4D9BA

Pyridoxamine 5' phosphate (pmp) bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with d-cycloserine
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
328
structure length
328
Chain Sequence
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVADALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQIEMCDALTDPDAQLQTLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQCEEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHLWDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPVYTGKAMAGLIDGISQKRFNDDGPILFIHTGGAPALFAYHPHV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-cysteine desulfhydrase
publication title Structural and Mutational Studies on Substrate Specificity and Catalysis of Salmonella typhimurium D-Cysteine Desulfhydrase.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 124
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature ec 4.4.1.15: D-cysteine desulfhydrase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9bA01
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9bA02
3AEXA 3SPXA 3VBEA 1A5AB 3HMKA 3AEYA 1O58A 2BHTA 2Q3DA 4NEGA 1V7CA 4LMAA 5D85A 4QYSA 1A50B 1FUYB 1P5JA 5B53A 4NU8X 3PC2A 2V03A 4D9IA 5CVCA 1E5XA 1PWHA 3L6CA 4ZU6X 3DWGA 5JISA 4D9BA 4D9FA 1TYZA 1TJPB 1CX9B 1WBJB 2CLMB 3L6RA 1CW2B 1BKSB 1TZJA 1TTPB 2ECQA 3CEPB 3IQHX 2J9ZB 1OASA 2J9XB 1QOPB 5I6DA 5IXJA 4XUGB 1F2DA 2O2EA 2RKBA 4COOA 1K3UB 1KFJB 2TRSB 1C9DB 2ECOA 1V71A 2EGUA 4AECA 2ZSJA 3BM5A 4D9KA 2CLFB 1K8XB 3R0XA 5B1HA 2DH6A 1X1QA 1WTCA 4WX2B 5EY5B 5BW6B 1C29B 1K8YB 2GN0A 4HO1X 2EFYA 4L0DA 5D87A 3VC3A 2Q3BA 1K7XB 5B36A 4ZU1X 4JBLA 4D9EA 2TYSB 1TDJA 3R0ZA 2CLEB 3FCAA 5I7RA 2TSYB 2CLKB 2RHGB 5DW3A 1BEUB 1Z7WA 5E0KB 2BHSA 2JC3A 5J5VA 1J0AA 1VB3A 5C3UA 3X43A 5JJCA 1KFBB 2J9YB 4PCUA 4D8UA 5B1IA 1QOQB 2C2BA 1K8ZB 4OFXA 5I7WA 5HBGA 5B55A 4KKXB 1J0DA 3RR2A 5KZMB 1Z7YA 2ZPUA 4D97A 4D9CA 4D9MA 1A5BB 2ZR8A 3PC4A 2CLIB 4AIRA 1FCJA 3T4PA 4D99A 1TTQB 4L27A 3X44A 1KFEB 2DH5A 2ISQA 4JBNA 1UIMA 3IAUA 1A5SB 1J0CA 3L6BA 5CGQB 1TZKA 5KINB 4D9GA 1J0BA 5I7OA 1Y7LA 3DWIA 5DVZA 4LMBA 1WKVA 4H27A 3SS7X 4L28A 1J0EA 2D1FA 2GN1A 4D8WA 4HN4B 4Y6GB 2GN2A 5DW0A 3ZEIA 1D6SA 4D9NA 1KFKB 2RH9B 4IL5A 1M54A 1PWEA 5IWCA 1UBSB 4HPXB 5I7HA 1KL7A 2PQMA 3VSDA 4L3VA 1KFCB 5T6MA 5DBEX 4HPJB 1K7EB 4D92A 1UINA 5B3AA 2C2GA 3IQIX 5D86A 3FGPA 5D84A 3DKIA 3TBHA 3IQGX 2CLLB 2WSYB 5DBHX 1WDWB 4LI3X 4ZQCB 4D96A 3PC3A 2O2JA 4OREX 1VE1A 1VE5A 2Q3CA 3V7NA 4D8TA 1V8ZA 4HT3B 1TZ2A 3PR2B 3SS9X 1C8VB 3VSCA 5J43A 1JBQA 3VSAA 2CLHB 1TZMA 1RQXA 5I7AA 5IW8A 1K7FB 2CLOB 4I1YA 4F4FA
chains in the Genus database with same CATH superfamily
3CB4A 2P3SA 1P75A 4JUIA 4MQFA 3FJYA 3K32A 3NJ8A 3B5JA 4BJ1A 4DT1A 2X9GA 2NAFA 2FUG6 4E5PA 1U3FA 3NVDA 2KQUA 4MK4A 5EWLA 3IPAA 3JQCA 1AS3A 1XMOB 3U09A 4ZI5A 4YUAA 2YXBA 3MG9A 1Z5NA 4QRHA 4RADA 3RRJA 3G1TA 4RQTA 2ONJA 3UICA 3T5CA 1HTWA 2R1VA 3L79A 1FC0A 1AKYA 1DELA 1WB6A 4Q4AB 2IEDA 4KR0A 4TYPA 4ZD6A 4BFUA 2XEXA 1QG0A 1EVZA 2H54A 4V3BA 5AJXA 2J9XB 4JJ7A 4B1FA 3KWLA 1GTG1 1R9NA 3NRJA 3ZU3A 5I7SA 1FDTA 1XKLA 3EGDA 2QW1A 4B47A 4RVUA 2A5DA 4Y9UA 2EX0A 4QBGB 1HQDA 2CXXA 2VS1A 1T2CA 2PO7A 4J0EA 4AJ2A 3ER6A 3K6RA 1ZD3A 2D0PB 3S5UA 3T7CA 4OPMA 1NI4B 4DDTA 1L8AA 1J25A 3I9JA 4Y2TA 3A0RB 2O2SA 2NIPA 3TPZA 4Z1OA 5M7EA 2O7RA 4LXIA 2O5VA 3P27A 4FDAA 5KYYA 1RXIA 4I50A 4IWNA 2ADFA 1IPFA 2V5AA 3U7EB 3GYBA 3OEEA 3FMFA 5ERGB 5ARDA 5FFFA 1P1JA 3AFIA 4MQEB 1A7KA 5SYNA 4LFCB 1GUZA 4YDRA 4A91A 3EOAI 2RIRA 3GNSA 2Q62A 3H19A 2X77A 4IH9A 4ENWA 3QNUA 1EVLA 1N34B 1SMKA 1KMCA 1K86A 4Z1MA 5AW7A 4PO3X 5FX2A 1ODJA 1BVRA 4TMWA 4EY4A 5A5FA 221PA 1F48A 1K8ZB 2PFSA 2QSZA 3KXLA 4RFVA 1Q19A 5DCUA 5EHNA 2X1VA 4ZAZA 2R68A 2WF8A 3CKKA 4X1IA 5C1PA 3AUKA 3OQVA 1ZHOA 1SU7A 1J8DA 4XI9A 4B4WA 5JRDS 1Y9DA 3NV7A 5D1NA 4F93B 1XEFA 4KQ2A 1W0KD 4UTVA 5I9LA 1N7IA 4WY2A 1Y8AA 1ZGAA 2DPYA 2NACA 1XVVA 3FA2A 4B44A 4HADA 1I3OA 1NU6A 4G23A 4ARAA 3L7IA 4YC7A 2CVFA 1M8JA 1EVKA 1L7RA 3HE3A 1N8KA 4W5QA 4DM3A 1YDFA 3LO5A 4YCNA 1G20A 3AHGA 1IBSA 4GNKA 4IS3A 3QX8A 3FHTA 3P96A 4XCVA 3WQSB 2W0MA 3DULA 3N8HA 1T8WA 1Y8QB 1YZ3A 2Y1OA 2ZYSA 2WE7A 1GPWB 2VTVA 3BQNB 3ZHXA 3PGMA 4B80A 2H00A 3O95A 5EZYB 5L8VA 3NTOA 2Q3JA 1VIVA 5GM2A 3H86A 1NRWA 2PIDA 4X6YA 4YV7A 4ZVUA 1GJRA 1UINA 2K7FA 1PFQA 4PFQA 4JQOA 4W1QA 4JGIA 2YZMA 3EA0A 2J46A 3LNCA 2BJHA 3O7MA 4ZQCB 5TRTA 2JFVA 1WPGA 2RCNA 4B6FA 1HLGA 3E58A 1RI2A 4IV8A 2GNOA 2ZUSA 4WJZA 2WNHA 5DNEA 5TQJA 3N53A 4KOAA 3SS9X 1K75A 4K3VA 2RIPA 2OAQ1 1U0NA 2W7TA 4UJ3A 4ILEA 1NW3A 1RIFA 2GF9A 4TLAA 2I4MA 3RTEA 4Q9JA 1KC3A 2JS7A 1ZGZA 2RAUA 5IXSA 2J87A 3M6IA 2QE6A 4WMLA 1HOXA 4Z9YA 3KB6A 1XHFA 2WKWA 2XDAA 3BGWA 3CWCA 3PYMA 4JKYA 1XZ8A 2ZDHA 3VC7A 1W19A 3PNYA 2G82A 1XJ5A 3K1AA 1VL8A 1H2FA 1ZNZA 1ZJ6A 3GEIA 3OPXA 4H77A 3WHKA 2WM3A 4MQLA 4RTMA 3IDSA 4Z54A 2NYRA 1GYQA 3HL4A 2I7DA 4JBXA 4RSMA 2AXQA 4PLYA 4RV5A 3EVTA 3ILHA 4JMLA 5AKGA 1IJFA 1M2VA 1CR0A 1KO5A 2VG8A 3WDMA 3UAZA 3AIIA 3AHDA 1U9YA 1GLNA 4P31A 4B3BA 1QLJA 1Z7EA 3JWGA 3LA6A 2OV4A 3A25A 1SH7A 3WTCA 3UHAA 1BEZA 3KTAB 5FQOA 4TTPA 2CVOA 4EJ2A 2RGRA 2IYRA 3QOWA 1H6CA 2QT0A 1OFUA 1QANA 3H97A 