4D98A

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in space group h32 at ph 7.5
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
molecule keywords Purine nucleoside phosphorylase deoD-type
molecule tags Transferase
source organism Bacillus subtilis
total genus 81
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d98A00
5F77A 1OUMA 1T8RA 1V2HE 1A69A 1Z36A 4TTIA 1U1CA 1ODIA 4BMZA 4QAQA 4D9HA 5B7PA 1OVGA 5CYGA 1Q1GA 3ODGA 4OJTA 2GUWA 3KVRA 1VFNA 1OV6A 2QPLA 1A9RA 5F73A 5EPUA 3BL6A 2A0XA 4LZWA 1V45E 3IOMA 3ONVA 3ENZA 1FXUA 1ODLA 4QASA 3E9RA 1ZOSA 2QDKA 1YBFA 1NC3A 4X24A 1JDTA 1ODJA 1V4NA 3FB1A 1K27A 1PR4A 4PNPA 1RR6A 4OGLA 1Y6RA 1TGVA 4WKPA 3DPSA 1PR0A 1M73E 3D1VA 1PKEA 1Y1RA 2RJ3A 1PR6A 1OTXA 1Y1SA 1K3FA 4R31A 1VHJA 1A9OA 1XE3A 1Z37A 1Y1QA 1SJ9A 4BMXA 4GKAA 2Q7OE 1PBNA 2P4SA 5CCEA 2BSXA 1RXCA 1V41E 3IEXA 1TCUA 1Y1TA 3DDOA 4F2WA 3UAVA 3K8QA 1Y6QA 4F2PA 1PK9A 3OZEA 3EUEA 1RYZA 1YQQA 1PK7A 4G41A 2HN9A 3LGSA 5I3CA 1PR1A 4WKCA 4DAOA 4LNAA 4M7WA 3U40A 3MMSA 4K6OA 1Z38A 5F7XA 3T94A 1PF7E 2IQ5A 3P0EA 4YNBA 1T8SA 1U1EA 3PHBE 1WTAA 5F7JA 2AI2A 3UAYA 1NW4A 1OTYA 3FUCA 4TXNA 1RXSA 2QSUA 3F8WA 2OC4A 4F3KA 4WKOA 4TYMA 3TL6A 4L5AA 4IP0A 3OCCA 3OZBA 4BN0A 4EB8A 4TTAA 5FAKA 4M1EA 5JPCA 4DA0A 3OOHA 1C3XA 3LBAA 3LA8A 3FOWA 1SD1A 1RCTE 1T8WA 1N3IA 4L5YA 4P54A 3C74A 3DP9A 4TXLA 5EFOA 2ON6A 1JDZA 1RSZA 4D8XA 3UAXA 1A9TA 1YRYE 4JOSA 2A0WA 4R2XA 4M3NA 3UAZA 3P0FA 4DARA 5CYFA 3DJFA 1JDVA 4GLFA 1B8OA 1JPVA 3GB9A 2AI3A 5F7ZA 1Z35A 3OPVA 3O6VA 5KB3A 4WKNA 3OF3A 1A9SA 4DANA 1V3QE 3BGSA 2A0YA 3NM4A 3MB8A 3INYA 4YO8A 1Z5PA 4QEZA 2PGAA 4QARA 5CXSA 1A9PA 4L0MA 1LV8A 1U1FA 1VMKA 4EARA 3KVYA 2OECA 4OY3A 1Z39A 1YR3A 4GLJA 4JWTA 2I4TA 1U1GA 3E9ZA 3NM5A 1RXYA 1SD2A 4BMYA 4GMHA 1ZL2A 1ULAA 3KVVA 1PW7A 5B7QA 1Z5NA 2QTTA 1JDSA 1T0UA 2QTGA 3KHSA 3O4VA 1LVUA 4OEHA 1A9QA 1RT9A 3FWPA 4DA7A 1RFGE 4TTJA 2HSWA 5B7GA 4H1TA 3UT6A 3EEIA 1JE0A 4YMLA 1PWYE 4L5CA 1I80A 4NY1A 4F3CA 4KN5A 1T8YA 4OGKA 3EUFA 2B94A 1LX7A 4PR3A 1JE1A 3BJEA 4DA8A 4G8JA 1QE5A 3QPBA 1CB0A 5B7NA 1NC1A 3KUKA 1TGYA 5DK6A 3UAWA 2AI1A 1U1DA 1VHWA 1B8NA 4D8VA 4LDNA 3OOEA 5CCDA 1ULBA 2A8YA 2I8AA 4QATA 4QFBA 4OF4A 4ECEA 1CG6A 5F7OA 3SCZA 4D8YA 1JP7A 1K9SA 4F1WA 1SQ6A 3E0QA 4TS9A 5ETJA 2OXFA 1JYSA 4MCHA 2AC7A 4WKBA 4YJKA 2HWUA 4U2KA 4DAEA 3K8OE 1YQUA 4NSNA 3EMVA 4TS3A 3PHCA 4G89A 3BSFA 4E1VA 4LKRA 2OC9A 3GGSA 4RJ2A 1V48A 4MCIA 3OZDA 1JDUA 5K1ZA 5F76A 1PR2A 3KU4A 3NM6B 4L6IA 4R2WA 4TXHA 3NBQA 1PR5A 4I2VA 1RXUA 2ISCA 4FFSA 4NS1A 1TCVA 5CXQA 3FAZA 1Z5OA 4DA6A 4TXJA 2HRDA 5IFKA 1TD1A 5EUBA 1Z33A 5IU6A 3PNSA 5F78A 3FNQA 4MARA 3DF9A 4LNHA 1Z34A 4D98A 1OU4A 2H8GA 1ECPA 3OZCA 4UC0A 4DABA 3PNPA 5C80A 1G2OA 4TXMA 4JP5A 1ODKA 2XRFA
chains in the Genus database with same CATH superfamily
1U0RA 3IFSA 2HPAA 3F96A 1T8RA 1EK2A 3DKRA 1KYWA 4H31A 4CEIB 1SWVA 4TTIA 1KVQA 2R66A 5GJWC 4KBFA 4OHZA 3RUHA 3NWPA 4RTPA 3CEMA 1BD3A 1PHPA 4JEIA 5HVNA 4S04A 1ZK0A 5CEJA 1SHJA 4YCLA 3W3AD 2QRVA 3EN0A 3LPLA 4UTZA 4DLWA 2AZXA 1ZDMA 4ASUD 1VHDA 4EJFA 2IIVA 5ALPA 1U2TA 2CBGA 2AKYA 1JZTA 3B38A 4HATA 3ZGZA 1OFUX 1VBMA 4PQEA 5LP6A 1VFNA 5BSRA 4R3NA 2NU7A 3G88A 1OV6A 3IV9A 4OQMA 1DZ3A 2X2PA 3NV7A 4XVCA 1T3SA 2ZTLA 1RQ2A 3V2UA 1T6XA 4MICA 1XYYA 2GYUA 4ZT5A 4ZVRA 2AN4A 2O1XA 4OM7A 3UC9A 5BP7A 3ZVNA 2JRCA 1D4FA 1X1CA 1RC8A 4ZT2A 3VNBA 1YQTA 2GPYA 3CO0S 4KHPB 1CE8A 3FSEA 3RNLA 4P83A 2QQ5A 3WMEA 3EXG1 3O84A 4JC5A 4BVEA 2HU5A 3FHTA 1XU4A 1KPHA 1RWXA 1MABB 2WB2A 2A2ZA 1OLXB 3E9MA 4IJWA 4WOPA 5AW7A 2G9UA 2NYVA 4Z1MA 3E9RA 2R5FA 4EIWA 4GDFA 1CR6A 5EJGA 1JHAA 3A6FA 1NC3A 3BMNB 4INZA 1T2DA 4M88A 2B9VA 2Z8YM 4HUQA 4UUMA 3IDZA 3BAFA 1E3DA 4P4TA 2ZETA 3AETA 1HK7A 2NAPA 2QL6A 3E70C 1NVFA 4FMPA 4KTTE 5JRJA 4MW2A 1IEVA 3Q9NA 1FSZA 1V4NA 1XTKA 3J81A 1JAXA 4I19A 4X7PA 1M2JA 1THGA 2NPFA 5EQTA 2DWPA 4QU5A 2Q9UA 3E9DA 1G5FA 4XYLA 1HPLA 3G5UA 4HDOB 2QTAA 2L18A 5I51A 3V4RA 3PQDA 4GG1A 3B53X 1E2BA 5JVDA 2YYAA 5L3VA 5C1IA 4DV3B 4C3VA 2XY4A 2JI8A 4WJZA 1UBLS 4BE9A 4DMKA 3TQIA 1U7UA 5IEBA 3S8MA 3SYMA 4B7XA 4MLZA 4GI1A 4E5UA 3A37A 2ISQA 1V5FA 3RAGA 1YS1X 3GFPA 1SN7A 5CAEA 4YIHA 3OMWA 3WWEA 4JQYA 4LMPA 4W8HA 2CK3A 5BN4B 3UOGA 3WB1A 3JVDA 5LZ2A 2C2ZA 2DTEA 1GQSA 1L8QA 3GRPA 1DADA 5CH5A 4DXHA 1QIFA 3U7IA 4UAUA 2VK2A 4IIJB 4E6EA 3I23A 1LLFA 2WB4A 2DT8A 4JP1A 4QE3A 2IS1A 4MQFA 2VL7A 4D4GA 3B5IA 4QX6A 3WGVA 3AUFA 2RK4A 1R12A 4XZ3A 2QRUA 4R41A 1T13A 3BXPA 1XSEA 3ZY4A 3EC2A 4MCJA 4K05A 4B3DA 1I4OA 5AW8A 5J1SB 2FK7A 2ZVDA 3IAEA 5FOQA 3A1TA 2O7NA 1NP6A 3R8CA 4Y6SA 4HQFA 5IYZA 3ANTA 2KSQA 1TCBA 3DWGA 2CLLB 1PFQA 1MB0A 5HTOA 1TUBA 2JANA 2Q2VA 1OLUB 3QPCA 5F2KA 5EYPB 4ER5A 5KREA 1KMHA 5BOSA 1QOZA 4KNWA 5L45A 2UZ1A 3I64A 4TSFD 1P9RA 2WJ4A 3Q8LA 3QUBA 1FYWA 4ME6A 1H8HA 1PR1A 2PEZA 1C2YA 4HZIA 4WKCA 1L5QA 3FNIA 4WXYB 5FBLB 3WY9A 2VYFA 1U8AA 1B73A 3K8ZA 1L7MA 2AYZA 3BIXA 1U8YA 3G8CA 4LBYA 2IITA 3R44A 4C78A 2JAHA 5CGZA 5CB0A 1NNEA 2Q0SA 4LVNA 4PYQA 1DS6A 2KBFA 3X1JA 5KEIA 1Z68A 2YWFA 3HKBA 1PV2A 4O59O 2YC4C 4K0RA 5J2TF 4ZFNA 4OI1A 1WVGA 1T4DA 2IQ5A 2C84A 2H1LA 