK2A 5ITZB 1UZUA 2QVZX 3FNBA 1KFKB 1N3IA 1V37A 1Y5LA 5B6JA 4QXOA 2RIPA 4M0UA 1I4TD 4RD4A 4ARZB 2OXTA 1ZWLA 3MCWA 3LIPA 1RAGA 4D79A 1BQ3A 4CCSA 3FFXA 4U6SA 4Q6WA 1FXWF 5DP2A 5SY9A 4UUNA 3TO5A 3W3ZB 5KAPA 3RTAA 3C15C 4KXLA 4LC9A 2FPOA 2PKYX 3JQFC 4RETA 4XFJA 1GJRA 1V8OA 2AD5A 4KBFA 4O29A 5ES3A 1FF9A 4KPUA 4TL8A 5JDCA 3G6KA 5FNVB 3V6LA 1HK7A 1ML4A 3O3CA 4UDYX 3LDFA 1LS6A 1S8NA 2XDQA 1MV8A 3D5QA 4ND5A 4AKGA 4XQ9A 1Q92A 2Z2IA 4MTLA 2ZS9A 3NIGB 3TIFA 4FMDF 1JPVA 2FWMX 3RHZA 3AJAA 2BUAA 1AQNA 1NPDA 2PNFA 2RGRA 2W2KB 3J7TA 4MO2A 1WR8A 1OFUA 2B5OA 4JZKA 2EWWA 4Q0MA 4X91A 1PWZA 1NXVA 2EP7A 1IIRA 3H5NA 3U1VA 1A9ZA 3FLBA 1U2SA 2X8WA 2GF9A 4LBZA 3VPSA 3DEZA 4ZQBA 2UZAA 2RB4A 4GPAA 4AUKA 2O2JA 4GR5A 1SVLA 2GD2A 2BJHA 1X9GA 4KP7A 2XNCA 1KO7A 3ORHA 4RAQA 1DS6A 2V96A 2J32A 3BXGA 4NJMB 4IXDA 2VNHA 3DB2A 1LI4A 4OYHA 3CJTA 3PC7A 1XD8A 4AJJA 2XYPA 1E2PA 1RYYA 3AB3A 1Q0QA 2BN4A 3CZAA 4N7JA 4TKLA 3SJ7A 1AMUA 1M7HA 1RYHA 3MRSA 4LV5B 3GGGA 4GIBA 3U48A 5C4IA 1J42A 2C2MA 4B35A 3LC0A 3JAWA 4KIJA 3SKYA 3UF0A 1ZVMA 2FN8A 3KT3A 4Z7OB 1T1GA 2Q6OA 1RQGA 2IY8A 4G09A 4CR6A 3BWEA 3HKDA 1ZNWA 1PR3A 1GTZA 3FZGA 5J5AA 1MF7A 5AI0A 3VQTA 4F38A 4M7RA 2BGUA 4HH0A 2QAIA 1XCBA 4EB6B 1K5DA 1TZKA 4NU5A 4A4DA 2QKYA 3CN7A 4X7PA 1QH8A 2NSJA 5C80A 1Z2NX 2OHXA 2HCBA 3C8UA 1DV2A 4B6JA 1XF1A 4FFRA 4MR7B 1CQJB 2O07A 3FMVA 4UHCA 1BO6A 3ZDEA 1CJCA 1PUJA 3V1UA 4KREA 1ZMTA 4UNSA 1E6KA 5EQJB 4HDOB 4I9GA 4FYXA 4OP3A 2Q4BA 5K0FA 1N2CB 4Z99A 1BROA 1HT0A 1XQVA 5AHKA 4BMOB 4YR9A 4EJFA 3R7DA 3FAZA 3TIXB 1N9KA 2C9YA 1GD1O 4QRHA 1C1HA 2JC3A 3WMGA 4DCVA 5MGBA 3MWDB 2J31A 2QSJA 4AJ2A 4W9MC 1UIMA 2JJQA 4IEFB 2ODQA 3F5SA 1EFCA 1IXYA 3NHFA 3MK31 1TZJA 1YKSA 2QY9A 1WDKA 3F3SA 1UPTA 3HUDA 3U62A 3WIEA 4LBYA 2IVZA 1OQAA 1P1FA 4GYKA 3WAJA 1WPXA 4B4DA 1QHXA 1MXFA 1GTMA 3N2IA 4IDFA 4DEYA 1DAIA 4F93B 3OA0A 1ZU5A 1AS3A 2YYAA 2LR0A 2YS6A 4WINA 2J4CA 3LT5A 3ICCA 4S04A 4DKJA 2WHXA 3LL4A 4BLWA 4YQYA 1SD2A 3SIRA 3GARA 3IEUA 1E96A 1LK5A 3F46A 4BP9A 4Z9FA 4XSHA 5DK4A 2Z9CA 1W59A 5I7EA 1USVA 4AXXA 2GAAA 2PVPA 3HWX1 2NUPB 4K81B 3T9AA 2RCYA 1Y8QA 4EP1A 5ABPA 5FWAA 4I9UA 2Z2ZA 1I6LA 4L15A 2EX1A 3BFXA 1KIFA 3GZTB 1Q74A 4TMXA 4AIRA 3MPOA 4TGLA 2PBLA 2VN8A 3ME5A 2QDXA 4TTIA 3LUAA 3CGGA 4WY8A 1FZQA 2N1BA 2W0SA 4BKRA 3L43A 1WHTA 3HCDA 3FN4A 4K6MA 1YHNA 3LUGA 3E05A 3I9NA 3ESBA 3QEKA 4P3XA 3E7WA 2XHEA 2MU1A 1G6Q1 4UD2A 3VR6D 3WWPA 3KL2A 1G21B 4AJIA 4RE6A 1IHYA 2ZP1A 2YVQA 3HDQA 3L0YA 3WRWA 1S5PA 1JJFA 2BFEB 1PJTA 3I72A 3PQ8A 4DR3B 3EVFA 2B0CA 2R25B 1OBOA 3HB0A 3EBLA 1IIBA 1NX9A 1OLUA 1JYFA 3IVMA 5K5EA 1YS9A 5HQJA 1OLXA 2A0UA 4CR7A 3THXA 3VPDA 1IN7A 3OIWA 1TTTA 3UXEA 3A58B 3A9CA 3QLTA 4QSMA 1KY4A 3VU3A 1XTTA 2OA0A 4RLHA 1KIAA 1M5TA 4FYMA 4O4JB 5CHYA 4ENWA 4QYSA 1E3TA 1DOHA 3QSGA 1NJSA 1R8XA 1TUBB 2HRBA 4V0OA 2V3CC 2B21A 1FC0A 4PG8A 1ZK4A 4NCJA 2NXJA 1SAYA 2HLNA 3QHQA 4A8JA 4G9EA 2HCJB 1BX0A 2F3RA 4GX2A 3DG9A 3VFDA 4JQYA 3CLHA 3UJ7A 4JB3A 1LF0A 2R2AA 1GG2A 3L5KA 2GN4A 2GSDA 2AK3A 1U28C 2FU5C 3CT6A 2WYUA 4GQBA 3WLPA 3WYEA 3DMHA 1YU9A 1OXXK 2BV3A 2NO6A 2C1EA 4J0CA 2Z3WA 2RKOA 3TJRA 2C83A 3WNVA 5FHQA 1ZM4A 5AK6A 3GH3A 1EHYA 2A7QA 1ZM2A 1BHJA 1NVBA 1JXMA 1ZCBA 3S68A 3DFUA 5J2UB 5U4QA 4AX8A 4Z54A 1T1IA 2CDCA 1YTLA 2D5BA 4MICA 3BMOB 5FBZA 4ZKDA 1X1EA 3KYIB 4NYMR 2WYVA 4O08A 2VHXA 1TFUA 3CF4G 2C61A 4TLEA 1GGJA 1KTVA 1LJLA 2GN1A 1LLCA 3IJPA 1E9AA 4FX5A 2VI5A 1LPBB 3LOPA 3I1YA 