4D8VA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
231
structure length
231
Chain Sequence
b'SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 79
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d8vA00
4DANA 1RT9A 3UT6A 3EUEA 4YJKA 4NS1A 1K27A 4QFBA 4R31A 5F78A 1TGYA 1OTXA 3FWPA 2OC4A 4JOSA 1A9RA 1VFNA 4TXHA 4TTAA 4NSNA 1VHWA 1K3FA 4PNPA 2A0XA 3BL6A 4JP5A 3KVRA 4GKAA 4L5AA 1V4NA 3ODGA 1Y1QA 5IU6A 4GMHA 1NC1A 5JPCA 3INYA 1Q1GA 1Z35A 3KVVA 3MB8A 3GGSA 4QEZA 1T8RA 5IFKA 4JWTA 4G41A 4E1VA 5F77A 1JP7A 3KU4A 1PKEA 3FB1A 1K9SA 5C80A 4L5YA 4WKOA 1CB0A 1Z38A 4PR3A 1TCUA 1Z5PA 4L5CA 2XRFA 5EPUA 3SCZA 1A9TA 1Z33A 3E0QA 4R2WA 4BMZA 3EEIA 1PF7E 3IEXA 1TD1A 2OC9A 1T8WA 3LBAA 1PR0A 2A0YA 1RR6A 1RFGE 1ZL2A 5CCDA 3KVYA 1PBNA 4DARA 1B8OA 3PHCA 4YO8A 5KB3A 1PR1A 1U1FA 1LVUA 4OGKA 1Y6RA 1RXCA 3OZBA 1T8YA 2HRDA 2ON6A 1U1DA 1A9SA 2OXFA 4WKPA 1Z39A 4TXNA 3PNSA 5ETJA 1NC3A 4QAQA 1Y6QA 2QDKA 3OZCA 1FXUA 5DK6A 1A69A 5F7XA 5EFOA 3P0FA 4U2KA 4DA7A 1OTYA 3P0EA 5B7NA 3OZEA 1ODIA 4DAEA 4YMLA 4IP0A 4EARA 5F7OA 3EUFA 3BSFA 4NY1A 3FNQA 5CCEA 3OOEA 1LV8A 4QASA 4F2PA 3KUKA 5K1ZA 1PR6A 1RSZA 1Y1TA 2ISCA 1JDTA 4UC0A 4L6IA 4H1TA 3FUCA 5F73A 1JE1A 4DA0A 1PW7A 5B7PA 1YBFA 4GLJA 4MCHA 1Z36A 2AI3A 4FFSA 1V45E 3ONVA 1Z5OA 1PK9A 1OUMA 4D8XA 4TS3A 1YR3A 1RCTE 1ULBA 4YNBA 4TYMA 1PR2A 1YRYE 4TXMA 5CXSA 1ULAA 2QTGA 2H8GA 4KN5A 5CYFA 3QPBA 1OU4A 4LKRA 1RXYA 4M1EA 3OF3A 1V3QE 2A8YA 1LX7A 3LA8A 1WTAA 4F3CA 3OOHA 2AI2A 1M73E 1JDVA 1JYSA 5B7QA 5I3CA 2HN9A 1RXSA 3BJEA 2B94A 3DP9A 3NM5A 1RYZA 3U40A 5CXQA 4WKNA 4ECEA 1QE5A 4TXJA 2HSWA 4TTJA 1Z5NA 2QSUA 4BN0A 1Y1SA 4LNHA 3PHBE 1SD1A 4D98A 4DA8A 1RXUA 1JDUA 1ECPA 5F76A 4D8VA 4TXLA 1JDSA 4LDNA 4D8YA 1PR4A 1G2OA 3LGSA 1B8NA 4G89A 4P54A 1I80A 4BMXA 4D9HA 3FAZA 1A9PA 1OVGA 1JDZA 3DDOA 3E9RA 4QARA 1TGVA 3D1VA 3OPVA 4R2XA 3BGSA 4LNAA 5CYGA 3K8OE 4MARA 2AI1A 4F2WA 3UAVA 1YQUA 3NBQA 4I2VA 4OJTA 3NM6B 1N3IA 1U1GA 1U1CA 1PWYE 3OCCA 2Q7OE 3GB9A 3PNPA 3UAXA 2PGAA 1Z37A 1OV6A 3KHSA 1SJ9A 4F1WA 3DJFA 1Y1RA 3UAZA 4WKCA 3T94A 5F7ZA 3DPSA 1V41E 4EB8A 1XE3A 1JPVA 1SD2A 4GLFA 4BMYA 1PR5A 3O6VA 1YQQA 4OY3A 2I8AA 3NM4A 4OEHA 1CG6A 3ENZA 4DAOA 4DABA 2OECA 5F7JA 3UAWA 3EMVA 4WKBA 2A0WA 4M7WA 1A9OA 2GUWA 4DA6A 1ZOSA 2RJ3A 1TCVA 4RJ2A 3UAYA 2I4TA 5FAKA 3IOMA 1ODJA 4TTIA 3MMSA 1A9QA 3OZDA 4TS9A 1ODLA 2P4SA 5EUBA 2AC7A 1PK7A 4M3NA 2QPLA 4LZWA 1JE0A 1T8SA 1ODKA 1NW4A 4L0MA 1V48A 3C74A 4MCIA 4QATA 4OGLA 1T0UA 1VMKA 3DF9A 4X24A 1V2HE 3O4VA 2QTTA 4F3KA 2BSXA 1U1EA 5B7GA 3F8WA 1Z34A 1C3XA 3E9ZA 4G8JA 4K6OA 1SQ6A 3K8QA 4OF4A 2HWUA 2IQ5A 3TL6A 3FOWA 1VHJA
chains in the Genus database with same CATH superfamily
3O0TA 3FR7A 1FW6A 4Q7KA 4HB2A 4V0OA 3ZVMA 1RPTA 4ZKDA 1OA0A 3FDZB 1E2PA 4M9XA 1EVQA 1NHWA 1F48A 2PLRA 1D1SA 2F1HA 1ZH6A 4CQMD 5CEFA 5J2TA 2CB0A 3VGJA 4C3OB 2HU5A 4E5PA 2I29A 1C0PA 1UINA 3AVPA 3CO0S 1H6BA 3FTPA 3RD5A 3NUGA 1RKXA 3B6MA 1Y9DA 4RK1A 3ZTYA 5C1OA 4XLZA 2QTLA 1KMHA 3G2LA 3QFSA 2PZJA 3WQSB 4EUHA 4IIJA 4KN8A 5H83A 4PZYA 1Q1NA 1BE1A 3T9DA 4TTAA 2JFHA 1KOJA 2PWBA 3DHVA 1U4OA 2PEYA 4TTVA 3EGOA 2F3SA 2X0RA 4YCCA 2I3ZA 5HDBB 2PZEA 9MHTA 1ISFA 4N0QA 3GBPA 13PKA 4B3BA 5KWJA 2XGJA 1VCOA 2FSIA 1FFAA 4JP5A 5IMBA 4OSPA 1TXGA 2E6KA 5DTMA 2ZM5A 3GGJA 4FFOA 4L5AA 2JCGA 1ZHOA 3CLSC 1KZ6A 3EG9A 1EX1A 2GPSA 4FIZA 3D3KA 4H1UA 4I46A 3KD2A 5CVEA 3UC5A 4QJ3A 1U31A 1M76A 3UHJA 3FTFA 2IDZA 4BAGA 4DC0A 1CY1A 4MVJF 4IJVA 3A6KA 3QVJA 2QJRA 4DMKA 5HIKA 4QGAA 4Q4CA 3U4QB 3DNPA 2GF9A 2P27A 4MQUA 3BEOA 4KJZA 4IKOA 4PQYA 1N3BA 3CZQA 3I2FA 3E3NA 4DUPA 3ANYB 2ZTUA 1FVHA 2FG5A 3LCUA 4E1VA 1NL3A 2YZNA 3IDQA 3OJOA 3DOUA 3A1EA 4YPFA 4H60A 1QRDA 1U5BA 4PZAA 2ODBA 4H7EA 5FBKA 2J4DA 2CGEA 1T91A 1UFQA 2VF8A 4KUHA 4UUBA 2D2VA 3OPMA 1ADBA 3Q1LA 5IW8A 1KH2A 4L5BA 1RMQA 1I0LA 5LQJA 1F12A 2JJ2A 2V7VA 3HKDB 4MMZB 4KR2A 2VIIA 4FNOA 1QV7A 3UAOA 1XCPA 4JLWA 1W581 5KX5A 4AO7A 1KSJA 3ADCA 2NPFA 8OHMA 5C3UA 1EUDA 4BB6A 1QH0A 5KNBD 1VKOA 4MB0A 4QTYA 4HX9A 2BZSA 2HJVA 2H11A 5EI5A 5J5CA 4BYGA 3M0EA 4NK5A 3AONB 3OLQA 4DUGA 4JFRA 5IUNC 1UPBA 4TSFD 4H3VA 1LY1A 1MIOA 3RRNA 4W5QA 3QUBA 1GVHA 4ND5A 4UDXX 1BWPA 4IHJB 1PEYA 1LSSA 2A0YA 4WEOA 5AW9A 3RUFA 1KEEB 3A2NA 4JC8A 3CR7A 1GGEA 1E5LA 4G9GA 1ABEA 5IKEA 3H0CA 1Y6ZA 4Q34A 2W4IA 3K6KA 5BV7A 3E61A 1TLTA 3K53A 3QU7A 4FTWA 4RNDB 4UEKA 3S68A 1UOPA 4JIGA 2BCEA 5HQ3A 1ZW1A 4X8HA 2B69A 5EXPA 2PXHA 3EPLA 3PXDA 2O3QA 2J07A 4B3MB 3FCUB 1F2TB 1VG9B 1I7NA 3H0EA 4P31A 4UM8B 2VK8A 2B1RA 2JJYA 1MIHA 2P6PA 1Z0FA 2JLRA 3HHEA 4PIMA 3NR2A 4RHFA 2GJKA 4YALA 3R9XA 1MQ9A 4F6CA 1IM8A 1Y7HA 4L15A 3BULA 3SBDA 2V8OA 1AO0A 4M8SA 1DFIA 2H4ZA 1GDTA 3VSBA 1PYGA 3V4FA 4MJLA 1YDEA 4MUYA 4EHDA 4HYQA 3UPDA 5DP2A 1QCCA 1RKQA 2P35A 2I6FA 4NCXA 3OE7D 4OXNA 4TM7A 1JUDA 2CHGA 5EJMA 4ZWNA 1Z4JA 1I1HA 4D25A 4E11A 4UHBA 2FRVA 2AMLA 3IQZA 4OQFA 1BCSB 1Z7YA 1ACLA 1DDGA 3VUFA 1ZU5A 3Q7EA 1Y6QA 2C5HA 4UUAA 4CR8A 3GEDA 1JNXX 4OJQA 2BHTA 1DO0A 2OSVA 4YI3A 2F8TA 3IR7A 4GWLA 3HACA 3F5DA 4EQ6B 3OC0A 5LMCA 3R5SA 2H2IA 1L5MA 3ONWA 3E7DA 2H3HA 5FL3A 3R75A 4NWIA 