2IU0A 3A58B 4F93B 2A86A 3OY7A 3MUNA 3RS0A 4YV2A 2BEJA 1OXMA 2MHCA 3AJ8A 2GTHA 4MQ5A 3K2EA 5IH3A 4A0RA 4Q1CA 1NVUQ 4AWAA 1HQKA 3L1KA 1FXSA 5JAIA 3WGGA 1G8MA 2J3KA 1R8XA 1WCIB 2HSJA 5M7EA 3V4SA 1LZLA 3L84A 1BOFA 3MOIA 5HWSA 8GPBA 1UC9A 4YCBA 5E4JA 4ID9A 3TL6A 3B13B 4Q48A 4OFBA 4BMPB 3HJFA 1Y4AE 1TM2A 1E1KA 3OZBA 4ZVKA 3VGJA 5LD2B 4UE3S 4RC9A 2BKAA 1R88A 2OHOA 2R00C 3GJXC 3WJAA 4JCCA 3ZBUA 4IQ0A 2W6IA 3ZDFA 5FAKA 1EFVB 4W5TA 4KR2A 3FHJA 5DN6A 1SC1A 2NM0A 1CD5A 1RABA 4REMA 5JY6A 1HYBA 2W2LA 3NHSA 1UKBA 3COZA 1JRLA 4LJLA 5H83A 2ATCA 4AWXA 1M9NA 2FN8A 1P2DA 5KWSA 5MGNA 1M6VA 2JFVA 2XWBF 2HCRA 2CCJA 1LK5A 2RGUA 4OBEA 3NHPA 1DX4A 4YMIA 1OROA 4L5YA 4V3CA 3WI7A 1ZGCA 4LHZA 3H9QA 2OY0A 3P9IA 3FGOA 3UMSA 2PX3A 3ILSA 2WTEA 1QNFA 4N5NA 1FYXA 2H7XA 3FWKA 3CX3A 4HAOA 4NJEB 4R69A 2HXSA 3OJLA 3FNGA 4TXLA 1J42A 2B8NA 4PHTA 1YB5A 1GQFA 2FWNA 4WTOA 4ZDIA 3AUAA 1AN9A 1IUOA 1FBTA 1GZHB 2QUIA 4LKOA 1UBTS 2MU1A 4J4HA 4D8XA 1R8JA 5DX8A 5GONF 2ZT7A 3JQQA 3ZHZA 4QOGA 2AVDA 3JQ6A 4AWBA 4DEVA 4UEOA 3I9JA 2XD9A 5AKYA 4PZCA 4LJAA 3FW1A 1P77A 3EUWA 3IQZA 3BEOA 3DH0A 1YIAA 3IBGA 4HXFB 5TPZD 1SULA 2GS9A 2WIBA 2YXEA 3BFVA 3LX4A 4JLKA 3UAZA 5ADWA 4PLYA 3DV9A 2OXRA 1W4ZA 1I5EA 1TJPB 4O5AA 1IOLA 4R9NA 4UNNA 4Z4QA 4HZUA 5LZ7A 3QKRB 2B98A 1ZD5A 2UZAA 1EK1A 3OU2A 1SOVA 1UDBA 3EVNA 5TXGA 4YT4A 3HU1A 1U5AA 1TE2A 2ODAA 3I37X 2VP0A 4JC8A 4DT1A 5IEJA 3GUYA 4G5HA 3TXYA 1QP8A 4KYTA 1DMSA 5TEVA 2J5QA 3Q2KA 2FEAA 2WWWA 1VMAA 2EFDB 3D0QA 2PS3A 3VBCA 3FKSD 1ECFA 5LIPA 3LWNA 4J1QA 2VHUA 1VJ1A 2AW3A 4R8KA 3L8FA 1N2GA 1V3UA 5JXIA 1TVMA 3PFNA 1DCKA 5WRFA 1IVSA 3LLUA 1VJ0A 3QV2A 4OL0A 3VZSA 4AP6A 3ZUPA 3T3HA 3ISVA 3RC9A 4EY8A 3JYLA 4C0XA 1BWSA 4E30A 1KFKB 1F6WA 1WOMA 2FUEA 2B1RA 2BV3A 3DZGA 3KIPA 2AGVA 5EQDA 1SKUA 3GNTA 3WGOA 1G8YA 1SG9A 1W8IA 2QQFA 2ZAOA 1REQB 5KQGA 4PEVA 2XB9A 1QH8B 1F12A 2I4RA 2WP8J 3DTVD 2G28A 2IVFA 3KKQA 5HX7A 2B21A 1CUDA 3ZWPA 4WXHA 1SOWA 3G7NA 1O94D 3N2YA 2B20A 2VCYA 3RSOA 4DLTA 1TO2E 2X2EA 3C6QA 3TW8A 5CVCA 3DWFA 3ROMA 5KKCA 3VPGA 4AAYA 3T3PB 1E1CB 16PKA 3VRHA 5DCYA 1TIPA 1HFJA 3F5DA 2NU9A 2CV1A 4FX2A 1ESCA 4AK9A 2A1IA 3F67A 4ND3A 1O9HA 3CX4A 3HUUA 4PHFA 3UYKA 3WLQA 4E4YA 3R7WA 3PYXA 5L51A 1I9CA 1YZHA 3I34X 5GOZA 2PMEA 5KJ1A 3V1UA 1W25A 2NP7A 3CRVA 2J3IA 4H7JA 4JJFA 1KRHA 1GG9A 1PJ4A 1JZQA 2HSDA 2J41A 1P5RA 2WJ6A 1Y37A 3WBJA 2R1VA 4TV9B 5D84A 1Z7GA 1U6JA 3FRHA 4ISBA 4M76B 3TLBA 3EASA 2WTBA 2Y77A 4IUBS 3KHUA 3AH8A 4BEWA 2JCSA 5F3DA 5KNDA 2J6CA 5FI3A 4I5EA 1RFGE 2XNDA 4TTJA 3H1TA 4LZAA 4YDQA 1H2FA 1DKNA 2P9YA 3O93A 3I2KA 1R9NA 3GRCA 4HX9A 5AQEA 1FFEA 1RYBA 3GGPA 3BH7A 3JQAD 2LR0A 3T99A 3M83A 4EABA 1RRMA 3U4DA 5T41A 1WHSB 1SCJA 5DJ5A 4BO5A 1NFFA 1H5NA 1SQSA 2VYNA 1BYIA 3MBKA 2WA2A 1AHIA 1C30A 1VJRA 1W94A 4ZDWA 3E82A 4EQ6B 1Y3FE 4F9FA 5FXMA 1ISJA 1Z26A 2XNSA 3D7KA 5FFFA 3SS8A 3P4YA 5GY7A 5JCOA 3RASA 5AR1A 1LPSA 1FDUA 2AD1A 4G26A 3REFA 2FUG6 2O07A 1A7UA 1JR2A 3ETJA 2BRUC 2PGIA 2X42A 3HPQA 3CRZA 2B69A 3QTBA 3KJNA 3SSAA 2PNJA 1NDQA 4I6GA 5CYPA 3TAUA 5FX2A 1GQ2A 1CUFA 1QR2A 2CNWD 4G9BA 4N5IX 4Q1VA 3ZTYA 4RIEA 1N2ZA 5DBEX 3L7DA 4RHCA 5K0BA 1I7QB 1RWMA 2Y1EA 1JR4A 5CDGA 2QZ4A 1RQPA 5E9QA 1J24A 3A25A 1CUJA 1NBMD 1PU2A 2VAXA 4WJLA 5K4GA 1SIUA 1O54A 5DGIA 2PMCA 1NNUA 1WIWA 4OA5A 2IYXA 2RD2A 3W9UA 4UNPA 3RVQA 3KOMA 2GD2A 6REQA 3ZCQA 3C3YA 4DHWA 2IYFA 2YC2C 1F2TA 3BXOA 3E48A 5AM3A 1MGOA 3KDPA 5CHYA 1LQUA 5IW8A 4O2BF 4ER3A 2HPHA 3P9ZA 4QOSA 3ND5A 3GWGA 3N59A 2OBNA 5DXFA 1SUBA 2EXXA 1ONOA 5AI6A 5HIIA 1CUXA 1QONA 3WOVA 2Q5HA 1TU4A 1OXKB 2WG1A 2XNKA 2AR0A 3FMOB 4ECEA 3L92A 3NIGB 1DC4A 4KQCA 3BD6A 4J3JA 5ELXA 4OHYA 1Z0ZA 5I6DA 2FX3A 1JG6A 4IUDS 2ZXUA 4GL2A 4KGVA 4ZOLA 1ZW1A 1EBFA 2XYRA 3E03A 2A6PA 2GDZA 3F7MA 2VYCA 5J47A 3EWNA 4XQGA 2OCGA 4HWGA 3WK9A 1SQ6A 2ZSDA 3KG2A 1XRPA 1YHYA 1VA4A 1W1UA 4LYJA 3ZZTA 4OFZA 4CIDA 3SNKA 2D2FA 3NTXA 2GX6A 1A98A 4QXAA 4XPIB 1RI4A 5LL6P 3GGDA 4HJRA 4OQPA 3EA5A 4E2WA 5EJEA 5AW4A 2I34A 2Q3CA 2XVXA 5BQOA 2VHCA 5HFAA 4P80A 1A5BB 2F48A 2YY6A 3CFYA 4G89A 1W19A 4NF2A 3SFVA 3SICE 3PS9A 4AICA 4E1VA 1ID8A 1NF9A 4V1CA 1YQXA 3D6FA 3BORA 4HDAA 4YRQA 3CPSA 4K6GA 4R4JA 3B1ZA 1AN0A 4ZCLA 1OTHA 4AY4A 5LP6B 5JJKA 2G76A 3S7TA 1EDDA 1I36A 4FFLA 1CUVA 5A62A 1JDUA 5I5EA 1YZGA 3RUAA 4FX5A 4BN5A 1KO5A 1NI4B 1SXGA 2GAOA 1U7TA 4DM3A 4XGNA 1O8CA 1M2NA 3EBPA 3RE1A 1FUIA 4KIWA 3IP1A 3QG5A 4R2WA 4XB6B 4BYGA 3MWYW 3OLZA 4K6MA 1CE8B 3GLHB 5DNCA 1LY1A 2G09A 2PMBA 3IJEB 1YDEA 3NYIA 1KJQA 1J8QA 3QXHA 4JA2A 1QPBA 3LG2A 3E5MA 1NUPA 2Q50A 4WVFA 5AOAA 4F85A 3GR6A 4KRGA 2V0NA 1Z7BA 1YUNA 4DA6A 4OQFA 3TJRA 3GVXA 3G2PA 4R0VA 3DZKA 2G4VA 2YJNA 5T8KA 3TXAA 3ZWKA 1P7CA 2PPVA 4QUJA 3B2QA 3HB9A 4GEKA 4HH4A 3R7BA 3TL2A 3AETB 3AFIA 2Q5QA 3G0BA 5HM6A 5ICSA 4AS3A 1A7KA 4MITA 3MFQA 4KGZA 1I9GA 4NFYA 1KK3A 3EFBA 2UU9B 1OA0A 1AUVA 2FQ1A 3QWFA 5SICE 4IZHA 2AG6A 4LWPA 5DFAA 3NHBA 2QI9C 3FTCA 4CM1A 4CPDA 1WOYA 3OU7A 4IW3B 4CF5A 5AKIA 5J2UA 3WE7A 3VKUA 5JVDB 2W0MA 3PFHA 3LTEA 2WEKA 4IG4A 5E95A 3VR5D 4NJOA 2WPNA 5CTAA 3LQ1A 5FCDA 3UK1A 2P67A 1WP9A 3VJLA 3R0VA 2DWUA 1WUKS 4AP9A 