3VPSA 3UQZA 2FOIA 5E3HA 3LC7O 1JEQA 2C5EA 3RTBA 1LFAA 1JH8A 2LDBA 2NO5A 4GF5A 1AQNA 3L7CA 2OZLB 1KZ4A 4HZUA 3M5DA 4O4JA 3OT1A 3C3YA 4MI6A 1IEQA 1RMYA 5AK0A 4EB6B 3TNJA 2Z9DA 3KTOA 4J1TA 1J6UA 1RAGA 1QGOA 3QOYA 4KUHA 3A3KA 3K70B 1T9HA 2FETA 4H1TA 2CNDA 3ZD6A 1B15A 4YT4A 1AUPA 4WUVA 1Q0RA 4OXKA 4QDZA 4O2AF 4FT4A 3S7TA 4PPYA 2H2DA 4C0WA 3OQNA 2HYIC 2B5WA 1EWKA 4QICA 3R6TA 2VP6A 1KDVA 1Y89A 3HU3A 1Z33A 3M6XA 1C9KA 3PQ7A 4QGFA 4WVFA 4C4ZA 4D0GA 1ZK0A 2EKQA 521PA 3GFBA 2DUMA 3ANLA 5CDFE 2Q3LA 2MCFA 4JWKA 4Q7KA 3QELA 1W2GA 2HR1A 5BUSA 3X44A 4UUNA 2G28A 4RAOA 1UOOA 1UBKS 2SCUB 2ZWMA 3SIPA 3TMKA 5F1OA 3N70A 3CUYA 4EJMA 5CHEA 3U81A 3FTQA 4NR0A 3QKSB 2WTMA 1DBQA 1I6LA 3V7WA 2QTRA 5I47A 4I1VA 1KRHA 4PLCA 1XMXA 2PMWB 3I2YX 4I3HA 2RH8A 4HDRB 5MFZA 2Z95A 2XZOA 3LDGA 3EXIB 4IPTA 2IDKA 1CZRA 2V59A 1CE8A 3R0QA 4OBBA 2ZTHA 5I7HA 2O0KA 4HEQA 3NTRA 2EU8A 1LFDB 2RC5A 4TSKA 1E18A 1RHJA 1L8QA 2RK4A 2NZVG 3J81k 3C43A 4MWSA 3DQZA 1L7AA 3DMPA 5CCEA 3H2ZA 4ZI2A 2AE1A 4CDRA 2X9VA 3EG5A 2OV2A 4P4GA 1EKXA 3CO5A 4LRUA 4C1NA 3GXOA 1XL0A 1YGPA 4YJKA 1BA2A 1M8FA 2Q6OA 1C7FA 3OLCX 2AD5A 3DEIA 4DLTA 1VXOA 4M9CA 2GCOA 5BT8A 1GY8A 4IM7A 4DJJA 2HJVA 3L8HA 1DIAA 2BV3A 4PBTA 3S8EA 1P1FA 4CZ2A 2CXSA 4FOOA 5BVHB 4GP7A 1GR1A 4WACA 1I2ZA 4JD5A 3JX9A 4F8EA 3GLIA 4RPGA 7AT1A 2FN4A 2HGSA 1Q0QA 1S2GA 2PSDA 1W88A 1Y9EA 3R7LA 4Z0HO 1USUA 2Q0HA 2O0LA 2H11A 1NN1A 3A11A 2P6UA 4DPKA 1A4XA 3ONVA 2ISSD 4KFRA 5ALTA 2PQ0A 5CW2A 1Q14A 1S7GA 1V2HE 3NBYC 3O8DA 4KQFA 4MVJH 4UEWA 1C30A 5E7QA 4F04A 1DG9A 2JHAA 3AILA 4K3UA 4UHDA 4RPIA 3FWPA 1L2TA 4CMJA 4WFJA 1Q22A 1ZU4A 2DWCA 3IB3A 2WHQA 1RKBA 1ORDA 2REBA 1NMXA 2JIZA 1OXXK 4C7MA 2DC1A 1VGRA 4AJ4A 2D62A 3MWKA 5TGZA 2O3JA 4GKVA 2D7DA 4YMHA 2NN3C 2APJA 3ESXA 3WKBA 3A1WA 5KNCD 2QD1A 4OY3A 3O3OB 3BGVA 3F6PA 1Q1AA 4QPPA 5FP0A 5BOSB 1W30A 4QBIA 3RIGA 3VZSA 4D4KA 4PZEA 1X7GA 4Q47A 4DUPA 1JI3A 3GRZA 4U6SA 2NUAB 2RI0A 1EGAA 2HH9A 2XADA 2PKXA 2KLBA 2UYHA 1K8QA 3SBDA 1GPBA 4XYGA 1A8IA 4MWCA 1UM9A 1SRRA 4NFHA 4W9RA 4B9EA 3MT7A 1ZXBA 1E1NA 5EMLA 3ZNNA 3RUAA 2P2YA 4Z0PA 2CLKB 5IJ0A 4K6HA 3FETA 1BJKA 4EEKA 1BJRE 5F12A 4BO9A 1ND6A 2GD2A 1PDVA 1EXMA 3DDOA 3KL4A 1JJ7A 3NBXX 1U8TA 4PLFA 4B32A 2I3ZA 4GMDA 3GRRA 3OWOA 3HDYA 3ESYA 5AHWA 3ZI4A 3DDZX 3VH4A 1U8ZA 1RC8A 1FJHA 1SVOA 2GPWA 3KKQA 2BDTA 1KAQA 1PFUA 2B20A 2R4UA 3FSJX 4CMCA 3QTTA 4B76A 4CPDA 3KB8A 8ABPA 4X63A 5J4VA 1K4KA 5THKA 2GM4A 1BC5A 4DEVA 4P5EA 4EY5A 3E84A 3KKLA 1MG0A 1T1EA 1XRJA 2PT7A 2PX2A 5ARBA 5I45A 4WXMA 4D3DA 2BEVA 1AXEA 3JASB 1HE2A 2B82A 3I73A 5LOVF 3H05A 4Y2QA 3DV0A 4J0JA 2G77B 3WFIA 3WQBA 2VF8A 5KOJB 1KWGA 1QC5B 1SQFA 3KAPA 2LIVA 2GN2A 4C5AA 4HX9A 3QQ5A 1R0BA 4TKVA 3NAMA 4KN5A 3NORA 3DZJA 3HCRA 1OYWA 5BSKA 4GZ5A 4DTIA 4CMIA 3C6QA 1Z6TA 1JHXA 1LRJA 4EYKA 2P2LA 2WDZA 1N6RA 1EG7A 3E8MA 1T5IA 1QCZA 5BN5A 4ZDWA 4BWGA 5I4CA 3SEAA 2PA3A 1X7XB 1SZDA 3OQ1A 3NU1A 3PIIA 4ZXPA 1XRRA 2FVXA 4BO6A 3JS5A 4WOPA 4XJSA 1EAYA 1YR6A 4F3RA 2BWJA 2XE7A 3CH6A 4FC6A 4FQ8A 1TVKB 2G07A 2JATA 5GADl 4XR9A 1D4OA 1UPUA 3AHJA 3KYJB 5HUQA 1BSVA 3AR3A 2MSNA 3R5TA 1O9GA 3NIWA 1K7FB 4PGAA 3T0IA 2ZQYA 1JDBC 4LECA 4JB2A 1T4GA 2B6HA 4A0FA 1D07A 3MGCA 3D4BA 3CTPA 1J2YA 4EG6A 5NLLA 1N92A 3M7IA 1RD4A 3DKPA 3BFVA 1I3CA 3M89A 4LHEA 4MUKA 1EUZA 3P2IA 4M1KA 5DM60 4I5DA 1O94A 3C6YA 4A8JB 4ZU6X 4DUYB 3PWKA 3JAWA 8LDHA 3RK1A 5JISA 2AOTB 1M1YB 4CDGA 4B73A 3QK7A 1T6YA 2Q4RA 2ZIXB 2ORIA 2REXB 2VWGA 1Y3IA 2RGCA 4ZRNA 5NULA 1ENYA 4US1R 5C8ZA 1JR4A 1XDGA 2HRBA 2X5NA 3L82B 4IMJB 2LKCA 3QEJA 1XNJA 3PFNA 1OY1A 2QBYB 2CLFB 1VSVA 1HDOA 4LOLA 3LGAA 5E9AA 3UUEA 4PW0A 5FOQA 4LRXA 1D2EA 2BRUC 2NZ2A 3ESDA 3KHUA 4O4LB 4X92A 5CJ2A 1OKKD 2HT6A 4PRKA 1FRNA 5KQRA 3IR5A 4XQCA 5LP6C 3NHPA 3NW9A 5IJXA 3VJRA 3P52A 5K5EA 1E77A 2TYSB 5DM2A 3LQ2A 5DU2A 1YWGO 5C31A 1W36B 3QTBA 3HC7A 1A3CA 3E22B 4DA9A 2VQEB 3AV0B 2O54A 2XDYA 4AULA 3MTBA 4LHVA 4OJYA 2JD2A 6LDHA 1YL5A 1ZITA 3TGWA 3A32A 5F3WB 4II3A 721PA 1NBMD 2GWHA 2CNNA 3C3JA 4PG6A 4X45A 3H2BA 4P7GA 1Q91A 2UZIR 1RFGE 4MA0A 1BO6A 2WT9A 4JGBA 2M6KA 1XRSB 4HDKB 1OX6A 3V97A 2RB4A 2X7XA 1AURA 3KLBA 4UBMA 4GQBA 2WKPA 1OJ7A 1IC6A 1U5CA 4KN8A 5KNCA 1SGWA 4AY6A 1U3UA 1DO0A 5TXGA 1UIMA 1WF3A 4E1BA 3T54A 4D9GA 1ZM2A 5DNWA 1EHIA 2BBTA 1J0BA 4YRAA 3ZYCA 3AHFA 3OHPA 2QLNA 1OA0A 1ZYUA 1KJNA 4QYTA 4AS2A 3X1XA 1WBBA 3OZTA 1WDMA 3CLSD 4KZPA 1DWPA 3HHPA 4U2KA 3FH0A 2I8LA 2ZG6A 2C2KA 3MTEA 3OF3A 4DV5B 4ZEMA 1YU9A 3P7MA 4N7MA 4OFBA 1DAMA 3WFJA 1DV1A 2D0IA 2IOQA 2WD9A 1RYZA 4FN5A 4PNZA 4W8HA 4B17A 1Z7GA 5I51A 2GJSA 1V9SA 3EWIA 3QPAA 4EMSA 4TWZA 4P3NA 3AFOA 1ABEA 2AFVA 3OPMA 2OO5C 5AVKA 3GEBA 3JVEA 5ENZA 2WIJA 4DGQA 5AI5A 1H2YA 2YWBA 3QVMA 3WNBA 3M81A 4FX2A 4C4RA 2AI3A 2NUAA 2FKNA 2HL6A 3G82C 3IE0A 3EPJA 3ZVKA 3W0LB 3FKSD 3PG5A 4JP3A 1UK8A 2XWBF 2F8MA 3KPJA 1KZ1A 2PVPA 1MGOA 2FUKA 1QCCA 1WMAA 3IOEA 3DG9A 3EXEA 4O2AB 1RPNA 4R9SA 4B3FX 5LZ4A 1RZUA 2VZ0A 4MV1A 5JJBA 1Z35A 4P2BA 4U63A 2GDZA 1MJGM 2ZRKA 3CNEA 1TW2A 2C00A 4FBLA 5K1ZA 1T0BA 1RI3A 2Q3FA 3B8HA 2YIJA 3BWYA 2CK3D 4AX8A 1XKXA 4CKEA 1ACJA 4X8LA 3BHMA 1M8PA 3CG0A 1BHQ1 5E95A 1RBQA 2IYPA 2PGJA 3ODGA 3L4KA 1AGYA 1QMGA 2EZ4A 1Y1LA 3E9EA 3RM3A 2NO7A 1KBOA 