4KWHA 2ODAA 3ZHXA 1NXPA 3ONDA 2GT1A 4M55A 3V4LA 5C1BA 4PLYA 4K88A 5HKKD 1RC0A 3DF7A 4JMLA 4ZEXA 2FI1A 2FWPA 4MRVA 3RNLA 5NULA 4AMVA 4AS3A 2JLQA 3V8PA 1NLMA 4BWYA 1XCBA 2EW1A 2LCIA 3PPVA 4RSGA 3BD7A 4RGQA 1ZVVA 3PE3A 4WXRA 4E21A 4EHIA 2R8EA 3RDPA 4TLMB 1T8TA 3GY0A 3JRNA 1E9SA 3S29A 5H82A 5I45A 2FUG1 3WMFA 1BXRB 4HTFA 3L7OA 4YCAA 1H4QA 1ZCJA 1WD7A 4HNQA 2ZRMA 1TCBA 2Y1WA 4LBWA 4LZNA 3JARB 3GLFA 4J7CA 4JUIA 3OWXA 5JH7B 4G07A 1R6DA 4UHDA 4YRCA 5ED0A 1VYTA 1L7NA 1PR6A 1RPNA 4HEA1 4IS3A 3VR5A 1JNYA 2W6PA 1T6XA 3FKJA 3D0KA 3CEAA 2JD2A 5TEWA 3WL6A 3NIGB 1U3VA 3Q7PA 4H1TA 3TGWA 2GKOA 3EVNA 3GVPA 3QW2A 1VG8A 5D7NA 4UBLA 5EESA 3ZDCA 1FMFA 2P40A 4RELA 1GRVA 4BBAA 2NO9A 3OZVA 4NAHA 2BAGA 3CH7A 5DYGA 4FOOA 4TRRA 4J1QA 1KBQA 5F2OA 4CIBA 3QUQA 4PYOA 1DEXA 3VR4D 2J6HA 1QP4A 4OU4A 3D7NA 3RF6A 3D2CA 1NQUA 1N2CB 2NAPA 1KBOA 1CUSA 2JI9A 2XB9A 3ASZA 4YGYA 1W44A 4DJAA 2FXVA 4O59O 3ZQJA 1NKSA 1LBSA 2ADOA 1QQTA 2BM1A 4UM7A 2DH5A 5J1SB 1G4UR 1TZ2A 3IAEA 4JQZA 4O2BB 4N3GA 4PINA 4U7TB 4W8HA 3AUKA 3OZAA 2IEIA 1DRJA 5C4GB 1KIFA 2AI3A 2JA1A 4R05A 2X9LA 1H66A 1I4LD 4FYXA 1A9XA 2V54A 5H5JA 3QVMA 3GA7A 1AK9A 2G0TA 2IKQA 4BQFA 4ER7A 5BXYA 1M1UA 5EKUA 3ILXA 5DM4A 3SZOA 4FZVA 5LWQA 3SY8A 2JNWA 2Y3IA 4PAMA 5BQXA 1NG1A 4WWHA 4B5LA 3I6QA 2FG7C 2VNAA 3HXMA 1W88A 2OV1A 3BILA 4XJXA 4WACA 3LPMA 2WRZA 3VOSA 3UMVA 2HU7A 3OQIA 4U7GA 2XKJE 4KN5A 3H16A 3WYAA 1V2GA 2V6MA 4IGKA 4KRGA 3RSLA 1A76A 1OU4A 1FDIA 2B5OA 4H1VA 1RJEA 5JXIA 2JBWA 1EG2A 5DWDA 2BJHA 1OFVA 4BUZA 1BWSA 3A2LA 3OOYA 5IM5A 3T35A 4FIDA 3NOVA 1K8YB 4P0QB 3AHGA 4UDYX 4XRGA 2PKQO 1DIAA 1GCUA 1LFDB 5MHTA 3KSAC 1ZWLA 5C8XA 3TLJA 1GUZA 2Z5LA 4D9KA 2BFOA 2C42A 3A37A 5B12A 3IQFA 4MRAA 4EG8A 3KOYA 5JDIC 2A5JA 3O1JC 5C3MA 1YVUA 4RTMA 3LTNC 1GLGA 4WESA 5HNKA 4U7FA 2HMSA 3D6VA 5EJIA 5CA1B 3E05A 1OLOA 3BJEA 2C98A 4FYVA 1QIGA 2ZITA 4K6MA 3IRUA 2VJMB 1YQGA 1OYVA 2WINI 3T4PA 4CI0B 2JEZA 1RQLA 1EIWA 5JEEA 4DC1A 1NBME 1IUPA 2YOGA 2MTBA 4H31A 2BFBA 2GTHA 3VYRB 2UZAA 4RLFA 1TLLA 4HDNA 2C2XA 3DCJA 4G9BA 1R37A 4Z9BA 4A03A 4M98A 4LNHA 5EQTA 3O2QB 4A7PA 1USGA 3RTCA 3KZMA 1LS6A 1WIWA 2Z3WA 2RJOA 3BJRA 1MAWA 2G9VA 3BMOB 3KYDA 2YRXA 1ECPA 1PQUA 1XWIA 4INAA 2V74B 3U26A 3ZGZA 1KR5A 2PGOA 1E61A 3DTVA 1E9FA 4H17A 1N2BA 1NW3A 3NBAA 2ZYRA 1D2HA 3FYUB 5IDVA 4GZ3A 1UJ2A 4CIDA 4MGYR 3JQCA 3TX6A 2ERYA 1HQDA 4NEGA 4B3IA 4PC1A 4F38A 5A4FS 4RDHA 1DJNA 1CHDA 1T3LA 3K72B 5T7BA 3JY6A 3MUOA 4MKXA 3S2IA 3N7AA 4ALJA 1WLYA 2XE6A 4BVLA 4LPSA 1JXAA 3QU2A 2YXPX 1KMIY 3Q12A 1HRKA 2AEJA 2E48A 2Y9MB 1B23P 1U7DA 2AG1A 4HY3A 3SC2B 3ZNPA 5LZ9A 3O03A 3PC8C 4OUDA 4B4UA 1VJ0A 3ED5A 2ISSD 2LE0A 1LTKA 5E6SB 1P4GA 2P5UA 1JBEA 3ACCA 2NSJA 3FETA 3PIRA 2QTFA 5GY7A 3TSOA 4C5CA 2AB0A 2CFRA 1XD2A 3BGWA 3ZDQA 1TKCA 4ZIRA 3PNQA 3EXEA 3BWXA 1XWWA 3RNOA 1G2QA 1L3IA 2RGAA 2Y92A 3JQ8B 5FR1A 3X1JA 5L3SB 4XB2A 3THWA 4CG2A 4D4IA 1MX9A 4DV2B 1Q0PA 3RE1A 3W2IA 1N36B 4AO6A 1A8QA 3TB6A 2FPOA 4AO8A 3IDFA 3I45A 3PTLA 4FWBA 2JL1A 2SCUB 2BF4A 1V5GA 3GT7A 3QLUA 5M2QA 4CI9A 3PRYA 1Z0DA 5HGJA 4O2AB 3GP5A 4TKUB 3W5DA 2LNDA 3LDHA 4IDBA 5AJYA 4MWZA 5U1PA 2C07A 3WLTA 2JGRA 3MD0A 3L93A 4UMFA 4D3FA 2Q9UA 2GESA 3C8DA 3FYCA 1IZYA 3AJ8A 3DJYA 3GB9A 3KAKA 3KHTA 4WLOA 3UW1A 5LU9A 1Y6JA 2V7TA 2WYHA 3KTOA 2BDTA 5AM1A 3R6TA 4I3FA 1OXXK 1G2IA 2QAJA 4IG9A 1X13A 4F9FA 1EZ1A 4ER0A 5GIOE 4QVIA 1TX4B 3L0PA 3V55A 1NR5A 4MTCA 2ZI3A 3VR6A 3W4KA 4Z6KA 4RABA 2XADA 1YUMA 4GMGA 4B9EA 1SZJG 3D6AA 3R4VA 4BTEA 5K3AA 1PEAA 1WU8A 2FMXA 4JU8A 2A58A 3T1NA 3IOBA 1T0JB 5IHPA 1NRWA 1P1IA 1R10A 4JC4A 1L4FA 1CJMA 1C8KA 1G42A 1O08A 3HG7A 3HWX1 2HA4A 3N59A 2CEAA 5EPEA 3Q9SA 3WK7A 4UXIA 3AVTA 1DPGA 2HW8A 3F9CA 5EZYB 4X1OA 4RF3A 3JW8A 3S2ZA 3TTYA 4JXZA 3FOBA 1KORA 2ZTVA 3VXKA 5ITVA 2X8AA 1HDGO 1QKKA 1E9DA 4DR3B 3V7UA 2W42A 1XCOA 1G20E 1J1IA 1JG2A 3TR5A 5K0CA 1GQFA 1GSAA 2ACKA 4OI0A 4KFUA 1AB5A 1ZWKA 1SXJA 5FULA 1HUQA 3KUCA 4TLAA 1C1DB 1QAMA 1SR8A 2IZ0A 4PPGA 1MOQA 5EKXA 5A06A 2QD5A 4HNRA 5BSRA 2IU0A 4FD3A 4KGDA 3BSSA 2W0SA 2X8JB 3SQWA 3GCDA 3W77A 3W1WA 1XSEA 4YRLA 3T3NA 3ZHVA 2JW5A 3K2BA 5TQ0B 1JQBA 2DJ5A 4PNZA 1JXQA 3S4YA 4QOIA 2PCLA 1RPJA 4BNNA 2ZSAA 2NYVA 2QRJA 4RWEA 1FUIA 3UGKA 3W4IA 3WX0A 1ZAKA 2RC5A 1Y4DE 4RS3A 4V3BA 4DLNA 1ZD4A 1CK4A 1CUXA 1CYDA 4ND4A 3Q11A 3DAYA 1SPXA 1RWPA 1ODLA 2FU5C 2AG5A 1NBEA 1UXIA 1N2EA 3MOIA 4HSGA 3CUWA 3E2PA 5G40A 4RM2A 5DNCA 1X77A 3SWWA 3QXXA 1DKMA 2V5AA 2BBSA 3P96A 4KXXA 1E4OA 4RF5A 3TG2A 2O5RA 1OW3B 3LXMA 4TUYA 1JE0A 5AW0A 3QX3A 2B2NA 4IM7A 2PD3A 5IZCC 2N42A 2D0PB 1I1OA 2ZK7A 1H94A 1ZC3A 3H18A 4L0QA 4XTRA 2NSDA 2Z58A 4F4DA 4MUKA 1BYIA 3CJTA 4U9IS 2FPGA 4WGGA 1PJRA 1M1NB 2RGNC 4REOA 1VHTA 3C6MA 3JVUA 1MENA 1JV2B 1UEXC 4JSRA 1ADYA 3H9CA 1POWA 2GASA 4KCGA 4FP9A 4TT3D 4V0QA 4RUKA 1EFVB 3T9CA 3U9LA 3V1YA 4X3CA 3F71A 2ZJOA 1BOFA 2O4UX 2WZCA 4LZZA 1NONA 2PBLA 4B73A 1R74A 2JGFA 1M7HA 3HYTA 4UMVA 3RS3A 4DLPA 5LQSA 3L5OA 4K6OA 4N0MA 3WC4A 3R8CA 2IHUA 4PCVA 2F3RA 2NUPB 4UJ3A 2A7QA 3N8GA 5G2OA 4DCPA 4RMGA 2Q8PA 2HD4A 4J0HA 1N6KA 3RIGA 4CMAA 5DCUA 3ETJA 4WZAE 4DCSA 1K7XB 1N5DA 