4QULA 4DADA 3DD5A 3E61A 4B17A 1SXJA 2IEIA 1D6NA 1P73A 2I4MA 4EFNA 1KPGA 2O7VA 1CF9A 1E2FA 5COBA 2C7GA 1DT5A 1QJCA 2XDWA 3VNRA 1VSVA 2O0MA 3HDJA 4RFSA 3SC2A 3AI7A 1F8YA 4R7ZA 5E4FA 2WC1A 2X2PA 3VVBA 4E5UA 5KOJA 1ESDA 2B8NA 2ICAA 2A4MA 1YSCA 2BCGY 1LPOA 1U8YA 2FZVA 2C3PA 3DOHA 4DIOA 1HY3A 3NUZA 2INGX 3ESZA 2EJUA 5CBKA 3L4KA 5FI0B 5ARDA 1P39A 1H1DA 3ZCXA 4P0PB 3EQ9A 3ZDDA 3OWXA 2QN9A 1U63A 1EFTA 2MSDB 1ONNA 1KKUA 3VNQA 1D4OA 2BIFA 3B7GA 5GV8A 1KFJB 1Z12A 2CCGA 3ND7A 1SQ5A 3L3BA 4Q15A 4QQRA 5LXTF 3BZBA 5E0OA 4YRQA 1E2BA 3RAFC 4R8SA 4EHDA 4LF4B 2C5BA 2J0UB 2XEXA 2YY6A 5ANRB 4Q9LA 5CDFA 3ZHSA 3GJ5A 2Q0QA 1AOXA 3Q15C 4B6GA 1CY6A 1HPLA 4ZMBA 1CERA 3RT7A 2CV0A 3FNIA 2AK2A 4YAIA 4A2CA 5HSGA 1C29B 4HGPA 5JH7F 1HYEA 4X1YB 4UHHA 2AA3A 4QT0A 4FUQA 3R7BA 4RELA 4IHQA 1IFXA 1JQ5A 1JQLB 1SXJE 2A9VA 3HJHA 3IT2A 3JQGB 4C78A 1YZTA 2AVDA 2RCNA 1NVAA 2PS0A 1HTTA 5BW8A 3FETA 3G1WA 3L5OA 3R6WA 3HWRA 4CMAA 1SQ0A 3OVMA 4URUR 4C5BA 2BP7A 1O6GA 2B9VA 3NEAA 4TXMA 2JAHA 3ZD6A 1NRIA 2DKNA 2XUJA 3QUBA 5FADA 3H4VA 3MYYA 1ZUNA 2FSPA 4PSVA 3UCEA 5GZ6A 821PA 3KSZO 1G64A 2WUVA 3I4CA 2GEVA 3D6HA 4DIBA 5A7FA 3KSAC 5ULLA 4XDYA 5JAZA 5JXIA 3C43A 1DPGA 3C1TA 2JLZA 2ZULA 3IV9A 3FHJA 4ND4A 1M2WA 2AOTB 2IQIA 3V1TC 2RGGA 1P4RA 1T6ZA 5GWXA 4L9RA 4RMNA 2EKLA 2CMHA 4HAWA 3VJLA 4B3HA 3O3OB 1W46A 2RBKA 1IHUA 2ZAIA 1UC4B 4TYMA 4E3ZA 1YZYA 1W88A 2W6IA 3MWFA 3BB3A 2R5NA 1KQFA 3AYZB 2RGEA 3B6KA 3HJNA 2FDCA 3TBFA 1F8GA 5IEJA 1UJ2A 4CF5A 3B89A 1SPBS 5A1JA 5JI3E 1YZFA 1FEZA 4EHAA 4EMUA 2IZ5A 1J4AA 1O77A 3NLLA 4NDNE 1CUGA 2GASA 3BIXA 3GVIA 3MCZA 4Q82A 4C4ZA 2HWXA 4YR7A 5JY6A 4LKRA 4JXZA 1E94E 5A6VA 4WBXC 3RIHA 1JW9B 3EQ8A 1X7ZA 4QDZA 4U3JA 5FI1B 2V8BA 4AL4A 2RBGA 3BFVA 4G5SA 1SZDA 4I1SA 5IYZB 1Y3BE 2GNAA 4K9PA 3D4IA 1D2GA 5CEEA 3G2IA 4CIDA 4RY8A 2Z30A 1JPUA 3UT6A 3D8UA 2NYUA 4GQAA 1JSZA 5I9BA 3O47A 4LW8A 3UVEA 4X93A 4HPXB 1USWA 3I8OA 2C97A 3A4NA 4JJZA 2ZRDA 4YUZA 1L1QA 3R5JA 4JXXA 1B8PA 3H6GA 3WHPA 1PT7A 3EW7A 5KC9A 3NBYC 2CJXA 3OOSA 4IIXA 1ZGBA 2VS1A 3DE0X 4RVFA 3OM9A 3WO0A 2ZBRA 4EL5A 2NV2B 4H1WA 2VYVD 3M4ZA 2Q46A 4H7IA 2JGDB 5SYAA 2M6KA 3SNHA 2PQ6A 2ZYAA 1F0PA 4K6KA 2W2LA 2X8AA 4LZZA 5DP1A 2P91A 5JD3A 4C9BA 4IMIB 2ZWOA 4UEJA 4J90A 1HETA 3UWKA 2H0QA 3K70B 3X1WA 5F2KA 2V7GA 3RIMA 5FUQA 1ZAYA 3CRVA 4TLCA 3A4TA 4Y1FA 5A0FA 3SXJA 5F7ZA 3V1MA 2G6BA 1THTA 3HB1A 2F1JA 4U4AA 3URMA 1B7GO 1JJBA 2WIKA 2RI1A 1N1MA 1MV5A 1E2HA 4M99A 1LJUA 1QGUA 1Y42X 4J16A 1H3EA 1X7YA 2R4TA 3F47A 1E6CA 1T9GR 3KQTA 5IVKA 3FCCA 2VHEA 2FP4B 5K1ZA 4ZC1A 5JSQA 4WFJA 2PKXA 2Q2NA 3JVIA 5C8DA 4EUEA 1EGVB 4F7WA 1JH8A 5MN6A 4AP5A 4S1VA 3F5MA 4NAVA 4V0NA 3KPYA 3V2GA 3GJ7A 1EWRA 4LWPA 5JFTA 3OCYA 3V2HA 3JASB 3VKUA 2IPXA 1S2IA 1SZPA 2O0HA 3E0QA 5B1EA 3E23A 3B9QA 4DLNA 2YKGA 1RLIA 4TVSA 1YR1A 1CUBA 3AUUA 2CK3D 4R1LA 1LTKA 4XIFA 1LVUA 3PITA 1N2JA 2XLCA 4L4UA 4IHJF 3AO0B 3VR5D 1I01A 1N6NA 3QJ5A 3DL0A 3RUEA 1JLLB 2Y4NA 2HCTA 2QRHA 1XQXA 3R6LA 5JXGA 1RZRA 2XIQA 3QTLA 2UXBB 4RVOA 1JHOA 1MB9A 5ESDA 3WIUA 3AERA 3DONA 1ULSA 2R65A 3ZWMA 5H82A 5JSZB 4UM7A 1DNPA 3K8QA 4I4TA 1GKLA 4LQCA 1X74A 3S27A 3U9TA 5JR3A 2C8LA 3LLSA 4HAXA 5K2MA 3FTNA 1LW6E 3BMNA 4HDQB 4JI7B 2QLMA 1D07A 4EGCB 3MD0A 2Y76A 3L0BA 4HAYA 1UJNA 2OLJA 2R8YA 3MINA 4JLKA 3PTZA 2FPWA 2H7VA 1QP8A 2X1LA 2X8JA 2W22A 1VG0B 5CA0B 4NZMA 3U3OA 2IHBA 1FX0B 1MNAA 4WUTA 5CHEA 3ZIDA 4LOLA 1CYDA 2QUKA 2R7LA 3KG2A 4OM8A 3WNQA 