4D9GA

Crystal structure of selenomethionine incorporated holo diaminopropionate ammonia lyase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
387
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diaminopropionate ammonia-lyase
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 119
structure length 387
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA01
1A5SB 4JBNA 4HO1X 3R0ZA 1D6SA 5IWCA 5KZMB 1WTCA 2J9XB 4XUGB 1K7XB 5DVZA 4D8TA 1KFCB 4IL5A 3VSAA 5I7HA 4D92A 3T4PA 1TTPB 5EY5B 3V7NA 2RH9B 1O58A 3SS9X 1FCJA 2ZSJA 5I6DA 2GN1A 4D8WA 3PC3A 1CW2B 2ECQA 2Q3CA 1WKVA 2RKBA 1UINA 3L6CA 1K7EB 1J0AA 2EGUA 4L28A 2J9ZB 1QOPB 4OFXA 5D87A 4F4FA 2TYSB 4HPJB 1CX9B 3IQGX 4D9MA 3VSCA 5IW8A 2ECOA 4HPXB 5I7OA 1J0EA 2DH5A 2O2JA 2C2GA 2BHTA 2JC3A 1Z7WA 3AEXA 3IQHX 4NEGA 3X43A 2CLMB 3ZEIA 1RQXA 2CLIB 4I1YA 5HBGA 1VB3A 4D9CA 2RHGB 4D9GA 1TZKA 5B36A 1K8YB 5D84A 1TYZA 1WBJB 2TSYB 4L27A 2PQMA 5B3AA 4D9IA 1KL7A 1J0CA 5DW0A 5E0KB 2CLKB 1FUYB 4D9BA 2Q3BA 1OASA 2ISQA 4D9KA 4D96A 1P5JA 1TZMA 4LI3X 2CLLB 1KFBB 1VE1A 2EFYA 4NU8X 5CGQB 5I7RA 4WX2B 4HN4B 1A5BB 5D86A 2Q3DA 4Y6GB 5J5VA 4ZU1X 3VSDA 3DWIA 4D99A 2DH6A 2O2EA 4L0DA 5IXJA 3DWGA 1TJPB 2CLEB 3VBEA 4KKXB 2BHSA 5DBHX 1M54A 1K8ZB 1PWHA 5JISA 3CEPB 5I7WA 4AIRA 2WSYB 4L3VA 4D9NA 1A50B 1KFKB 1X1QA 1QOQB 1K7FB 4D97A 1F2DA 1TDJA 4LMAA 5CVCA 2CLOB 3RR2A 1J0DA 3R0XA 3VC3A 5B53A 1Z7YA 5JJCA 4ZU6X 1J0BA 4HT3B 1V71A 5B1IA 3SPXA 3L6RA 5I7AA 2CLFB 1Y7LA 1KFEB 2TRSB 2GN2A 4COOA 1KFJB 5D85A 2CLHB 1UIMA 1C9DB 1K3UB 1C8VB 4H27A 5DW3A 3L6BA 2ZR8A 4ZQCB 1UBSB 3IAUA 3IQIX 4JBLA 1V7CA 1WDWB 1E5XA 5B1HA 4AECA 4D9FA 3PC4A 3HMKA 2D1FA 3FCAA 2J9YB 1TZ2A 1K8XB 3DKIA 3PC2A 3SS7X 2ZPUA 4LMBA 4OREX 4QYSA 5B55A 5J43A 5C3UA 3BM5A 3TBHA 1C29B 1BEUB 2V03A 5DBEX 3AEYA 1TZJA 1PWEA 5T6MA 4D9EA 1A5AB 5KINB 3PR2B 2GN0A 1BKSB 3FGPA 5BW6B 3X44A 1JBQA 1VE5A 4PCUA 1V8ZA 4D8UA 2C2BA 1TTQB
chains in the Genus database with same CATH superfamily