3DE6X 4WE3A 2GN8A 2WV9A 2AFHA 4DMUB 3KV3O 2I78A 3AF2A 3WO0A 1P6UA 2GM3A 2I2CA 4BFLA 4WXPA 4UOZA 5IXJA 1TEXA 2ASEA 1F14A 1NNLA 1NQAO 1PGNA 2Q0SA 5AKJA 1T2VA 2H07A 3DMYA 4KK3A 1TK9A 2D5LA 4MLCA 2JCSA 2YFKA 4AK9A 2ZSJA 2O6LA 1HNWB 4P38A 1CYDA 1ABBA 4U3JA 2GCEA 4EG8A 1YR7A 3GA7A 4CFZA 5H1YA 4GX2A 2AOVA 5EAIA 1RRFA 3PT5A 4IOMA 4NQRA 1T8YA 4EYEA 4I1SA 4QREA 1QH1B 4D82A 3CLTD 3BIFA 3E6AA 3KYDB 1N7GA 5A5VA 2VYFA 1Z16A 4GGPA 3V4SA 5KC8A 4B3XA 1Q16A 3E35A 2QUIA 4QEZA 1Z2CA 1PQYA 4HGZA 3L0IB 1V4BA 4AJEA 4D80A 4E2ZA 3JVVA 4ACAA 1MNAA 1DDIA 2EHJA 4IFTA 1LSJA 5GY7A 1WB9A 1K89A 3A4IA 1CUVA 3RVKA 4B3IA 4EVSA 1ZZEA 1TGVA 1OGJA 4MEBA 3CJRA 2X0EA 5K8IA 1JG4A 2VKTA 2HA2A 4RHYA 3S2IA 3TSCA 3VVLA 3W5AA 4P34A 4PQEA 3CX8A 2ZB7A 2WB4A 3A8TA 2D5AA 3R3ZA 3MAGA 5ALNA 2GETA 1XDDA 2ZIGA 1ZWLA 2ZSKA 1XRMA 3JATA 1PG0A 1X1TA 1UMKA 4IQFA 4MPRA 4ND8A 4NY1A 5GJVC 2XCTB 2C3OA 3LUFA 1U0TA 4WESA 5BWNA 1WVMA 4F5WA 1QE5A 4Q4HB 4DUGD 4JBNA 4TROA 1CZLA 4AWXA 2ADOA 1AGXA 3C8ZA 3UK1A 5FJJA 3TR6A 2GO1A 3EE6A 2VSYA 1GZ6A 2A3RA 2ZRQA 3LCVB 4W7IA 1V8OA 4QOHA 4BTEA 3CZCA 3PE3A 1N0IA 4LRYA 1XZEA 1JPVA 2JBAA 3FKJA 2OPHA 4A2WA 1IAQA 3WB1A 3TJRA 4O29A 1E2IA 3PBKA 2AR0A 1MO5A 4UHCA 3U4GA 2FB9A 1IJKA 2R8PA 3FNBA 2W6JD 1V37A 4GM4A 1NHWA 4V0ME 2E3JA 2YIDA 3ZGVA 1L0BA 3HSKA 4FEGA 2IRWA 4RD1A 3U0VA 3E5NA 1NBMA 4YRQA 1O97C 4JL8A 3VKGA 3EZXA 3F6SA 1FF9A 3RS9A 3U62A 3HDGA 5DBHX 1AA6A 2XQFA 3JCZA 1KPHA 4D41A 3R5SA 3EZYA 5KX5F 3GT4A 4NBTA 1DG3A 3AWDA 4MP8A 5CT5A 3I9V6 5BSWA 2R11A 1RADA 1S2OA 1SVUA 3WYDA 3E5MA 2WU0A 1RZVA 1EFDN 1PQUA 3M1IA 4GH5A 5EGSA 4Q48A 5BURA 1P7ZA 4KR9A 3O3MB 3AR8A 1Y33E 2QW8A 4MUYA 4Y6QA 1XEWX 4G9BA 5GZ1A 5IS2A 3FFTA 2HWUA 2K2QB 2R1TA 2C7RA 5CTAA 5IH7A 4BPBA 3E1SA 2E49A 3BD9A 3H65A 4R6XA 4Y0AA 1QYXA 2GBLA 3ILYA 4OXNA 5DO9A 4TXLA 5FPYA 3Q1LA 4UZSA 1XQ6A 3K30A 6REQB 3E3OA 4UVEA 1MNQA 2DX7A 3ZZUA 5JANA 4U2CA 1JG3A 5DM0A 4C05A 5IVDA 3HGQA 2C9DA 1ZNXA 1LK7A 1QTRA 2I7VA 5BWLA 4E03A 5LOVB 4CLRB 5ICSA 4PRYA 2IVZA 1PL7A 1WG8A 2ZKLA 3OLYA 4AQ7A 1Z8DA 4U2GA 4Q7EA 2Z3WA 1AQIA 2P5YA 4MO9A 3ZW7A 3LUBA 5L4NA 1NYRA 1CV2A 2XD4A 1RS0A 3M6WA 5I4IA 5JYBA 4PSDA 2ZVPX 2J5KA 2WWWA 2RKWA 1ACMA 2P8SA 2QZJA 2V0CA 2DM6A 2WMDA 4L9RA 3GI1A 3H1PA 4LF4B 3BXHA 4EVRA 4XIJA 3M2TA 1A76A 1SXIA 3Q3HA 1O57A 4MR9B 2WTAA 2A1TR 2Z2JA 3G8YA 2LKDA 1D2AA 2AN5A 2CK3A 3E3NA 4TKZA 1YJQA 3M4NA 2VT7A 2VRNA 5J59A 3W1WA 1NF3A 4OH1A 1NW4A 2A86A 3G1UA 3JW8A 5FEMA 4L72A 4BMNA 1XZGA 1OREA 2PYZA 2G3YA 5D5HA 3VR6H 1CUBA 4RM3A 3FWHA 1PCXA 1VLMA 4PN3A 2IYZA 1OSNA 2BR4A 2JLQA 3FUWA 4XPIA 4ETIA 2WHXA 4FMPA 4WJLA 5KQPA 5ER6A 3B60A 4HX5A 5M3BA 4AURA 4NBWA 4G4IA 4X84A 2ECPA 2AX3A 4MLZA 5AP9A 2IV7A 2EJVA 1FFEA 3UWSA 3Q7IA 1DC8A 4YRSA 4IEEA 4ER3A 4KO2S 4YCSA 3JQAD 4S0XA 5L7WA 3QTLA 1RWXA 5AJTA 2BELA 3VPXA 2FPPB 2IOFA 4KGDA 2F8LA 4IIYA 3EEQA 2PWAA 3G0OA 4N65A 4C5CA 2RJ3A 4LZOA 4K5QA 2FMKA 1OAOA 1NWHA 4BVHA 1NBEA 2I7CA 2Z8XA 3IEUA 3NEJA 3OOWA 4KPUA 5F64A 5J5AA 5DTEA 1YNSA 3PU6A 1JB9A 2Z2YA 5LZ2A 1DBVO 3TTSA 4MV0A 4PGGA 4UHJA 5CCBA 3CYFA 2O8DA 5EVJA 5DNVA 1L8OA 5KYTA 1GRRA 4Q9AA 3THSA 2P4UA 5B4TA 1XI2A 3PQEA 2Q4BA 2WD7A 2QP9X 1FNBA 1RJFA 1HNXB 3ZE1B 3B6IA 2E2WA 2P6NA 3KEOA 4HDMB 5KUTA 1LTQA 1MW8X 4JXZA 3KL2A 2NX2A 4FQ5A 4WXEA 4TV9F 5CAEA 3N28A 4D4JA 5EUMA 3IQIX 1U5BB 2GFQA 1XB2A 1JLMA 3TSYA 4C6SA 4ZYVA 3CZ9A 3WHLA 2XUZA 3O31A 5LDHA 5CPFA 1V5GA 2VIIA 1ZS9A 3PFFA 1OWPA 2WTUA 1UFVA 4JOSA 2C84A 4HDAA 5LZ7A 4DUGA 1R0ZA 1PFGA 1XEWY 2P7HA 1XZNA 1KWKA 5JC1A 1W47A 1XZBA 2AXNA 1C0EA 1KH3A 3OQJA 1SC6A 4J03A 2PL5A 2XZPA 3DFIA 3LU1A 4Q7LA 3ASZA 3ZJYA 3HMKA 3ZTTA 5JWOA 2QXTA 2VKQA 1IWOA 2IHYA 1G8GA 4R5MA 4ZYYA 2E85A 5BQXA 2JFNA 1PR4A 4I7EA 2VDKB 1YZKA 3ZQ4A 4BLTA 1NXPA 2F62A 4C4AA 1U7PA 1M6VB 1MOSA 5F52A 4BP8A 1CVIA 3GZNB 2W6JA 3BSSA 3PQ6A 1P1RA 2HDHA 4GM1A 1R0LA 3PDHA 4MUIA 1HI9A 2IUUA 4EO4A 4MGZR 1EPUA 3BL8A 3GLHB 4B3DA 3HA5A 3TUJC 4CMGA 1R8QA 1DBSA 4LQCA 2FK8A 4PZLA 3ZHVA 1CPYA 4NFLA 4ALMA 4DLVA 3NCHA 4IUDS 2Q1YA 1J39A 2XBMA 2O2EA 3W77A 1EFRD 3ZUPA 3LKDA 1A9ZA 1AVTA 1JHOA 1I1OA 1E62A 2VDRB 3AB7A 3I45A 4PNPA 5TPWA 5DX8A 4BNUA 3HUEA 4ZGBA 1PR9A 2CMDA 2WP8J 3KC2A 4M1ZA 1KXZA 5BNFA 3KQOA 2VSOA 1FRQA 3IUMA 3P9IA 4IHJA 4R0VA 5K01A 3VA7A 4D0SA 1SUIA 3WMXA 3AKDA 4QRDA 1I0LA 1PR3A 2AOWA 1EX1A 1WSBA 3FOFC 1BQEA 1KE1A 1Z6AA 2IHKA 4N5DA 1KI7A 3IELA 2X5OA 3PEUA 3BX1A 3UJNA 2JGDB 3YASA 1JXOA 2JHCA 2LVBA 4PQYA 4BEBA 2FX3A 1VJ5A 4JP2A 1BXKA 3ZWXA 4QVIA 3A2MA 1DTWA 2CV0A 3EHDA 4ZZ0A 3PQ3A 1F6BA 4BFYA 5J5CA 3WAJA 3ZJUA 1ZUNB 2CUKA 3VR4D 4EJFA 4XVUA 3MLBA 1ZK1A 2GBIA 3RSZA 3S81A 2G5CA 5GVSA 1K68A 3KK0A 3K0BA 4EHKA 4GVLA 1JWAB 1EWVA 2OBFA 3MTGA 2O1EA 4K9OA 3ZD9A 1KYVA 4OSPA 1GV0A 1QH8A 3O82A 4BNVA 3DZDA 3RR2A 4JUFA 1FUKA 2DPMA 3PUVA 4LBZA 4Q3DA 3ELWA 2P75A 5C35A 1LEHA 3UW3A 2SICE 2I6UA 5ECDA 1UXHA 3IOMA 4YPFA 4QDJA 2HYDA 1AGRA 1MJHA 1QAQA 5KCMA 3STXA 3VHXA 4ZJZA 2J4CA 3IURA 1RMTA 1QRDA 3SGLA 2QMYA 1SCKA 4P36A 4RV9A 1SQ0A 1NVAA 4M7OA 3RIMA 4QWMA 3UK0A 3PHLA 5JCZA 3CUTA 3T5GA 4DWVA 2CFOA 5KJEA 4XTRA 4C7OB 1IHOA 2C9CA 2XYRA 3AJAA 4B5KA 4DILA 5LQUA 3W3AH 4D7AA 5C46F 4YX9A 3ZY5A 4ZIRA 2PJUA 3HWX1 4FFBB 4IDPA 1H94A 3RFFA 1E8NA 