2Z1DA 1ARZA 5KWEA 4Z0PA 3EPJA 2JVIA 1JXMA 1SKYB 1VB3A 1JAYA 3ANSA 2FWJA 3IAUA 4GS5A 2PANA 4KC0A 1OFGA 4P3PA 4X9XA 2AWNA 4ZOEA 2ZU0C 3C7TA 1YJBA 3L0BA 1UKCA 4A8JB 4AB1A 3HGQA 1A4RA 3UMFA 1BNCA 4MKGA 3AR7A 4QOHA 3VSAA 2NXJA 5C7YA 3O4FA 3CCBA 3UH1A 5K6AA 2OG1A 4B35A 1I3NA 4Q7KA 1XVIA 2LVBA 4NNPA 5ERXA 1LZKA 5JCPA 1KVRA 1USWA 2NSJA 2VHTA 1BW9B 2VHJA 1SCBA 3GEEA 1Y3CE 3I8SA 4MP6A 4MQFB 3JZFA 2DQ4A 3HXQA 1SOAA 3ENNA 4L4ZA 5DV9A 4N8SA 4EEZA 3VKGA 1B1AA 2E49A 5FOSA 1WD7A 4MRMB 3LPMA 2O7RA 1DWOA 5JR3A 4UOZA 4CXMA 3I5XA 1VLLA 2Q9BA 3PKIA 2HUPA 1G7TA 3B3GA 5IYZB 2XCLA 4MV6A 2C8JA 2POCA 3T1YB 1TUBB 4FEAA 3C97A 1W5BA 4UNQA 1CTQA 3TG8A 1DX6A 4LSZA 2UZ1B 3DLAA 1XZPA 3WLPA 4DCJA 3UWOA 1SXJE 5F35A 3FETA 3IE0A 1OXSC 4XM0A 4QPJC 3IDQA 4RD6A 4OV6B 2ZRIA 1GDHA 4B2LA 1N5OX 4NOKA 4UU0A 3ZU5A 3A4LA 2BM1A 2IOFA 1E1RD 2RCYA 4BEJA 3KPUA 1RMQA 4BTLA 3LA6A 5ECYA 2P1DA 5FH9A 1FMFA 2BGMA 2VJQA 2R60A 3HKBB 3QPVA 3T15A 3ZLUA 2WTXA 1C1HA 3G8AA 4TN5A 3T0FA 2GN4A 4UHCA 1ZUIA 3VDRA 3M4JA 3NRJA 4DIKA 1RP7A 3GWZA 2WNHA 2GPWA 3L7KA 4R5HA 4OLHA 1PNTA 1XL0A 2VQSA 3TZCA 2I54A 2C3OA 2Z04A 2H1IA 5THXA 1BX3A 2A14A 4J2TA 3S0JA 1JDTA 1W1IA 3L1IA 1WSAA 4U0KA 1RQLA 5CDSA 1GWNA 3C0KA 4RV5A 3DO5A 4PZ9A 2JFBA 1RW4A 1PDWA 3DOIA 1K27A 3ZXYA 5HJ5A 2R4UA 4UTXA 3RVRA 1ESDA 5HHTA 1DEAA 3NHAA 1V43A 4K2HA 1UR5A 3AZOA 1JJVA 2PTHA 4PBRA 1WS6A 5EE3A 4HT3B 3EGOA 3R3WA 3GPDG 5CT8A 4CQMA 3LC1O 1XQWA 1JHDA 2XGMA 3ON5A 4FUTA 3CYFA 3RSHA 3S7ZA 2QVCA 3TSYA 4W5JA 1KYIA 3T9DA 1OWPA 1GUDA 2VJAA 2NPIA 4M1WA 3TTWA 1FMCA 4FGWA 1MOQA 5LLTA 4NV3A 3KM0A 1X7WB 3TVDA 1G3MA 3L8EA 3WFJA 2PXHA 4HQKA 1NBOA 2HIAA 3TNDA 1IXYA 4TTSA 5IC4A 4NMHA 2V3CC 1J0CA 4RCZA 1G2QA 3H1BA 4WESA 5BOVA 1L0BA 4MYRA 3NETA 1M6VB 1PWXA 4HP8A 1J99A 3ZN2A 4OHRA 1U9IA 3GJZA 3M4XA 4M8KA 1EM8A 3PNMA 3HCOA 2XR1A 3LWDA 4P53A 3C48A 5DLYA 2GZSA 3HCNA 4F92B 3GG2A 1Z6ZA 2JIRA 4YJFA 5CYOA 3UENA 2Y27A 4Z4EA 5CX1A 4F2WA 1L7XA 1ZIOA 4DLUA 3TRHA 2HBZA 2YWJA 2D7DA 3Q0IA 4X61A 2A1UA 4OMFG 1I8TA 3I8XA 1QTIA 4IHJA 5FNVA 3V8RA 4MYDA 1OPRA 2I55A 1F7UA 1N8SA 2ZGVA 4GOXA 4AXBA 4HH1A 4O4JA 4MTLA 1DBVO 4RADA 3P45A 3G9TA 4QFCA 2FPOA 1G3UA 4V0MA 3R8FA 5M2QA 2GN9A 4C14A 4Q4CA 3VYWA 5L95A 4GYJA 4LECA 2QRPA 5DPMA 4D56A 5ILOA 1I01A 3WGZA 1L4KA 4HZUB 2WUWE 1W6UA 5I3CA 3QVKA 1BDBA 2D0PB 3AHFA 2VAVA 4JS0A 4QQFA 1O58A 1NXPA 1JA9A 4BP9A 1TFUA 1IZ8A 4DT1B 1AXGA 3GLGE 3TKLA 3CTPA 3P20A 2A9KA 2VNAA 1E3WA 2RHHA 3QUAA 3WXMA 5JAOA 5M04A 1XDWA 2CWWA 3CJTA 2FR1A 4JQCA 4TM8A 5AK3A 2ZUTA 4GKBA 3ROZA 4KH0A 4I3GA 2GQ0A 2I6FA 1O6GA 1RQ7A 4G2TA 4HGPA 1DO8A 2CC2A 1WTAA 3GVCA 3IPLA 4BO2A 3DE0X 2XTAA 1DC3A 4D82A 4IL5A 1QIHA 5CW2A 4MS4B 5IN5A 1FW8A 4X20B 1D2RA 5PNTA 3OWXA 8AT1A 4OUDA 4JB8A 3M1LA 3U7QA 2GJ8A 1G6HA 2EQ5A 4H77A 2XPCA 1C7IA 1ZOIA 1EWKA 1ORIA 2A0FA 1UMDB 1QLWA 3OHSX 4RK4A 3H0CA 1QFYA 1Z4JA 2J08A 3A2NA 3MWKA 4PSUA 4WKOA 2OYRA 4AJNA 1J5XA 4D41A 3O8QA 1FTGA 1XLWA 4IP0A 4PYNA 3PSHA 1W46A 2CMHA 1ZA2A 3FYUA 4QU9A 1KWGA 4BVGA 3EEFA 1U0TA 4KWEA 3ZIDA 4U2FA 2ZUSA 1H4TA 1P1FA 3W05A 2ZZNA 5FBKA 3GLVA 1M8PA 4FYMA 4ECAA 1HSZA 2NU9B 5KC9A 5JJIA 2QAGC 3KAQA 5FL7A 1BAPA 4OI0A 4Z0HO 1MJNA 1B0UA 2H2DA 4GOOD 1FPQA 2A0UA 3BXFA 3LA8A 2XMQA 4JUFA 2P30A 3BD7A 4B6GA 5JQWA 4PQYA 1R8SA 1GDTA 2EV9A 4EO9A 1N3IA 3JZDA 1K7XB 4GI2A 4Z4FA 5T4FA 1ULZA 2Z9DA 4BDSA 2VDKB 3P9PA 2HRBA 3LCCA 3V48A 2JK0A 4DUGD 1Q3HA 1UQUA 2R1VB 2ZRCA 4IDEA 4Q02A 1I7NA 2H2IA 1KGDA 3DGEC 2IOHA 1CF4A 1WDMA 4J43A 2AIRA 2JGDA 1QHHA 2FFHA 2WJWA 3DHYA 4OU4A 3MBIA 1X1RA 1OE0A 2I4IA 2OD9A 3LL7A 4MEBA 4MV4A 4PW0A 5JALA 1M0EA 1DJPA 1HMYA 1MB4A 2QSJA 3LD9A 4HV4A 3B6KA 1Q19A 2NO7A 2WWYA 1JAHA 4HB0A 4UHFA 4FR5A 3O2SB 4NK4A 1RXWA 4G25A 3ICQB 2JI6A 3IAS6 4NYJQ 4EGSA 1ZH2A 3P0FA 1SB9A 5ADHA 5KU1A 3E2IA 3OZVA 2BBTA 1C30B 2F3RA 1SBIA 1YASA 5CYFA 1HORA 3CX7A 2LDBA 1ADCA 4LBZA 4XIFA 4GPEA 2P3OA 5FA6A 3PXGA 5EPOA 2FMTA 4L0QA 1FNNA 3QBEA 4EUHA 5IUKC 2WKSA 4NAUA 5F7ZA 1RVV1 4C7MA 2ZBVA 3V7WA 2Y1XA 1XLTC 2BJVA 5E0OA 1GZDA 5KS2A 2ZRJA 3PA8A 4RY2A 3W2FA 2P8JA 4IV5A 4CT5A 5CB8A 1Q15A 2C03A 4ZOCA 4CM4A 4XFKA 4DNXA 1YR9A 3W7AA 1OKKD 2W37A 4B4UA 1OV4A 2WQZA 1RC1A 4FQ7A 3ZHTA 4J7UA 3L3BA 4OOEA 2HJWA 3LOUA 3WMRA 5L3QA 1T2FA 4JYAB 1F17A 3HB7A 6REQB 1DQPA 5H1YA 2D06A 1Q0TA 2ORVA 4JBNA 2X77A 5AM5A 1F2TB 2FZKA 2WYUA 1DOHA 1B76A 2FOIA 3DQZA 2GFIA 3KTOA 4ZVTA 1Q7RA 4R0NA 5YASA 3C8HA 3GJYA 1N6PA 4NONA 2XWQA 1DELA 2OBXA 3KE8A 3BBLA 4NDNE 4M0PA 4DQUA 4ZJYA 5HZMA 5FTLA 3LFTA 2I4TA 3QHAA 2ZVPX 2QM8A 2JH9A 3L18A 4HH3C 8OHMA 2XCOA 3HJBA 3QE2A 5FPQA 3BMXA 3EC1A 3K6JA 3N8IA 5AW3A 2JAPA 2OQ2A 3Q12A 2EEZA 3PVCA 2KYRA 3I42A 4MEAA 4BMYA 4ZOLB 1C0EA 5T3UA 1OB2A 1ULAA 2QTBA 5J4YA 1J2JA 4OTZA 2X9GA 3GNSA 1YMQA 2X19A 2BMAA 2PE5A 2QV7A 5B7QA 3B6IA 1JQKA 2HHJA 3OP4A 4WBXC 5H4GA 4RTSA 2QTTA 3WYGA 1SG0A 3CN9A 2YXDA 3WGHA 3LHSA 4BQNA 4F8EA 4AUKA 2QTGA 3PYLA 3LCJA 3T4XA 4EMUA 3MWDA 1EZZA 2P11A 1P4JA 1MFZA 1UPBA 1D07A 3NIDB 4HN9A 4X1KB 1UOQA 1VRWA 3PQ4A 5T8KC 4F4HA 4A16A 4BKMA 3FWPA 4V1CB 4AVYA 3PGA1 3ZVMA 1T10A 5JCXA 3VNVA 4TV8F 3UF0A 4QODA 1TLFA 2UVPA 4ZAYA 1EI9A 