1KK0A 1S9HA 3T9EA 2C8KA 5AKZA 1LFAA 1GKKA 5BUSA 1TM5E 4YONB 3DPSA 2GA8A 3OX3A 3VNUA 1MORA 4DFDA 2XF8A 1Y34E 2PGAA 5KKAA 5J3JA 1J1ZA 2D5IA 4U2GA 4D8TA 2FRXA 3JAMA 2A92A 3K73O 4Y6SA 5CLIA 3Q7QA 5KVAA 1XLWA 1K9VF 1QONA 2WJIA 1I5OA 3C6XA 3PDWA 5JAUA 2GCOB 3E6AA 1ZKMA 1V0JA 2DC1A 4E5YA 1QZ3A 1F2TB 5GM1A 4FGUA 4RIHA 1ZIYA 2XB4A 3ZIUA 5FDFA 1LDMA 1NI4B 3EHEA 2EZ9A 2PDAA 3I64A 3K16A 2NTNA 4EVSA 4RZXA 4JI5B 4EI8A 1ZL0A 5G2OA 4LJ9A 4RJKA 3C70A 3EGDB 5KNCH 1A77A 1GPJA 2VL7A 1N5DA 4KK3A 4H0FA 4ZVMA 4OHFA 1QRSA 3ENKA 4I19A 4WN9A 1H23A 2Q5EA 2XNDD 4GSLA 4Z9BA 1KS2A 2Q4EA 3TDMA 3U4AA 4A0RA 1IBMB 5K0CA 1XR3A 3TM5A 1YRHA 4G0MA 4G8DA 1OX6A 1A5BB 2YWDA 3NNSA 5KC8A 4BQQA 3DDHA 4MCIA 5B7GA 3A70A 4RA6B 1JJIA 1J8YF 2HLDA 3O1HB 4E4TA 4Q4LA 1GN9A 2G04A 2BH9A 3GLVA 3CISA 2CB9A 1EYZA 2O8DB 4NZZA 4M54A 1IHXA 1C3EA 4R9NA 2IHYA 4PQEA 4US1R 4XCQA 3ZD8A 4OOFA 5THQA 2MINB 4O2AA 4O5AA 1E4VA 2QV7A 3DEKA 3P9PA 3MW8A 4MV4A 3D31A 5FA8A 2FR8A 1ZA1A 1Z5PA 5LMUB 2NSLA 2FSHA 2QI9F 1BMQA 1U1CA 1LBTA 1ZMXA 3L7NA 1ZMOA 1FNMA 2Y0EA 1KFBB 1T4MA 3FGOA 4JL5A 3KT0A 4AY5A 3DDNA 3T5CA 3CKMA 2NVWA 1OHHA 4NHEA 1R5JA 2CXOA 3O75A 4YBZA 3IHLA 2PSSA 4EPWA 1ISRA 1W47A 2G0AA 1WMFA 2ZYTX 3AK4A 1VE5A 3PA8A 4HN2A 1E4EB 1U8FO 1YIAA 1JSLA 1TAGA 2G0TA 4HZUA 4HGZA 3C1UA 3N07A 4JC4A 3T7SA 5KVCA 1WUKS 1BXZA 4XJVA 4BX2A 3EZ6A 1ZW1A 1RQ2A 1B3BA 4MR9B 1M54A 4R1MA 3G85A 4OG2A 4CKWA 3EEBA 4CE6A 3VC3A 1K7SN 4BAGA 3ZWKA 5DCUA 1FUEA 1NKSA 1XKXA 4XGIA 2JVKA 5DBIA 4UOEA 1TMYA 4LRXA 3DOIA 1K89A 2RGBA 4Q9JA 1MGPA 3AUXA 1RQLA 1UJ4A 1E1RA 2E4WA 2OC4A 3L82B 5ILGA 1AQLA 1LPPA 4BBAA 4C89A 1SHZA 5TQ2B 1K9SA 4X7MA 4YJGA 2KI5A 4M1WA 1EPUA 4L4YA 1SXHA 4YCCA 4BNWA 5ESRA 1RDFA 2IYFA 3H1EA 1VKNA 3FMFA 3CRNA 5IPFA 2EF1A 3NIFB 1M6YA 1LPAB 3QBEA 3WNBA 3NT4A 4UREA 3AVUA 5KYTA 1KIMA 4JSTA 3SMVA 2BFFB 2KQUA 4KGZA 4EJSB 1K6JA 1PWHA 4P33A 2I7XA 3FCOA 1L7AA 2ZIZA 4KHPB 1MCZA 2W11A 5ICSA 2VO1A 2YWJA 3T1VA 3BE4A 3HCBA 4L7QA 4ZAXA 5ARBA 2VTBA 3IBTA 2O2EA 2D0OB 2O9JA 3LZ6A 2A0YA 1P77A 4WVLA 4DCGA 3P96A 2ZBVA 4MV3A 4RZUA 1MJGA 3S4YA 4DLVA 1JQBA 3NUGA 2YN2A 1E1DA 2I54A 2GF0A 2VZ9A 5DI3A 2XBUA 3FWZA 4E14A 3KEOA 1I24A 3EEFA 2X3YA 4YMIA 4S1WA 3OI7A 4YRGA 1E58A 1IHOA 1K7XB 1VYTA 3CNHA 5B64A 1ARZA 1I7DA 3ADKA 2KE5A 1ZS9A 3CH6A 4OPMA 1B2RA 2FK7A 3X1JA 1RRMA 1RQXA 1ADBA 2QYOA 3TOVA 3FYCA 3SVTA 1COWA 4MR8B 4RIFA 4FCWA 4AVYA 4PNZA 2JPDA 3SF8A 1DAGA 2YR0A 4QVGA 2VIIA 4H7FA 1LGYA 3MTBA 2IY7A 1JBQA 2KPOA 2ETVA 2IZ7A 2QDKA 4URYR 1U4OA 4CMIA 2OBBA 4D3DA 4DV7B 1JMYA 1O94A 4HJRA 2W9XA 2P1DA 1RP1A 5P21A 3FH0A 3UTDA 2QU8A 3X3HA 4GKVA 1KZ6A 1X77A 2FPPB 2VNAA 5A05A 1FW8A 2HT6A 2IXAA 2VDKB 2ZETA 3C5VA 1LB1B 4JY7A 1CUAA 5C7IO 4RMGA 3PUKA 3T3OA 1IG0A 1U8XX 3KB6A 4NPAA 2QAGC 3EMDA 2EP5A 4TUYF 4DJEC 1FRNA 2BONA 4R16A 1Y4SA 2AH5A 4PLGA 1NF9A 2CBZA 3PFHA 1WVIA 5M29A 5B55A 1Z0ZA 3PF8A 1L5RA 2O2GA 2Y1LA 3AM1A 3ZZ0A 2HU7A 4B3XA 2H1WA 2AMFA 5BWCA 3FMIA 5LP6C 3NR2A 3RAGA 4JC5A 4V38A 4UUOA 5E6SB 2XE8A 2XF2A 2JCBA 1JKFA 2OZLB 3KYCB 2JLXA 4HX2A 1WSDA 2FOIA 2PBFA 3LYUA 2RG1A 3B12A 1SC9A 1YU6A 4GVXA 3TLKA 1ULUA 1GV0A 2LDBA 5CT9A 4NG4A 2NACA 4DMUB 4HZIA 1K5PA 1QHYA 2GX6A 1GNTA 3ETHA 4HJXA 4D41A 3QOWA 3BICA 3WGKA 3JQ9C 5BN4A 1F5NA 4L8FA 5FBKA 2CNWA 2YRFA 5F33A 5B2EA 3ZBQA 4S2UA 2AX4A 3I5UA 3KLOA 4H2DA 1WF3A 1UQRA 3EC1A 5CB4F 1LKZA 3HCWA 4YJ3B 3X1YA 1RWPA 5I7HA 5CX4A 1GCOA 1T8RA 3SIPA 3QF4B 3AINA 2MHCA 4I1YA 