3RYCA 4IRXA 1PNVA 2X86A 3JQAA 4ID9A 8ATCA 3CE6A 2PGLA 4L4YA 2XZLA 2G83A 1X87A 3H6HA 4M2LA 5BSFA 2M6LA 5JEDA 4BO3A 4MR9A 1X7ZB 1ECFA 1E5DA 3LIPA 1QGED 1J7KA 5KNDD 5DCWA 2WJWA 1O4VA 3PGVA 5FBHA 4FZ3A 4N9WA 2SBTA 5A4JA 3H11B 3NHFA 3I83A 3GXBA 4MMXB 2VHXA 3UF0A 2QM0A 2BHTA 4JJEA 4JGGA 3IHLA 4KNWA 4JBGA 4M6WB 3R9XB 2I1QA 4U0KA 5HEKA 1FYVA 3LG2A 1LJ8A 4KMOA 4WNAA 5DZSA 2MMCA 3N2LA 1V11B 1NVVQ 1D0IA 3E8XA 3LJKA 2ZBQA 4FIDA 5H0IA 4E08A 3PX7A 1UWKA 3BWEA 4X3CA 3U3ZA 1WZEA 2XB4A 3AZQA 1FDWA 3PDWA 1MBZA 2WNSA 4IOKA 1B0UA 1GNRA 1P73A 4GI7A 5IAEA 1UZUA 2ET6A 3NYWA 1KEEB 3QE2A 1QG2A 1GNTA 1Q74A 1RBZA 3FUXA 3GHYA 1ESDA 2IX3A 1FMFA 2W2OA 3RHZA 1OASA 2V4ZA 3KUUA 1Y48E 5EHXA 5FI0B 2Q50A 4O1HA 5EE1A 3UY4A 3O90A 4O59O 1R4NB 4LV5B 1WXQA 1QF6A 4P4TA 2DUJA 2HSDA 2C5SA 4QM6A 4KI0A 3RS2A 3BCUA 3BWBA 3G68A 3PFHA 1GL6A 3PQ4A 5IDQA 5J1SB 2GN0A 3L0CA 4FVTA 4MRRA 2X2PA 5TT1A 4Z8YA 2H8GA 3N7TA 3H6KA 2CHQA 2DPLA 3BK1A 4WNYA 4J90A 4FK8A 2XOKD 2KWIA 1KI8A 3NATA 2G17A 3P2JA 2OQVA 1HO3A 1YE3A 2C61A 2IEYA 2PX0A 1G0OA 2WSLA 2C2MA 2PUEA 2PYIA 1LRKA 3DF9A 3Q7QA 3ZH2A 4NYMQ 3IQZA 1SBTA 1XRLA 2J9FA 3KYCB 4WCVA 2XKBA 2ZZMA 3IAAA 1SXHA 3PFKA 5BP7A 1YFLA 1E2PA 3UOGA 4RV4A 5CD1A 2B4AA 1Z56C 1QDEA 1F8UA 1EVYA 3B9RA 1EFRA 3E9MA 1IEXA 4HFNA 2ILTA 2GF0A 3TCNA 3A37A 4JLWA 2LCQA 2V7QA 1E59A 1GT6A 2MDTA 3JWPA 3HJTA 4GIBA 3N2GA 4EF6A 1Z63A 3R7FA 4CEJA 5JH7A 2XF2A 5EQFA 4RK6A 2JFZA 2CDBA 2DH5A 2HQOA 3D54D 4NE7A 2JJ2A 1JLLA 2YWHA 3EEBA 3X2FA 3DV2A 3MWDA 2YV5A 3BWVA 4CI9A 2OBBA 3IUBA 1E8DA 4HYYA 4XCXA 3TE6A 5IBPA 1MVOA 1PZFA 4KRYA 2JK0A 5T4HA 5TJ9A 4KAXA 4IILA 1OXTA 5ENDA 1VI5A 2FWMX 1KQOA 1YQDA 2Z1MA 4DR5B 4UDYX 3VR4A 2X1HA 1L7BA 1YXMA 4AZ3A 3D6MA 3O03A 2J0VA 2JVIA 2FW0A 2XT9A 5JCJD 1FYDA 4F5EA 1XWFA 2AW5A 1S4MA 3THYA 1FSSA 1K3FA 3HKBA 1QXSA 1LBIA 1TYDE 4R05A 1ORRA 4KXLA 1HQYE 3D8UA 1ZA2A 2PH5A 2H16A 5F9HA 4IDCA 4L6AA 4WH0A 4J1TC 5JXJA 2MJLA 3TEMA 3KT3A 2ZYHA 1ECLA 4Z7JA 1N36B 4F6RA 4KLNA 1JIUA 1CJBA 2ACWA 4R84A 4JBWA 3AESB 2PXAA 3ZU6A 1ABFA 3A9SA 3ELBA 5EJGA 5FRDA 4I81A 2XY4A 5CB4F 1GUYA 3F3MA 5BV1A 3J81A 1Y8CA 1IQUA 3M1LA 2IBMA 4JBHA 4LYHA 4QDTA 1XZKA 1YBAA 4WXYB 5E2IA 3SN6A 3UWPA 2PWYA 3AEUB 1FJXA 1R3DA 2AS0A 3BPSA 2J6CA 3IP7A 4QUDA 5K0TA 4BVAA 5IARA 3E27A 1YUBA 1DQNA 3KJZA 2CFCA 1JBEA 2OGTA 3V4ZA 2Y1GA 4MDYA 5ALOA 3BXFA 3QXXA 1DC6A 1J0XO 4A2PA 1NX9A 3AGPA 4B8WA 3RU2A 1E3IA 2JJ1A 2YIMA 4IDQA 1T8TA 4EW3A 3URMA 2BBSA 4ZCTA 3FZYA 5L3SB 1ZUD1 1VPWA 2RKBA 2YWJA 4RA6A 1QLWA 1U6IA 4JLKA 1LW6E 2ECOA 2YYAA 4PHTA 4BC0A 1T9BA 2AWNA 1XP8A 2BKLA 2HBYA 2O0JA 3JYNA 4G0OA 4LY6A 3HWWA 1DJPA 1ONBA 5KNDA 4JASB 1T24A 4QOSA 3RC9A 1P9LA 1OX4B 1X1QA 3QVOA 4LMRA 3X1JA 2IHVA 4BPRA 4CODB 4HDSA 2DAPA 1MORA 3RE1A 1R0YA 3UWKA 1G5IA 1VZ3A 3ZLVA 1UBTS 4RY0A 2WYIA 4TV9B 4FGWA 5FWXA 2JEZA 3Q3CA 3RVJA 3P32A 1RW4A 4U02A 1YRQA 4ZKEA 1LU9A 4MW1A 4QT0A 2I4IA 2UXDB 1NDQA 2PGNA 3LWBA 4YQFA 1UPFA 4G5XA 2LWIA 4L9AA 1XA0A 5EXSA 4BVEA 4GR9A 5DGTA 5JCOA 1CF4A 1G3IA 1N1MA 1DQYA 1SURA 1UADA 3B1ZA 3V48A 3SJAA 5GIOE 4IIGA 4U0JA 1SZPA 5DBFA 4ZANA 5GM1A 5CFLA 4RE5A 5ALIA 1Y5NA 3FR8A 4CIVA 1DRVA 2GJ9A 1IB0A 2ZRNA 2A78A 1FVFA 2J3IA 1W4BA 2I76A 1U4SA 4OJTA 4MUBA 3WK4A 3WWPA 3HJNA 1C8LA 2QTVA 3CUWA 5C34B 4YR7A 2HADA 5ALRA 3F5QA 1VQ1A 3UMVA 4R3UC 2EP5A 3G59A 3I2FA 1TF2A 1X7YB 2ZPUA 3OLXA 1DJMA 1XTZA 3JQGA 4LJSA 3MOIA 4M8KA 4BY9E 1R2QA 3B12A 3HN7A 4X7PA 1IUPA 3AETB 2OV3A 3OZWA 1IZZA 1GNVA 3HDJA 3U7QA 3FOAA 4HB0A 4BP1A 1USGA 1F4VA 3RYHB 2PKEA 4D43A 2XOKA 2FV8A 4QDOA 1P2BA 5L40A 4BQRA 4Z3OA 1M0TA 3ZWMA 1I4EB 3H5NA 1NVVR 2VDPB 3KQMA 2VEDA 5BVGB 3OTOB 4Q9IA 1EBFA 1F20A 1BMDA 3T7IA 4OBEA 1NUSA 1QGUB 1JZSA 2CWWA 3UMFA 4CU5A 5JAIA 4YIHA 1OLOA 4D79A 3HM9A 4MRVA 1NI5A 2O52A 4QRIA 1QU3A 1R4NA 4EZIA 3N6RA 5KU7A 5KTOA 1KMHA 1I6MA 1N4DA 3QBJA 4OI0A 2YQ5A 1TM1E 2P35A 4UCFA 3GFOA 3H9JA 3ZW8A 1U98A 3LHDA 3PXDA 3TCKA 2ZYUX 4RS4A 2ABWA 1H2RS 2ZYWX 2O7SA 1IU9A 2PZMA 3OMWA 2FUG1 4UPEA 3C6BA 1KY2A 3IDZA 3UN1A 4BCDA 3WGNA 1NRJB 2OC9A 3HBLA 1HT1E 2X6QA 1HEIA 3GT7A 3N39C 5HJ2A 2XF8A 2ZI9A 4LV6A 3WL3A 4KXWA 5GGXA 1Q77A 5AVUA 2Y9PB 3E9NA 4ARVA 4BS9A 3CVOA 3N2NA 4A0QA 2R1UA 3C3DA 2GARA 2W2KA 1GT91 3K0FA 2PG3A 3FYUA 1WXHA 5THQA 3B3GA 4BFVA 3FX2A 5HQ3B 1T4BA 1TT5A 3PGKA 1BW9B 4HNTA 4NYMR 5AW2A 4FW8A 4OQMA 1MOPA 2C8LA 4RJJA 5IKXA 1L8XA 1SIWA 2Q0XA 4OFZA 5JCJA 2RK6A 1EP9A 3DOHA 2OWEA 3GDGA 1CP2A 1TJPB 3SVZA 5KWEA 4CQNA 4MUNA 2C8JA 2Z4SA 3I2IA 3O7WA 4B84A 3OURA 5HUJA 5FUQA 2H52A 2IU6A 2P4EA 5IBQA 3T12A 3RJ9A 3TNDA 4WLEA 3BN3A 1NP6A 3KQWA 3WNQA 5JMWA 4U2BA 3UK7A 3EUFA 2X9NA 3RSCA 4AUEA 2VNIA 2EGUA 2YZKA 1SBZA 1V25A 2AE2A 1T0PA 3IP3A 3P9YA 4M53A 2CBXA 2PRIA 4NE2A 2Q5IA 1RPTA 3L5KA 4KHZA 4NBUA 4U9UA 3TBFA 1Z4QA 3GJ4A 4DBVO 1NUUA 2VJYA 2PO5A 3VR5H 4LTDA 1E7YA 1UK7A 2EFYA 3ZHRA 1UL1X 5KVCA 1DTSA 1PJZA 1DKOA 2ZRJA 1GPLA 4JY7A 4PINA 4DFDA 2G1AA 1D04A 1JHRA 2OBXA 2Y6UA 3OUZA 2J07A 5KKCA 2P2ZA 3NTLA 2A8YA 1I7SB 2OE2A 4FYXA 4HTAA 5DGCA 5KPJA 4Q4CA 2B7CA 2HQ1A 3LHIA 4MAAA 4EW6A 3I2GA 3EY9A 4L07A 3JR3A 1DAGA 2OXRA 1JGTA 2V7BA 2YW9A 5FORA 1Z0DA 1J0AA 4IW3B 1H2EA 4N41A 1TM5E 3E7PA 4MRMB 5TQ0A 1IATA 2VQSA 1B0PA 4DIMA 1NJ6A 2XB2A 1D2GA 