2E37A 1HDCA 4AD8A 4EECA 1P1RA 2PX4A 3OZSA 3RDPA 1BXRA 5A4MS 1WNTA 2R7LA 5FBRB 3UK2A 1FP2A 1EJ0A 2A5LA 4FIDA 3KLMX 1NQ5A 1PWYE 4U7TB 4LXXA 1UZLA 2ZWIA 2H7VA 2W8BA 3E8SA 3QRWA 4HH0A 2B5WA 2E6KA 2WMOB 3DL4A 4FJ0A 1L8XA 4JOCA 4Q9HA 3ROKA 5FPKA 2J5BA 2ORIA 2O8DA 2QIOA 4GU5A 2FJ0A 1JB9A 1IY0A 1FTQA 1PLJA 1T8YA 2HRRA 1LRLA 1NMEA 1SQ5A 1AT1A 2ZROA 3FBTA 4N6GA 2E21A 5DNUA 3QUQA 3AW9A 3OX3A 1KE1A 3ER9A 5FBWB 4RL4A 4DZZA 1UK8A 2ILVA 2B94A 2I3DA 1XRMA 4M1OA 4RH0A 2AUNA 2X6TA 2FSHA 1Z56C 2Q7XA 1QE5A 2J3QA 5U1PA 2NVUA 4L6CA 5E3HA 1O6BA 3A1DA 5K6AC 3QPBA 4YAOA 3LKDA 3PIIA 4QM7A 1ZZEA 1KH1A 2FG5A 2OPHA 2P9FA 3I4LA 1FL9A 4CIBA 1Y3IA 2NV2B 3G1TA 4LSMA 3NDBB 4UUOA 2QTNA 5HUHA 1C8LA 4JLWA 5CA0F 5J2UB 4BBAA 5M34A 3NUZA 3OEEA 1YXMA 2Z56A 4WIAA 4I9GA 5CIWA 4Q01A 3M5WA 3TL3A 2JI4A 3WLRA 2X0DA 1LQ2A 1NHGA 2VUHB 3ICPA 2ONCA 4GZMA 2B8WA 3EXFB 3OOEA 5JJ5A 4QQ8A 1YL5A 2PAFA 2Q5IA 3ANNA 3V6LA 1NJ8A 2EKQA 2I8AA 3A1UA 3AV3A 1E2KA 1A8UA 1Y0BA 5DBOA 1ZVQA 4HVAA 4F91B 1A76A 3NVAA 2OD2A 1E89A 1BEUB 3EG9A 4KIFA 1OWLA 2EKLA 3SCZA 4D8YA 4HUTA 4ZZ3A 2XCTB 3KXPA 2QB5A 2XMRA 1N75A 2BBSA 4MKRA 3O4IA 3F46A 3M4ZA 4X8OA 5ALUA 3E23A 3C43A 3NI2A 3ORQA 4RAQA 3LO8A 1GGMA 3BRWD 2I91A 2OGSA 4X6UA 5IX8A 1S2MA 3BJZA 2XKBA 3HRKA 3IS3A 5JSUA 4PS0A 2NQ2C 4HNUA 1CEEA 1MRSA 3WGKA 2DOKA 4PG8A 1DQZA 1U2RA 4K9QA 5L3SA 1XMVA 1QG0A 1CUAA 2ADMA 3K9FC 5K09A 1U04A 3JAWA 4FILA 1A72A 1R0SA 1XROA 1O57A 4FHFA 4PR0A 5A7FA 1Z0KA 1GTZA 2C07A 2WF5A 4DIBA 3NKFA 3I6BA 3WYEA 3HB4X 2PYDA 3EXHA 4D9JA 4NXNB 3TZ6A 4DC0A 3PRYA 3QENA 1C1DA 3CUKA 3LPCA 2FLWA 1H22A 3NIBA 5FPSA 4W5OA 4J2HA 3KU4A 5KOIA 3PWZA 5DWVA 4RQUA 3UV6A 3W06A 3H2IA 1NPDA 1XZNA 4I4NA 5FO0A 5C8YF 3EGVA 4M55A 5EAIA 3P0RA 1L3CA 3F98A 5CVTA 1UBCA 3FCYA 1JU4A 4Y2XA 2P75A 3N0XA 4FHDA 4LGYA 4P4SA 3TPFA 1VPWA 3I2GA 4KE6A 3D7MA 1ZM4A 4UCXA 1X14A 2VF8A 4CR6A 3LV8A 3O7WA 3QA9A 2AC2A 1K4YA 3R23A 1KDOA 4IG9A 2BKLA 3UZUA 2O3UA 4J91A 3PD7A 1IQRA 4CL3A 4EHNA 2WI8A 3ZYZA 3C3KA 5IFKA 3DZFA 4LE1A 4NEGA 2XA1A 5KSWB 3CNQS 1L4BA 4MYTA 1KY4A 4LVUA 1C7ZA 4A8TA 3TRKA 2R97A 1QM5A 4WXEA 4I81A 1VXOA 3D2CA 3HI4A 4FDMA 4Y2UA 1PJQA 5D1NA 3UCFA 5AVSA 5DBFA 1CFZA 2O8VA 1LSUA 2XVZA 2XOKD 1FU8A 4Q3NA 5DO9A 4DYVA 4CQMB 1VI2A 4TT3A 1JFVA 1ZGZA 5T67A 4CKWA 3SZOA 4DG8A 2DULA 2VDLB 1VMDA 5CHEA 4XCXA 1I2AA 3HM9A 4I5DA 5K8JB 3GDHA 2CV2A 2RAVA 4K3UA 5A4JA 3AI7A 4E70A 4GM4A 4A6XA 1X1BA 2X4LA 2I66A 2B3TA 3PZBA 4ZDJA 5BWLA 3ZCTA 3GRUA 1YZLA 3W6PA 1BDIA 2BGLA 2P2YA 3FHCB 3MCWA 4KXYA 3QMVA 4QXMA 4BKQA 3AY3A 3DDWA 4ZC1A 1GZ6A 1KI7A 1MT3A 3LBFA 4AMUA 1EM8B 3NC1C 1P1KA 2Z09A 3QVMA 1YQEA 1D8TA 3SC6A 2ANBA 1YIOA 3MTIA 4QGHA 1RMTA 2OV3A 5F3WB 3DLPX 3CZQA 5K8UA 3FLBA 2FCRA 1N5DA 2EZUA 2XB8A 3CRMA 3H2BA 3L0YA 4FVTA 5HE9A 5JHHB 2XWSA 1COWA 2HU7A 3B1FA 5CX1B 3IV7A 3SVTA 3VJRA 3BS4A 4C03A 4QAQA 1WLYA 2WRZA 4S1TA 1TJNA 2Z5FA 2OVBA 1DAEA 4ERXA 2D2IA 5FNVB 3PC8C 4IHJB 5ECWA 5J63A 2IV7A 4AN4A 4B6EA 5H8WA 4CQLA 4MVJA 2HCJB 3V7YA 4D4LA 1UXKA 2ALJA 3CLVA 3FWNA 4U7DA 3O82A 2YHSA 3GRKA 3BHJA 2FWRA 5ED0A 3WJ2A 3GFSA 2FP3A 4MUKA 2HQSA 2PKEA 5EMJA 5I9IA 3ILXA 2DT5A 4D81A 3WL4A 2Z6UA 4F1JA 2I4MA 4YA6A 3UIEA 1CJVC 2XQVA 2G40A 5HMLA 4CMJA 3RNOA 3QLJA 1A9RA 1U8FO 1B15A 1W93A 2BKUA 1JA0A 2J67A 4LXTA 4UMVA 5FOUA 1MG5A 1UL1X 4HLUC 1T6NA 5GOTA 3NFRA 2HHAA 2WZQA 5FLYA 5KDDA 1CZKA 4HQOA 4HOYA 4EGAA 3DBLA 2V59A 2RAPA 3VR3D 1FXUA 2I0FA 1AUOA 1CNMA 1XDZA 4NYMR 1YIDA 3KPVA 3EFOA 3MOSA 1HEIA 2EYQA 3R5KA 3TAHA 4HB3A 3DHVA 4H7KA 2ZUWA 4MV1A 3NEPX 4V2IA 2B6NA 3W6UA 4C4YA 4NCJA 1YVPA 3DV2A 3BF7A 2EJVA 3G8BA 4EJ2A 2XITA 1SIBE 4AZTA 4C0BA 4OUDB 1X8KA 3I30X 1AHPA 2D00A 2QR2A 3ACCA 1S96A 3HJTA 3U7QB 1FFGA 1SC3A 5REQA 1QR6A 1X3SA 2LWIA 3LY9A 2AKAB 4KYUA 4KXFB 4BQRA 2Z6AA 4LBVA 3LC7O 4OGLA 3CM0A 2EW2A 1SZJG 1NY6A 1P6UA 2GPSA 2OSBA 3AP1A 4Q37A 5DT9A 3USCS 4DF3A 3CF4G 3PJDA 1GSOA 1M7HA 1GL9B 2H59A 3O8QB 4BFUA 5A3QA 1EFRA 4Z1OA 2D74A 4INOA 3RYCA 5CB4B 1CY8A 3FYUB 3PA6A 2CKMA 4RSHA 3RHFA 1Z8HA 2XT0A 1T5BA 1YUBA 5B30A 3HNRA 4LX0A 5EXSA 2Q7DA 2FG7C 4XJSA 4ARZA 4KTVE 1S1MA 1QTQA 2GRAA 1C3EA 1W6RA 1BROA 3A0RB 5DGCA 4BFLA 4ZMRA 1MRNA 3EZNA 4OM8A 1W30A 2J7KA 2BGRA 2X1VA 2ZG6A 3DDUA 3L0SA 5TC4A 4F11A 4AJJA 4KXMA 1Z15A 5IBQA 1OW3B 4BMOB 3OIFA 1XTRA 1WMEA 3WZ2A 4CWAA 2QORA 3AGPA 4FGSA 3LUGA 3ER6A 3T9BA 3QBVA 2BSXA 3BOSA 3D0OA 3DE4X 3FVWA 3IT2A 4FYHA 4OQ4A 3WTCA 4YXWD 1C0KA 2WLSA 2XD4A 1AV6A 3DDOA 3CINA 2NW6A 2FF7A 4DILA 1M8KA 2YMPA 4EF4A 4URXR 5CD9A 1ZITA 3FPKA 3TAXA 2DPGA 2A78A 5J4VA 2GXUA 4RGBA 2B4RO 3K8QA 1KI4A 3FFBA 3MCZA 4KJZA 1M8GA 5JO9A 4C3ZA 2G80A 2RIRA 4DQKA 4O3MA 1N8KA 4F2PA 4XIJA 1X7HA 1CY6A 1GT91 3P0HA 1M1NA 4WEQA 3IQGX 2WWXA 3TUZC 2ORYA 4PNEA 3GDOA 4FBMA 3GEIA 4LCBA 4MAAA 1P2BA 4YDRA 3W3AH 1XDBA 2PUJA 2C1ZA 3FUTA 1DBRA 1RKVA 2FGJA 5JQGF 3CNEA 2DM6A 3ORRA 3SNHA 3WHIA 4EEKA 4PSDA 1TM3E 3DE6X 4QTYA 2IS4A 2C2KA 1WXEA 4HNQA 4U9UA 3LOPA 2AQ8A 4UDYX 2X8JA 2C2BA 2WJPA 5FLXA 4FWTA 3S70A 2YWBA 3HR7A 4OHPA 2ZSIA 4LYDA 1ZY2A 3T06B 1HFWA 1TCAA 2XWPA 2YW2A 2NO0A 2R48A 2VUIB 1EH5A 2G82A 3CLSD 4H0NA 4RM2A 4QDKA 3MC1A 2VNIA 2WJVA 