2J59A 2XDQA 4LAFA 4DANA 4ZO7A 3C7TA 4FYKA 1JHRA 2WJHA 5G41A 3ROPA 5AUPB 2VL7A 4ZK2A 3DO8A 3IYLW 2PWYA 1V37A 4ND8B 2FW8A 3TEJA 2WM3A 3L6OO 5CTAA 2XNCA 3SJZA 1UT6A 3FYUC 3TBFA 1CUGA 4NICA 4I9GA 5HK9A 1OQAA 1N2XA 4QFBA 4DLLA 5JZVA 1IATA 3N7TA 4OJMX 1WMAA 5JOQA 5EHGA 3ZXIA 1WMFA 4MDEA 3W6NA 5K0BA 4W1QA 4LYEA 3QEOA 3FMVA 2A6PA 1EK1A 3ET4A 2VTKA 1NUUA 4MR9B 1QYWA 2CV2A 3KIPA 4XM0A 3WNCA 5BN4B 1O9HA 2D7CA 2I66A 5KNBA 2IS4A 4J0IA 4LBYA 5KCMA 3WL5A 1NMXA 5I8PA 3IBSA 3A6PC 2JFYA 1S96A 4PHTA 1COZA 1ZKMA 3BMNB 2OCDA 2V7PA 4I4LA 4DYHA 1LDBA 3BL6A 1TYAE 3MMZA 3OT1B 4TSFA 3SC6A 5BSGA 3U60B 3RIXA 2VKQA 2OAP1 3DT6A 3ZZ1A 2O8CB 5INTA 1JB1A 3DLAA 1EM8A 5DGXA 2NO6A 2R5FA 1PQPA 3CN9A 3GQVA 1YRAA 5E0OA 4AJ9A 4JB0A 5E4FA 4DIOA 4CTNA 4ZYTA 1X0XA 4OHXA 2V9CA 4G37A 2EJCA 5I5GA 4XX0B 2W22A 4HFRA 2J9FA 4G8BA 4ZVVA 3S3TA 5BNTA 3INYA 1M6WA 1RMYA 1DKQA 3I58A 1WXDA 4ND7A 3RBZA 3WLPA 2VQFB 2B37A 2WT9A 1QX4A 1JIIA 4XSHA 4EI2A 3TFWA 3O8BA 4LDAA 3QPVA 5FUXA 4EPTA 1YZ3A 2IUYA 3VZSA 2Q5JA 4M37A 3THXA 1YE8A 4E07A 5EAIA 2WF8A 3K5IA 4PBRA 2J5RA 2X2EA 2I4OA 1SBCA 3L1IA 3BTVA 4CLXA 2XTNA 3BWEA 4D0NA 1QPGA 5F77A 3VBCA 1T0HB 2GKSA 3HABA 3KZVA 2V6IA 2B8JA 3M6UA 1KZ1A 4TV9A 4I1PA 1FIUA 3LK6A 1PKEA 3R3ZA 5T64A 4E5DA 3RVRA 3HM9A 2PSHA 3BF7A 4M99A 3GLIA 5IKMA 2OCGA 4R7ZA 2VOJA 3FHLA 3NC4A 4DBLC 1DJOA 4ZREA 2D1YA 2VDVE 3VOBA 3ZDXB 2NIPA 4LUCA 5HCUA 4DSTA 3AY3A 1FY2A 3OZSA 3AF2A 4BX9A 3L8CA 4JR0A 4S24A 4EJSA 3CLSD 2BH2A 1QRTA 2B4QA 1CF9A 1P5HA 2Q3LA 1IEVA 2C7VA 3V1NA 3BJMA 1QH1A 2GTPA 2UYQA 3AIMA 5HKKA 2XT0A 1F06A 4OJKA 2BHLA 1W7AA 2OD2A 4YUWA 1YH3A 2ZYVX 1SQSA 2HQBA 1F2UA 1UBGA 4MDFA 3ELDA 4G4JA 1I3MA 1MC4A 1Z6YA 1AJEA 1NP3A 3U7HB 3PD7A 5CB4A 1GZDA 2V7GA 1FYVA 2WUVA 2YYZA 3KSRA 3N5KA 1CIVA 3GAAA 4JT4A 2NU7B 2OXTA 1T26A 4LCBA 3U4IA 5DXAA 3NHRA 2WW8A 3G59A 1E3EA 1KO1A 1RBYA 2P7HA 3I6YA 3O3CA 2QMUA 4BO3A 2GPNA 3MT8A 5DKFA 5FD8A 4C3UA 3GCZA 3M9LA 2QD1A 1MHTA 2R62A 3DL2A 1V9SA 1W48A 2HAEA 4EI8A 3GLHA 4A5OA 4TTTS 3PHLA 1Y6RA 4DCTA 1RXCA 2P75A 4AMBA 4TRNA 4I1UA 2R6CA 3A1NA 5F1YA 4W9MC 3LQ1A 3D8NA 1MEJA 1QGAA 5F3RA 3K6SB 2EF1A 2EBFX 3B7GA 1RWXA 1A9SA 1U1DA 1BJKA 2YR0A 3DMRA 1BGXT 1T0IA 4LWPA 4OYLA 2RONA 1GPLA 4BN4A 1TFUA 3PNSA 1EZ4A 1NI4A 4LSZA 4A0QA 2E9SA 1R5BA 5DMHA 4EG6A 4X7RA 1XKTA 5IKOA 4HDAA 3H6KA 1ZXBA 2B1IA 3IV6A 4XJVA 4B43A 5C52B 3KE8A 4ZDIA 3DAPA 1YRBA 1DSSG 1DEHA 1P5ZB 3PNYA 4BMCA 3GZJA 1UC8A 3MWEA 1ECGA 4AP9A 1I7QB 4C0BA 2IOHA 2VRWA 1G6Q1 3BAZA 4RULA 3H5WA 4H0CA 3UHAA 1AZWA 5DN6D 5DIFA 1C7ZA 1Z4LA 1DQYA 4OH7A 3UUGA 1A95A 1ZJ6A 2FAXA 3OIVA 4D92A 2GYVA 3ZVRA 1JJVA 1YBAA 2BEUA 3HCAA 3QUSA 1TQ2A 3IOCA 3N58A 1NNSA 4ZHQF 3P0FA 5JC8A 1H2RS 1C8VB 1WL8A 3OHSX 5CBPB 1FMLA 3P0EA 4R51A 1DFHA 4TQAA 5ALYA 1YZQA 3W0LB 4RM3A 4JUBA 2CUKA 1QR6A 2R87A 3VBEA 2I67A 3ETGA 2REBA 4TSRA 4UBIA 3VR1A 3ZLUA 1KYZA 4IP0A 1TZBA 1P0QA 3PWKA 4P0PB 4JLMA 3HNRA 2W58A 4LHSA 1R6TA 1TVEA 4KVFA 2B83A 5EWLB 5TQVA 2XBMA 4OA8A 4AF7A 4WJLA 5GTDA 1ENZA 4LX0A 2QTRA 3IEPA 3S28A 2XTJA 3EQ8A 2RIRA 4HAOA 4QASA 4A2QA 1Z28A 1M5UA 4DXHA 4EG4A 4UQOA 4HUQA 2OPBA 2W93A 1XPOA 2VPPA 3BWVA 5DGHA 2RH8A 4JJFA 3HFSA 1H6DA 2IF2A 4DHEA 1PZEA 2WFLA 1LCIA 2J3JA 4ZOEA 2DT5A 1UJ6A 2IYYA 4DRXB 4UZFA 2XPCA 3UJ6A 2XUPA 4IILA 3W34A 4LHXA 5LVAA 1Z18A 3EPRA 4ZAZA 1P2DA 4EKGA 4IYJA 1LBQA 4DV0B 2F2TA 4RK0A 5DMXA 2CJYA 3DNMA 2C94A 4WDQA 2LZ0A 4JL8A 4N6GA 2BH9A 2F17A 4I4CA 1PYDA 4HG2A 1EXDA 1QRRA 4B3GA 3FN4A 5IJ9B 4F3TA 1X39A 3AX6A 1ZP6A 2DTXA 1M2EA 2I99A 2W8BB 3FTCA 4JK3A 4N40A 1MV5A 3RQIA 2NQTA 3JQ6A 2PKQP 5IAKA 2VAPA 4M8IA 1CUCA 1OUMA 2C9MA 2H31A 1R16A 5GMOA 2RGGA 2FP4A 3A3KA 1UPUA 4UBJA 1NJ1A 1QHIA 2LDXA 2ZEJA 3W5JA 3CSUA 4U8GA 1WEHA 5E8JA 5FHQA 4W99A 3MJHA 3FD8A 1U0TA 3BXHA 3G8CA 1PR2A 3KXPA 3WLIA 1D04A 1MOPA 3L8HA 3A6GA 4MPTA 4MZDA 1KHHA 4NHOA 2GILA 2QTHA 2QN7A 1I1QB 2Q9AA 4X95A 3W6UA 3NYQA 2NNLD 3M34A 3VKWA 3WZLA 5JVDA 2OHJA 3V8NA 1CETA 1NE7A 1R0SA 5DTEA 5LZ2A 5HDQA 3BRWD 3RJTA 3TZKA 4DKJA 5CLLA 5CDTA 5FORA 3UPTA 2I9KA 3I4LA 3QNUA 3WIOA 4LGYA 5BN1A 4D82A 2WFAA 4XE5A 3N0RA 1KI3A 5KYGA 2OAGA 3D4IA 2WBLC 4PFJA 1B1CA 5C5EA 3AESA 3L79A 3CC8A 3KEGA 1JSCA 3BTOA 2Q5FA 2CB9A 3MXTA 4LHYA 3OU6A 4NZOA 2OG2A 4KPYA 3EXHA 2H2AA 3EAGA 5CT4A 2TYSB 4UHKA 3H2BA 4MIYA 5H9VA 2K7ZA 1X1BA 2G9QA 2NT3A 1HKHA 3G0OA 2A5FA 3H1GA 2V03A 2VHYA 4GX5A 3O75A 3JWGA 1JA0A 1SBZA 1PT7A 3UVEA 4JQSA 4B2IA 1ACJA 4KHPB 1AV7A 4OQMA 2E1PA 3OX4A 1WZNA 4HZGA 1YNSA 3NT4A 1DG1G 4EBFA 3BA1A 4F3RA 1AUXA 3REGA 2GKGA 2RHBA 2XXJA 1SXJE 2WUFA 5CU7A 1AX9A 2ZYAA 3H9GA 4R9NA 3FUWA 2XMSA 1Q0LA 4IGAA 3TH5A 4L22A 3GLGE 8MHTA 4B81A 3MVEA 3B1WA 1F8UA 2I2WA 3NTUA 4KXNA 4EHFA 3CF4G 4FR5A 4P4TA 3X1WA 3L0SA 4EW3A 2MSKA 3LL7A 5F76A 3OPYA 2PMDA 3DMGA 2FETA 3LUAA 2PZ8A 3JATB 5JANA 5F4BA 2XXAB 3PJRA 1TU4A 3KWFA 4ENWA 2O6LA 3OM1A 1HV8A 2VSYA 3O9ZA 2Q5HA 2QNIA 4RL6A 2JFQA 4ESOA 3QTBA 3ETHA 1BN7A 4MGEA 2N1BA 1HURA 1OFIA 3DW3X 1C9DB 2FP3A 1VIMA 5BW5A 1UKVY 4WXYB 4JEUA 5HF5A 2QXUA 3RFUA 1U8AA 1SVMA 2X6RA 3ETEA 4B2LA 1W36B 1L1RA 3MN1A 3ZCRA 2COEA 3QBJA 1J90A 2C8LA 1HLFA 4M86A 