4MVJM 4HATA 2IT1A 5F7JA 1UQUA 3OCYA 4RVSA 3VHQA 1L7NA 1O94C 2GQ0A 4I1RA 4I9NA 4OHCA 1FS6A 1XP5A 2NTYC 3AHEA 4L73A 4LCEA 3PI6A 4PX3A 1L1FA 4D97A 5AUPB 3TO5A 4KRXA 1QFSA 1A8HA 1YCGA 3FPAA 4NDNE 2FFAA 3GQBB 1IOVA 4L95C 3MIZA 2OMEA 3KAKA 3BJRA 3H75A 1IVYA 4EZBA 2XQIA 2Y77A 3PXAA 4YT8A 1AKNA 1J00A 1C1XB 1RWQA 2E87A 2GBCA 3Q3GE 4GBJA 4JVNA 1IN5A 3M9LA 1DFHA 1ULSA 5JG7A 1Y8RA 1Z5WA 4LJYA 4O02B 2VO1A 3E4CA 1EQUA 3QPWA 2Q28A 1Q92A 3AQIA 3N9IA 3ZTWA 3EEOA 3MQFA 3U60B 4W5WA 2WJAA 4XEUA 3HXKA 3IT0A 4DSOA 9MHTA 4X97A 5C8YA 3I05A 5FYQA 3S68A 2DJ5A 2HMWA 2AUNA 2B1GA 5ALLA 4RF2A 5KYKA 3CR7A 5EN4A 4J3NA 4INOA 5DI9A 3K5WA 2WSSD 5DJ5A 1UKZA 1JDPA 4YUVA 1P3DA 4GVPA 4EX6A 4JJZA 5IUJC 3BMNB 1R0WA 1NBAA 1VJCA 3EIHA 3GJTA 5A9SA 5FAKA 3OQHA 3RVPA 3RT9A 5IF3A 1UDBA 2GVDC 5EPUA 3RS8A 5ICFA 1RHRA 4IV5A 4EG0A 3ECCA 3PXXA 3HXOA 1II8B 1ND5A 2IEIA 4DLYA 1FUUA 1Q5PA 2ZROA 2BHRA 1LVUA 2P1DA 3EAGA 3IIIA 3RGGA 4V24A 1VYTA 4INJA 4NZZA 4XD7D 2GD0A 3OIYA 1NL3A 1Q0PA 2HD4A 2XR1A 4YRLA 3K3PA 1CRQA 5J2TA 1L5ZA 3NT2A 3SVTA 4HNRA 5H8WA 1V7ZA 1M67A 1SUEA 3T9EA 4M98A 4OXQA 1PGJA 3B52X 3Q9UA 3STHA 4B48A 2J5BA 4COKA 2WHYA 2I4OA 1HKHA 2IU3A 1E9VA 2RBGA 1JHYA 2E9SA 4OXRA 2QXUA 5JAHA 1Q21A 3U61B 1ZXXA 2BMJA 4MSUA 2B0CA 1XDWA 3LX8A 4O4HB 5AI8A 5WRFA 3ABQB 2H7XA 3QJ5A 2GEVA 1RXSA 3CRNA 2XYGA 1U2DC 4WOCA 4XWOA 5IMSA 5F78A 3K73O 3MN1A 3ZBPA 4DJEC 3HU5A 2VQ3A 4YJGA 5AJZA 5B1HA 3LBHA 1C3JA 3HU1A 2Q41A 1G21A 5F98A 1X13A 1JSLA 3E82A 4MUJA 3F9RA 3BDIA 4YB8A 1FS5A 2HCJB 2YJ3A 1VSQA 2IYLD 1G2PA 3H83A 3JAKA 1N32B 1L5VA 1K7XB 1V5IA 1FJGB 1F8FA 4FYKA 3DYVA 3KQQA 3HXLA 3SCZA 4BVBA 4J0CA 1XG5A 2OCKA 3WB9A 4PRLA 3WVNA 4EEXA 3K4HA 4L2IA 3MVEA 3CZ5A 1VA5A 1RVV1 2AG0A 2Z3ZA 3DR3A 5KJ1A 2LUOA 3WFZA 3EZ2A 4UMVA 2J48A 2ACKA 2V1XA 3KJXA 4X20A 5I01A 4A15A 5CB4B 3F6YA 2VNSA 3A6JA 2B4YA 2VJPA 3QE4A 3RS0A 3AEZA 3MA0A 3ZGOA 1XLUA 1ZRNA 1GDTA 1I14A 4ZEWA 3KKMA 3WSVA 4CIYA 1R4AA 5DN9A 4HBZA 3LP6A 1YA8A 5AKHA 4ND4A 1U11A 1W87A 3ZWAA 1KQGA 4Y1RA 1ZZGA 3KOYA 2JDID 1T1JA 4QBKA 4C43A 3AVXA 1TO6A 3GFPA 3GZTB 3TZKA 4WBNF 5L3QB 2DHDA 1DAIA 1Q7GA 3KDPA 2XUOA 1P3Y1 3OO1A 4Q82A 3HRKA 5EJ5A 3LMKA 4EG5A 1YL6A 3THXA 4XZ3A 4MGIR 5AUQA 3ONDA 3D6NB 4HUQA 3FDFA 5B37A 2V5UA 4WZZA 4EHBA 3ORHA 5H3LA 4MTLA 1G9SA 2VPWA 3D1LA 4U2EA 3RHSA 4BFSA 1UC5B 1XCLA 2PS3A 1NJGA 2G7ZA 3KLNA 1UBRS 3GVIA 1UBSB 2F3UA 1V1JA 1U0FA 1GTVA 2QPOA 5JSKA 4BGVA 2QIOA 2JIMA 3VPBA 2J3LA 5G40A 1HR0B 3FPCA 1PR0A 2V96A 1EGMB 1XNHA 3PTLA 1IM5A 1P1CA 1RDFA 5KC9A 3K2BA 1QAOA 2JB9A 4YYZA 3PVCA 4J7UA 4JWTA 5DNUA 2IP2A 3NDBB 4FI3F 5LYJB 1PTKA 2BCJQ 4BO1A 9GPBA 5C18A 4POAA 1VL2A 1ZCBA 1TCVA 4GM0A 5DNDA 4G2NA 2P68A 3SXUB 1RM3A 2QF7A 3OZIA 2ZJ7A 3GLFE 5LWQA 1YDHA 4AO7A 1F8YA 1WXFA 4PICA 3ROFA 3W8DA 2HMSA 2E6KA 4EA7A 3B5IA 1WU7A 3LLVA 4DQDA 4LPKA 4GI5A 3TPCA 2EEPA 3LUPA 4IJMA 2X40A 1YJXA 4FFMA 3V8NA 1S01A 3F4BA 4FLMA 4OXIA 4QYSA 1OBFO 1DJNA 3W1EA 4FOPA 3RRYA 1ZOLA 1Q95A 2DYKA 5HZGA 3NETA 3HDTA 3HADA 1Z8FA 1TD9A 1AB6A 3OSUA 4YJHA 4A8JC 5I9BA 4IDBA 3BDVA 5MGBA 3NDPA 2WSSA 1VDZA 1A4RA 3CNOA 3INTA 5DSZA 2BHLA 3G0DA 1GDHA 1HSZA 2ODQA 4KODA 1UFKA 3N07A 1MO3A 2EF1A 3SZ3A 4REOA 3EQ8A 5LBIA 3T7AA 4QXOA 2O5EA 5DGHA 2P3QA 1O96B 4M1WA 4I46A 4G1VA 4MKFA 2X19A 3QU5A 1Z15A 3CKYA 5CIWA 3BZBA 4KFSA 1EUYA 3ICQB 4F96A 4Q3LA 1B41A 3SEFA 1SB9A 5AOCA 2VZ8A 2ZWIA 1WW3A 4EP1A 3JQQA 1SBCA 2O8FA 3U39A 5KYGA 5C3MA 5B7GA 2C29D 1NW9B 2AW3A 3V34A 3EULA 2GHTA 1ADBA 3QRWA 3W2GA 2IGBA 4CM4A 3AL2A 2WJPA 5BNWA 3AUJB 4C76A 1WOYA 1BFKA 4B85A 3F7NA 4Y2PA 4XE5A 1E2NA 2O2GA 5DW3A 5JD3A 3USCS 4RZ3A 4IDEA 2G1KA 2PSFA 2PRZA 5BQ3A 1J7JA 2O9JA 4R8KA 2NU9B 3R8CA 3CLSC 4GBMA 1FQKA 3UAXA 3HFSA 4DLSA 3RQIA 6ADHA 1BS1A 1T3TA 2H5EA 3JWJA 1GPAA 2G0AA 4UULA 2J0QA 4HH3C 1XCGB 2VRBA 2XCSB 5AJVB 1XRPA 2I2WA 1T8UA 3NEPX 4I8DA 4LJ9A 4Q4DA 1WD7A 2ID4A 4YHBA 5H7XA 1ILEA 1DO8A 4RVFA 4LSZA 4AMYA 4C5BA 3D7KA 1CUFA 1JU4A 2OXTA 3UAWA 5BWCA 4OGWA 3ZLTA 5C7LO 3K0KA 3G3EA 3N8DA 3VZQA 3EPPA 1J0EA 1KU6A 1W5SA 2O07A 1ZKDA 3PE6A 3CLUD 3H84A 1MX1A 3FTDA 5CXSA 2A30A 3WI7A 3MB8A 3NFRA 4P0QB 1JR3E 2ZI4A 4KJZA 2V9PA 2VSQA 3G5TA 2F43A 1Y3AA 3U26A 5KI6A 4CTKA 2HO4A 3CCCA 3H2JA 4JL6A 4RELA 1IXRC 1MAVA 5FOTA 1CKEA 3WJ2A 5IT5A 4XGIA 2O2HA 3OMLA 4WD3A 3U7HB 4Y7DA 5HBRA 4DQVA 1QRUA 3RAPR 2LPMA 3RU7A 3N8NA 2DZDA 2XGSA 3T9BA 1CUHA 5A3SA 2XHEA 1PWXA 5FO1A 2WF9A 1G9XA 3E5RA 4XWGA 4HDNB 2XNHA 3FW1A 2DERA 2LTAA 1DKLA 2DSTA 1TLLA 2JDIA 3CXRA 3QYAA 2WJIA 3M4ZA 4P4LA 4ALNA 1BKDR 4P5DA 5KYXA 4UASA 3V4FA 4DLWA 3C1AA 4XVCA 5AXBA 2C5GA 2H5JA 1OU0A 1PUIA 5CYPA 4ABTA 4JX8A 3CKLA 1Z2NX 3FPEA 3SE0A 2CXNA 1E4YA 1JALA 4WWHA 4OHMA 3GJRA 1Y4UA 4M9RA 4YY3B 2GAOA 4URUR 3UT6A 2ORYA 3OEHD 2FMUA 5FV7A 1SHKA 5FLXA 1BU5A 3JALA 5B53A 4YMVA 3BMXA 1OAOC 4D5EA 4IIDA 4KCGA 4EB8A 4F6CA 4KNYA 1TI7A 4L3WA 1YK0A 3DBVO 2J6IA 4UE6A 5CX4A 5JXWA 4AW9A 3KUXA 3U5ZB 1ZI6A 4MARA 1LPMA 3RASA 2IV3A 5AIAA 2VYCA 2EZTA 3QLJA 1SULA 1VFNA 2WZDA 2YMMA 3D1JA 3WGJA 1X2BA 4LXQA 4QUEA 4AZSA 4B6SA 4EI8A 1I33A 1V6CA 3CBGA 3DFMA 2ERCA 4M0LA 4MJLA 4G97A 2H48A 1OILA 2BTEA 1E0DA 4TTIA 2FUNB 1JYEA 1XMVA 2BD0A 2EAUA 2J6HA 3ISVA 2O8CB 1PKXA 4JJKA 4OYRA 5DHQA 5TPZD 1QHHB 3WRVA 