2GTPA 2ORVA 2I6QA 1A9PA 1C9NA 1TTTA 1EGVB 1JIVA 3BORA 1DPGA 1JR3A 3A6HA 3ZE2B 2QTMA 4I6GA 3DO5A 1LD3A 2CY0A 3HXKA 3SZRA 1SHTX 1HT3A 1HPLA 1ZN8A 4TKLA 1R1DA 3T6KA 4LRXA 3FNRA 1E3LA 1DKLA 4K9QA 1GGMA 1DBWA 2YQ4A 4L5BA 4P58A 4UULA 3ZHRA 1BG6A 1VGRA 3A1EA 4Y6LA 4V1CA 2W8ZA 5ER6A 3HJBA 3EISA 2OYCA 4XVUA 1F5SA 4JUIA 5EJMA 5ECWA 1M2NA 2OXRA 3ILVA 3P20A 3ZV3A 5LYYA 4IDAA 5J2TA 1B0PA 1SVNA 5HMLA 3TKLA 3D2BA 3GP8A 3AEXA 3L01A 3LLVA 4NBLA 4YEDA 2QX9A 4YP6A 4D79A 2C1EA 3RYFA 3AHCA 3GRYA 5B57C 3ASZA 4MQUA 3HVIA 4CYMA 2JDIA 4O8CA 2I7XA 3ISTA 4D8YA 1TRHA 3C3MA 2R25B 4ZQGA 2RG7A 3BCUA 2B4RO 4GICA 5EXPA 5IAAA 4G01B 1KAOA 4ZCLA 4NMXB 1S4MA 4K81B 4KODA 4ZI7B 1X1TA 1CEXA 2ISQA 4WADA 3W2IA 1TEHA 1E4YA 2C2MA 2QUAA 5CX1A 4N47A 3T94A 1N0HA 2QZ9A 2ODNA 2C3UA 3G7SA 5CTJA 1QNLA 1U2QA 3LUDA 4UHCA 4BVBA 3U6KA 5H8WA 4JKOA 1MA3A 4I55B 2QUJA 1EU1A 2J6IA 1C8BA 2OECA 5F7ZA 2N42A 3RUHA 3E70C 3RU7A 4BNDB 2CWWA 4RIIA 4CQNA 1T2UA 3DDNA 5JHGB 5JZBA 1GG2A 1NGSA 2AZ4A 1Z8DA 2OORC 4D46A 4ESEA 4S24A 4Q9LA 2FEAA 3B89A 3K2BA 4M9RA 4ONEA 1IBMB 4HLQB 4ZV4A 1XKXA 1TMGE 5K0FA 2IXDA 3C6YA 3N28A 5FOXA 3V4RA 3GLFA 3SQXA 2GR9A 3DLTA 1E3WB 1T8WA 3D1LA 4GKBA 1H6DA 2ZJFA 5E9AA 2XR1A 2JARA 3KR9A 1NXPA 1LPBB 1QH8B 4FYMA 4U5XA 4B3MB 1UBNA 2JZNA 1V3VA 2XZDA 3DE0X 3U3MA 3YASA 1NBMA 4UUNA 3E61A 3BL6A 2EAUA 3KCQA 1N2CB 3MYRA 5B3KA 1IWPB 1KVTA 2YICA 4K6GA 5IUKC 4L0MA 1A8UA 3H6KA 4P80A 3QEMA 3HZHA 5EIOA 2WF6A 2NMVA 4OOFA 3THYA 3C5VA 2FU5C 2XUPA 3D54D 2GBLC 3V97A 4NH0A 4TLBA 4D9FA 3K1AB 3AOGA 3KKQA 2A9FA 4HZIA 1TM4E 3WE7A 3I6ZA 1IN8A 4WNAA 2FF5A 5HX7A 521PA 5JAMA 1SD5A 2F9FA 1JQDA 2C7RA 1CQIB 2A5DA 3JU3A 4HLDA 4BVLA 3WBKA 3PFCA 5BR7A 1G16A 1Z6TA 2PMKA 4LE1A 3JAWA 2ZI5A 5G2OA 3X1ZA 1Y8QB 4DCUA 4YUWA 3DKVA 1YFZA 1JU9A 2Z9BA 4YJ2A 5G4KB 5K0ZA 2DMRA 1ECCA 3V8PA 1QCCA 3NHSA 1EZZA 3C8DA 2WPDA 4H1HA 1K6JA 3ADKA 4NBTA 2JIBA 4KMOA 4Z86A 3IRUA 3WRVA 3R9IA 3ZWQA 