4MVWA 1WU7A 3SEZA 2IZ6A 3HH8A 4CM4B 1F9AA 3K70B 3NHJA 2X1MA 3B8EA 4MV8A 5FPYA 4AJ1A 3U1BA 2AOUA 4RV4A 3OQVA 1YMVA 5T64A 1ETUA 4G0ZA 1PS8A 3N3AC 1PVDA 1J6UA 3OX1A 5BRNA 1SURA 3VHRA 2NXNA 5JLJA 2OO5A 2PUFA 2G7ZA 4AJKA 5C1BA 5AK5A 1ABBA 1V95A 1ZCBA 2XNCA 3WVNA 2YOHA 1TU3A 3QEKA 5AM2A 2ZR9A 5I4KA 3VTKA 2GEVA 3QKIA 4UVGA 1SEVA 1OPXA 1LBIA 3DF7A 3GGCA 3K6KA 4O02B 1PDOA 3R0ZA 4UHBA 5JISA 2XUPA 2CYBA 5DHSA 4RCYA 2UYCA 4EB8A 4N0QA 2WVHA 1XIVA 4JP2A 4CT4B 1PNVA 3M4YA 5IK2D 1JN0A 3LBYA 2HZBA 2GHRA 2N75A 2JGLA 2EQBA 2E55A 1LI4A 2BGUA 2IUFA 4AUEA 1J2UA 4GC9A 2Z08A 5JPCA 1IG0A 2YRXA 3IXMA 5KKAA 5CBPB 4F5EA 1WUHS 1M6YA 1BRTA 4Q9IA 4MVJM 2RGWA 3AF1A 1ZAKA 4EY3A 3PDHA 2VDVE 4QT4A 2GF0A 5JSKA 1KZ4A 2WUGA 2XHZA 3GGGA 2QD5A 3H9EO 3RRYA 5AVYA 1IBMB 3MWDB 5C7IO 2CDRA 4LYEA 3NBZC 4O29A 8LDHA 2X3YA 2ERXA 3CEAA 1U9YA 1SUPA 2C2GA 3DFIA 4KPUA 4QVGA 4TTPA 4LV8B 5K2OA 2PKQP 3BWBA 1L5SA 3R7SA 4IIYA 3KD3A 2UVPB 1QQTA 2QL7A 3QWBA 4L27A 4N3NA 4WACA 4B3RB 5DTRA 1VG0B 3AC0A 2C57A 1ACJA 2YL2A 1BXRB 3GGOA 3QMWA 1LLUA 1CUEA 1PZEA 1UKYA 2A0WA 2J45A 3L0IB 3OTQA 4MGHA 1BU5A 2EF1A 2IYZA 3IP6A 1RYEA 1MVLA 4JP3A 4DDTA 4QPZA 3UT0A 1Q84A 5L4SA 1DAMA 3L8YA 2W8BB 4HDNA 3SN6A 3DFFA 4U7JA 3KTAA 5AKEA 2ANCA 3AUTA 1U7OA 5BSWA 1FRNA 1R5OA 4A0FA 4RZIA 2WA1A 3K5HA 1E3EA 1FQKA 4ZVLA 1H69A 3EXAA 3PVSA 1ZINA 3SYRA 4ZQCB 4EX7A 2O5CA 3EE6A 4F4CA 1L4EA 1Z25A 4E14A 4FOPA 1E0JA 1T2UA 5EMNA 5AHXA 4IIUA 4GH5A 1TAHA 2HLDD 1VSQA 2QGFA 4IPTA 1XCLA 2IPNA 2XTJA 3K9GA 4GLBA 2JHCA 1AK2A 3CRRA 3UJHA 5IMBA 2X15A 4PX9A 2NVUB 5EOVA 1P0QA 1PNOA 3GDWA 4KLCA 3G9ZA 2AOVA 2CJPA 4G0OA 1WMSA 1ZCJA 2Z4RA 3N76A 4E7OA 4TMYA 3INYA 3N2KA 1YQWA 2NYUA 1M6HA 4FYVA 3S2EA 3KKOA 1H8ED 4NBUA 4G0XA 1SUEA 2FFAA 2HDOA 4RV9A 4JLMA 2QR3A 1Z2EA 5DWQA 3ZUGA 3MM4A 4G5XA 2D7JA 3DEYX 3R0XA 3QX3A 5SYNA 5E2BA 1MLDA 3HY4A 4BNNA 1E9SA 4EARA 4NV0A 4PRYA 1G42A 3PUZA 2JFNA 5I48A 3HXOA 4ZOBA 4I55B 3G2QA 2A3RA 3OWHA 4QICA 1T34A 4RIFA 2IXEA 3EXHC 4F3RA 3AEYA 3DV0A 3STHA 4C0QC 5GTDA 2CLCX 4YMUA 3STYA 4PCUA 1KI1A 5CFZA 3FM9A 3RSCA 1Y8CA 3LT1A 1PGNA 1QYRA 2BWJA 1L7BA 2ZXFA 4DCGA 2PXCA 3U3KA 4N76A 5DW3A 3X1ZA 2P6OA 3DT6A 2BFMA 4IOJA 5HIJA 1TLTA 1BFDA 1SKMA 3BE6A 5MN5A 5AKKA 4C30A 3IVCA 4HC4A 2H52A 3GVPA 2FX5A 4A36A 2Q29A 4DQ0A 3HDVA 1G5PA 1AS3A 2WU3A 3HL0A 4Q1FA 1NJ1A 1E3MA 2HWXA 1EDEA 3ZGYA 4K28A 5JDIA 4IR7A 1LVUA 3CXUA 3WB2A 4OEHA 1LW7A 1UMCB 1P8JA 2R6JA 1AS2A 3M6LA 1E60A 1TUIA 3D7RA 4RE5A 4X65B 5ECDA 3AG6A 4UATA 2NNLD 2PS1A 2ZJ4A 1C1DB 3R7NA 1FLVA 5GIOE 2HF2A 3K1AA 1NIJA 3SXPA 4NX2A 1LI5A 1JI0A 4IJ5A 1W4BA 1HL3A 4P38A 3CKKA 1HDRA 4C1BA 3ZHSA 4PPNA 2VJOA 1H2RS 3KAJA 5BQFA 3KR9A 5DVZA 4UXJA 5KNCA 1Y9ZA 2AZTA 3AV0B 3TKYA 2O2HA 4GC5A 1VGQA 2GCNA 4NY1A 2G6BA 4F3CA 3WKEA 1YULA 3NG1A 1DT5A 1HBJA 4L95C 4MB2A 4HGOA 4Q05A 4L02A 1MB3A 5LR6A 5FTNA 4B4KA 4I50B 4RL6A 1GFSA 5GP1A 4OMUA 1FVHA 4KAXA 1MX1A 4AJOA 2AEEA 2FE1A 1QYWA 4CM3A 3SHVA 5C51B 4JA0A 5ALHA 3T54A 2BM8A 3K7EA 3RJMA 4MW5A 3HO8A 1J20A 4DA8A 4G8JA 2VNSA 1UAYA 1ZUD1 4MULA 1YZFA 2Q46A 2IYSA 4TPKA 5LA6A 3WAKA 4IGIA 5IKXA 1RADA 3QPWA 3SFZA 4NPAA 3TLGA 1HKUA 5L53A 2GHQA 3QF4B 3LLCA 4GGOA 2IPLA 4LDPA 1GZ3A 1FVOA 3OZUA 3KUKA 1JSLA 4K5QA 4EUNA 1NDUA 1QHYA 4J1NA 2BGNA 1TM4E 5FBZA 2H9YA 3ZK7A 4CKWB 3M0EA 3UAWA 1OI2A 1ULSA 2C4TA 1TQDA 2F3UA 1FDSA 3ORYA 4FYKA 2I5PO 4KO8A 3STUA 2E18A 3WIVA 4B3JA 2CCKA 3P32A 3GEHA 1Z4PX 1JTEA 1SBZA 2GTIA 3TOVA 3UHAA 4DQXA 3K0HA 1V3VA 3HLKA 4E2FA 4LE0A 1I30A 1B74A 3WK7A 1GJRA 3EA4A 2F9FA 4OJQA 1QV6A 2QYHA 3GNQA 1J90A 1WZIA 2CXQA 5G3ZA 4DCNA 3ZDRA 1QQBA 2QPOA 5IMSA 1KDVA 3EWIA 1U0GA 4PWYA 5IAAA 2FWBA 3QTTA 1QYIA 2BKXA 2FEKA 4BC1A 3K0BA 2JLVA 1K97A 4FCVA 7REQA 3LY5A 1I13A 4IQFA 2GKSA 5ETJA 1ZXBA 3CGWA 2D1SA 4KO2S 3LKVA 2QUHA 3IC5A 3IPYA 1F8FA 1WXGA 3EVDA 3H4IA 4JYPA 3PLNA 3IUBA 3HVUA 1VG8A 3DG9A 4QYTA 1V7PC 4Q9AA 1L5GB 1XF1A 5BWOA 5L9AA 2X76A 5C4MA 1KVUA 4BVLA 1VCIA 1EPUA 3G2LA 4OYLA 4TUYF 1A3CA 4LX8A 2AG0A 4HPJB 5LOVA 2O2EA 2QW0X 4PG6A 4MO9A 4WGFA 1EWVA 2QYOA 3OECA 4HDKA 1SBNE 4ICIA 5A0FA 3TTYA 1KY2A 2CJWA 4FI3C 3GI1A 5ITSA 3QG1A 5K1ZA 1NNLA 2CE7A 1P2SA 4Z7OB 4D3YA 1R2QA 2XCUA 1JILA 5INTA 5I47A 4AQ7A 4YJ3B 3IEPA 3B1JA 4MA5A 4KP7A 3HUFA 3QBTA 2J32A 2J9GA 5KDOA 3DBLB 3N70A 1VDMA 1HUQA 1SUDA 3IIMA 1VSBA 1AU9A 2REBA 5IDQA 1JIXA 4JVNA 3VSDA 4GLOA 5KNBA 5ALGA 3B7GA 4KN9S 2BVNA 3MMPA 4E09A 1SUWA 3EFOB 3L0OA 5GADl 3CN7A 3A2LA 2R8RA 1V4BA 5D7NA 4IDOA 4RANA 1YC2A 4QNNA 1GUYA 1T9GS 3CUVA 2NV6A 4XQ0A 4CF4A 1J2EA 1ANKA 1IM8A 2YJGA 1CS0A 1R6VA 3CV3A 5EKXA 4ZEOA 2O8FA 3UWSA 3V2GA 3UOWA 4NU6A 2ZBGA 2QDXA 3CG0A 2ZSJA 3AOGA 2VHQA 3LS2A 3SQNA 3MGKA 3I32A 4RY9A 5REQB 1V25A 2AG1A 3SQDA 5DSXA 1XPUA 4HQLA 2W5UA 5K6RA 4WKGA 4XEHA 3BXZA 4QOJA 1QLHA 5KX5F 1EXVA 3T3MB 4MUMA 2B2NA 2WFMA 3PQ7A 5IVIA 5FUXA 2DHEA 2FH5B 1NNSA 5E3JA 2Z98A 2PD6A 2FP4B 3FOFC 2HNAA 2R6DA 3L9XA 3O9VA 4ZQHA 1YI1A 2FPMA 3RYCB 5ALIA 2C8LA 4L57A 4INPA 5KTSA 3ZDBA 4ARZB 2SICE 3K3PA 4BATA 4AKGA 1S2IA 2EKZA 4QJ5A 4CKEB 1XV5A 3JV7A 1VL5A 2OV1A 4F71A 1J0BA 1N0WA 1ZD4A 5L7YA 3UHOA 3IL2A 3QXSA 3REGA 3CE9A 4GVPA 