5U4XA 3TX2A 3NTVA 1M0TA 1IAVA 5E1DA 3OTIA 3BHNA 3THYA 4R84A 1ZW6A 4W5JA 1HTWA 2WJAA 4JYMA 3ZY3A 3CG4A 4B1FA 1QCZA 3BGSA 2NXCA 3K8OE 4P2BA 1RZ3A 1R4NB 4BYMA 2G4VA 4JUFA 2JLVA 3UMRA 4PCLA 4JQCA 3L7BA 4YO7A 3COYA 1DC5A 2PO5A 2IVFA 5EZ6B 1RACA 3KEMA 4AJIA 4HDKB 3WKBA 4MSUA 1OH8A 5I7VA 1H85A 3FSEA 1SBIA 4IZHA 3HUEA 3E15A 4M0PA 1P60A 1FSGA 4ZARA 3VZDA 2ZR8A 3NXKA 5FCDA 2H65A 1Q0SA 1W25A 2VHUA 3P9IA 4QQFA 4QGSA 2RGEA 1GGNA 3LIPA 1AKTA 2HA7A 1UDAA 2X4IA 4ZANA 4RW0A 2QR3A 1RYHA 2P9EA 5KSPA 1ORRA 1UJ4A 3PQCA 2CVHA 2GN2A 1SOMA 3PD0A 2F9FA 4D3YA 1A50B 3G8AA 4LVUA 5KSZA 2A9FA 1UWLA 5BWMA 3FHTA 3MLBA 4HQ6A 1VKJA 1MRNA 2GK3A 1L1FA 2FQYA 2O52A 5DVZA 2XA1A 4J9VA 5JCXA 1XEWX 1VE9A 2AJDA 1H2HA 1E7QA 1YRHA 4IKPA 4S1WA 3WV5A 2XQIA 3K05A 4YQZA 4G5SA 5DN9A 1OSNA 3EY9A 4PZ9A 5DW3A 4IV0A 4URZR 3MT0A 4H7DA 2Q2VA 5HIAA 2GUGA 3DEKA 4HQ0A 5LIRA 1O54A 1Z6GA 3EQ9A 3GROA 3NOXA 1W6RA 2OO5C 3OY7A 5TQJA 3SSNA 4GLFA 3PJEA 3RW9A 1VQ1A 1EDDA 3O6VA 1YQQA 3HVRA 3NTRA 2I2DA 1ZXXA 2OE2A 1XVLA 5EJ7A 1DAKA 4X8LA 4B4VA 4TT3A 4LF6B 2YXNA 4J16C 4R6XA 4LISA 3E9QA 4PZCA 2H63A 3L8YA 3M83A 2LIVA 2H51A 4MR8B 3PL5A 2ZSJA 2M6SA 2ID8A 2GXSA 2HHCA 3AH8A 5IJAA 4B75A 4V1CA 3T7JA 4C0KA 2R4QA 3CY6A 4RBNA 1P7YA 3ZVLA 3CXRA 4MS1B 3DOIA 5EIFA 2AMYA 4EFDA 3PNLA 4Q9IA 2GHIA 2NG1A 4L16A 3WTBA 5I3ZA 4NCBA 4I08A 3NEAA 3R5KA 2WU3A 3UAYA 4CM4A 3N86A 5H3HA 2D1RA 3RVBA 2WLSA 4WCFB 4DDKA 4E09A 3WGHA 3FUVA 4UE6A 3GIWA 2NP6A 3ST7A 2J7PD 1H0KA 1EK2A 2PRYA 3HZOA 4WFQA 4DYVA 2XUHA 2CLHB 2ZTLA 3LLVA 1XK7A 3FVTA 2Y93A 4R1SA 1RJ9B 1YONA 3A4YA 1GL9B 2GLXA 1RHKA 1SVIA 3HI4A 3WLHA 5FQNA 3GN2A 5C18A 5ABPA 3BFXA 5T8KA 3GLIE 4ZYYA 2WAYA 3F1LA 3OY2A 4Z5XA 2QMZA 4WA8A 4ID9A 4MP6A 3NEYA 5LDDC 1W0JA 4EPWA 5EE5B 5FWYA 5F1OA 5BR7A 2Y0DA 3AWDA 2QY9A 1VL2A 3IJRA 2R6DA 4LK2A 1XP8A 5FL7A 4ZT7A 4AZSA 3KYCA 4CV2A 1Z0JA 1IXKA 1C3OB 1JAYA 3W6OA 4M1KA 1QB7A 2LRHA 3HXOA 4AKHA 4D45A 2YJGA 2OYCA 4F9TA 1VI6A 3LJKA 1WMSA 4I8XA 4YMTA 3G0IA 2HRZA 1COWD 3E7XA 5KYKA 1Z29A 3AKYA 3C4QA 3GRAA 4AUKA 3RKRA 2H8KA 4AW9A 4DR5B 2C2BA 2JANA 1TEZA 2QTTA 2ZETA 1JIXA 4IVPA 3GNTA 4NFYA 5LQRA 4EG3A 1N1MA 4OXXA 2H3EA 1I3KA 1W85A 4BWFB 3WV4A 4MR9A 2I7CA 2ZUDA 5C2JB 3ZD7A 2NZUG 2A92A 4J0JA 4HMPA 4C0XA 2XAAA 3UWMA 2JI8A 3BHMA 2HA0A 2QR5A 3EUWA 4G5RA 4A9AA 4OO3A 5CIWA 4ACAA 4CMIB 2EAUA 4WE3A 1Y3HA 2GF2A 1Z12A 4JI5B 4FT2A 1UBNA 3AG6A 4NESA 3KV3O 5CYPA 4UFPA 4MCJA 5KNCD 4OQPA 2GAAA 2PVSA 4E2XA 4CTOA 1FF9A 1FRQA 2W2MA 3AIKA 4H7IA 5DSTA 3BCRA 1AD2A 5BWNA 4OP3A 4B40A 1GVNB 1SZPA 2C5GA 1L7PA 4FFMA 4RE6A 4URVR 5KJ6A 4IXNA 3QHPA 3F6SA 2BEJA 3SEZA 1KMMA 2YJ6A 4F92B 1JQEA 2VZLA 1ZH0A 2EYQA 2QP4A 4K0RA 4DQXA 3K71B 4NVRA 2CDCA 3MBOA 1J07A 1XB2A 4PS0A 2RC6A 2XNDD 3HA7A 1U7XA 3KXDA 2YV5A 4BHTA 3EBLA 1WBBA 1PS8A 2VCYA 4BLTA 4P58A 3HA3A 2EHDA 2AYYA 1B93A 1K3FA 1B6RA 2BMWA 2OGTA 4KDFA 4WN9A 4EYKA 2IELA 5HE8A 4CV1A 1H42A 5DGCA 1EGHA 4LYFA 2YZ2A 1JKJA 1NUQA 2RCNA 2B3DA 3P94A 4G5XA 5KYUB 1MA3A 3MRXA 1NATA 2FLWA 4FE7A 4FR2A 3Q9NA 2IYUA 3WAGA 1MC1A 1P31A 2YUIA 3AO0B 4QGFA 3NT2A 3UJ9A 1JEYB 1DP4A 4UXJA 3IIMA 1NXOA 2B1GA 2ZXUA 4WBSA 2BFEA 1MFPA 2Q41A 3FZQA 2EEZA 3O1HB 4FSDA 3O4RA 4KVGA 4HXFB 2BTQA 1XTZA 2VZ8A 3BVPA 4RGVA 3EXFA 2YDXA 1UMBB 2PLWA 1FVXA 4EZBA 3HO1A 3GP3A 1HSZA 1JVNA 1OROA 1U1IA 2ZT7A 4FW9A 3VR2A 1ML4A 4DG8A 3I83A 1CEYA 2Y0EA 4M6WB 3PNBA 3WOVA 2IEAA 3P5SA 3E3OA 3G5TA 3H1AA 3DLIA 5H70A 1GZ5A 4TN1A 3ZK7A 4DCUA 5IK2D 5DJ5A 3HR7A 3TTUA 2ZULA 2O8EB 1EK5A 1MG5A 3VNVA 2DBVO 3P2KA 5EGSA 4E5YA 1L7MA 3D6MA 3EZ9A 3N3BC 5BYJA 3S1SA 1FDRA 1MJ5A 2IH5A 4MRPA 4QLBA 1R15A 2R7AA 3H9QA 5DYWA 1TU3A 3H9JA 3N76A 3W8RA 5K3DA 5JAUA 3PFBA 2ABWA 3IPRA 5D3ZA 4R0NA 1SUDA 1ZK4A 3ZBTA 1YVDA 4CKYA 2V0CA 4AWBA 3HJCA 4D1YA 1FP6A 4RORA 3C24A 5DN6A 4JUAA 3DQQA 1MX1A 2KBEA 3KSDO 5J40A 1VLHA 2I3DA 4I8DA 3SG0A 3UT5B 4BRWA 1BYUA 5EIBC 3RSSA 3X2SA 4FSHA 4WFIA 4JLKA 2PNJA 4TROA 5FI3A 2QBYA 2NQ8A 2VTDA 3OSZA 4MAAA 4D9NA 3D7KA 4MQ6A 3G13A 4IZOA 4S1VA 1YAJA 4EA7A 4R1TA 1JLRA 2ZB7A 2C1EA 4TZ6A 5JO9A 1L7BA 3IVRA 5KS2A 1REQA 3G6KA 1E1DA 1VJ5A 4KE6A 5FOSA 4CCYB 4EUEA 5C46F 4WEQA 2V6JA 2VBIA 3FKSD 1ECFA 3JS5A 4GR5A 3O82A 3SFZA 3PHGA 4C7KA 3IOEA 4R2LA 4V03A 5ADUS 4N7BA 1YE3A 3T52A 4C4ZA 4PCAA 2NTYC 5TJHA 4E7PA 1OKKD 5BR8B 2O19A 3FPJA 2HSJA 3QVOA 2H9IA 2WAXA 1J22A 3HCCA 3QITA 4QPCA 3HHPA 3N2KB 1I6LA 3QNWA 4QHTA 4QPJC 1DFGA 4WCFC 2ZWAA 3D31A 5HK8A 1L4YA 2E4VA 2J9ZB 2BIFA 1HQYE 1KAEA 4MP3A 2HSDA 4OHRA 3SYRA 1BA3A 4D80A 4YX9A 5JSQA 5LMUB 4R2HA 3V4RA 1C4WA 3RVDA 8ABPA 4PSDA 3FIUA 1GUBA 1L5HA 1FBTA 2BFCB 3IVMA 1FX0A 1LNZA 5FOTA 3V1KA 3DW1X 3E35A 1AHPA 4BFYA 4TXNA 1U2TA 3AB7A 3CH6A 2VPTA 4F5EA 2MJLA 2IYTA 4QFMA 1U8TA 1P2TA 3AY7A 3PDWA 2TMYA 1LBIA 3TLGB 4ZHQB 4D7AA 4WXHA 2PAFA 2PJZA 4FHCA 4R1QA 3BICA 4OBBA 5CH5A 3IEVA 1UKEA 4AD8A 1YFLA 1RBQA 4BQEA 2L17A 5TX7A 1J49A 4FDUA 4X5OA 3VJLA 2R4TA 3N6VA 4ESHA 2XYGA 5A5VA 5HWSA 1DBPA 3GAMA 3NNSA 4FFRA 4AJOA 2QL5A 4LXTA 1OA1A 1HDEA 2RFLA 4TZ0A 3DA8A 4AMUA 4EJ6A 4IO0A 2BHNA 4K26A 2J4FA 1TYBE 1U2ZA 4IDNA 5IEBA 3LPAA 2NPIA 3SZLA 5JFTA 2VBFA 