4NS1A 5EXEA 5AD1A 4RSHA 3W5VA 5HZMA 2HDNB 1KEEA 1XNQB 2I9KA 4H60A 1FSPA 2OHVA 2CL7X 4OL9A 4BQPA 2DU8A 2ES4A 4J3NA 5D00A 3L7DA 2W6OA 3RSGA 2H9AA 3AOGA 4QFCA 4F8EA 4QTXA 2NQTA 1HLGA 4PF1A 1XLVA 1SIBE 4QYIA 3CUTA 5IULC 1VCHA 4X7BA 1ESZA 1XK6A 2O5RA 1U0OC 1NLZA 3CVYA 2H52A 4IBOA 3CRRA 4N3AA 4J7UA 4DCMA 1LRKA 2WTBA 3H6HA 3JD3A 4TKZA 3ZHZA 1J8DA 5HQ3B 1VP3A 4LSZA 2CJWB 1ISMA 3JYPA 3CF6R 4NYJQ 4PPQA 3EIUA 3ZH2A 3ZU2A 5LU9A 3W5DA 3CUWA 1FXWA 1T9DA 1I4LD 2F43B 2E21A 1E2GA 1CUDA 1H9BA 2F67A 1P75A 4PXSA 1LI7A 4EECA 3RYCB 2OESA 1E7WA 2P7IA 2PR7A 3UMJA 3GAMA 2C2ZA 4FFOA 4Q18A 3P9QA 2E6KA 1T2UA 2IITA 4ZU6X 3VOBA 1TAQA 2O57A 4KFCA 1MD9A 2D0PB 5JLJA 1LVHA 3C3XA 3I61A 3KQPA 5IAKA 2YN4A 2BL4A 2P77A 2XI4A 3HKCB 4XX0B 1IY9A 4AW9A 2Z1MA 3E4CA 5FOSA 4BQSA 1HG1A 5CDYA 3T5AA 4DYVA 3OJEA 1IDOA 3LOUA 1PHPA 2YICA 5B53A 1T43A 4HGNA 1FFSA 1VPDA 3E7PA 3PPVA 4Q37A 1G66A 4TL6A 5CR9A 5CVJA 3TZBA 4AP9A 1F1JA 1JFSA 4G65A 4PSCA 4WDQA 3IOYA 4TMKA 3IBFA 2HQ1A 4GPBA 2VK2A 4AYWA 4Q00A 3IEVA 3LCUA 4AK9A 4L4ZA 3IBSA 2FDXA 1VL2A 1UP6A 1W94A 3OQ1A 5BQOA 1E5QA 3AR7A 2C4VA 4YRJA 4BFXA 4RKQA 2I62A 2QG9A 3L7YA 4WNAB 3UZUA 4AF8A 5F2NA 2AMJA 1Y3DE 1F9AA 1QE0A 4EJ2A 4OY3A 4PG4A 2ZSEA 2PGIA 4MRPA 4Q34A 1XMPA 2PYZA 3S0JA 2PSEA 1AZTA 1EWYA 1G6OA 2XB8A 3WKCA 4OI0A 2AXQA 4RSGA 5G02A 2NMVA 4S35A 4PSKA 3IUMA 4G84A 2FWPA 4RWEA 3LDGA 5ALYA 1V48A 5IT9A 2NLOA 1JG3A 3MS7A 4A7PA 1GDHA 4P3YA 2F55A 4PRYA 1UC8A 3PGXA 4W5JA 2WK1A 3EC7A 3L8GA 1TEXA 1Y6RA 1ZJ5A 2V6GA 1DX4A 2OB1A 1Z7BA 2WHEA 1SXIA 2PXXA 1SOUA 2PMBA 2IH4A 4NL4H 1EX6A 2BGIA 4QYXA 3UW3A 4DZZA 4ZT6A 3N75A 1W5TA 2WUWE 1Q0TA 5U1PA 2ALJA 4EENA 2BI7A 1U2GC 4KO2S 3KCNA 4QUKA 2EGHA 1WW3A 3UGJA 4QHTA 5DGCA 2C04A 3U7GA 4IOJA 1KZ9A 5KYYA 4MQMA 3RRMA 1UJ5A 5BQFA 1ZSVA 2AUTA 1V9SA 1YS2X 3A6KA 2EP8A 2W4QA 5ILQA 3R7WA 3RC7A 2JFYA 4I2VA 1IJFA 3O4GA 1UMKA 3VTFA 5AVTA 1IOZA 3W5JA 4XW2A 4WFIA 2C78A 2AOVA 2X9NA 3ZD7A 1NBIA 2IS1A 3G79A 1PR6A 4BEBA 4F11A 3AJRA 3GLTA 3IOMA 2NPFA 1WP4A 1Q83A 3H99A 2GM4A 1XJQA 3VKVA 1X1TA 2WFMA 1XELA 5AUNB 3H2SA 4F5YA 1LFDB 1G0OA 2JCYA 3A3PA 1Q21A 3VDQA 4DE5A 3Q87B 2D6FA 2MYNA 3H9JA 4KO4S 4U5QA 3V2UA 2QHXA 1ZVKA 1ZGHA 2VK1A 3OZ7A 4B9AA 1NRXA 1CUYA 4RK1A 1ZLYA 4LDPA 1A69A 4K28A 3EZFA 4MVXA 4HX9A 3ZE9A 4PLHA 2A3NA 4Q12A 1QGAA 1XC7A 5MN4A 3CE6A 1YC2A 2H0AA 2WABA 2WAYA 2WWWA 4LYJA 5JXJA 3C6MA 1FU8A 2QT0A 1FFXB 2GRJA 5F21A 3ROXA 5D3KA 4GVLA 5E4YA 4WTOA 4C0KA 3AU8A 1UBJS 2GPWA 2H4XA 4MH0R 4Y2RA 2JIDA 3DYIA 2ZBDA 3VBEA 2HHCA 2YXNA 2P2CA 4YPOA 1A5ZA 3QLUC 2YUIA 4YLEA 2WVJA 2P9ZA 5EHNA 1GZSA 3MJSA 3ITNA 1MG0A 4EZIA 1SK8A 4W1QA 4XYMA 4HI0E 2C9BA 1AMNA 1BXKA 1QB7A 1JYSA 1SVIA 2A0FA 1M7BA 1BH6A 3ODGA 2FF7A 4XQEA 1ZO8A 4TRRA 5JRDS 3TRKA 1SXJD 2EWMA 1SUCA 2OB2A 3VV3A 2WYWA 4Y9UA 1TX4B 4QOEA 4J4BA 3MMSA 1DXHA 2V4ZA 2AFRA 2EJWA 3GFGA 3RB8A 4MVCA 5JISA 1MHTA 2PUFA 1J2TA 4ARIA 2B4YA 1DE0A 5HIIA 1JHZA 1HYQA 1B0UA 1W4RA 3KUKA 3Q85A 4CBVA 1WS6A 3UMSA 5AVWA 4HNGA 1XDBA 3ADBA 2P41A 4ZEWA 5E6UA 1XRNA 1VE1A 2VSOA 3NGMA 5AOAA 4KWTA 4EVQA 5EGSA 3V9PA 3RBVA 5C8YB 5IAAA 2FSSA 3I76A 1Z28A 2G06A 3R3VA 2G63A 3UO8B 1I13A 4IEIA 2QMEA 1VDZA 1WMEA 1TW3A 4LDQA 1YZHA 4RD1A 4WKNA 3B7WA 3VXKA 4MITA 4B2PA 5KX5F 1NRWA 2ZYVX 2QTVB 4EW3A 1OWPA 2VJPA 3SMQA 3SZMA 3D43A 3I04M 3KNZA 3PI6A 3IS3A 4L3VA 1NR5A 3V4VB 4MWGA 4OQLA 4CEJB 3R3YA 4AJOA 3GUZA 1L5QA 3QPVA 3LUFA 1RJDA 3GT3A 1WDLA 2XUDA 4IX9A 4PGGA 1M8FA 