6YASA 3PUYA 2CVHA 1YONA 3CMCO 5JSHA 1HK7A 3JQGB 2FCRA 3KNZA 4BQSA 1ZJ4A 2QM8A 3T4EA 3AT1A 4G2NA 5AP9A 2Y1KA 1G5RA 1R3UA 3CEMA 4RZIA 3EA4A 2AFIE 3NDBB 3V9AA 4EMSA 2GN8A 2OG1A 2X14A 1E6KA 2R00C 1ZNQO 3PVZA 2ERXA 3Q88A 2AOUA 3HO6A 4TTVA 1XCJA 4EJSB 1ZH4A 3DUFA 4Q18A 2YWRA 3UY4A 3WLRA 1UR5A 4TV9B 1Q1EA 2WFLB 1P1IA 2A0KA 4CFYA 1CU1A 1HBJA 3LVFO 2HNBA 4IQFA 5EE0A 1ZCFA 3VYUB 4EPRA 3HYCA 1JR2A 2WZBA 3GFVA 4QPJC 4W4TA 2AVDA 4X3CA 5EHXA 1L7EA 4N6GA 1R64A 2QPOA 3DMRA 4JBWA 3U26A 3G17A 4OV6B 3S28A 2O0JA 4FJ1A 2JIRA 3C5WP 4F7DA 3H99A 1FQJA 2I4LA 1LS6A 1SVMA 4F2DA 2RGGA 1BQ4A 4JHLA 2WVHA 1PVDA 5DB4A 4DR7B 2OFFA 4YRNA 4N0PA 3EOZA 1GG8A 1DI0A 3PNOA 4DPMA 1YVUA 4REMA 2JFGA 4Z4IA 1C0PA 3M6AA 4DG8A 1XJ5A 1ZNXA 3FFWA 1ISHA 2PNJA 1DHTA 3USES 1L4EA 2CMFA 2LDXA 1TADA 2OCLA 4JC5A 3T52A 2P9ZA 2MR6A 3TRHA 2DGDA 6NULA 4EHDA 4IP0A 4Y6GB 5EUQB 1RM0A 5K01A 2Y1OA 4B6JA 2O0LA 3URMA 2H9AA 2QB5A 4CKWA 1X74A 1TI7A 2R6R1 5LNK6 4M9CA 1II8A 5E6UB 2AL7A 2BHSA 5DBHX 3ZR4B 4DV6B 2GTIA 3CT4A 5LYJA 1GDTA 4IM7A 5TDHA 3WYCA 5K0SA 1N9KA 3CRZA 1WHTB 4I3HA 2GJKA 1KFKB 3F49S 3QPDA 4B6RA 3O1IC 1ZGZA 4OFZA 2ZB8A 3ZGXA 3NTRA 3NTXA 9LDBA 1BFKA 3MFYA 3A1VA 4FOPA 1ISSA 5FWYB 3S1LA 4R54A 2XUOA 4UKDA 3L6RA 4K9RA 4F8EA 4G5XA 5B1EA 1OFVA 2PQ2A 5KVCA 2JFZA 3BKWA 4RIGA 3T3EA 1XVVA 1T2AA 4ZZ1A 2BMEA 1RYDA 3QM1A 4JI2B 3OOYA 4BUZA 3WWDA 3B7GA 3FYHA 5LMCA 1D2MA 1Z16A 3A27A 4NPAA 1QNFA 4G84A 4YUXA 4CR8A 4GI5A 2D7JA 2LZ0A 2AWNA 4NJOA 4KUGA 4ZYXA 3PR3A 1A9TA 4CRWB 2PX5A 4KCGA 2WJVA 1ZM2A 5INTA 5EE1A 4HBGA 3JYHA 1TVCA 2I3GA 2Z09A 3L8MA 1D4OA 1LS1A 2CK3A 1KPIA 1Y9EA 3LXXA 3G5UA 2FWPA 1LSSA 3DV0B 4QQNA 2IPOA 4NMMA 3CLSD 3WMWA 4E5KA 3W79A 3V8BA 4KHPB 2YWEA 2W2QA 4XZ3A 1M34E 3THRA 4DV3B 1RKQA 1E1RA 5CYGA 2H18A 2J3JA 5IU6A 2VJOA 1IHOA 2HPAA 1GYPA 1F14A 4EATA 1DG1G 2WIDA 4YP7A 1DG9A 2Z9CA 4BBAA 3E15A 3DJFA 4LOJA 3B1XA 3FYUA 4IJKA 1HQKA 1PQUA 5EIWA 3ZLVA 3ADCA 2O8FB 3O3CA 1POXA 2D2EA 