4KBYA 1YB4A 1UIRA 3R40A 3UBMA 4D9CA 2GYUA 1Y98A 1Z6PA 3FDZA 1ZD1A 1O96B 4KPGA 5B3AA 5KJEA 3L7KA 1UK9A 3EUFA 3BRWA 3PE4A 2CD7A 4IDGA 3AP3A 3OPNA 5LB2A 1YRQA 3MTIA 3OCUA 2JLZA 1LBHA 3INTA 4Y1EA 4URHA 1PJTA 3JVDA 4CU2A 2ACWA 2MU1A 5B6IA 4XUDA 1UR5A 4TT8A 3H2KA 3LC7O 3ZY4A 1WXWA 4JKYA 3L7JA 1E6EA 1TO6A 3DGEC 2X9NA 4CMBA 3F78A 5F9FA 3X1MA 3L1UA 3U19A 2OV2A 1SCQA 1OX6A 3LT5A 3Q15C 1H3EA 3AFMA 4TLCA 3A3NA 3E1SA 4UFNA 1QK4A 3FGZA 4GECA 4J2TA 3S99A 4F7DA 2JIBA 4C2UA 1GZVA 2J46A 2Q5IA 3FCSB 3GOHA 5F73A 3RK0A 5MN6A 4R8SA 5UKDA 1YA6A 3G0HA 1MA0A 2LBPA 1XDZA 2CWDA 1AGRA 4QLAA 4LCJA 2W70A 4EDHA 2VNKA 1KQPA 1NVUQ 3DOFA 4MJ7A 3WDSA 1A5SB 4S1NA 3DP7A 2Q5CA 3H2YA 2P0AA 4YROA 5F51A 4YP7A 5BNWA 5B58C 3H4IA 5U9CA 2ZE6A 3ZE7A 2R6HA 2JBAA 3KOMA 4F5YA 4AJKA 1NJ6A 3GHYA 1NNUA 5JZ9A 2I2AA 2CL0X 1RHRA 4LY0A 3C6BA 1KJYA 3M81A 3I6ZA 3ZQKA 3EFHA 4Y6RA 4UEJA 1NRIA 3A9WA 2OCIA 3ACBA 3B6KA 1SVSA 3EGCA 3U4QA 1X42A 3JPYA 4B82A 2XT6A 4MV8A 1E6CA 4BFUA 1U94A 3OQPA 1ULZA 3OOSA 3QG5A 3ZBPA 1TADA 4Q3KA 2N47A 3DC7A 1SC3A 4G5YA 3OSUA 5LN1A 5TS3A 5CXSA 5L3QB 1TA9A 4EF5A 5A7HA 1N3YA 1W52X 1U0RA 2WJVA 4KXWA 3TAUA 5KOJB 1GUDA 1H69A 1XJCA 2JGKA 3WIDA 4ZZ0A 3ICVA 4AJPA 1N2ZA 5JDIA 5K0ZA 4CV3A 3WDLA 2A9KA 4ZD6A 1RXYA 3C3XA 3VTAA 1YJQA 3VO8A 2EARA 1UC4B 2BELA 3FZNA 3NGLA 4P4LA 4Q3BA 4X20B 5A3VA 3S7ZA 3MD9A 1P7VA 3ZDRA 1SK9A 4BVEA 1V8ZA 4C06A 4INPA 2A8YA 4JR1A 3NJRA 1GADO 1ISPA 5E95A 3GCWA 2Q21A 1LX7A 1UAYA 4MWSA 4F3CA 1WTAA 1YS4A 3E1KA 1GYQA 1RWVA 1C7FA 5CLFA 3H05A 4WLVA 5KSWB 4P3KA 4YASA 2CVFA 4G8CA 4KVAA 2H9YA 2FGKA 5HKOA 4G1EB 1DEKA 1LC0A 3LS2A 4IHJA 2G9NA 3TTSA 4AUMA 4ANFA 2QX4A 1P45A 5DH9A 2PKXA 3N8IA 1KEEA 4LVNA 1GSIA 1RYZA 3HDYA 2OHIA 3NTOA 3UATA 2QR2A 3QU9A 4L8FA 1YF3A 2HL6A 3L0IB 3N9IA 5L7YA 1DUVG 5DXFA 4NIMA 2WD9A 3F9RA 3A4IA 3R7WB 3DZIA 1K7YA 1EE9A 1F2TA 5IVDA 5ESRA 1YRWA 4UTZA 5BVHA 3ZJYA 1SFRA 5K8CA 4D8VA 5IARA 5JZMA 2O8NA 3F2VA 1RKBA 2ZS7A 3FUUA 4HDOB 4TL9A 4EY5A 5JAHA 2PS3A 3CU5A 4PTYA 4Q6BA 3GDFA 4QAJA 1WXXA 3LLMA 3PC8A 4LTDA 3VR6H 2HNKA 4BDSA 1XFDA 2DQYA 2QRNA 2ZJ8A 4ZU1X 3TLKA 3H11A 1OFUA 4MA0A 3LXUX 2W9XA 2VA9A 3EEYA 3ZIAA 2Q7DA 1XRMA 4IEIA 1OY1A 1WMEA 4G89A 1BU8A 1ZGGA 2XUAA 2HK6A 3I1JA 4N0EA 4XJSA 3A4NA 3NRJA 4ZCMA 4R7GA 4QQRA 3ZV4A 1A4XA 3KHKA 2NUBA 3O8CA 1XXHB 1YCDA 2AR0A 1FXWA 4BO8A 1XA3A 2PZGA 3BIOA 3VZPA 5IDQA 4XDGA 4ZTBA 2ONZA 4QARA 3SQNA 2H1RA 5DNVA 2WWRA 3BKWA 4IEEA 4QX6A 4P4SB 1GKIA 4RPKA 1CVIA 1M0SA 2BDUA 4OHCA 5FOXA 1YBMA 5AKKA 1G7SA 3EWSA 2X0IA 4K1LA 1F7VA 1D4OA 4Y3UA 3KDAA 3ICPA 3PEVA 3SJBA 4OQDA 1D0SA 5FWXB 2WQ7A 2VWQA 3JD4A 5JC1A 1MW9X 4UTPA 2J3QA 5B3JC 5I7RA 1CUHA 1WUJS 4G63A 1TI7A 4Q02A 4CM6A 5FI1B 1Q77A 4Q9JA 1BKSB 1BXRA 2ZB4A 4ZMBA 1W2HA 1MABB 4I6JA 1H22A 2POCA 1LK5A 2NXJA 2J7PA 1V71A 4KR9A 4KWIA 3VU8A 2HK8A 4X60A 2FWJA 1U1GA 2QZ4A 3QX9A 2BMFA 2XNHA 5CB8A 5JH7A 1JHQA 1ZD3A 1KZ7B 2OBXA 4EG0A 4OSEA 4PICA 5DASA 5KKNB 1HZZC 2ZTSA 2ZUBA 3R6DA 1MORA 2IXGA 4Z9XA 4WNCA 2JHCA 1WV1A 1CUUA 2Y2VA 2Z2XA 1S1CA 1GUFA 3KHSA 4JL6A 2XSZD 4YUVA 4CM1A 3TK1A 1EU1A 4ZOQI 4TMVA 5MN4A 2AJBA 4BZQA 4OMFG 3OIUA 3QU4A 5ED4A 2X9QA 3B82A 2VH5R 1R4ZA 1E1MA 3H75A 3KOUA 2JAQA 1ZGAA 3BB4A 1UMDB 1Q84A 1BEEA 4FDLA 1W47A 5FB3A 1GNVA 4JVOA 1PJ2A 3LLSA 1E3TA 4NI5A 1PWHA 2UXBB 5CK4A 1J8MF 1N2CA 2QORA 1Z7WA 4IIXA 4G26A 3LDGA 1ES9A 4LNUB 3E9NA 4MUXA 5T6BA 3ZH9B 3ZWYA 1CY6A 4FJ1A 4OAOA 4P22A 2G6BA 3B7WA 1IVNA 4F3YA 1RI2A 3ETLA 3PXBA 1KL7A 3N0WA 1A72A 4O2BA 1Z22A 2A9JA 4EYOA 3B1KA 2QD2A 3GI1A 3PXUA 4DV7B 3R5TA 1JI0A 2RJNA 3RJZA 4PQRA 1JQDA 1U0EA 3F4BA 4WKBA 3ZH2A 5KWEA 4W5RA 2H5JA 4G0UA 3SXUB 4BQSA 1XAJA 1YMUA 5FJJA 3KUXA 4DMHA 5JJIA 4YQFA 1U9IC 4BBJA 2WDZA 3G1WA 5K09A 3S2EA 1O3YA 4YIKA 5LMNB 5DCWA 4H7KA 1JAIA 1NVEA 3R4CA 2LKDA 5EKSA 1U7OA 1G7CA 5KNCA 2DTDA 2QLBA 4RGYA 2O3TA 2XTZA 3GQBA 2ERCA 4RF2A 3H9EO 4LQ4A 2NVWA 1NJFA 3VO9A 2LWIA 4OMDA 3PPWA 4P32A 1NY6A 1NX9A 3OICA 1ORIA 1P2UA 3FZEA 3OTQA 3V1UA 5IZCA 4C0QC 1YR6A 4RVFA 5K01A 1IBLB 3Q41A 4I4IA 4XEUA 2DCMA 5J4VA 1A8UA 1AS0A 3OWOA 3DCIA 2BGMA 3BQ9A 3KWJA 2XODA 1VJCA 4H6WA 4NR0A 3Q2KA 3MFYA 4XXHA 4IJKA 4EA9A 2WJIA 1PJCA 2RGNA 4RD4A 3AB8A 2H0AA 2DUJA 3IUNA 3QKSA 1H1TA 4PC6A 1CDZA 4B8WA 2GCNA 3K9WA 2G5TA 2R6AA 2VAMA 2YIMA 1QRAA 1T2DA 2QJTA 1YS2X 1QR2A 3P0JA 5AVVA 5E6UB 1YACA 5HRAA 2QN2A 4WOKA 5EJGA 1WW8A 2YBEA 3N2GB 4KI7A 4RMHA 3ZD8A 4N9WA 4BVAA 5LLDA 1TE2A 1V8OA 2H1SA 5AVTA 5HJEA 2VRBA 2IPNA 4EPYA 2VJMA 1V48A 3OEHD 2ZB2A 1F0NA 2JZCA 2QNRA 4Q1FA 5EP1A 4D43A 4OGLA 3ZWDA 1T0UA 3OCXA 3RVSA 3W7AA 1GU0A 1QS0B 4MGKR 1LSOA 2MSLA 4HS9A 1GARA 3ROGA 4HNTA 5A03A 2DUWA 5F5NA 1F9EA 1Q1EA 1W4BA 4ZO9A 5FO1A 4HZIA 3I04M 1HC7A 1V2HE 5K8JB 4UNQA 4CM9D 3U13A 3MS7A 3C8UA 4YMSA 3WNZA 2HJWA 1CF4A 3R24A 2H1WA 1P4SA 3OH8A 3PFNA 1TUEA 4N8EA 1IN4A 1SVNA 1TQ8A 3B9BA 2QA5A 2QU7A 3FYUA 1SQ6A 3QXGA 1POXA 3CX4A 5DBIA 4U9HS 3QIAA 3F5SA 4L4SA 3QBVA 3HO6A 1G8SA 5IK2A 1H0RA 3WGLA 4ARSA 3D1JA 2OT3B 1JHOA 1TQ4A 1YL7A 1JZQA 5F2NA 2VTBA 4YRZA 1T6YA 3M70A 1L8XA 3CUTA 2P30A 3SR4A 2QM8A 2W2KA 1GA6A 3DMDA 4GSKA 3CGWA 1Y81A 5KOHA 3L4EA 