4RZIA 4WZZA 2AJ8A 2GPTA 5D86A 3W3AH 5AW1A 2PL1A 3FPFA 3KFXA 3COPA 4N5HX 3A05A 1NBWB 1LZLA 2K7ZA 1O6ZA 1JJAA 2YJTD 1X8JA 3VOAA 1QYIA 3WL6A 4AY4A 1J23A 2VSXA 5EKUA 1YGYA 4UBMA 5EIFA 2P9YA 3KYJB 4Q6BA 3ZY4A 1YQUA 3VOTA 2I87A 4ES6A 5TQ0B 5CB6A 5ADHA 4BJ6A 2DR0A 4J2HA 1B0PA 4YS6A 1XU4A 2C1XA 2VAXA 1RWBA 1ADGA 2CF5A 3FR7A 3PJEA 2GKOA 3EFOA 5AKJA 2PSFA 5HJ2A 3WOVA 4D45A 3JVEA 5HCUA 1JHPA 2XGJA 4B40A 3JQDA 1XMQB 9ABPA 1Y4UA 4IQ8A 4G1UC 1B6TA 3EG9B 3B3GA 3A2LA 3BRQA 3G49A 3IVXA 4M1KA 4DNOA 5FD8A 1XMXA 2L0XA 2YWXA 3EH2A 4H0CA 1A8SA 5ALJA 3NEPX 4BNLA 3F96A 1EWVA 1Q7GA 4MPRA 4RHCA 5JDCC 2P4HX 1EINA 4DQUA 3ZLJA 3F4KA 2XUAA 2H4WA 1ZBQA 3D2LA 1E5TA 5DEOA 5IM4F 3Q7TA 1D2NA 3GCZA 5FTLA 3RS8A 1BVYF 5FKJA 1EVLA 5K3CA 3WGVA 2CT8A 4TV9B 1FXUA 3WJ7A 1BJRE 3G5LA 2PX3A 3OX1A 1MEOA 1V8PA 3DP9A 2H00A 4GOOD 3JSAA 4UBJA 2W6ID 2CBGA 4ZHQB 3FROA 4KXMA 1DJMA 2XADA 1LDNA 2C03A 3Q9NA 1VHWA 3UHAA 5JARA 4ZVVA 3PGMA 3RSLA 1SC3A 3C41J 4FDAA 4TSFA 5HKBA 2QGNA 2ORWA 3I5YA 1QQ7A 5C5IA 1OI4A 3ED1A 1WXWA 3QXXA 1R6VA 4F97A 5KWJA 2W6JA 3N2ZB 1E5VA 2X5JO 4L6AA 4ZQFA 4Y9RA 4DKXA 1VXOA 3F7NA 4E21A 4DSOA 5JCXA 1K7YA 4M22A 2UYYA 3AONB 1ZC3A 1U7ZA 3NBAA 4PG7A 4IGFA 2W8BA 1C7RA 4H27A 2J4DA 4RYLA 1Q91A 5IBPA 3ONVA 1ZUD1 3PTLA 1V7QA 2JRCA 2ZI5A 1I4OA 1X1AA 1JEQB 3CR3C 3OTGA 1REQB 4P38A 3NXSA 3VHXA 4CHTA 4HAZA 5JH7A 3UKDA 4R40A 3VPXA 2BH2A 3AEYA 4LZOA 4MKIA 5LP6B 2AB0A 4AAYA 4IQ4A 1RAAA 1WVMA 1OXMA 1TW2A 1N4DA 1PJLA 1Y7PA 3TKYA 2FDRA 4W5HA 4ARAA 1Z0KA 2ATCA 5E6RB 1KMIY 3RF6A 3SQXA 2JCSA 3ZJVA 4YT8A 3PG5A 3O38A 3ORRA 1OYWA 4GMHA 5L8VA 1XA0A 1MIOB 4XRGA 4RBNA 1QHHA 2RHBA 3CVJA 4UU8A 2PUVA 2ZYGA 4AMUA 1LBQA 1J97A 2P6NA 1P2DA 2DPMA 4KQHA 3GFRA 2Q7OE 3DBLB 1I7PA 5F9HA 3OQHA 1N5MA 4DCUA 4OM7A 3WFJA 4AKHA 5ILOA 1WKVA 1PEAA 2PTGA 3KOYA 1NU6A 2MSCB 5FBRB 2ZUDA 4JLUA 4M2LA 2HMTA 1JZTA 4BX3A 4BGUA 4N8SA 4YA6A 2XMGA 3KEMA 2WIJA 4Y6RA 4LHEA 3KDSE 3S8EA 2R6GA 1CFZA 2VOJA 3I73A 4DJ5X 2GERA 5HKKD 1E69A 1YS4A 1GCIA 1BSVA 2I1LA 2OOKA 5D85A 4CMEC 4QBGB 5K0ZA 2DJIA 2VCHA 3CM0A 3FUWA 4QECA 2OYSA 5D3ZA 2CXUA 1NN5A 3PHCA 2CLLB 1N2ZA 1DMRA 1X8LA 5DOVA 3AHEA 3QQPA 3RSOA 3DE6X 3U0VA 4N7BA 3SSNA 4X8OA 2XT6A 1YZGA 2WINI 2B1GA 4TL7A 3QTTA 4RIGA 3W1WA 5EE5B 2Q27A 1S6YA 2AG8A 5JHGB 3ENQA 1BXRB 4D5EA 4AY2A 3LVFO 1RVV1 1DO0A 2QS9A 3FFWA 4HDRA 1JEYA 2H85A 1FRZA 4M1YA 5CNIA 4AUNA 4HNTA 5IKMA 2QD3A 3AUYA 1XZHA 4K9QA 4FGWA 3NYWA 3HJFA 3ES9A 3UYLA 4EFMA 2JAXA 1P1JA 1GPH1 5ENDA 1LLQA 4NICA 1G60A 4OQYA 1PK9A 1PR0A 2W7TA 4N18A 1PJSA 4GKKB 1LTQA 4L9AA 3R3XA 1T5LA 2XVMA 1IZ9A 4HAVA 1KEZA 5AW0A 4OQPA 4P8RA 2EVWX 5BSMA 2QZSA 1Z0AA 3CXUA 5AP9A 5K3BA 3VZDA 4Q1AA 3O2SB 4OI1A 4R05A 4IY1A 4KDCA 1TGYA 3LG2A 1TTQB 2G6TA 4AN0A 2YJNA 2WILA 2EARA 2O3TA 1GU7A 1NW6A 4QHSA 2VSNA 2W2OA 3LFUA 4M87A 4LZNA 1P0PA 4AJ9A 5DX8A 3TLZA 2GZMA 3E9CA 3V9AA 4BNTA 2GO7A 4H6XA 4QO8A 1JI0A 2ZSJA 3ADOA 3I37X 4KWIA 4XM0A 3V8VA 1CY7A 1WEKA 1X0XA 1TAUA 3OZDA 1Z5UA 3HS3A 3HWSA 2I3ZA 4Q3DA 3BJIC 1TVCA 3QW2A 4QYMA 4Y0VA 3LWBA 5ICCA 5JQWA 4HYYA 3ZDCA 3G1UA 4ZI7B 3IDZA 4EG7A 2AN4A 1SBZA 3ISTA 3P26A 3ER6A 3SX0A 4D81A 3OZUA 3GUHA 5IANA 4G0OA 2I6SA 3ZTYA 3S28A 3V33A 1BKSB 3FDZB 4IEEA 4PBTA 2B92A 4A8JC 4RTLA 4TTPA 4WKBA 2PMFA 2AQHA 2JGRA 2OENG 5C7YA 4ERNA 2HUNA 4YFVA 2BI4A 2B30A 2BJWA 1N8SA 3UK7A 4EW6A 3MJEA 4KPGA 5LWQA 1ZITA 4KB5A 4FFWA 2DM6A 3Q40A 1KNXA 3LQ1A 3M1AA 4QJBA 1AD2A 4R2WA 1E3IA 1SCUA 4KFSA 