3H2IA 4FYWA 3UKDA 1ZGHA 4YA6A 2DFVA 1UXOA 1UMKA 2W6PA 3H4TA 5JCJA 3EN0A 3TW8A 2Z1NA 1T6BY 3CO5A 3ECCA 3LUAA 2BMFA 3NG1A 4GBED 1XGKA 5L3SB 4NE2A 2PTHA 3EGEA 5KNCH 2FZ4A 3I05A 3NC0C 4TOIA 3L1UA 5JNVA 2IOFA 1KEKA 3DXYA 5ICFA 2NU8B 2KLBA 1W0KA 1Z9BA 3FFXA 3K5HA 2D7DA 4J75A 1RZ3A 4M1SA 3F6EX 1EFTA 3NCHA 1Y4AE 4UEJA 4E70A 5FO0A 5E0KB 4ETIA 1MD9A 3ADBA 2X4GA 1T5TA 2BZGA 1AURA 4OQPA 2X7HA 5EUMA 1M67A 4BEVA 2WM8A 5SYMA 3E2IA 2G77B 1PG5A 1PJ4A 3B9PA 1ZIPA 2Q5CA 3DT9A 3HCOA 5F3RA 3WWYA 4J0CA 4FDMA 4C2AA 1AUQA 4HTFA 5SZIA 3ROKA 3PTZA 3BEOA 3T3OA 4OHOA 1B73A 3H2JA 5HPYB 3QNUA 3SMQA 2WYVA 2EATA 5EIAA 1QH9A 3BDIA 4IMJB 4CCSA 1V5EA 4DTIA 5ECDA 2ZYVX 1LF0A 1XG5A 3WB1A 5JAPA 3FDXA 3X2SA 1TTHA 3DTVD 5CDHA 1K8ZB 1N36B 1OYYA 3HJGA 3WK8A 1ZQ9A 1Q84A 1N8TA 1SUBA 2ORWA 2QRGA 2ZE6A 4PYOA 3SHFA 5I7WA 4N3GA 1XCBA 5KDLA 3T3PB 2AC4A 4CM9A 5CCBA 1L5NA 1W0CA 2JGJA 4ENPA 4KO1S 1PRYA 1VDMA 3VR1A 4BDSA 2PRIA 5H1YA 3DEIA 2CC2A 4NL4H 1PLKA 2CLOB 4KP7A 3C5EA 4TYPA 3L0CA 1H4QA 2YXEA 4FBGA 1OWPA 3IBGA 5B1YA 3SXJA 1Y9JA 3D5TA 1SVUA 1Z18A 1I2DA 3L0DA 5KQGA 2CLHB 4NCAA 2WW8A 4FFDA 1SZPA 1QX3A 1Y6ZA 1YU6A 2O6HA 3DMHA 3A7EA 3OOEA 1AA9A 3TLAA 4AJKA 1CUAA 1ZO8A 2A1TS 3N8HA 4NDZA 1DG3A 2QX8A 3ETJA 4PYJA 4WBNF 1P60A 2A0WA 2PGAA 1XEWX 2FZWA 4HHEA 1H0SA 1TZ2A 2VP9A 3EULA 3LQRA 4I9GA 5G1OA 1FFEA 4G23A 1N33B 1KJQA 4QARA 3B5JA 1SZJG 1ZHOA 1BYIA 1WCIB 5TEVA 4EVIA 3LX6A 1PZFA 2ATVA 3CKMA 3MMPA 1YVDA 5I8PA 1Z0IA 2IUEA 1D2NA 4A0SA 3SYTA 4OLBA 2DHEA 4WA8A 4KNWA 2HHCA 4QXAA 2K2QB 4EF6A 3OJFA 3PHLA 1D07A 1G8JA 5B6PA 1Z6ZA 1T43A 4TQ9A 4G4SP 2DLNA 2V45A 5M7EA 2PZLA 3C16C 1QS0B 3N7UA 3OQPA 5EKXA 1P72A 1CY0A 1OGIA 4JXZA 3LUBA 3CUVA 3NHYA 3PFGA 3IBTA 1KXJA 3B78A 3R0VA 4DLLA 3CWCA 5DM4A 1S3SA 4E3ZA 4JI4B 1JVNA 2YIDA 1IUPA 3Q1KA 4KBGA 1B76A 1G8FA 3A6KA 2QSZA 3E7WA 4I46A 1FU7A 5IABA 1WZIA 4FU0A 4MUNA 4B44A 2RBGA 3SFVA 4K9MA 5TF0A 5BN5A 1GFZA 3N3AC 5FAKA 3Q7RA 3P9CA 1WXGA 1TMKA 