4PQFA 4TVOA 2IEGA 1EA7A 4RQTA 5EP2A 4CIYA 5JSZB 2Y71A 3QELA 4PWYA 1X7DA 1SIBE 1T9KA 3C5VA 4BNJA 3F9IA 5AW8A 1ZRNA 1Z06A 1Z7GA 4HWSA 1RP7A 2NGRA 5E6SA 4WX2B 3DXXA 1CUEA 2GNOA 3NTQA 2A5GA 5D3QA 1GJRA 1VFNA 2P78A 3A1DA 4HBGA 1T1EA 3N87A 1TRKA 1KDRA 3KLMX 4YRJA 2JIPA 3JQ8A 4PLVA 3ER8A 5L3SA 2ZPAA 1EWVA 5M7EA 3I9V6 3HN2A 4KXLA 3OQBA 2Q0SA 5BMVA 3H84A 2G5CA 3QSGA 5ALRA 2XUKA 3ZHZA 4BB9A 1IZ0A 3CX7A 1T2CA 5FLXA 2SCUA 4FN5A 1G8PA 2JK0A 3EIFA 1FS4A 2PQMA 4NZZA 5CUQA 1PN3A 5HQJA 4BQRA 1F38A 1E9VA 1ZESA 2I8LA 3FZYA 2P77A 1F2VA 1G8JA 4O2AA 4YJHB 4YRTA 2CLIB 3WA7A 3NVKI 2V6BA 4GOXA 3DS8A 3FKSA 3HI6A 3QENA 4BFXA 4ZVUA 1EGVB 4O0LA 4EUKA 1ZH4A 3K1ZA 1GFWA 1N1GA 3W79A 4FZ5A 3AF0A 2NO0A 3HN6A 4HX2A 4RY9A 5LBUA 3DBOB 3UWPA 1C9YA 1XNJA 1D2RA 1PDWA 3AW9A 3P2OA 2YMQA 4NU0A 5JE8A 1GZ4A 2D1SA 4AJHA 3QVGA 1NU8A 3HP1A 4GPD1 2G67A 4HH4A 3WGZA 3NBFA 2ZDQA 5B30A 1KYIA 2XF8A 5F1PA 1JU4A 3RUEA 4UUOA 1O6GA 2ZBGA 4K9DA 4FZJA 4EJFA 2PLFA 2Q3CA 2Z30A 2ZAOA 1QZTA 4MNTA 4RLQA 4C4XA 4DOMA 3NW9A 1VJGA 1XZHA 2XMBA 2HA6A 4QUIA 1L5VA 3V2UA 3VR4H 2YQ5A 1AOXA 3MFQA 1O77A 3TAHA 2PL9A 2E49A 4O29A 3O5AA 4UZSA 3TUJC 4CKWA 3UO8B 3H86A 2HRQA 4H9GA 2IKSA 5CB6A 4H77A 4WKOA 4RA9B 1RMTA 5EZYA 1X7XB 1Z38A 4MA5A 3WLAA 3VSCA 1ICEA 2R8OA 2WG0A 2P3QA 5DT9A 1F20A 2Q29A 1N2OA 2I1QA 3UUWA 1Z0ZA 3ZUGA 4A2WA 4AZTA 5JJLA 3CNOA 2RI1A 4L72A 4L0CA 2VP9A 4O5AA 4AB1A 3WADA 1X1SA 1UMCB 2BP7B 5BWCA 4AP5A 3AZPA 3OQVA 2UYHA 1IHUA 1KO8A 2AFIB 1FXSA 1A88A 1TL7C 5A3QA 2DR0A 1Z33A 2IP2A 1Q0ZA 3PFWO 4PNHA 1C1DA 2H1IA 4WXMA 5B6JA 5HXAA 1ENOA 4HEJA 5AKGA 2PX3A 2WAOA 3BG5A 2OC9A 1ID8A 2X8JA 4O2LA 2CV1A 1O9BA 521PA 2WTMA 5KYVA 3L8EA 3TO5A 5HPYB 2WUDA 5TQ0A 5AM2A 5I7WA 4IWNA 3NIFB 2GO1A 1QHFA 3EEOA 2ZUFA 1RRCA 3DFKA 3PRJA 2QL9A 1OD6A 3DVLA 3LW8A 4U2EA 1EFDN 2QY6A 5AW5A 5F2KA 3RBXA 4AF8A 1RWWA 3L02A 4QNMA 1X0VA 5CFLA 2F4NA 2EC5A 3I53A 3K73O 2YW2A 2WAAA 4CGYA 5P21A 4YUYA 2JCVA 2BF7A 5BQ5A 4L08A 2JRLA 3I5YA 1ZHFA 5BSVA 2B7BA 2JD1A 2WIJA 1V4VA 2X13A 5FTWA 4FJ0A 3UA3A 1USIA 1GPH1 2R5NA 2VP0A 2Q9BA 4DIKA 2DU8A 2G4CA 2PZAA 1G3MA 1EGMB 3F46A 1NXVA 2HDWA 2XGMA 2HPAA 4PYRA 1M1NA 1SCNE 3G2JA 4WZBB 4YJ3F 3QUAA 5EIBD 3AV3A 5JJBA 2ZBUA 1MJFA 3JWEA 4X92A 1WNFA 3LT4A 1EFVA 2UUBB 1FFYA 1PLKA 2YWBA 4MWEA 3OM9A 4HK4A 3SLKA 1U8ZA 2REXB 3I05A 5E2AA 4QOGA 4ZFNA 2JC3A 3HJAA 2HU8A 4NAVA 1I2DA 2XBLA 4KMSA 4ZYLA 4MHSA 4MQFB 4AM8A 3BTSA 2P4QA 3PK0A 1Z3CA 2NUPA 1TAHA 5TGDA 4IUCS 2VAXA 1ICIA 3RIHA 5JO0A 3U5ZB 4TMFA 5CFRA 3EODA 4CNQA 4W63A 2GZDA 2XGSA 3ZU2A 1DRKA 2WP0A 3MCZA 4TLBA 1OTYA 3JTEA 3G9XA 4FQ5A 1UFKA 1VGVA 2D7JA 4M88A 4ND8A 2F3UA 3DUFB 4BASA 1SHJA 1UQTA 2AFVA 2IP1A 1SCJA 3RFVA 3L6CA 5EQFA 3CIOA 4B3XA 1ZHHA 1V3TA 4KQKA 3ELBA 3ABSB 3UMGA 2V0GA 4HPJB 1IDOA 4YUZA 7MHTA 3KR1A 3W6ZA 4G1MB 5J2TF 1J8VA 1VL6A 1T6BY 1YZHA 3UMJA 1X1EA 2G77B 4YWHA 4DCVA 1WOMA 2QB5A 4OLFA 5BN4A 4JBNA 4UC0A 4BO2A 2V6FA 3BCSA 3ZTWA 1QYVA 1B6GA 3DD5A 4Y30A 4EJMA 2IH4A 1EAMA 1UBFA 1XA0A 4UREA 1OI7A 3GJZA 2H1OA 1FQKA 1HYBA 5T6MA 3OT1A 5FLEX 1WZ2A 3HVUA 1QO0D 5B7PA 1P8AA 4OM8A 2O8CA 1QCDA 3G89A 3M49A 3GF4A 3T7DA 4Y2QA 4HHEA 1KPHA 3FPGA 3GXOA 2YUTA 2VF2A 3IP3A 3L7CA 4I1YA 4IUBS 2G07A 4XX0A 4B46A 2VXOA 3EQ7A 3E22B 2OK8A 3QKWA 3Q2IA 2P9FA 3C8MA 2ZIFA 3JR3A 2PX8A 4G0ZA 3FM9A 1RLMA 3SF0A 3FLAA 1HTTA 2HIAA 4QTZA 5ICFA 3ZEIA 3SZRA 3ONVA 3OLCX 2X22A 1PNVA 1U65A 3DVQX 2ZBDA 2WJYA 1N6NA 1C2YA 3FZGA 4MV5A 4EZEA 1QUFA 1ADFA 3AUYA 3TBHA 3G17A 2CHEA 2Y0CA 4ICIA 2ST1A 4YRNA 5LLSA 1J20A 3W3AH 4LVCA 2FCAA 2R68A 3F7OA 3EVEA 1YU6A 4MS4B 1WUIS 3RT7A 1NVVQ 1D1QA 5CT6A 1S3FA 1PZFA 1BKYA 4XPZA 4AT1A 3EDCA 4QJIA 2OZLA 2DECA 1FP1D 5YASA 2WTXA 1S2NA 4YP5A 2IUSA 4F1JA 4U6NA 4QJ5A 3EZYA 4TWJA 3JQGB 3L49A 1D5WA 1RQXA 3D3QA 3THRA 1DIRA 3LKZA 1GL6A 1E1RA 5FUBA 3CMCO 3R0QA 1GZSA 1USKA 1YMQA 1ZUD1 1FFGA 1LFAA 1Z4IA 3NHAA 3VPBA 3QIVA 2R8BA 3W8EA 3JWIA 2C84A 3AXSA 3FDFA 2C8VA 4HYTA 1R4MB 5HA5A 3QOXA 1XRNA 2PFGA 4CUKA 3IMGA 4LXIA 4RFVA 4FX5A 1EEHA 1RXEA 5EMMA 1XHEA 3S27A 4HX5A 1CR0A 4KN6A 4PVDA 2Q5EA 4QDTA 3UXEA 4MTLA 4PCUA 4PLWA 4UVGA 4TKLA 1SHUX 3PIIA 1ZBDA 3V4VB 3UQZA 5EJ5A 3T99A 2P3SA 4JD5A 4WKNA 3G68A 2J5BA 1TB4A 4PRZA 2Q4OA 3NI2A 2HQ1A 4BY9E 3EBPA 3KKQA 3SNHA 2YWEA 2GBFA 1T6NA 3B52X 3K9CA 1K06A 1M66A 4HO1X 2RHCA 4OI2A 2XBUA 4ZAWA 3L8FA 5TGTA 1MNAA 4WD3A 4B32A 1F4PA 1C7QA 1UJCA 1RXUA 3WK6A 3CSDA 2ZYUX 4MQEB 1BW9A 4ZVKA 1A9ZA 4BEWA 1XX6A 4QPZA 4RHTA 3TSCA 5MF6A 3R9IA 2PN1A 4PX2A 1QZ3A 3D4PA 2EJWA 3G88A 2OQVA 1JDSA 2ZREA 1GCAA 1U2GC 3WJAA 4LXQA 4NYIR 3K6SA 2QTZA 3FPHA 1F2DA 1UQUA 3KYBA 3UFXB 4B87A 1FYDA 1Y89A 3UK6A 2ADFA 2AMFA 3EIXA 1B8NA 4WDRA 3EGDB 1BKDR 2EW2A 1XT6A 2ZRJA 2I1WA 4DMMA 3O4FA 1D4AA 2AXPA 4EUSA 1JDPA 4MAFA 4Q4LA 3SR3A 2RD2A 2J0SA 1J5PA 2DWCA 2R1TB 2RKOA 4C4SA 1EAYA 2CLFB 2YNMC 3FFWA 3LC2O 3UFBA 3EVDA 4C5AA 4W82A 4ECAA 1UC5B 4CDRA 2IGBA 2QTNA 4NBUA 3W2HA 4L9WA 3LP5A 4ESEA 3OP4A 4EQZA 5A3SA 4K7JA 3L4SO 5C81A 3ANXA 4JUCA 5AW2A 3K4PA 1NZFA 3KWLA 4DGQA 5DNYB 1HYEA 1HYHA 5EIEA 5IANA 3NHWA 2A2ZA 4L9RA 2IS2A 2HREA 5AI9A 1TA4A 5AXBA 3ADDA 1J8DA 1ZX1A 