4PXYA 2UV8A 3PI7A 4ED9A 5A7GA 3KXLA 4ZJUA 1PT6A 3GBVA 3FYUB 3DZIA 4PLTA 4ZI3A 3L05A 5CM2Z 3I6BA 4BLVA 3IMEA 3T4UA 1G1MA 4HWPA 4WRRA 3ZVRA 2D3TA 5BMVA 5HKLA 2PRKA 1QZZA 3LH5A 2YWCA 4JEUA 4IXWA 2BFOA 3VU1A 3L7BA 3MTDA 1J99A 2WQ6A 3WIDA 3R3UA 2KS6A 5F73A 3NDBB 1TU3A 4IS2A 4IVQA 4C01A 2CC2A 3QPCA 3UK1A 1XTRA 3AFNA 3OZWA 2G76A 4YYZA 4Z4IA 3H18A 3K4QA 1N6LA 4KAJA 4D92A 5IJ0A 4EHBA 2IUEA 4PHHA 3FOWA 1FMJA 4HAOA 4IRUB 2OD9A 2OUKA 4HB3A 5DNVA 3WNZA 2FMUA 2NSYA 2ONKA 3C8MA 3HI6A 3NTQA 4HMOA 4EIWA 1R10A 2NAPA 1FDVA 4RFLA 3OZBA 2HEIA 1OHHD 4UE6A 2VDLB 3UAWA 4A5SA 2I3BA 1NP6A 1MRZA 2BFPA 1VMIA 3A25A 3K5IA 1TL7C 4ZALA 4G5GA 3A3OA 3Q9UA 4RGVA 4PLZA 3TQTA 3PU6A 2PLWA 2GLXA 3EZ9A 3DOCA 1VHQA 5J2TA 2IXBA 1JKXA 3R7NA 2P0AA 4CMBA 4QT4A 3H1FA 3FYSA 3OLZA 2JGKA 1TF2A 2GCIA 4HRVA 2VLBA 1E3WB 2LV8A 3EDQA 3KTFA 4FDUA 3TX6A 2ZWIA 3D0OA 6REQB 1RHQA 5KWVA 1YDHA 2H5IA 5LZ4A 3I2FA 5ECGC 1K7CA 2AN5A 2XB9A 2BHLA 5C1IA 1P2FA 5DTRA 5DI9A 3L0IB 2VF8A 4BYMA 1P31A 1KXJA 1JN0A 1UPBA 4K9SA 2XMRA 1GLGA 2A1TS 1QHGA 4K1LA 2PL3A 2WHPB 2XUIA 3PXCX 3UYKA 4R1PA 4BV8A 3FIUA 2QUJA 2UXCB 1T35A 3U7HB 3CRW1 2J5QA 1N5RA 4H4EA 1UPCA 1VBMA 3ACBA 3N7TA 3D4NA 4JK3A 4I6GA 1GRQA 3KPVA 5BVGA 3RC8A 2JFOA 5AW4A 2NTEA 3I5MA 1UJ6A 3GVCA 1QV7A 2AGVA 1MENA 3DL7A 1MOSA 1S0UA 3OT1A 3C8HA 4PIVA 3NBFA 1KAQA 2R8BA 4F91B 4JI8B 1NDQA 1P60A 4D80A 1EUCA 1ZM7A 5FOUA 1WLYA 1N0VC 3TZKA 5I5EA 1U8CB 4Q5IA 3SZRA 4A27A 5FI3A 1CP3A 4URHA 1L9KA 4YJ2A 1K68A 5HFNA 3OY7A 1E98A 1JKJA 1Q19A 1DIBA 3RUCA 4LZLA 1S3GA 1KP3A 1KEPA 4HQ6A 5CVEA 3SBEA 5BY2A 3VDNB 3AP1A 5T3UA 4XPZA 2OVBA 3V8BA 5KNDD 3NOOA 1WPQA 2PJRA 4V0RA 1VJCA 3FNQA 1J22A 1JDJA 4AMGA 1A04A 1A76A 1QTRA 3EJ6A 3RTEA 3UAGA 1O94D 3GMTA 1AUPA 4PQFA 1RHUA 1V9LA 2RHCA 4CMCA 3IR6A 3AUTA 3FMGA 3P2MA 2HY7A 4R8RA 3BVPA 3GFSA 4ZN6A 2R0QC 2A9PA 2Q8QA 2P5YA 1PQUA 3AEUA 3L93A 1Y63A 4GI3A 1H2HA 2Q2VA 4HMPA 5DASA 5A2GA 2ISCA 1UM8A 3PGVA 4WJZA 3T4XA 3WL7A 1T9CA 1VLJA 3RC3A 4AROA 1I14A 1L7BA 2X1HA 3NAMA 4BBZA 2NZYA 4EVRA 3GLIA 1O58A 4ARVA 4DA6A 4PYJA 3OQMA 2GVZC 4I55F 1TE2A 3NORA 4H1HA 1KXZA 3HN7A 4WCFA 1Z5WA 2F2TA 2WWIA 3CLUC 4X44A 1IM8A 3EBPA 1FP6A 3BGSA 3KPWA 2WKPA 4D4MA 1TQ4A 2OGSA 4DNXA 2PD3A 5I7VA 2IP4A 4KPUB 1YE5A 4FC6A 5DBFA 4RS3A 4R1SA 5F1PA 1CQIA 2JLWA 1D9XA 1Z2OX 2Q5JA 5JNWA 2PS1A 2WIBA 3BXZA 1DOZA 1PZFA 1WUTA 2DVMA 2XDQB 2WPDA 4MV7A 4A0FA 5U9CA 2FMHA 4HZGA 5DGTA 4LXXA 1HZZA 3BSSA 2VPYA 5HA5A 5L3RA 3D1JA 2FVXA 1P2GA 1KVQA 4ZRMA 4K8RB 4KFRA 4UZFA 5EWJA 1B76A 1DELA 3TLBA 6ABPA 3DFKA 3NOVA 4X65B 4AYXA 2I8CA 1HDIA 3TKLA 1RYMA 5GTDA 4J0QA 3WWCA 4C7OA 4FCTA 2OHFA 3PQ7A 4HLUC 2OGUA 3EHDA 4KYIB 4C2AA 4CN9A 4LGVA 4U9IS 3A6GA 3MWEB 2JD1A 1U0HC 3EDMA 2H8KA 4EX7A 4TYNA 2XE7A 4NJOA 2GPJA 4BGEA 4DUZB 1SUEA 3ER9A 2OXIA 1KVUA 2DP4E 3U19A 1PF7E 1BYUA 4RPCA 3RASA 4DS3A 2HYDA 2JF0A 2R60A 3GLIE 5KNBH 1CVIA 1K6IA 1JA1A 3P2OA 3QX9A 4G4JA 5DB4A 2X40A 3QPWA 3AR4A 3ACDA 3PXUA 3HJGA 3JAWB 3MGGA 4PSAA 5PNTA 3AILA 2W2XA 2QNBA 2WG2A 4WBSA 1KYTA 4TLLB 1QHIA 4PYOA 5JJBA 3HKDB 4JKIA 1P9RA 3HR7A 2OR3A 2C2KA 2QNRA 3NUQA 3L8YA 5AI5A 1BCSA 4DDUA 4OP2A 2Z5FA 2NO0A 1QH8B 2EKDA 3QU2A 3KWFA 2L42A 2QIOA 4AJNA 4CMJA 3BGVA 4OK6A 1UAGA 3QA9A 4LK2A 2Q3DA 3QKSA 1DCTA 1JHYA 2UUOA 1SEPA 4BEWA 5IDQA 4F9GA 4X1IB 4FEGA 2QQGA 1X87A 1DEOA 4IZ6A 2NQ2C 4ICIA 3T0GA 1ZXLA 5K51A 1QLWA 3BSFA 1GPKA 3LX8A 4ZYTA 1Z07A 3D59A 2MSNA 1P4GA 2QJOA 2IU3A 1I4EB 4BOYA 