1XXHA 2X9QA 2H3EA 2QORA 2X7HA 3IPRA 3K35A 4KDFA 3D7MA 4Q00A 2WU3A 4WZBA 1KORA 2H1OA 1X77A 4ZC1A 3EOZA 3FUUA 1BU8A 3JQ6A 1PEYA 1PVVA 5HMLA 1LBTA 1U3DA 5E9QA 1PGPA 1E9DA 3HGTA 4NL4H 5TNXA 2CSXA 3LLSA 5EJ9A 1RXVA 2UUPA 3I9MA 3D2LA 3I4FA 2ZS8A 1LNQA 1MFZA 2X6TA 2NO6A 5IT9A 2HHCA 2IPMA 4ZJUA 4C0LA 2J3MA 4NZYA 1T35A 1VHDA 3N1UA 4FB4A 5B1YA 3K71B 4HH1A 4U7HA 1E9EA 3AM4A 1DQPA 4EHIA 2XPCA 2IY7A 3NJRA 2BFDB 4G84A 4XVQA 1QCYA 3OP1A 4DC9A 1ECJA 1JEOA 1T5DX 1VKJA 1KYWA 1ITZA 1CY6A 2CYBA 2QTBA 5A4DA 4QG3A 5THXA 1CXZA 3DTVD 3GLRA 3Q12A 3TI7A 5KSPA 1VSUA 3QVSA 4WKNA 1LC0A 3C3MA 3QKWA 1VMIA 3KJFA 3V8BA 5BNTA 3O4IA 1Y9ZA 1G1MA 2J3KA 5FR2A 4M99A 1BMQA 1FCJA 5AW5A 5ICEA 4Y2VA 2FJPA 1M2KA 1PP4A 1RVDA 2P67A 3HSYA 2Q9CA 4PIPA 4WFIA 5ALQA 5BT9A 3HM2A 4BNFA 2PSEA 3S2GA 1T2FA 1U4OA 1ZL0A 2XCOA 3EH2A 4GDMA 4GG1A 5JZ9A 1SA0B 2B35A 1THGA 4J75A 5FOWA 3WKAA 1BXZA 1TCUA 2GEKA 2XCRB 4UTPA 2HKIA 2JFUA 2JFPA 4JV5B 2L19A 4PLHA 3DAFA 3GLKA 1XPOA 4OQQA 1JN0A 1N1GA 4MX8A 2UDPA 4Q12A 3MXTA 5G0TA 1L5RA 5IUNC 3QNWA 3L8EA 4IIEA 3KXDA 4F4HA 3KQNA 2JRCA 2VYVD 3TI9A 4EMUA 1V41E 4DNOA 4BAGA 1Z22A 1RLIA 1QP7A 3DNMA 1E8MA 5T3UA 2X3YA 2HO5A 4B5LA 3QLUC 4BO2A 4YUYA 2QZ4A 1MJNA 5IWAB 3STVA 1O6CA 3RRBA 4I36A 3DAHA 2ERYA 3JD1A 4FW9A 2ZBRA 4KXFB 4UCQA 3CVUA 2R6JA 1Z4IA 3OZSA 3GEHA 2H59A 4I1OA 3I42A 5EJ6A 3RSQA 2IPOA 3FRJA 2B21A 4V1CA 1B4DA 5G2OA 5FAXA 1ICEA 1KMNA 3VSCA 4NK4A 5AM4A 2QZ9A 2FEMA 1HYQA 1SVMA 3U9LA 2JFYA 3Q2OA 4PHHA 3SBXA 4NDZA 2JA1A 5IDXA 2G06A 4IX1A 4CU2A 4G4JA 1WAMA 4LZLA 1XWWA 3O0DA 2J0EA 3CRRA 4YJFB 3TTXA 2Z8YA 1SD2A 4MVCA 3TAHA 3VRHA 2ZE6A 4E3WA 4RK4A 4KFCA 5LQAA 13PKA 4BQEA 2AJTA 3RUDA 3U4HA 2QYTA 3DH0A 2AMVA 2OAGA 3DO8A 4V0SA 5AI9A 4XX0B 4CQMD 4CKWA 3G02A 4OMCA 1BKSB 2GFIA 3VQTA 4MNTA 3R7NA 3O8NA 5JSZA 4BLSA 2FZCA 3B13B 3DBRA 4EI9A 3FMIA 1WZCA 3C6MA 3IAM6 2Q6LA 3W5VA 1FYFA 3LUKA 3RKSA 3KJNA 1GTJ1 1RYFA 3MRTA 4IRUB 2XWQA 3WWDA 1V4VA 3I1IA 3AEKB 3PEFA 4X8OA 4XJVA 1BXRB 3MXOA 3TZEA 3KUKA 4G0MA 1G7RA 4L3OA 4UBKA 4H4DA 5EHQA 4DZTA 4KDRA 4B81A 4I55F 4F2WA 1QO7A 4LDQA 2WWFA 1YZTA 1LF0A 1OLUA 4OYYA 1FTGA 2GOYA 3OEHA 4P08A 4UNNA 5IP5A 3A4YA 2Q4EA 1XQ1A 2VHWA 3Q6NA 3P2OA 4UTZA 4EYOA 4OHPA 2ZSUA 4NZPA 4IICA 1L1EA 4ZXFA 1AM4D 3DDWA 4F91B 3DLBA 3GJZA 3PNSA 4MS4B 1NC1A 1PJBA 3IUYA 2W71A 2WJGA 3LUJA 4HDNA 4JBYA 4LAFA 2BM0A 1GO2A 1GD1O 2IEGA 2WZCA 4R51A 1OU4A 5GONF 3ELDA 4ALLA 1G60A 1YJ8A 2ZSAA 3Q8MA 4IKPA 3T61A 1BWRA 3TRHA 1EHYA 4NU5A 3DB2A 4IDNA 3IULA 4J9VA 1L5HA 4WKPA 3UV7A 4GP6A 1JFTA 1S2MA 2CHEA 2Z58A 5TPZA 3CTMA 2QPTA 5FLEX 2FEAA 1VLJA 1WULS 1H8HD 3FJ1A 3PC4A 4G36A 3PVSA 4BMSA 1R88A 2HSWA 4RMGA 4GXRA 2GD1O 5ITZA 1Q1ZA 5DP2A 4AF8A 4TKUB 1WUIS 4Y9TA 4EY8A 2OSBA 3FFBA 4ZVKA 2FWAA 3C74A 4PZYA 2X0DA 2P2CA 3R9XA 1KMQA 2QAGB 2O4CA 5AJWA 3HDQA 2GUWA 3QV2A 1LD3A 3HCOA 1GA4A 4JAVC 4UHKA 4UVDA 4KQXA 3PJRA 1CRWG 2SHKA 3PWZA 3A9WA 4J1NA 1NQOA 1O0BA 3HY4A 1K6JA 4IL5A 3W7VA 2QL7A 5AK5A 2ZBDA 1JHAA 4HPXB 5K0SA 2IS6A 3I9V1 3FDZA 1FNNA 4F6LA 4B9AA 3IL2A 2H7VA 4MW9A 3FZEA 4AY4A 2ODAA 5A0TA 1Y81A 4DCNA 4I3GA 3PYXA 4K9RA 3ENZA 1ML3A 1TZBA 2D00A 1N9GA 4CF5A 2QTCA 3GPBA 2WWHA 1ODFA 2CV1A 3GPLA 4LHYA 1VHQA 4MGYR 3RU3A 1IULA 5BYAA 3B9PA 4CEHB 2XQKA 1FRVA 2QYOA 2YVAA 4LK2A 4NCKA 3I64A 2OT3B 3BGIA 3MCVA 1EXDA 4RVOA 2KM1A 2A9PA 3DVAA 3IP9A 3HVUA 3LPAA 3KUDA 3P2YA 1NVEA 2NXJA 3U4MA 2QE7D 3NPAA 4DW8A 2GDJA 5IKOA 3MAAC 1C80A 4BNYA 2MSWA 3IBFA 3OKAA 4K6MA 2D8MA 4TQAA 1YZFA 5I8PA 2XAUA 4DS3A 2HREA 4IXMA 5G0SA 5C51B 1GXSB 4RGQA 2VYVA 3P9ZA 1XEXB 3AERB 2NYVA 2YXDA 2PMDA 2V54A 1QYIA 4RQAA 2OCBA 1CY4A 1KOJA 1NP3A 2A5GA 2I34A 3A9TA 3JQRA 2PAAA 3EG9A 3VBCA 3E48A 2PT5A 3IAEA 4GE3A 4NMLA 4ADSG 5FEUA 1T4MA 3ZBTA 4X64B 2V6IA 3H5TA 1QTIA 1NUAA 3OOSA 3WGQA 1D2CA 4HRXA 1ECGA 2CF5A 1XLVA 1HFJA 3DKVA 3FF1A 4JMPA 5K0LA 1U2RA 4R1SA 5B1DA 1U1FA 1E3WA 3WL7A 2DETA 3L8DA 4TUYA 4G56A 2KX7A 4R68A 1V43A 1II0A 2OQRA 3CPHA 1WMBA 4TL9A 5KHAA 3TNLA 5DYWA 1M1UA 2CEAA 4TM8A 1OE0A 2XIJA 3AI3A 4QLBA 3PNMA 5GJCA 2NSHA 1NSYA 1TUIA 2Q5JA 4ND5A 2J3JA 1T5HX 1ZUHA 5F73A 1SIUA 5LQKA 1VZ2A 2W6QA 4IJ6A 3L7JA 4GU5A 3K0AA 2VAWA 4JL5A 2OENG 4RW0A 4ZHSA 2ZR9A 4F1KA 2J0SA 1QE3A 2Q49A 1M2OA 4IDFA 1QJCA 3OHSX 3SY8A 2VDUE 2C82A 1N33B 4CQMA 1SU4A 1Z7WA 5REQA 4B3MB 4WW0A 3L05A 5F21A 4TRJA 4FYHA 4O3FA 4DIFA 2IIQA 3OZ7A 5IYZF 2PZ8A 1X7WB 4MQBA 4Q24A 5JXIA 2O7NA 1PD1A 5EIFA 4Z53A 4YMGA 5HW0A 3EIFA 4YROA 1KK0A 4G1BA 1JU3A 4HLQB 2QTNA 1U0OC 5BN4A 4HNAA 1E6WA 1I1HA 2HRQA 3OEYA 3ZKAA 4DNXA 4F3TA 1N5OX 3CRZA 2JIPA 2GEFA 4OYLA 3DCNA 1OI3A 5HQJA 2IXBA 4QGSA 2WWYA 4PFKA 1OZAA 1JFSA 1PJ3A 5CGQB 1TZKA 2QPAA 5JPDA 5JTTA 2LZ0A 3DMTA 3NZEA 1MG5A 4R8LA 3ROQA 4DLZA 5JUWA 4WBNA 1C4WA 2WABA 3NHJA 1NXQA 2ZT7A 2A92A 1WHTA 1E2JA 3EC7A 2BUBA 3K15A 4KO3S 7REQA 1P1IA 1L5SA 4HWSA 4DJTA 2YXPX 3I9LA 1KP3A 3UPUA 5AUNB 3CH5A 5AI4A 4E13A 1RWKA 2SNIE 3F6CA 4NPHA 4P9NA 2Z43A 2WINI 4UXJA 2VDWA 2WM9B 5KSWB 1NOKA 3DCJA 5H70A 4BVKA 2LRHA 1RR6A 4D92A 3ORSA 4L9SA 4E22A 3ZJ5A 1EFTA 3JYPA 3KTDA 2P3LA 4J2TA 2LCIA 3DE4X 2ORVA 3O9VA 5JCOC 3T1HB 2BYTA 2WHRA 1T34A 2FK7A 2WU4A 3K1YA 1DC3A 1H8HA 4HVTA 3TW8B 2RD2A 4WZAA 2FEWB 1V16A 4C1BA 3W1VA 1FEZA 2J0UA 