4QWMA 3TRIA 3C8ZA 3ROTA 2P2CA 4FKBA 4HRYA 1EFHA 4MV7A 2QZ9A 5CLFA 3RUEA 4B8ZA 2PA3A 4GWGA 5IKEA 3GJTA 2XB2A 1V5EA 2DFDA 1CEXA 2AJTA 1MX5A 5DM4A 4B7UA 3D3WA 3L8CA 1FJGB 1R3UA 1K98A 4PZEA 1C41A 3MPOA 2M9MA 1E2IA 1X1DA 1DCMA 3DVSX 4B32A 1OX4A 2BEUA 2GLXA 1L5HA 1NHWA 1M1NB 1QIKA 3DFMA 3KNZA 5CNIA 1B3RA 1YACA 2ZCUA 2AE1A 1UWVA 1WZUA 2HBYA 5AH0A 5DX1A 2PRJA 3VSBA 5ELMA 1W4LA 2FZEA 4N8DA 5DP2A 3W6OA 5JJCA 2GBPA 3FCUB 1CR4A 3X44A 4QYXA 1ZMXA 3UOAB 3AFOA 1CJBA 3BK1A 5HFJA 1N5JA 3H99A 3DCYA 3DFKA 4TRJA 4DIFA 3MELA 5H70A 1LSOA 2K6GA 2IK8A 4G4SP 4KAFA 4OX9B 3JQPA 5B3JA 2CD9A 3H2YA 2AK2A 1P9NA 4CF7A 4F9TA 1U8ZA 3IJRA 1IU9A 1ZMOA 4AY5A 2CB0A 4EA8A 4EMBA 2QT0A 3RKSA 1WP4A 4G0UA 2VJNA 1R0ZA 3JQBA 5TGDA 4N6OA 3FVQA 1ORHA 2AOUB 1J2TA 5ICCA 3GVIA 3EGWA 3AF5A 4I7EA 1EUYA 2C99A 2MMCA 1ZD1A 3ANMA 3IOYA 2PGLA 5EEHA 4HLDA 2OV4A 5KTNA 3DEKA 4ZI5A 5FTWA 2VPPA 1ORRA 1BXKA 4HB2A 5CT6A 4KACA 1I10A 2PZBA 2Z1NA 1XRSB 4QVKA 3OQJA 1QKKA 2YVQA 5EXPA 3WNBA 1VG9B 4PZAA 3QXCA 5HK9A 3LNCA 1R10A 1F48A 3OCVA 3G1WA 2OR3A 4PZLA 3IQEA 3S1AA 1PR6A 1TI7A 4NVRA 3BRCA 3OZRA 5BW6B 1IL0A 3SP1A 4QYSA 3VNSA 1X9IA 3KUXA 4UFPA 5TEWA 2XUAA 4YX9A 1PWHA 1RWOA 3IHKA 4CV1A 4J94A 1AD2A 3OCXA 4WNIA 3UWDA 4G1FA 1Y1QA 2LTAA 1XPOA 3VR5H 2QNBA 2GJ9A 3CCCA 3AOEC 1KWKA 4JIMA 3JS5A 3BQ9A 4K1LA 5J40A 6GPBA 1T36A 2OFOA 2Y0EA 4GOKA 3FSGD 1SVIA 2TS1A 3V8QA 2GSDA 3TNFA 4OHFA 2B4TO 3WKDA 1G5HA 2QMYA 3F97A 5ICGA 1NSTA 4KPUB 3J7AC 3C3DA 4B8YA 1F0NA 3LQRA 3ROPA 4Q3AA 1DRVA 3TX2A 3V80A 3VR6D 1FBNA 2WG0A 5HF8A 3OE1A 3UW3A 4QGSA 2PUAA 3GH1A 2FAXA 3JPYA 1Y6QA 1FP7A 4Q3CA 4B81A 1FW6A 2QSYA 4GVLA 2H57A 3DOHA 5ANRB 3TLKA 5H3CA 1C9MA 1TKCA 2CXRA 2J0UA 3G9XA 1WDWB 4QFMA 3B52X 4NQZA 1DGQA 4O4IA 1DV1A 4HDNB 2H2AA 3SC2B 4A1FA 5K6TA 3KTAB 1TCCA 3DKPA 4UMEA 4Q6BA 2JAQA 4JOQA 4DW8A 2KS6A 2R7AA 3H2SA 4RVCA 2RHWA 4U4AA 3ZV5A 1VBKA 1ZJJA 2IV3A 4D9BA 1NQWA 4NAHA 2QTFA 2JKZA 4JITA 2R79A 4L0DA 4LK2A 1MT0A 3O1LA 4IV8A 3CO5A 3FDXA 1X9HA 4LNAA 1L7DA 4LQDA 3SHOA 9GPBA 2ACKA 3L6OO 3FH0A 1CY7A 1RC0A 3MS4A 4FFDA 1U3FA 1BHO1 2I8CA 2MSNA 4OSEA 4E2YA 5CFOA 5F7XA 1J2YA 1PF7E 1Y4ZA 3ZHUA 4UBNA 5K0FA 4B3TB 2Z2XA 3PTAA 3ZGNA 1IHOA 1G5TA 1TMGE 4YNBA 1JKXA 4I9FA 2ZM5A 4B6JA 1BVYF 1ZICA 2UKDA 3SLGA 3N58A 1BMTA 3N2KB 1UBEA 1LD3A 3FNRA 3WADA 3TQOA 1TUGA 5CXXA 2GZ1A 5LKAA 2H2FA 4KW7A 1TA4A 3AEUA 1OBVA 3O1JC 1O87A 3U3OA 2A4MA 1T9HA 4RDHA 1XX6A 4TGLA 4W9NC 3AB7A 4RS3A 3QU2A 3HZOA 4GX5A 5JCJA 3RSQA 3GC6A 2P1RA 1YVDA 3R1IA 4XQCA 3RR2A 4TWBA 3O4RA 2IEZA 3AZQA 3OCCA 4JDPA 3QP9A 1CQIA 1U9CA 3OQIA 3TB6A 1DRUA 3DV0B 3LZCA 1XU7A 5T4BA 4GXNA 2AMVA 4G5RA 2Z83A 2PA0A 4UHEA 3P7MA 2PZLA 4LG1A 4G8CA 3H16A 3BFJA 4FFBA 5AVRA 2J07A 3OZIA 2XUOA 4RHTA 4F6LA 1AA9A 1CQZA 1K5HA 3K05A 2AA3A 4NPCA 3SBXA 1Q44A 2WWFA 1FZTA 3KSAC 2PJUA 3EMDA 4HN4B 1QYCA 2O6HA 4ND2A 1M2FA 4CE6A 4LAFA 3TINA 3CX6A 2BH2A 1QP7A 2OB2A 3RVBA 4Z1MD 2CL0X 3MQ2A 1RQNA 4P54A 1B00A 1GCAA 3QVVA 3GAAA 4LY3A 4MB6A 4OHXA 3MERA 2XB6A 2PX2A 2NSDA 3FDIA 5CW1A 4QUIA 3M6FA 2BCJQ 1MH9A 2XSZA 3PQEA 3GPCA 3QU9A 4RVSA 4QULA 3MT0A 4CUZA 3COYA 1JDZA 1L4YA 2WSIA 4HS4A 3OOSA 1W0KA 3HA7A 1V6CA 1MXHA 1Y3AA 4Q16A 5IJAA 2V7EA 1XNHA 5FL3A 5DRYA 2I2DA 3K1AB 4BV8A 4I5IA 1W36B 4WY8A 2JJ1D 4DDVA 2Q4RA 4HEQA 4R2XA 3I9MA 4DCVA 4BLVA 4IWNA 1KFJB 1HNXB 1ZN8A 5D3MA 2F9MA 2VQDA 3FI9A 2I7XA 3PE6A 2QU7A 2NUAB 5K8CA 2DY1A 1A88A 1B6SA 1J9GA 1NBWB 1IN6A 2OSVA 4BO6A 3SXUA 3LCMA 2C4VA 4PXSA 5H9VA 1TF5A 4F6RA 1DC6A 2R8OA 3NXSA 4LDJA 4RPJA 4YJDA 1HFEL 3UWMA 3VPBA 1V6AA 2AI3A 4PAWA 1B3BA 4V1CI 4PYOA 3H2KA 5FR2A 1D2AA 5KOJA 1PHRA 3ZXXA 3NXKA 2WF7A 3W1WA 2A3NA 1XA4A 3DE7X 1XCJA 4JJ7A 4BEVA 4DLRA 4CETA 2XQGA 4G0PA 3GUUA 1Z2NX 4IJKA 1LBEA 4NARA 3UB2A 4Q0MA 3ZOKA 4TM7A 5G0UA 3F6BX 3T3EA 3TLGB 2QTHA 1YOVA 4OQXA 4BJ6A 1UC4B 3ZWMA 3C2QA 3OBIA 1RBQA 1I1NA 3MB8A 4LC0A 4FHZA 1U28A 2X9NA 4MA0A 4UVHA 3VYRB 2CJXA 1A9XB 2IPXA 2P4QA 2Q6TA 4H15A 4E5DA 2PGAA 3NTVA 4DRZA 2FJUA 3H9CA 5EIEA 5TDHA 3E81A 4ZANA 2O8CB 4LE2A 5I7AA 4XQ9A 3ZNNA 1FY2A 5GONA 1XOIA 2PFGA 1Y9EA 2CGEA 3LGXA 1P19A 2TMDA 3F9RA 2WHXA 4JB0A 1WE2A 3AB3A 4YI3A 4Z9AA 3GW8A 3RT1A 2ZJ7A 1S2OA 2W11A 4QPCA 4J1SA 3RVKA 1HNWB 2CEAA 1FB5A 3ADBA 1DG9A 1YCFA 2VF4X 4GMHA 1ZVVA 4OJKA 2E5WA 2JLRA 1LNQA 4RQBA 1B14A 7REQB 2DBVO 5AVJA 1KKLA 3KQVA 4DJJA 4OYRA 5HS4A 4A03A 1T8PA 3Q1LA 4ZQEA 4LTNA 1P0IA 1USUA 4XWKA 3KKPA 3JD2A 1AG9A 4DREA 2X2FA 3M6IA 4F2HA 3R3JA 2FWIA 2OYCA 1B1CA 1M7GA 1W52X 4PYIA 5U4QA 3IT3A 3LBNA 4YN3A 3RS5A 8ABPA 3ACDA 5HCUA 5ER9A 5LOVB 2PUDA 1N2EA 2ZUUA 4DA7A 4AI6A 4IKEA 1FK8A 2XJ4A 4J16A 5EWMA 1M66A 4HDKB 5IUNC 3K0SA 3VJMA 4MW1A 2CJWB 1QK3A 3SX2A 3A1SA 3WLOA 4E13A 1CUCA 1VE3A 1M2OA 4Y2SA 3SZ3A 1V8DA 1FFBA 2JH8A 4WERA 4K9OA 2OCKA 1I1OA 2OQRA 3NQ41 4L5CA 5HF9A 4F97A 2G9RA 1Y8ZA 2BDTA 1C1XA 5FEMA 1EBBA 4FXOA 1TO6A 4NYJR 5DN6D 1B26A 3DMTA 2J46A 2WP0A 1EFTA 3HBLA 5IM5A 4CKCB 4C22A 1UT6A 3AVUA 1L5RA 3SLRA 2DBQA 3VR1A 4FS3A 3ZU6A 5CJPA 2ZCJA 2C7VA 2BDEA 3JVVA 3NDIA 2J0SA 3FRIA 5C8VA 4GBJA 1J4AA 4FINA 1CS0B 3HZRA 2O8FB 1OMOA 2VHEA 4QPPA 1AMUA 3HL4A 3D7SA 1KAQA 3JALB 1N77A 