2XCUA 2I7VA 4AMZA 3GGSA 4RK0A 5LA6F 1MMFB 2B3DA 5IK2A 4EI2A 1R6BX 5IASA 4QLOA 3VJRA 4JBNA 4Y67A 2UUBB 3ID6C 4L08A 3PR2B 3WL4A 2YXEA 3E9ZA 3FFBA 3O9VA 4QG3A 3I6MA 5H59A 2YJ4A 4R2JA 1C1DA 1WPGA 5TS2A 3B7PA 1Q0SA 2PAFA 3B82A 3IT3A 3DV9A 4N7MA 3W8NA 4A0HA 4U02A 4Y9TA 2WHRA 1DTWA 2HCRA 2OLEA 4LE1A 4H17A 4P4LA 4KNVA 2GH1A 3OZGA 3F9IA 3A27A 4EUHA 2NYAA 4S3MA 4ZJPA 5J4HA 2IYOA 4N49A 1YONA 3H2GA 4M86A 2NZ2A 2LZ0A 2JRLA 5EIOA 4Z9AA 5IXJA 2GYYA 2AI2A 3PIIA 3QQ5A 3WGTA 3Q7PA 4D99A 5ALGA 4DYDA 1JEJA 1E61A 1NV9A 2QRMA 4EGJA 1O9HA 4P3PA 1NXTA 4GWGA 3SSMA 4HVAA 1DQPA 1NMYA 1XZMA 4YAUA 2DPXA 3PC4A 5BN3B 1EUDA 1KZ7B 3RVKA 2IPAB 5KQMA 4MUMA 4UU7A 4GMDA 5FNVF 1QG0A 3DFZA 1DBQA 3O8QA 4MWSA 1I80A 4MUYA 4PC3A 4DA9A 2AWOA 2QQ0A 2ZRGA 3DLTA 1T26A 3PGA1 4HC4A 1FMFA 5CJJA 3TFWA 2LUOA 4QXQA 1SHJA 1L4NA 2CLCX 1P0MA 5JV5A 2WG0A 1EEXB 3W6PA 3SK0A 3CV3A 1WHTB 4FZ3A 1YBVA 4PYQA 5DGIA 3DEFA 2VP0A 5H8WA 4ZDKA 2VBGA 5LQKA 1J0BA 3BJRA 4RIIA 4MUIA 2QQ5A 5IDXA 4Q3NA 4ILKA 1FFAA 1TTHA 3JQEA 3E5NA 3GD5A 1XAIA 5EUCA 4ZVKA 4DCNA 3KKOA 3S2YA 1S7GA 3ZGYA 5EPOA 2OQVA 4DV5B 2J3HA 1WCXA 3F78A 4KXNA 1OLUB 3UIEA 5LZ8A 1CZLA 1UDRA 3QMWA 1LV8A 1OLXB 5L51A 3THXB 4QWWA 2OHOA 3Q2IA 3UMCA 3LLCA 2C4MA 1P8JA 3WNCA 4PXAA 3BULA 2R68A 2ZYHA 3C4QA 8ADHA 2QVLA 3IFSA 3IMKA 4Y3UA 1KS9A 1GL9B 1HFEL 2A5DA 2WW8A 3ST7A 4CKBA 5TS3A 5EP1A 1XZEA 5AW2A 4LRTB 2ZYSA 4CV2A 1DX9A 1XI2A 5JS6A 1H1TA 4A8JB 4PGHA 4RKWA 1EP3B 1UBGA 2WVGA 2Z2JA 5H83A 3ZX5A 5LZ7A 4KXXA 3WA6A 4Y98A 2D62A 3LCCA 2EHDA 4N6OA 1B1CA 1I2DA 2Z2XA 5MDHA 1NE7A 5REQB 2JKVA 3ZD9A 2RDMA 3LC1O 2HK6A 4Z8YA 3L8DA 4I8DA 2SHKA 3RSCA 1KZGB 4LFAB 3UG6A 2L69A 2HHJA 5I6DA 3V7YA 3QFCA 1JA0A 4NFSA 1XJWA 4KH1A 5KYNA 4ZYWA 3R3ZA 4MWEA 3A3KA 4GPIB 3PPXA 3JYQA 2FEXA 1B6GA 2G9UA 3IO3A 5LNK1 4RTPA 4M0EA 3U4QA 3RC9A 2VSFA 2VF2A 5CG1A 1NL3A 1C7ZA 1NOKA 4MDHA 4QUIA 3MWKA 1S8FA 1JPJA 2C4NA 4B4UA 3W4JA 4YH1A 3HO8A 1SXJB 3KZKA 4AWBA 2YFHA 4CMKA 3W5UA 2DLDA 3WGNA 3P9YA 3IKJA 2H1VA 5UKDA 1N9GA 4G86A 5EMMA 3ZHTA 4B9EA 1R0LA 3RREA 1YDFA 1Z5ZA 2CHFA 4PAMA 3I3OA 4M21A 4RFSB 2BKUA 3E9EA 3SC2B 4LOJA 4YMLA 1I2CA 2H5JA 4U2DA 5KOJB 2E3JA 2V4MA 4YQZA 2GZ1A 4B6QA 1QP4A 2DHRA 3EA5A 1GRRA 3WICA 4H59A 2I6XA 4FLMA 4QUJA 2IXGA 2GRAA 2Z9BA 4TQAA 3ZLTA 2ZCUA 3ECSA 1B16A 2REQA 2ID9A 3DSRA 4RVHA 3UG7A 2IDKA 5BO5A 3BWBA 1H0SA 4C7BA 1TJPB 1H9AA 3DVAA 4DV1B 2BEKA 2X4GA 3FG9A 4CNBA 1EGHA 5JZMA 1GGFA 2PXCA 1N2HA 5FIUA 3RRXA 4BLSA 3OX4A 2DPHA 3A1UA 1CRLA 3H0KA 3G2MA 1ZGAA 3PLNA 3PPIA 3WAKA 9LDBA 2O2HA 1GEEA 3TS1A 5KKNB 4Q66C 3A9VA 2ZPTX 2JHCA 4RHUA 4ZT2A 4DJJA 4BMCA 1J24A 2I3DA 1O94C 4NKRA 4XCXA 3K6KA 1EFVA 2JJ2A 2P1RA 3GP8A 3DTTA 1A9XA 2QTLA 2RH4A 2GS9A 1Q6ZA 3EDYA 5A7HA 3MMZA 3A9WA 3UB3A 2A5JA 2IUSA 1MQAA 3NATA 5DCWA 4J1TC 2HD4A 6LDHA 4LE0A 4RTKA 4GGPA 3DL4A 3RIEA 3VPHA 3GP5A 1DQSA 1UWCA 1VE3A 2BP7B 1XCJA 3OHMA 4BMNA 1GPUA 1U3WA 5KZMB 5AM1A 3D5TA 3HN2A 1FS5A 1DAMA 721PA 4RENA 4MPPA 4MLDA 2I2FA 1TU4A 4MGHA 1QFJA 2HF9A 3TL3A 2P8SA 1ZUNB 2CLOB 2QT9A 4IMPA 3NQ41 4DSZA 4X62B 3LCVB 4YRIA 2F6RA 2VHTA 2GSWA 2J9YB 3VYVA 3LCJA 5T8KC 1WB9A 5JMWA 2XSZD 3UANA 1GIAA 2GCGA 1VDMA 4YC7A 4DLZA 4QXPA 4YV2A 1DPFA 3OUUA 4ETWA 4W82A 3K9QO 2HBYA 3C48A 1XDSA 3IP9A 1W88B 3LQYA 3OO0A 3P19A 4P4SA 4QDKA 5K8VA 4JU8A 3DF9A 3PWKA 3D3EA 1AKMA 4JGIA 2W6JD 3KETA 2X4LA 5J5CA 1SO8A 2Q9CA 4JBHA 4AKIA 3KJZA 5K6TA 3QU5A 2WIDA 2ZTSA 4LISA 1CY2A 1YR6A 2J3EA 3A04A 3ZV5A 