1J09A 1SOMA 2GHQA 3K2QA 1E3MA 4MV9A 4Q3BA 3UC9A 2G1PA 2VUSA 5HIKA 3RK4A 1JKJB 2HUPA 2ZJ0A 3OCVA 2FSVA 5SZJA 4XOUA 3MTIA 1CDOA 3RS3A 3A7DA 3TOVA 1P7PA 4G0WA 4KOEC 4RK5A 1JXQA 1GUDA 2C98A 5T7BA 3OBBA 3HKEB 1N1DA 1M34A 3HKDB 4GOOD 4MS3A 4CRWB 1TFUA 2BEJA 2H1WA 3KQUA 1FVHA 3DVQX 3S1SA 1YIOA 3A6EA 1D1PA 3B8EA 1J23A 4NU8X 5JY6A 3UMMA 4JKIA 2I4RA 1W49A 1FFAA 4MP3A 2AZ4A 3B51X 5F3DA 3FOZA 3SC2B 1C0LA 2VBIA 4W1SA 3VDRA 2G63A 2BI8A 3FMOB 3V4LA 2MSLA 1Y1QA 2ECQA 3ZU5A 4ZGWA 1U2GA 2W37A 4GKKB 2Z6AA 4YNBA 1FDUA 5EE9A 2GS9A 4TQUS 4K03A 1YZHA 3QFSA 3N8IA 2XWJI 4LMPA 1Z5OA 1G98A 4HVAA 1BZYA 3GUHA 3KTFA 3HCBA 4Q15A 3UKOA 1O6GA 2G70A 3MPUA 4NBLA 1FX0A 2HRRA 3SYRA 1L5MA 2NADA 4IIXA 1RQLA 3UJ8A 3KR0A 4RS3A 1FMTA 1LBSA 2UZ1A 3BORA 3E53A 2AMYA 4G4SP 1GCOA 4JNKA 4TTQA 4EMBA 5IYZA 2B98A 1CS0B 1HTBA 3S2EA 4XWWA 2QE7A 4QGAA 3B53X 2H92A 1ESCA 1Z38A 1Y9JA 3PA8A 1R18A 4QOIA 1U99A 4QE3A 1C81A 1ZD4A 5J3JA 2ZJ5A 4BYGA 1XN1A 5LKRA 1T1GA 2Q27A 1RKUA 5HIAA 4KPFC 4F5YA 3HJFA 3FOBA 2CNOA 1MUUA 4TQ9A 1LA2A 5IT4A 2QI9F 2GEUA 5EP2A 2ZSHA 2HF9A 1Z4LA 2XNKA 4ZT2A 2ZRGA 2FOXA 1NPTO 3N7AA 3DV9A 3GJ0A 4RH0A 3DOEA 3FXAA 1M75A 1VKZA 1QOQB 3ETGA 3EAQA 4FCWA 5AXCA 4DBLE 3PIDA 5B7QA 3RK0A 3WGUA 3QPDA 1N5KA 2WIFA 5ANRB 5KNBH 1U28A 3LT2A 2H1VA 4MS1B 2F4VB 4P92A 4TSFD 3OAAD 2PN1A 3P19A 1W34A 4DARA 1NURA 2ERXA 1MJFA 5EZ5A 1WLYA 4LWZA 1EK0A 1SHLA 1ULAA 3KOZA 2HJHA 2Z9BA 2ANBA 5EZSA 3W3ZB 5CBPA 1JSZA 4K9MA 1E9RA 3K5PA 4TMKA 4YBZA 1X9GA 1I24A 4RFSB 2IHJA 1R6TA 3GU3A 4NJOA 4KBGA 4Y1GA 2GX6A 2HTFA 2OCIA 4PLPA 3D6FA 3PWSA 1ZX1A 3LH5A 1P77A 5B3JC 1F6WA 4OJNA 5ELLA 1T5BA 3R77A 4LQDA 2HMTA 4W1PA 2PSJA 2JIBA 2ZCUA 5K3CA 1OH5A 1L1RA 2QN6A 3A1EA 1UC4B 1AIPA 1U3TA 1UMBB 4KQ9A 2VNAA 5DH9A 1GSAA 5LC1A 5A0FA 1KYXA 1PK9A 3O75A 5KQLA 1N3BA 3NKVA 2E4AA 3FLMA 3R5XA 3QZUA 1R0KA 4JK3A 4KIFA 1FDOA 4JLPA 3VH2A 1EE2A 1KJWA 1R27A 1S8FA 2JAHA 2XMBA 3R5JA 3EFOB 3LZDA 4ND1A 3TIGA 2ZDGA 4J0GA 1L5QA 4V0QA 3NXKA 1V1RA 2OR3A 2JI8A 3JARA 4YAEA 1AHNA 5D7NA 3SVLA 3ZDBA 3B1XA 2XXAA 3EF3A 4F0JA 3M0EA 1P72A 4RK7A 2JAXA 5SZKB 5KVVA 3PR2B 1BMFD 1GGVA 4S1NA 1E2HA 3D4NA 2GPAA 5GONB 2ZI3A 1QQ6A 1XTUA 2YMPA 2EJWA 1UWVA 4LDRA 5IANA 1QONA 3QIVA 4FMDF 1I4TD 3D2AA 3M6MD 1X7HA 1GKYA 3IGFA 1JI0A 3ZDEA 4MV4A 2W42A 3G2JA 3WIVA 2V7EA 2OC4A 2ZIUB 1ISPA 1T36B 3LWZA 4Z9XA 3DBLB 5CVJA 3S4YA 4ZCIA 1JKFA 2CFTA 2W2VA 2G1JA 3ZCTA 5IAAA 1LWOA 4F1JA 3W6ZA 5AD1A 1AV7A 2PPVA 2Z08A 4CHTA 2ATEA 2IKSA 3UIEA 4P82A 2H7CA 4I6GA 1W46A 4TL6A 1F2UA 1Z5PA 3QFRA 5BMVF 3D31A 5D3MB 1WWKA 3LP5A 4RIIA 4JLUA 2YVKA 4MHSA 1FSZA 5FPQA 1YZYA 1RHKA 2IPAB 3T3IA 4PX9A 1E9AA 3D3WA 1REQB 3W9SA 3NT5A 4X6UA 4ZZIA 5K0ZA 5KOYA 2OLEA 3ZOKA 2EFEB 4N0QA 5D3QA 5HOEA 3MLEA 4MW7A 2YH2A 3PFBA 4LCBA 3UAGA 3TLGA 4GRIA 2H2FA 1EM6A 4A92A 3CPEA 1R5BA 4AROA 2W70A 5CIYA 3HJUA 2NUTA 4ZHQF 2X2EA 3U3MA 2HHLA 4GD3Q 4J16A 3GLIE 4XQ0A 3ZHYA 2ZJ1A 1DLIA 5TQ2A 1L5YA 4JU9A 1RC1A 3F96A 2M1ZA 1XJCA 5EFOA 4DCCA 2NU7A 3CONA 2ZYAA 1VL0A 3Q3VA 5JRZA 3U1BA 4FD3A 2CL0X 1U9IA 3RRNA 1VJ1A 2WNIA 5HKKD 5LLSA 2P0EA 5BQPA 1I2AA 3O8CA 2BW0A 4QXPA 2RJOA 1E6MA 2C2YA 1RYNA 1TFRA 1Y6ZA 2JRLA 4OH7A 5BWBA 2IFTA 4PLWA 1M0SA 1GAJA 2FPLA 2IEZA 2IYEA 2J30A 4AMBA 1YE8A 3QNMA 1CY0A 3TPFA 4N5NA 5A4IS 2DUUA 5LZ9A 1KAEA 5EYPB 4KYIB 4ZQIA 2WAXA 2UXCB 1KTVA 3PZBA 4P32A 1EA5A 1O03A 2GCNA 2PUCA 3OQ6A 2CDNA 4FXOA 2P27A 2VJBA 4OK5A 3RUFA 3AF6A 4MRAA 1ZFNA 2I9PA 1RRMA 4BNDA 3AMVA 1CEQA 4G5RA 2YVUA 4S05A 2ZUUA 1LLDA 2RAVA 4LJ5A 1QPZA 1MEOA 2Y1WA 2HSJA 4WK4B 4LFAB 4AKSA 2D13A 3RJZA 1QHIA 1PTJA 4JEUA 2WFMA 3HYNA 3UFXB 2HDWA 3DAPA 1UKVY 3FCOA 3GJ3A 5IWCA 1GNPA 4ZI7B 1YZQA 2UVPB 2VSXA 4N3NA 4JFRA 5K0EA 3V1LA 4R8RA 1P7YA 4ARZB 3T52A 2QRKA 1EDEA 2IHTA 4QJ4A 4DIKA 1FFYA 5BSVA 2DF8A 3IVRA 3NIBA 1CJCA 3KEMA 5FI5A 3FWNA 1PFYA 2DSNA 2W58A 4D96A 3OAAA 4GX5A 4O3MA 1KRWA 2XDQA 4ND6A 1GG9A 2ZUVA 4OO3A 3TQIA 3UGQA 1V26A 1V47A 2CVZA 2WFLB 5E38A 4EA6A 1RFLA 4KEAA 1AQ6A 1KDYA 1DE0A 3VM6A 1R4MA 4CL8A 3VSAA 1YQEA 1QIJA 2ZTLA 2QLMA 2BFFA 2PUGA 1EVQA 1S3FA 3CNHA 8ADHA 3PDJA 4JH0A 4KQ6A 1NFQA 1Y5LA 1B42A 1M2FA 1Z17A 4ITVA 1GTMA 2ZSFA 1RMQA 3SFVA 3UEOA 4JYZA 1SVSA 1AQLA 4DRXB 3DZKA 1G19A 4WZ6A 4YT5A 4WADA 4BUCA 3WTBA 4CCWA 4W8GA 4MQ5A 4UCWA 3TOCA 3ZDRA 2HXSA 1TF7A 3DWGA 4ZOQI 5EWJB 4FZVA 1E7QA 4WXHA 1USVA 3VJKA 3KXPA 4RHCA 2F6RA 4Z8XA 5TY0A 4AN0A 2O2XA 1G8JA 2HA5A 2G4VA 3KQPA 1FNMA 1GRCA 2NZ8A 2Q3MA 2GWRA 4AMUA 3UOAB 2ZBFA 4FWTA 2PSSA 4DWOA 3HJRA 2PGXA 4JQYA 4AECA 3QWHA 1JILA 1ZD9A 3H5WA 5TSDA 3BWMA 1BMFA 1J70A 5HIMA 2D06A 2OP0A 2V65A 3KU1A 4KVAA 3MD0A 1DDGA 2BFMA 4ECAA 4L5AA 3TVYA 2W5UA 3GMDA 4WLUA 4JJ6A 1JIXA 3ITDA 5CX1B 1FPQA 2YFQA 1UMBA 3U6BA 2CGEA 4I55A 1ZOSA 4XGQA 1JWBB 4MR8A 5CUQA 1EMDA 2XRFA 3H17A 1YIDA 3DONA 4AWAA 5BWMA 5H4GA 1E1QD 2I62A 4LWQA 5L45A 5E1MA 4Q4JB 1N5RA 1AKUA 3OZUA 3V3KA 4Y2HA 2C9BA 2ZI6A 2JCGA 4LYDA 1H66A 3QUSA 5CFPA 1PSZA 3R3JA 5IBRA 1P2SA 2IDZA 4L9WA 2QP4A 1ISSA 4ZQHA 2C2BA 5FBRB 4EL5A 1DWOA 3D4IA 3Q7RA 4NCXA 1VPTA 1OB5A 3LSTA 4FGKA 2FPUA 5DI3B 3RWOA 1R16A 3C7DB 1E61A 1PYDA 3F0TA 3IPCA 2OFWA 2W00A 2E4ZA 4S24A 2UZ0A 2ODBA 4P2GA 1XCPA 4AIRA 2VPQA 1SWVA 3D6AA 2QR5A 5BWOA 3NT4A 2QKYA 1ZJJA 