3TI9A 4JVMA 2XZLA 3AVYA 2JZCA 1XAGA 3W90A 2XDWA 4JC4A 4YONB 1NYQA 1Z5ZA 3AILA 4AROA 1BIFA 4KK3A 4RK0A 2H0RA 3A9WA 4L3WA 4AKEA 3OA2A 1AKRA 1NX6A 1ZK2A 3EVZA 1GEGA 1L1RA 1WCYA 4GICA 4JXJA 4ZQIA 3K9WA 1C7RA 2GF9A 3GVHA 3NUGA 4RPCA 3ZY6A 4ZIRA 4RABA 3D43A 2EJWA 1WSDA 3WHPA 2VLBA 2G88A 1AOXA 2Q3MA 2XE7A 2P69A 1N0HA 1GKIA 3GO4A 1D09A 1OX6A 3W1VA 2I9KA 3GA7A 1DOAA 2OMEA 4M9CA 1EUDA 1C1YA 1LTKA 3DC7A 3ELUA 1OIVA 1XMQB 3ZD7A 1VYHA 3GU3A 4QATA 3EDMA 2QQEA 2VH5R 2Z0MA 4KQFA 4MRAA 2M6LA 2BJWA 1ZNZA 4QWWA 5IWAB 5F7OA 1L5LA 5AVTA 3HFJA 4UBIA 1U3DA 2ZJBA 3UV7A 3R0JA 2C78A 4M87A 4Y2QA 4NZZA 2XUIA 1JALA 3VYUB 5JEEA 3IAS1 4OP1A 1A8IA 1XZLA 3TQFA 4NFHA 3NRBA 4TS9A 3HPRA 3FUXA 3C98A 3D3WB 4K9MA 1PJAA 3E7PA 3ZH9B 1G1MA 4YRGA 2HWUA 5F1PA 1SRRA 3HZZA 4H4EA 1NN5A 2GNPA 3ZXUB 4DAEA 1YWGO 1NQXA 1ENZA 1OX4B 3ZS8A 3AVOA 1UP4A 3PEWA 2ZKIA 1R8QA 1RD4A 1L5HB 1H42A 3MGCA 1W581 2QG4A 2SBTA 1AKMA 4PVDA 4MUJA 4XJVA 4JI6B 2IU4A 4F7WA 1X1SA 1YHNA 3T9CA 4EF6A 3QSYA 2HW8A 2FDXA 2HSGA 5EI5A 2GEBA 5H02A 2II6A 4MWBA 3A3YA 2O50A 3ONEA 3CVOA 4IFEA 1QRAA 2ZIWB 2HRZA 3TQTA 3IA2A 2GRUA 3W5AA 4JI7B 2FB9A 3I2YX 4PG5A 1JKIA 2Q6LA 3P2MA 3K2QA 2FSPA 5C46F 4R8MA 2HGSA 1QIMA 3L8MA 3U81A 3VI3B 1PZHA 4O2BA 2JW5A 4TXHA 1JQ5A 4O4HF 3TIXB 1MQAA 1BMQA 5B2EA 3ZHXA 4YHHB 1BZYA 1ECJA 2DU8A 2BFPA 2QXYA 3ORHA 2VA9A 4S0ZA 5JNSA 2PT5A 4FE3A 3FAZA 2WT9A 5JECA 2J4FA 3C3WA 1GRNA 2ID4A 2O19A 5CP8A 2H5IA 4XM1A 1Q5PA 4D8TA 1R0XA 2DH6A 2O3QA 4KR6A 4BLWA 1EVLA 1I51A 3R3XA 2QY6A 3MVEA 2WQ7A 5LMZA 1GT6A 2O5RA 3FCXA 5FOXA 1IJBA 1Z6YA 5JHGB 1YA4A 5EUBA 2NMVA 1VPTA 1R4AA 2AOTA 3BWXA 3UPUA 1NQOA 4WLNA 2EW8A 4WOJA 5A02A 1UOPA 1Z33A 3GZ4A 4H6XA 4Q4LA 5FTJA 4US2R 4GP9A 1F0PA 3AVTA 3E5NA 4FMDB 2Z8ZA 5IU6A 4Z5XA 2ZWPA 4OLFA 1R66A 2VDQB 2QE6A 2VJKA 5F1OA 1N6RA 3D2LA 1XHLA 5KNDD 3VTFA 3S1AB 1F8GA 2FPXA 3SYKA 2OE2A 2Z2JA 4LNHA 2ZS9A 2JIDA 5CH3A 1TYAE 5JNUA 4TRRA 3HKCA 3VHXA 4EFMA 1RRVA 3QH4A 2FQXA 4MUFA 1CRZA 1L5YA 1JG4A 1T8UA 1N5IA 2R4TA 5BURA 2R62A 4CMIA 3L7YA 3PNBA 1Y5MA 2P9QA 2PQ2A 2IHNA 3MINB 4XDGA 2E9SA 2JASA 2UZIR 3MA0A 2BMFA 2QRHA 4Q34A 2H3HA 1U94A 1T36B 1G38A 1KFBB 4UQLA 4QRIA 3ZK8A 3O03A 3H0KA 1KVSA 3FLMA 3I4CA 4HNHA 5TGTA 3IOCA 2NSHA 1YL6A 3EY9A 3IUSA 4E1BA 1EP1B 4O8CA 5C2JB 1T5IA 2JJQA 1NSYA 2RG7A 4KUGA 1L7QA 2VOJA 5AO9A 1ZA1A 1MRZA 3Q3IA 1AA6A 2SNIE 3EA0A 5KSYA 1LV7A 4YB8A 5E3IA 3F2IA 3STWA 1V3TA 2WD8A 3F4LA 4YUWA 4PPGA 4L3VA 5BUCA 4G1UC 3MT8A 4KAAA 4KRXA 4O4IB 3OQBA 1VL8A 4IS3A 5KJFA 4L78A 3STXA 2X8AA 4AKHA 2WLTA 3MTJA 2BGGA 3WMWA 1Q6ZA 2V5AA 4M9SA 2WJIA 3JSAA 4OHBA 5AW1A 4NMLA 2I6QA 4IF4A 3ZVRA 2EERA 1NYRA 4TT8A 5EP3A 2HRCA 4EJSA 5KTMA 3I5YA 2PD4A 3OH8A 3HYTA 1FQJA 4RS4A 2VRBA 4YRIA 3LRTA 3KOXA 1CNFA 1DLIA 4E5MA 4ZAFA 1I7LA 3SG0A 5G0WA 4FYPA 1EB9A 4HRAA 3ONVA 3RYFA 4ZYXA 3UK0A 5AVUA 3GYGA 3AKZA 1NT4A 4RKEA 1QO9A 1XJCA 4BMSA 3ZX5A 3HGTA 3R7DA 5CBKA 1XDSA 1Y4SA 1ZVJA 1YBFA 2COUA 4JLNA 4JUAA 1HDXA 3T7EA 5CFMA 4BZWA 5NLLA 2GEFA 4MVJE 2IC5A 1QVAA 2C8KA 3I04A 4WZAA 1IN7A 2V4UA 3H6GA 1XAIA 3WRYA 4BO8A 4X24A 4RCVA 3KLNA 1MB9A 4Q4AA 4D43A 4LJ8A 2PVPA 4I4IA 1ODJA 3MUFA 1ND6A 1LB1B 4QRHA 3ESZA 4FZ5A 4IUYA 3TX6A 3PRKE 3SJUA 3O38A 3U3ZA 1RAEA 3CIOA 3H42B 4RD3A 1G7CA 3T7SA 2ZK7A 5B6JA 1TGVA 4L08A 3EF0A 4M0LA 1UFOA 3M1AA 4G84A 3D1VA 1V39A 2FRVA 2F43B 1CQIB 3UXEA 2WC1A 3QWIA 2RJ3A 5C81A 4JI2B 3DZBA 5LB4A 4TYYA 1K3FA 1UJ6A 3GPLA 3KQUA 2X0NA 3MTDA 3SOPA 4RZXA 3O73A 4RD1A 3NHUA 2HYDA 2Q2WA 5FOWA 3OMXA 3U16A 4MAMA 1XE3A 1POXA 3AWDA 4FFBB 5AJUA 1N6NA 2G08A 1KQNA 2Q2NA 3SBOA 3W5SA 1OVMA 1YCHA 2XX3A 3PKJA 1FIUA 1BJTA 4NDZA 2E85A 5CJJA 3AJEA 4IJMA 3KETA 2PLWA 3JQ8A 3CZRA 3LPDA 4Q1DA 4G37A 1XQ6A 1ZK1A 2DPXA 1IMOA 3HDHA 3S55A 1ADYA 2OWEA 2QE7A 3NAMA 4F06A 1ZBDA 4CF6A 1DPGA 1KNXA 4IJ6A 2YDYA 1Q0ZA 3G9QA 3L46A 1EQ2A 3MW8A 5I3ZA 4RZUA 1CUBA 1DRJA 3ZI0A 4IBOA 1KJZA 2KHZA 4EFKA 2A9FA 2CD7A 3Q87B 3S2GA 4EY6A 4ZYYA 1PFWA 1LW6E 1T9CA 1TM7E 2VTDA 5BW8A 2BYTA 4ZU6X 2XUFA 3ZWWA 2YRFA 4MGIR 2B83A 1U28C 3R0QA 4L5BA 3SOZA 1GQRA 1JHPA 5D3MB 2Q8QA 1W2GA 3O1HB 1KBOA 1G21A 2BJHA 3BFPA 2WSMA 3ZCSA 5LUAA 4BB5A 3HWX1 1FVFA 2I22A 3GRAA 4WLEA 3SXUB 3WISA 3H8VA 1PQPA 4W5WA 5K4HA 2QK4A 2V1UA 1E2QA 4DAOA 4FD2A 1GKKA 4QQNA 1ZN7A 1A95A 3BCUA 3KT0A 3ZJYA 1YBVA 3ZY5A 5LZ9A 2QX9A 2MINA 3FTEA 4F4IA 1G3QA 3GRRA 3AONB 5KOJB 4F6CA 3G89A 3TCKA 2MTBA 1RDFA 2GN2A 4CCSA 1A8SA 2KE5A 1T3LA 3BIOA 4FPXA 5AXDA 4Q15A 3A8TA 3OESA 4KQ2A 1YOVB 5JD4A 1P4AA 4UEQA 1PG2A 1R0LA 4G5OA 3FUCA 4HDRA 4HQRA 5K0SA 2ZWMA 3ZQ4A 3ME5A 4K2AA 1X80A 3QEAZ 3PGMA 4BO1A 1TB4A 4EA9A 3DVLA 4DN6A 2ATEA 5KIAA 2FN4A 3EGXA 2IOFK 3FY4A 1VZ3A 3GLQA 3KQOA 5F9HA 3FJYA 3A2KA 3V8MA 4ENRA 3JASB 4BGIA 1KJJA 3HCRA 4A6EA 5BSUA 2HF7A 5GONB 5G2OA 3PD1A 1E1NA 5ALQA 1ZR4A 3K6RA 2Z2KA 4WJKB 4BZZA 1GAEO 1U1IA 3H5TA 1Y3HA 3NS7A 4J16C 4LPSA 2OCDA 1R50A 4PIPA 4DV6B 2BTQB 4PC3A 1KXZA 2H51A 2DECA 2CB9A 4IOMA 2IPMA 2COEA 3IIJA 1GAJA 1W96A 1Y5IA 3HSSA 1EFDN 3AG5A 3CZCA 5HGJA 3BTOA 2OENG 4B45A 1Z2AA 2FEWB 4HNTA 4PGFA 3U3DA 1C3XA 2OG2A 3C85A 3CLRD 3PRHA 4V38A 4B48A 4K9DA 4EB0A 3EMBA 1XMXA 2PBLA 3AKEA 