1ANKA 1P7WA 3C43A 1OAAA 5CBPA 1LEHA 1JFFB 2WHXA 3QNMA 5HUQA 2F1JA 4LQDA 4Q48A 3ER9A 1XIVA 3LVQE 4HMOA 1HO3A 1TJ4A 3PG5A 4CGZA 3NBQA 4S12A 1XLVA 3IAM6 4BN5A 3AZQA 3ZX4A 3D2AA 1PWEA 2VYCA 5AKIA 5K0GA 3UUFA 1XN1A 1JA9A 3R5XA 3B6JA 2VHQA 3RC3A 1L7QA 3AUUA 3OFVA 1UPTA 3BE4A 1EDOA 2R2GA 1I2MA 1ABFA 4QXPA 4HH1A 4E7OA 3RYFA 4KBGA 1JEEA 1PLJA 5HIJA 1U7ZA 2BC9A 5L3VA 3SIWA 1AUPA 1X1AA 4WTOA 3STTA 1DTSA 1ZJ4A 4K03A 5AVJA 1J2UA 2OO5A 5JBNA 2PKYX 4ENQA 4CQNA 1Q5PA 2WAMA 4WK4B 1JX6A 1V5IA 2FUCA 2WUEA 2ZKIA 3S1AB 3ADBA 2IBTA 4N76A 3BWCA 4RJIA 5BQOA 1QIDA 4Y18A 4C30A 3WBKA 4UE3S 3OKFA 4YMGA 3WJ1A 3ONEA 1KKMA 5DZSA 2NZ8A 5I7OA 4J16A 3BZBA 1J24A 3BBLA 2X1LA 1TF5A 1KERA 3NUZA 4OXIA 4BVBA 4DRXA 5LNK1 3N2EA 3WP1B 4MROA 3OKAA 3ZWBA 3WHPA 2GMWA 3M4XA 4PGGA 1SAYA 4EB8A 4EYGA 4ZI7F 1SD2A 3VDRA 4R0MA 4RIFA 4ZO8A 5JNSA 2NV2B 4I50F 3GD7A 3JRXA 4OHBA 1PE0A 1G21B 3AVYA 5IJ9A 3U4HA 3ROKA 4OYYA 4FR0A 5H68A 5B4UA 3J80A 3ENZA 2W8BA 4G2NA 3A2KA 1VA4A 3RM3A 4RD2A 2YY5A 4IF6A 3TZQA 3X3HA 3VNQA 2XB8A 1T6ZA 1UJ5A 4CHTA 2JFPA 1GPNA 1DB3A 3NRCA 3LUPA 4MB6A 1FBNA 3EZGA 4NYJR 2VKTA 4X44A 4AL4A 1WOYA 4Q3EA 3X1YA 2VDOB 1AK1A 2Y67A 3CJQA 2MSWA 4O4LB 3V1TC 2FFJA 1N7HA 1ZSVA 3CBQA 5CPBA 2Y1GA 1HE4A 1O58A 1TCVA 4HWPA 4I99A 4QUHA 4R16A 3L0YA 1K6MA 1QDLB 1QYDA 1U0OC 3A58B 2NTNA 2BEVB 1QMPA 2E21A 1L7XA 2VZEA 2Z43A 3HUDA 2I4TA 4H18A 3W04A 4DBLE 3J7AC 1IY8A 1W94A 4YY3B 2F67A 1JW9B 4HWTA 1M0WA 2P0YA 4EGFA 1Y4AE 3C3WA 2WWTA 3P1JA 1YVPA 1UZAA 3Q85A 2VAVA 4NZPA 1GA4A 4FMPA 1A2QA 1RI3A 3FPFA 3QWHA 3RQSA 4DFDA 5BWBA 1GCOA 3LBFA 1CE8A 3FPCA 4YXWD 2J85A 1W5BA 5ITZB 4Y2RA 4IIYA 3ISVA 3VPSA 1NR7A 3SF8B 1IOVA 4Q3LA 3DKKA 1R9GA 3FNEA 3LOUA 1FTQA 2ZSFA 2J5XA 4GI3A 4WQMA 3PQ5A 4LZWA 3UH1A 1I3LA 3GA0A 4UBKA 4CMJA 1G18A 2FSFA 1PL7A 1ZVMA 2AZXA 1GQYA 1ZRHA 3TECE 3WB0A 5MFPA 4RIGA 2OA0A 1SIUA 1KSHA 1GAWA 2GPTA 2CZCA 1YJXA 1NW4A 2R3SA 4HNGA 1WPGA 2AQKA 4QOFA 1CBUA 4Y2JA 1NOIA 4QATA 2XQKA 2VZ9A 4F96A 1SKYB 1F7UA 2BI4A 4CM8B 3OZFA 2NU8A 1S8AA 1UDCA 2HMWA 2CNNA 2P9CA 2EGHA 4MUGA 4OJYA 5ESWA 3JXEA 3RJMA 1F8XA 4M0EA 4DDVA 3KR0A 1YJ8A 4OHKA 1U2SA 1DKPA 1HOTA 4GL4A 2VUIB 2LV8A 2GD6A 3ZGYA 3HKBA 2R9VA 1E3IA 1QUEA 3QF7A 1RADA 2RH4A 3L41A 2YVAA 4REMA 1RC1A 3TIVA 2XXAA 4F71A 3TQOA 2FPPB 2IPMA 3A6ZA 2Q0QA 5CDGA 1P1HA 2DUNA 1PV2A 4LQCA 2I7DA 3N0TA 3CH5A 3FOWA 4GQAA 4LGMA 4C04A 1X80B 1QVWA 2JJ8A 4PGFA 4KX5A 1JHAA 1CR4A 5JHGB 4IIUA 5JFGA 3WMEA 4UW9A 3IDAA 1ZD2P 3N2IA 3CYFA 3O95A 2WM2A 4BIIA 2QAGB 3I4CA 4BNUA 3RARA 3QA3E 4Y6GB 1ZOIA 2VJNA 4HAIA 4CQLB 4FB5A 3E3LA 4LOKA 5IVIA 3B8EA 3ID6C 1SULA 4IMJB 4N01A 1GEGA 1W5FA 4BNLA 3MT7A 4JOSA 2Z8XA 1FJGB 4US1R 1VL5A 1PS0A 5ALNA 1LKZA 1PT8A 1SKQA 3GFTA 4PLCA 3RS9A 4KXYA 2HWWA 3VPGA 1XF1A 4KQ6A 4XB1A 1UBKS 3IVGA 2AJCA 1VL1A 3DGFC 4L8GA 4JYAB 4U6QA 1I5OA 1CT9A 2ACEA 1WBDA 4WNYA 5KVSA 1KFEB 1LPSA 4HDKA 5KKCA 2HJSA 1KGDA 2WDPA 4LTMA 1FMJA 3OCVA 3D6FA 1NY5A 4JYPA 3COPA 4QSMA 4FHFA 3WLNA 4HQLA 1QK3A 3U1TA 1F9AA 3ED1A 3OMLA 1KO4A 5CDHA 3JQEA 3KQHA 1FFBA 2ZAYA 3T5AA 3OQOA 2PUTA 3MTGA 2GCOB 2QVXX 2X86A 1KVQA 1PFWA 3PCXA 1E8MA 4GMHA 4IJQA 4UVHA 2CDAA 5HTKA 2CNKA 3SICE 4YR9A 1YJBA 3W8DA 4OK6A 2IPAB 1ETUA 2ROQA 1O6CA 4E08A 4MPRA 2I7XA 4R01A 3KVVA 5ELLA 3RTAA 5JLJA 4P08A 2XA2A 3TR0A 1GN9A 1SB9A 1EM6A 3FR8A 3GOQA 2K5UA 5AUOB 1AY0A 2GXQA 4XZ3A 5LR6A 1JDJA 3LWDA 3WIVA 4B47A 2F62A 4GP9A 3GGGA 4BP3A 2J5QA 2O1XA 4GZ5A 3WI7A 4RTRA 3HVIA 3R6WA 3L1JA 1LK7A 1CY4A 2FN4A 5GZ1A 2IX9A 1L0BA 5H7XA 5C80A 4BNMA 1SG6A 3VI4B 1CB0A 1SC6A 4RDXA 5J4KA 3HFGA 5CCXA 5JZSA 2BONA 2M6KA 4D4MA 1KI2A 3A14A 2V7EA 3NORA 1LDNA 1W9MA 2B8WA 2FWRA 3GZTB 5FAXA 4AY2A 1FNMA 1JIKA 2MSNA 2I55A 2GEUA 2GPWA 3BL5A 4KUEA 3R0IA 3TOXA 4JELA 3TNLA 4ZOCA 4N7MA 3T3DA 2C7PA 5G0UA 1IY9A 4HUJA 1BAPA 4MS1A 2OSBA 3AEQB 4C4RA 5K5EA 4O25A 4NKRA 2DWQA 1J2RA 3P2IA 1Z5VA 3AFIA 3H5RA 2GAFA 2WMYA 3F74A 1HL7A 2AOXA 2FWMX 2BZ1A 3M6XA 3ZWXA 3AHCA 3A6LA 2RSLA 3AFOA 2IYLD 4WCFA 2XB6A 3M33A 4U5QA 5JU6A 5TARA 3HJTA 3ZNQA 1C3LA 1W5TA 4G85A 1ZGBA 4IXDA 4PW0A 5SZHB 3MA0A 3NMUF 2NTVA 2W6QA 3O94A 2AUNA 3P2JA 3V7NA 1RJ9A 1O97C 2Y8EA 5HFNA 3SMQA 3HKCB 5SZJA 3DBVO 3GT3A 4CHGA 2D1TA 2C3YA 1M7GA 1XTTA 1C0IA 3OJWA 1KZYC 4YJ3B 1U1FA 2AEMA 3DE2X 2PZBA 1GAQA 4P5PA 1NYLA 1XRJA 4OHWA 4ZC8A 2W6IA 3L7YA 2ZI7A 2ZM6B 2WI8A 1ZCFA 4LJ6A 1ORTA 3VNUA 3LSYA 1KEKA 2BN4A 3NYRA 1E0AA 3F8SA 4MUIA 1DKNA 1T25A 3CZ4A 4XD2A 3FROA 4B6SA 4ZC1A 1U0NA 3AUSA 1C3OA 4KH0A 4V0LA 1UKBA 1M8FA 2QQ5A 1QO0A 3E53A 4EKIA 4EKEA 4TUYF 1RM0A 1BE6A 3ICCA 2JVKA 4YJFA 1GXSB 2ZUSA 4LV5B 4C0JA 1V5EA 5LYJF 1TJYA 3KQLA 2NM0A 3VU9B 2IXAA 1G5TA 4MDYA 1IBSA 1E9AA 1QVRA 2XUOA 3I3OA 3G1TA 5CG1A 1G9XA 3WWEA 1KXZA 4BNHA 3I6IA 2CJFA 3MUNA 1TJPB 4MUJA 4ERXA 2A9PA 3SAJA 3PLRA 2IT1A 4LCEA 3OHPA 3U4CA 2FE4A 9ATCA 1M8GA 2B1QA 1H9AA 3DBRA 4RY2A 1L5YA 4EIWA 1OBOA 4QWMA 5D85A 1VKRA 2FVXA 4CKBB 5A04A 5ERXA 1K66A 1X87A 4CL3A 2ZE8A 1W0CA 3Q98A 1U8UA 1G55A 4KQFA 4CMIA 3NALA 4DRZA 3N70A 4G0NA 4YLYA 1E2EA 3QBEA 3QOYA 1JQ3A 1Z82A 2FEXA 3MUEA 3M4JA 1B0UA 1GQOA 2FB9A 3QUCA 3WKAA 1N92A 4BO5A 4DMRA 