1NT4A 4NCNA 4BPRA 1AURA 5E7MA 3W9SA 2OCXA 3ZI7A 2ZK7A 1OJLA 5DH9A 5ES4B 1X7ZB 4U3JB 4WJKB 5DRTA 3KQYA 1JP7A 5CBPA 4N76A 1B14A 1F8FA 1TPYA 3L1VA 1G19A 2X5XA 1BCRA 2J5XA 1WOMA 3BIJA 4Q4HA 4BFZA 3SIXA 3GLSA 1O03A 2ACVA 1PJAA 4ZRNA 1ACLA 1Q3TA 2AX3A 1TECE 3UAYA 4EGFA 1SUSA 2Q4DA 5C8XA 1X7HA 3H97A 4WKOA 4A5OA 1EVZA 3O4IA 4RVCA 2W8ZA 4B7CA 3BL8A 4NRDA 3GAZA 1DKQA 2GPAA 1RAEA 1RNLA 1P17A 5EKXA 3RS9A 4FDTA 4CL2A 1J6UA 2P11A 2OCGA 1FJGB 3N86A 2ODWA 4GM4A 5HFJA 4CM9D 2ZSIA 2Z3ZA 5DNUA 4OB6A 1RMYA 4OA5A 1VYVA 3TX2A 3MTQA 4YB8A 4AKSA 1PYGA 1DI0A 1GNRA 1U31A 4JUDX 4W4TA 4AG3A 4OSOA 3UJBA 5AKIA 4ZHSA 2XNHA 1YAHA 5JXWA 5IM4A 4C87A 2IX3A 4J0HA 2XCQA 5DWQA 2OWEA 3FOAA 1ZFNA 4L5BA 3WMEA 4BQIA 1A72A 1UF9A 4E6EA 3SOZA 4F92B 2FTKE 1GP2A 4L07A 1ZD9A 2UZ3A 1QGUB 5LYJA 5LQDA 1ILEA 3DLHA 1X7YB 4QRDA 2ZATA 4HQNA 4YACA 3O91A 2GA9A 1BGXT 4YYEA 3FI0A 4GYWA 5DVZA 3WGJA 3RBAA 4C76A 3FRJA 1BKDR 1EVQA 5DM60 1O89A 2C2HA 3HPRA 3LQ4A 1G20A 1I1NA 1N5IA 1T3GA 2QM0A 1W4AA 2OAEA 2XQFA 2VSYA 3HEMA 4M8LA 4RVGA 1RLJA 3TRDA 1TO6A 3EG5A 3GFVA 3DPUA 4EATA 5KJEA 3AY3A 3BYZA 4KKVA 5SY6A 4JITA 2X0IA 3R44A 1P7ZA 5E1BA 5LQMA 4MI3A 2QN1A 4LXTA 4B44A 1N34B 3C6BA 3JY6A 1W30A 5FYDA 2ZRCA 4HATA 2VK8A 4TTRA 1GA6A 1UBOS 1FMTA 3R0XA 4HBGA 3RLFA 7ABPA 5D6NA 4F5DA 2IOFA 5IAJA 1I8TA 1OH8A 1YUNA 1LJ8A 1J8QA 2FUG1 1JWLA 5K6AC 4MVJF 3HKBA 4AJHA 1D6MA 2Z2KA 4L0MA 4DN6A 3ZS9A 1AKUA 1XLTA 2F9MA 5LZ9A 3LHFA 1DC6A 3AERB 1O5IA 3A8TA 4IAOA 3SJZA 5JNTA 4ITUA 3T52A 5JXHA 1G42A 1X3SA 4I4TB 3LYLA 4RM3A 1TQ2A 4FJ2A 3BERA 1ZOIA 4V03A 5IJZA 3O1IC 1QKKA 3BMNB 2PRYA 3WYAA 4G1MB 4ZU3A 3R09A 1ZH4A 1W8IA 3MINB 1PW5A 3KSUA 1N77A 2YJ6A 1QCZA 4UE2A 4EYSA 1TC2A 1OU4A 1VB3A 1YBHA 3D3KA 2JHAA 2V6MA 1MB2A 1XEAA 2X8JB 3DAYA 3MTGA 3NJRA 4GMXA 1I7QB 2QLFA 3TYXA 1AA6A 1Z4OA 3ZWOA 3WQBA 3GLGA 1A4IA 3ICEA 2PWYA 2GZHA 1A0OA 1C2YA 2P9TA 3EGVA 3KR1A 5AT1A 3C3AA 1OB2A 4QYWA 1FFYA 5CCXA 1KI4A 2GYUA 3GIDA 1UAAA 4XSGA 4ZYXA 1GA4A 1GQRA 3EARA 2UUCB 1ISHA 3MGKA 1HKHA 3EVCA 4LJ4A 5EZQA 4CUKA 3GJ4A 5B7PA 4XA8A 5F98A 5FPKA 3D8NA 4U00A 4EABA 3GQBA 4CI9A 3PC2A 5JANA 3EXG1 4JLWA 2IYAA 2VCEA 1W6RA 2P2ZA 2HIAA 1A2KC 2PBZA 3CZCA 4XH9B 4GR9A 4WNCA 3WLJA 3RGWS 4B34A 5F2EA 3G89A 4DJAA 2A2ZA 2EGUA 2C4KA 2ZBPA 2UXDB 3RWOA 1CE8A 1SEVA 3FPLA 2VQDA 4C3VA 5LKAA 2NU6A 1Y9EA 4JLDA 1GHTA 4L78A 1UXHA 3L4SO 3RVLA 3WLHA 4EDHA 5JAOA 1NM5C 1OROA 1Q0UA 3VZCA 4JBLA 3RD5A 1QHSA 3C16C 3JALA 1X14A 4RHXA 1KDYA 2OUIA 3DB1A 1JFLA 1GTJ1 1R4NA 2HBRA 2ZJZA 4WN9B 3RK4A 3RNOA 5FBVB 2H54A 2O3RA 3HSYA 2QP9X 4RQAA 3ROTA 4DCCA 3D3QA 4G01B 3EZ2A 4P3NA 4KR7A 4OHMA 3OP1A 2Z6UA 2W4IA 1E0JA 1SCAA 4KO3S 3U26A 4X3PA 5EE1A 2ZJ8A 4XIGS 2BDTA 1DKMA 3QVLA 5KCMA 3GLGE 1NJFA 5KHAA 5C4GB 1QFMA 4YCAA 4YY3B 1ZNQO 1A7JA 4ZAVA 3U7EB 4G24A 1JLSA 3I04A 2GO1A 4KSBA 1F7UA 4JAVC 3Q7SA 3IVAA 4DMMA 4O2AB 1R6AA 4QOGA 2XBLA 1NQUA 4PYNA 5B3KA 1XDUA 3OT5A 4QJ3A 3PQDA 4KVFA 2HB6A 1IZ0A 4TXHA 4NYMQ 3KEQA 5HGXA 1PLLA 1TEZA 2IFTA 1ZXXA 4OHBA 1QH0A 5DCYA 1CBUA 5HKAA 2RE8A 2XGMA 4RVDA 5T3YA 4HWOA 3ZWAA 3GEGA 1Z4PX 3EIHA 2RHMA 4ZK6A 4DJDC 1P44A 4HZUB 1TZCA 1WZUA 3D8SA 3SYKA 1TKAA 5KU1A 3QU7A 2P6OA 3WJ1A 4MUAA 5BSRA 3OZEA 3S1AA 1Y3FE 2QMOA 2ZI7A 5C53B 4TQGA 1L1RA 3NDPA 1N3BA 3P4XA 4JEHA 5K6RA 1XYYA 3C5CA 1SVOA 2Q6IA 1QIEA 2ONYA 5KNCA 2VUTA 1Y5NA 3JR7A 1ZRHA 2H4HA 3GRUA 3NAQA 3NI2A 1RJWA 2OGTA 2VP6A 1BFUA 2YYYA 2IYPA 2AMLA 3N05A 5AJYA 1UK9A 5E8JA