4QTYA 4G0NA 2P9HA 3MS2A 2DBYA 2GZHA 3C6XA 3HHEA 4TS1A 4YDHB 3WG9A 4EG1A 5C5DA 2X8BA 1Y3FE 2OFPA 1J2JA 3KPUA 3UAVA 1KK3A 4MJXA 2PL9A 1XD2A 4DNFA 3M5WA 3W6NA 4IVQA 4U6NA 4R7ZA 3KDAA 3IXMA 2XA2A 3U1TA 2N47A 1RQ7A 5ARCA 3ZZMA 2XODA 5DDIP 2VT3A 1T3ZA 4NNOA 5HGJA 2NAPA 5F1KA 3OM9A 5HKKA 3C5EA 2JCYA 3MS4A 4YXWD 2PQMA 4OK6A 1JA1A 2WT8A 2WUEA 5J2UA 3P20A 4K6KA 2FWNA 5EHGA 1D09A 4QX6A 3ZDCA 1Z47A 1WW2A 5FB3A 4DR4B 5DLYA 3X2SA 3REFA 3PS9A 4K86A 4LKRA 2YDYA 2F8TA 5CDGA 3EF1A 3LCMA 5EOVA 3T7RA 1TM4E 3AL3A 2BLLA 2D3WA 3FCCA 1ONNA 2OO7A 4M0FA 3TMYA 3D6JA 4ARCA 2B34A 3W4IA 2O2IA 2CXHA 5FCDA 3IV6A 3QLTA 1TYEB 3VZPA 3K7EA 4PFSA 4C2AA 1P80A 3JWHA 2QNIA 4MA5A 1EFHA 1NM5A 3AVTA 2A14A 4PG8A 1VXRA 5LMNB 5KB3A 2O8BB 2GLUA 1FDIA 4AYTA 3CF2A 4B46A 3BQ9A 1EB9A 3C5WP 4XR4A 4P7KA 1FNDA 3CF4G 1JDJA 2E18A 1T8SA 4MUEA 5AQ1A 3IJPA 1RBYA 4MI9A 3UXYA 4YMWA 1FLVA 1GFIA 4AM8A 4CM1A 1ZPDA 1M9NA 1ISRA 2QQGA 2YVLA 4XH9B 2P6MA 4LNUA 1AN0A 4MAFA 4RVGA 4RBNA 3ZKWB 3CC8A 4FZJA 3IBYA 2RGUA 1BX0A 3L0OA 1O5OA 1K63A 3OJXA 2JZCA 1E79D 3NC1C 1Q1NA 1EZ4A 1GCUA 2FW9A 3HB5X 3LPCA 3UPDA 3UATA 3JYHA 4YLYA 2EL7A 2NP6A 4C0XA 1Q1BA 2O7QA 1KSFX 4YWJA 3ZBQA 4R2IA 5CFRA 2NO1A 4LGCA 3TQTA 2AN1A 2IDJA 1P5FA 5EXEA 3WWOA 4EAAA 3T1NA 4KXXA 1ZWKA 3MWLA 4WKCA 5C4GB 1MB9A 4UAJA 4MB2A 4JZYA 4Q1BA 2QRVA 4QQNA 4XFJA 3ANTA 5M34A 2EWVA 3KFVA 1G55A 1G16A 4OFWA 3HB4X 4FCVA 4TMVA 3DPUA 2VHTA 2O8EB 2KHZA 4DLXA 5EP1A 4BO7A 3H04A 1OUMA 5JJ5A 3BXGA 4C7BA 1NLUA 1ZINA 1E2EA 2I22A 4IZOA 3Q2KA 1HT0A 4CM6A 2YXNA 1BS2A 1PV2A 1YV9A 4G0PA 2H18A 3HS3A 1N25A 3L07A 5BV2P 4ZCSA 2VXCA 4CT0A 3VTAA 3PJDA 1E6LA 4E33A 4P22A 5A7GA 1R10A 5F7OA 1CQJA 2F3TA 3NTXA 4R0NA 2WFLA 4RJTA 2AFRA 4RO0A 4UMDA 5JT1A 5JSQA 4FN4A 4EGAA 1KH1A 1USWA 3LLUA 1YJBA 1TUBA 4KKXB 4PZDA 4ZA2A 3TZCA 4AC9A 4XIYA 4BFXA 3NR2A 5ALXA 5CDSA 4D9MA 3C39A 2PUJA 4RCYA 1IUNA 2VEOA 1FW6A 4MYSA 4V0NA 3I92A 4EJSA 1WXXA 3AKYA 4WLFA 4GLOA 4DRXA 4QYIB 1JTEA 3CGWA 4MDFA 1KEZA 4L4ZA 1HQCA 1BQ4A 3S40A 3JVDA 4QTTB 3X2EA 4A6EA 3E7FA 1OFGA 2ZK7A 5G53C 3CURA 3INYA 3HA3A 1SXJB 2JJMA 5BMVB 2Y0DA 3IVGA 3ZGNA 5B4VA 1E1QA 3QUQA 1W96A 3BB4A 4FUQA 3C4QA 3ANYB 4JODA 3FD8A 4L8LA 4OF4A 4U9HS 4WY8A 4CTJA 4C14A 1CLUA 1HDEA 2F2TA 3NG1A 3DDSA 4H35A 4UE2A 5IG2A 4YCBA 1CY7A 1YOVA 2V7WA 3TRDA 3E5HA 4FFRA 2GJ4A 4PC6A 2H2AA 2MYTA 3FSGA 1PV4A 2CFIA 3U1VA 4BOYA 1E69A 2I5PO 2B8WA 3PUHA 4ZHQB 2IIBA 4OQFA 3RAFC 3PUJA 4GUDA 1W52X 4M49A 3FCXA 3S99A 1JXAA 1I1QB 4L15A 1QQ7A 3F97A 2ZRFA 4W7HA 5JHGB 3HH8A 1YHZA 1GEEA 2Q3HA 3B20A 3OD5A 4N1AA 2WILA 4LF8B 1YF3A 5JNSA 1IMJA 1G2OA 1Z07A 4E31A 3NDRA 2IYOA 3BK2A 5IW8A 5L53A 1KEPA 1BXGA 4I5EA 4YMIA 3TTTA 4BDTA 1XTVA 4DC1A 4F4DA 2PE5A 1R3UA 1SVWA 5DRTA 3DUFB 2R7AA 1A50B 1M3SA 5TMDA 4TWJA 1IJEA 1S2LA 1U3VA 4MA4A 3O8LA 1NW5A 1ZIOA 2OBMA 3L7KA 4YXWA 2DY0A 2C0CA 1XXLA 1TF5A 4NYIQ 1NPDA 2PEYA 3BSYA 3O8OB 4D5GA 1PV1A 4MR7B 2R00A 4DDHA 2YZ2A 3ECAA 5LA6F 1YRAA 4AJNA 1IIBA 4PAMA 1O5TA 1NBME 4ZCRA 4O63O 3L0DA 2F8SA 3NI2A 3K0EA 3OE5A 1URPA 3SHVA 5EMMA 2PZBA 3RYTC 3TKYA 5CDUA 4XSVA 4KGXA 1UPBA 3BMOB 1J42A 1GPDG 1W85B 5ED4A 3M1YA 4X62B 1GZ3A 1I9GA 1HDYA 3LBYA 2E82A 4OHZA 1U2SA 3I52A 3KRTA 1KERA 4AJKA 4ENVA 5IEBA 3QEMB 3A1NA 3K9LA 1E4EB 1FK8A 2OCPA 1L7QA 3G23A 5BQ5A 3SMVA 3GWGA 5P8WA 1KR5A 1NVFA 2ALJA 3HPRA 4PRZA 2Q5FA 2OORC 1BGXT 3RSFA 3LI2A 3PDCA 3NHSA 5JY1A 4L8FA 2V7PA 121PA 1I01A 2HCTA 2Y2UA 3FYHA 1FRZA 2FPOA 2VR1A 2P30A 3DR5A 2FF5A 3L8ZA 4K9LA 2A4KA 3R7DA 1E79A 5KQSA 2TSYB 5EXPA 2FPWA 3UJBA 4NG4A 3G2QA 3GBSA 2OL4A 3C5CA 1LS1A 4Q02A 4XM2A 5DIZA 1LBQA 4AY2A 1CUIA 1D03A 4ILKA 3VDNB 4CBVA 1T2NA 2VA9A 1S2NA 3L4EA 2AT1A 1FQJA 2O6HA 3F5SA 3ZHZA 3KQKA 4V1CI 1QFXA 2GH1A 2JJYA 3C3AA 1Y8ZA 2WU1A 2EIXA 2Y05A 4FGUA 1KI4A 2WF5A 4X7RA 1XAIA 3VYVA 4C0SA 4JHLA 3PNBA 1LVHA 1IVSA 2ZKIA 2QRUA 3AIKA 3EISA 3R6GA 4RD4A 2QUHA 1BDMA 5TB5A 1Q7BA 3BIWA 1DU4A 1X1DA 3EQZA 1P4RA 1RAIA 4J2HA 1F5SA 1MZVA 2MINA 3IIJA 3JD3A 3PICA 4M37A 1QFYA 2QN9A 4BZPA 3PEWA 4K81B 3F67A 2XH8A 5EA2A 3PV0A 3U4QA 2BGWA 4FHDA 1OIWA 3N7UA 5DVZA 2V7XA 4D56A 2VQDA 3PQFA 2AEEA 5DT9A 5KMGA 3R7BA 4H0CA 2EZ9A 1EUQA 2ODEA 1EFKA 3ND8A 3CMCO 1N2CB 1FL9A 2HNAA 3BILA 4MV7A 3ZJ4A 1ZGBA 1IK6A 4DBZA 1M54A 2BFOA 3EFHA 3NHMA 3URKA 4DADA 1W581 3OJFA 2X23A 2VHUA 2PUBA 3Q9NA 3Q9SA 5FFNA 3LE8A 4F9EA 2BGNA 4JCOA 5E4YA 1KEKA 2XTJA 1YRHA 1V7PC 1GIAA 4BXOB 1W8DA 5TDHA 4RHFA 5AW6A 3CB2A 5IJ9B 1DIHA 1JTVA 4H60A 4FHCA 4DJDC 2BKVA 1H93A 3HKCB 4IHAA 1GCGA 1H85A 2C8VA 2HAEA 2N0SA 1LI5A 4F2HA 5A3JA 1A9TA 1OD6A 4JR1A 4KITB 4KWEA 4FNMA 2PUDA 1YVEI 2C4MA 2P4HX 3PGA1 1KO1A 4NWIA 3H8JA 1P60A 2FWBA 2G71A 3MHPA 5FADA 4R6WA 2XUIA 1MJGA 3H8VA 2O19A 1OXMA 3WXBA 1FNSA 1ULHA 3AJEA 3CUKA 4H31A 1M8KA 2PIAA 2C4TA 2V55B 2WW8A 1ORIA 3DQPA 4EUSA 1KOFA 4XUEA 1KO7A 2V03A 2RGBA 4YRGA 4KUEA 4ZYWA 4AUMA 4B43A 2X22A 5HDBB 3P0JA 1I10A 2FSGA 4GO1A 5IT0A 1ZLXA 3GX1A 3PCRB 4EECA 2X4GA 4MROA 4EHAA 3OU6A 4J0IA 1S02A 3EJ6A 3KX2A 4XB2A 3VYRB 1NXVA 1NXOA 2HWWA 4IGKA 4J4TA 1E1CB 4L76A 4D2IA 4N6GA 5EMJA 2OD9A 4FFOA 3HTXA 4I0WB 3OC0A 4YCLA 4B7CA 1FFXA 5HKLA 2F3SA 2F48A 2X8AA 2QMEA 1S1MA 2MOKA 1EFPB 3NWOA 3PQDA 4FR5A 5ALDA 1PT6A 2GK4A 3NYQA 3PITA 1VKNA