5F35A 1UUFA 4N41A 3UHPA 4BEVA 2FFAA 2FW7A 4N5LA 2JA2A 3GR6A 4K6HA 3SHVA 5KU1A 4YLEA 3FF1A 2ZKLA 1WEKA 2RGRA 3I9NA 1TIPA 4KQMA 2O2GA 1YR7A 4FE3A 4DV3B 3I1FA 4C7VA 2IP4A 4LOAA 2JBHA 2P62A 5EYPA 4TVBA 2VHZA 4BPRA 2PD6A 5HEKA 3WQQA 4R98A 3SD7A 1XALA 1DAEA 1KYQA 4CR6A 4Y6QA 3NVMB 1GGKA 4UEOA 1WKBA 1QIKA 1CY2A 3LPCA 1Q6YA 3CF6R 1FCJA 4NARA 4U3JA 4E70A 3TG8A 4K5QA 3IB6A 2QAGC 4LRUA 1ISGA 3FUCA 2DFTA 5LCXA 1G20B 2H1FA 2J6BA 3P20A 5E9AA 5EMJA 1CR1A 5DX8A 2ZIUB 4RPHA 3TCXB 4M7PA 1FX1A 2G80A 1N32B 1X8LA 2CXOA 4IRMA 5KYUA 3HMKA 1SZDA 2WV7A 1A3CA 1E5DA 2EP8A 4YLGA 1KVUA 4TTSA 1Y33E 1LK0A 1NW9B 2WU0A 4KWCA 4TWRA 1JEYA 2C9YA 5ALSA 2BKVA 2P9ZA 3W5AA 4LXHA 3GPIA 1JSZA 3NAZA 1S2OA 3BREA 2FPLA 3I01A 3N75A 2A88A 5DNDA 3LRXA 2RGWA 3IP6A 5JD4A 5KPDA 1G9TA 2FN7A 1UMBA 4P1ZA 1Z25A 3DLTA 2D2IA 4MQ4A 3K94A 4Q01A 1FFXA 2RE8A 1Z68A 4GL2A 1AV6A 1FNDA 1U8YA 1YZVA 1BHO1 5L3ZA 4QFCA 3LX4A 1H2XA 4E5UA 1EWKA 4M6WA 3EF3A 4REQB 4TS3A 1CUJA 1JDBC 1AE1A 4JT9A 3TI7A 2IL1A 1YR3A 2CHUA 4E14A 1G9SA 4ENRA 2O8EA 3VZCA 3DV9A 3TIFA 3T7EA 4P83A 3EC7A 4MW7A 3DBIA 1YRYE 4FEAA 4ODIA 1ZUHA 3HV0A 3ZWQA 4AKIA 4X3PA 2FSVC 1JVSA 1UJNA 3LNTA 3LQFA 4JWKA 3RYHA 3KM0A 3ECAA 4IQ0A 2CCGA 4HVCA 3D02A 4L1KA 5JIBA 3JCZA 4TV9F 1Q14A 1W93A 4GC5A 1EUDB 1QHGA 3TW6A 4YMHA 1XDGA 2FUG6 2J6CA 2QLJA 3EF1A 4JKIA 3DYBA 5FA5A 1E0DA 2XVYA 1CUVA 2X58A 5FFMA 1N9GB 3ZXUB 4EOGA 5K3FA 3UT5A 1X7GA 3RBAA 3P26A 3BORA 1FL9A 3RU7A 4YYZA 2XT9A 1RI5A 3TMAA 4Z49A 1FYFA 3VYWA 4ALLA 1U0LA 3P45A 4UHFA 3TKAA 5FTNA 1YFKA 4KITB 2Z6QA 1N5JA 3DZGA 1GT6A 1J9EA 1O5OA 5AOVA 3RVQA 3KOWA 4PXAA 2IS6A 4CCYA 3GFFA 4EHNA 3SIXA 3REFA 3C7CB 1S4QA 3DP9A 4FK8A 4WZAB 5IG2A 1G5QA 2DPLA 3GMSA 1CQWA 5CXQA 4RSHA 1IL0A 3CRZA 3D1LA 2V7WA 1S89A 2P2CA 4YP0A 4E1AA 3MGAA 5CB4F 4LJYA 2NQ2C 3OPQA 4XGIA 5E3HA 2VG8A 4P84A 3N2KA 1SD1A 3PHBE 4DREA 2CXQA 2IIPA 3WMXA 2P2YA 1GGHA 3N2NA 5KAPA 3JZDA 2UVDA 2WJ4A 4KLAA 4ZVTA 2OCPA 2H4WA 2VPXA 2X76A 3I9LA 4O63O 3HB7A 4EVSA 1OIVA 1YZLA 2BFCA 3B9QA 1E96A 2X42A 1DZIA 2AOTB 1T3ZA 1M1YB 4YPVA 4CEJB 1L4KA 3E7WA 4ZQEA 2XKKA 3KB6A 1T5BA 1VLVA 3LGSA 3DMHA 1GL7A 4LW8A 2M9MA 1QTQA 2P68A 1QGUB 1BE0A 4R4JA 4ZHQA 3PLAE 2ZSHA 5D7BA 4ZVPA 5EEHA 3I9FA 3NYIA 4DR1B 1NLYA 4I1VA 3T0GA 3MTDA 1T4BA 1OVGA 2X0NA 1WABA 2IZZA 1QNLA 4OH1A 3DXFA 4RESA 5KOIA 5B3JA 2IHNA 4DLYA 5BNFA 3AR2A 2DOKA 3QLVC 4DLKA 2M2IA 1DE0A 5REQA 1T8UA 4BATA 3EQ6A 1MAAA 4LNAA 3PVCA 3Q7IA 3ZQUA 2WF9A 2XQJA 4ROSA 1SOAA 4XVRA 2C9CA 2G36A 2P65A 3I4FA 4A4DA 1TM7E 4B7ZA 4HTFB 3TEFA 4GPIB 4I5EA 5EMKA 3SC4A 2XGGA 1IBKB 4E4YA 4KZKA 3F4KA 1P75A 5FHRA 1HZZA 1RLUA 2V9ZA 4C6SA 3UWOA 4DM3A 1DWPA 4F56A 3E5RA 4MI9A 1O96A 3TXYA 4HUTA 4NXNB 2HI0A 1CIJA 4HYYA 1DBWA 4OX9Y 2DKNA 3PZRA 1R66A 2ZRNA 2HMTA 2DFNA 4QWWA 1PX0A 1R9NA 1FDVA 1QH9A 2VWGA 2DBZA 3HM2A 3LKBA 5KEIA 3AMVA 4LOLA 4BKUA 3BS4A 4BKOA 4D9JA 3L6BA 1MU0A 4ZI7B 1BDHA 3MPOA 4LHEA 1FUYB 2ERXA 3AHHA 3W5BA 3ZHQA 4YXWA 5A9TA 3TDKA 1J0CA 4I50B 1YDFA 2Y05A 3L1KA 3OFSA 2IWHA 1E1LA 3CZ5A 4IDOA 5JS6A 1NJGA 4MLDA 3EOZA 3IT2A 1O9GA 4MK4A 4AQ7A 5FXMA 3HSSA 4HWRA 1J6UA 4RQAA 1KJJA 2P7IA 4G01B 4XOUA 1LB1B 1CUDA 2XNJA 3FCOA 5EHXA 1KAQA 3ENNA 1HE8B 3CZMA 2H57A 1JU9A 2W4MA 2A1UB 1SVOA 2B4TO 3QWFA 5TVKA 2PZLA 3OP1A 4X94A 4GVXA 1N5IA 1E2GA 2ZIZA 1U9IA 3WRYC 3H2HA 2M1XA 4CE6A 1ZM7A 2XMQA 3CNQS 4CTJA 4P7KA 3KP1A 4B9AA 1UBLS 4ARCA 1M10A 4PZUA 4W7HA 3BIXA 1SCIA 3NHYA 1KVRA 3EASA 2E4ZA 2FFRA 3ILYA 2VZ0A 2ZVQX 4RENA 3RC2A 1ISMA 3UAWA 4F2HA 1UBMS 1PV1A 2ZSIA 3EMVA 2DC1A 4X1IB 5CVJA 4Y9DA 4BMOB 3OQIB 1QZUA 4RA6B 3UN1A 4MIEA 4X45A 3LV8A 5AK6A 2ISQA 1RPZA 2D06A 1ZOSA 1ZUIA 3IHKA 3SK0A 5KNDH 5AI8A 2DETA 2VT6A 3KC2A 5AI6A 2P1RA 4FX2A 4GX1A 4E4TA 4PSUA 3QVLA 1MC8A 4HEHA 4KYUA 5DLDA 2COKA 3PHJA 1WW2A 3U81A 2J31A 3OEED 1OGIA 2GBIA 4N8DA 2FF7A 4PG8A 4HZUA 3HEAA 1VRVA 3K2IA 1W0KD 4IYRA 4KOEC 3RT9A 4TTIA 2KLBA 5E4TA 2Z83A 4B4OA 3N7UA 4ARUA 4B8YA 2AX3A 3ZIUA 4X20A 4L73A 1ABBA 4D9GA 2O7NA 1X7YB 2XUDA 2ZR7A 1OGJA 2F64A 3GAZA 3MIZA 2C7RA 1IQRA 5D3KA 1QCYA 2QJOA 3MAJA 2C59A 1ATIA 1OXUA 2AC7A 3HRHA 2EATA 3CV3A 5EXSA 5L6LB 1ZM9A 4EO7A 1QJ4A 2ZLBA 4R0VA 2W2TA 4F72A 2C5BA 3IMFA 4QU0A 3BPSA 3VPCA 1QYXA 4NULA 3CPEA 4H1WA 3LE8A 1Z7BA 2WSYB 3C1AA 1EH5A 3ISTA 2QLLA 5SYNA 4DSNA 1RI4A 1JJFA 5AOBA 1H65A 4C76A 3C74A 3QMVA 3CX8A 1QANA 3INNA 2YFHA 3KYDB 4KSBA 4XSVA 3FGPA 3WXBA 2EKLA 3T3EA 3O7WA 3AKEA 3E3MA 3TNYA 4L9AA 4ARBA 1NW7A 4N47A 4PAWA 5KWVA 3QJGA 2ACVA 3GH1A 1BXKA 3HLYA 4GMXA 3R7WA 3F6BX 4UDNA 5IXYA 5JD6A 3GHHA 1R0ZA 1SCKA 2H7VA 1AF4A 1A2OA 1DBVO 2P2DA 4P4GA 2M6LA 2O2YA 2WNSA 1HK7A 2GD1O 4ZT2A 4URWR 3ZHBA 2N0SA 1QG4A 4G8JA 2FPXA 4IL5A 2CYCA 1SC9A 2C03A 3RREA 3DAGA 3KLOA 3LQRA 3DE3X 4Q3NA 4UAGA 4X1KB 4ZV7A 5T5QA 3VTZA 2C97A 2XWPA 1B43A 2ZSDA 3JZIA 2DPYA 1G0NA 3HB4X 4I9HA 1VDZA 3AIIA 3G6WA 2C58A 4LHVA 4YONB 2YJZA 2IYZA 3W6PA 4FUTA 4BEJA 3LX8A 1SY7A 2G76A 3GFPA 1JKXA 3CLHA 1XR3A 5COBA 1GTSA 4AF6A 4R31A 1AHNA 1FB5A 1AKQA 1IMOA 1TGYA 5CT5A 2N75A 1DX6A 3AI2A 1K92A 3IR5A 4UTXA 3EVTA 3AGPA 4J4TA 2YCBA 1RWKA 4HB0A 4CM7A 3TGLA 1NP7A 3EUAA 4Q39A