3H6HA 3DMTC 4I2NA 5DGXA 1SHKA 1T8WA 1OREA 1IK4A 2PLRA 5GM2A 5HKLA 3AUYA 5I01A 4XH9B 4MAFA 4L8WB 1FS6A 1Q0QA 4IQ4A 5ED4A 2IYQA 3PR2B 4S2UA 2I7CA 1PGPA 2AMLA 2X0IA 1AUQA 4CFZA 1QGED 4P58A 1TTQB 3AR5A 1CUSA 1WKBA 3KTFA 3PSAA 4LIPD 4MW4A 3FGNA 4XR9A 4V0QA 3PUVA 4JB3A 5K45A 3ADCA 4FTWA 1GU1A 3UAXA 3BGWA 4CG0A 5EWMB 3E2PA 2B82A 4IXNA 4IIFA 4A6DA 1EQUA 1XXHA 4JCOA 4JOSA 3AVPA 3WYCA 2R7KA 3EVGA 5KVSA 1KQ3A 4DUZB 2XZPA 1A27A 1M2OB 3HGMA 3I76A 4NMXB 2XADA 9MHTA 4C2TA 2JZOA 4CQMD 1N7GA 3KYDA 1DZIA 4LY9A 4DARA 1EK5A 2NZYA 1QOPB 2ID9A 4YY3B 2V0CA 2G8LA 3INGA 2HT6A 4C0LA 1U2DC 4B3IA 3I04M 2PZAA 2ZYUX 1IBSA 3DBHA 5JXWA 1G9XA 2HO5A 4FQ8A 3VKHA 4GBED 4C6SA 3PFCA 2QNIA 4B3MB 2AR7A 1E3LA 3ER8A 4WEOA 1U5BA 3ZGLA 2JLAA 3KDSE 2V9ZA 3M5PA 1NF3A 1Q50A 5GPBA 4AG6A 4CKYA 3IHTA 3ZD9A 1GSAA 2IY9A 5HCNA 1M2WA 3OE4A 4COOA 3V9AA 1PD0A 1QHEA 3U3MA 3ZWCA 1S3FA 2BHRA 3OLCX 4D4HA 1JDNA 1RHQA 1M10A 4D46A 5C1OA 2AFHA 2CZGA 4EI9A 1I0LA 1G4HA 1BS1A 1Z4QA 5D00A 3IVXA 3B3JA 4A10A 4EI8A 4ER0A 2PIDA 3FCOA 3TZEA 2F1KA 2Y2UA 5JANA 1NU8A 1K7EB 1W48A 3HVJA 4RQTA 5AKXA 5ARDA 4KQMA 4FDVA 3EZ2A 4ARAA 5HRUA 1J49A 4BP1A 1P2GA 5K0ZA 2XXBA 3NOXA 4DIMA 1EUDB 1ODTC 4M1TA 3UB4A 3ZWDA 5G41A 3L82B 1KSGA 3V1LA 3ES9A 5BWMA 1GRCA 3GCWA 3PEVA 4IXMA 4JX9A 1P8AA 4OMDA 5AI0A 4DMLA 2WPDD 1MD9A 1XZAA 3UC5A 3KYCA 1KEEA 3DB2A 3I5AA 4KODA 4TMVA 4C21A 4ARIA 4QXRA 3R74A 2YUIA 3CSDA 3AEXA 2M1XA 2XUQA 3FZGA 3CNBA 3WDKA 3ZHRA 4M1KA 3DYVA 4ILKA 4Y6OA 2C4MA 1U2PA 2LNDA 2PVCA 1T0UA 1JDJA 2ZYVX 2H4FA 1DAGA 4FONA 2EP5A 4GPZA 4WK0B 5EVJA 4ZO7A 1E0DA 2DBZA 2WM9B 4MDFA 3O4VA 2JLBA 2W2NA 1K4MA 2PS0A 5HJEA 4JGBA 4JJAA 1H6BA 1RI5A 4BVJA 4DR2B 3D2BA 3U17A 1PEYA 1DEHA 2HV9A 4DWJA 3HN2A 2AV6A 4MS1A 1HA3A 3QXGA 4QUEA 1V9CA 3C6ZA 1PWEA 4UBOA 2J3MA 1R5JA 4Q21A 4EKYA 1QF7A 4MJXA 3EYWA 3G0OA 5LLSA 4HKTA 2Z43A 3M2TA 4JJKA 1QOQB 3ND6A 4KVZA 1SXPA 3Q9UA 4IEFB 5D5HA 2H11A 3LUCA 3MYRA 2X9LA 4R2HA 4Z7NB 5ICMA 2AJ8A 3GRFA 4ZI3A 4U6QA 1NRWA 2M6KA 4I46A 1NV9A 1E6UA 2HBRA 4ATNA 3TF5A 4QU0A 2XUHA 4MVJI 1E58A 4O2RA 1B8VA 2MSKA 3AZPA 3IODA 4BE4A 1MQ8B 4MUIA 3HBJA 5FL7D 5HBGA 1SUSA 3W7VA 4JODA 3GDFA 3Q85A 5DM1A 1TD9A 1Y3BE 3QWAA 1NQAO 3W77A 2J5XA 4UTOA 1TVCA 2EWMA 1C3JA 1W49A 5AYVA 2VR1A 4B3BA 3JZMA 1RWBA 5AUOB 1BA2A 1FS5A 4GUDA 3BFXA 4JKYA 4Z3OA 3KDAA 4UFNA 3SQOA 1D4OA 5ARCA 1COZA 1CB0A 1ZGJA 1RWQA 3ECAA 3KEQA 3QE4A 4MLCA 1C7EA 5B7NA 4ZRMA 3NAGA 3E7XA 1CUWA 5JATA 1JNXX 1Z6XA 2GVZC 4RY8A 1U02A 3LC0A 3RGGA 6ADHA 2EKBA 2B7CA 3EAFA 1QAOA 3TUIC 3W5JA 3LT2A 1X13A 2RHMA 3BCSA 2GTPA 4AJ9A 5EJ6A 1U1DA 5EJ8A 2UYQA 3EEQA 2YUTA 1XZMA 3K20A 3JSXA 1A2OA 3O8RA 4YXFA 1OAAA 3GLTA 1CUHA 1E8MA 3HKCB 3I6IA 5EZYB 3ESBA 3PL1A 4BRUA 4HFJA 3DXYA 1ILEA 5FUYA 3UAGA 1KZ6A 4YCCA 4DWOA 2YOFA 5HBRA 1ZGHA 2A8YA 4E15A 1E0AA 2ZXEA 4CMIB 1XZ8A 3KELA 3OLWA 3U44B 3FHOA 4RK6A 1IEQA 1O95A 4NOLA 3WBKA 2PUBA 4O2AF 3LI2A 3TZKA 1E92A 2OMKA 3EXEA 1DKUA 1QE3A 4FGUA 2VDWA 1IN5A 1OZGA 1UH5A 3DWIA 4DADA 2XRZA 1IM5A 4RESA 3U1TA 4BVAA 1JHXA 3DMGA 4JEHA 1KO7A 3OICA 4EYSA 5CUQA 2NZ2A 4KRFA 3HACA 5FWXA 2XQFA 3OEHA 3ZIAA 2LXNA 5B1YA 3M49A 5B3LA 4QM6A 2BCGY 4WXPA 4U2KA 3OX2A 1YQUA 1ZD8A 3DEZA 3JQDA 4ZEVA 5FLEX 5BV8A 2VQ3A 1HT3A 2Z4TA 3OFVA 4A3SA 3K15A 4YRZA 1CF2O 3NOVA 3BK2A 2IYOA 2GBLC 1KMQA 3ADKA 4DEXA 4UZEA 5E1OA 4K9PA 3A9VA 3DAFA 5EUMA 1CUUA 1FP4B 2Q3DA 1N4AA 4A2CA 4RJ2A 1JFFA 4RTLA 1XO1A 4MCIA 3PC4A 4EA7A 3HYNA 2EJUA 4Z54A 5JZBA 3MD0A 4D6XA 1WA5A 2QN8A 1BHQ1 3GYBA 3K4QA 4KL8S 4EJSB 1JDBC 4WBNF 2XQKA 1T3HA 1J70A 2VWPA 3LC2O 4JGGA 5ULLA 3WHKA 1UBOS 4DMFA 4AJEA 5K9ZA 3AP3A 3PICA 4RFSA 5LBIA 1RBZA 3CRQA 3ZV6A 2BE7A 3MMXA 1I4EB 3K0CA 2I4OA 3RYFB 3BREA 4J3NA 4OSPA 3PDCA 1U99A 2ISCA 2ZAMA 3E6AA 3X1KA 4GKKB 4CIYA 5CLLA 4MPPA 2IYPA 3NONA 1NN1A 1U2GC 3K0EA 1XAHA 1QFZA 5FO1A 3DNFA 2EATA 2G71A 3ECSA 3NYRA 1Y42X 1EAYA 4WZAB 4CEJA 4R8VA 1NZFA 5CH8A 3G2HA 1U4NA 1S2LA 3BXEA 4JD5A 2VXBA 1P7ZA 3V8NA 5KOHA 5JNRA 4Q4AB 5HZGA 3HXMA 4EHHA 4HL6A 2UVQA 2GEDA 3EWSA 3CUSA 1RXVA 1GCOA 2Q5CA 2H00A 2P9HA 1QKIA 3NR2A 1XHFA 1IMJA 5K51A 1YVEI 3GCGA 1EX9A 3ZE9A 1RYHA 4ZXFA 3MILA 1F14A 1XRLA 1C80A 4ETWA 2Q9CA 1EJBA 1KP9A 4XUGB 5JJBA 5EIAA 5IDWA 2BP7A 3GIWA 5F78A 4BIMA 4EY5A 1TK3A 2MR6A 1Z0DA 3QVSA 3BMCA 3QLTA 2FR0A 3LDUA 5JH7F 2V6MA 4KMMA 4XVRA 3TBFA 5KOYA 3QYPA 1G2PA 3HMKA 4NZNA 1QGZA 1ECPA 5HNKA 5KAMA 2DUJA 3NAZA 5BPHA 4PINA 4PHGA 5TPWA 1TVKA 2C9MA 3NTRA 4OU5A 2WSSA 1V5GA 4GWLA 5C80A 3WAJA 1ESZA 1EE2A 3WRXA 3ASYA 4TMWA 4QDJA 2E4ZA 2WAAA 1ZC3A 3F4KA 5BUQA 3JQ8B 4KAJA 4P5DA 1E8NA 4GP7A 5C8YA 4DVGA 1ODKA 4YWJA 2NZXA 2OFPA 3E3MA 1QDLB 2GZDA 1U7DA 3OA0A 4P86A 5EN4A 1Q74A 2ZB8A 2E4UA 1QZUA 2OZVA 1SBCA 1UKEA 5TVKA 4C0SA 4MGEA 3FPHA 3U5ZB 4PBTA 4U8HA 2W6JD 4K88A 4BMZA 1G7SA 4GPAA 1VYVA 3MXOA 5E4TA 1WUJS 4OP2A 4WY5A 2PV0A 5CYGA 3S2IA 2D2VA 5P8WA 1P4GA 4NU8X 1Q1GA 2FDRA 3UK7A 1ZFNA 2P2ZA 1II8B 1RIIA 1Z08A 4O1HA 4R5MA 4XWYA 5ADUS 1OY1A 4PSKA 4BJ1A 2IZ5A 2Z9BA 3D81A 2W22A 3DOFA 3ETHA 3JTEA 4HX5A 4HNSA 3GLFA 4DV1B 4C3OB 3J7TA 4B47A 1G21B 5DOZA 4I8IA 2IEGA 2VXYA 1TQHA 2BFNA 3KOYA 2X22A 3MG9A 4B6OA