1SN7A 1KHTA 2NQ2C 2YZNA 3W1WA 1PZNA 4EJFA 3DO8A 1Q7RA 2WG0A 4O5AA 2NPIA 3X43A 1DWPA 1PUXA 3UCXA 3BE8A 3KX2A 4HNHA 3DZFA 3EOAI 3ONFA 3WNBA 3CUSA 4PM4A 3E5MA 3RGGA 1RM4A 1EQAA 3B1WA 2GDZA 1L7DA 1YS7A 3LUFA 1FU8A 5KU7A 2YUTA 5EWLA 1I10A 1DHRA 3HXPA 2UUAB 1FFDA 1GZVA 2HWXA 2ZRGA 1P8AA 3L0IB 2NYRA 5H5JA 5B2EA 1G3QA 2OENG 1R88A 1NVMB 3OLQA 4GF5A 2C2OA 1QB7A 1P5JA 2EIHA 4MA5A 2G5GX 4RZ3A 2X0DA 3V9PA 1WJGA 1Y3CE 1WB6A 3GJ5A 4HYTA 4UAGA 1RQPA 3KYIB 4YLEA 4RPKA 3CIOA 3GOQA 2X9NA 3ESYA 2NQTA 1TQHA 1LGYA 1U0JA 2MWMA 2PZJA 2Q5FA 3FIUA 3HCEA 4MW2A 4WN3A 5FYQA 4L4UA 5DV9A 8GPBA 4WQMA 4EJMA 1W75A 3GY0A 2RHMA 3L7LA 3VDNB 221PA 4F71A 1W4LA 4RWZA 5KYWB 1DFHA 4PAMA 1YD7A 3LT5A 1F4VA 1YS1X 3QUTA 4HEQA 4PZ9A 1N7IA 3ODGA 2JKVA 4OL9A 3D0OA 4X20A 2GAFA 1CCWA 3KYDA 3OX4A 2REQA 2L0XA 2IDZA 3TQIA 1P73A 1T5HX 3OVMA 2HUNA 5AT1A 5MN6A 4ERNA 1WSAA 1LBSA 1TVMA 1BZYA 3F7MA 1YB1A 3PFFA 4KN8A 1N2XA 5B37A 3T1VA 5ANRB 2NO6A 4CKCB 5EXDA 5K8IA 3GRRA 1ZI6A 4WA7A 2O48X 3ZDCA 4P7KA 4UTOA 3DH0A 1Y7IA 1EDOA 2X3FA 2RB5A 1H5UA 1JH8A 1GD1O 1PWXA 1ZUNB 2HM7A 4G1BA 3RTGA 4DR4B 2XZPA 4QHSA 4QASA 4OBXA 3M5DA 4LMBA 2IIQA 1MT3A 2IY8A 2NUPB 1HOTA 1L4NA 1DC3A 2XKAA 3NDPA 3OD5A 3RTAA 1A9XA 2YYYA 1ZGCA 4Y1RA 1U98A 3FKJA 2FZ5A 2D06A 4CT5A 3JR3A 4ED9A 1JVBA 2HBRA 1IXZA 2GN0A 3Q10A 4Z8YA 1VMAA 1L3BA 4AX8A 4N3AA 4A7PA 5J2TF 2OCYC 2AR0A 2CJWA 4Q1FA 4AK9A 3RVMA 3I64A 1XI2A 2LBPA 1PR3A 4UMEA 2EX1A 4ZO4A 4GGMX 5KQSA 4IKEA 1Z6XA 2JAOA 5HQ3B 1KH3A 1FRVA 5EY5B 1TEZA 1RXEA 4CCAA 4LF8B 2I1WA 3ES9A 1JXMA 4M3NA 2X19A 5H70A 1QRSA 2BD0A 4PCAA 5AHWA 3P5BA 2WILA 1YL5A 4OFXA 4QA9A 3RVDA 3OFVA 3ELYA 4KV9A 3HJUA 2ODAA 4TXNA 4OO3A 2K4MA 1KQOA 3H0CA 1MORA 3INNA 5DHFA 2FRDC 2ZUSA 3HYLA 3VKFA 1SFRA 5A3RA 4P4UA 5BT9A 2E4ZA 4XYGA 2O23A 4CDNA 4MS3B 4IXDA 1EVQA 1OBFO 3S7TA 1GZ5A 1SXJC 5C5CA 4P0QB 1MW9X 1XC7A 1PLJA 3PGKA 1GU0A 4AW9A 1Y42X 4TS4A 4FKZA 1A76A 3L0SA 1M6NA 2YJGA 1PT7A 2ZTMA 2HBQA 4QT4A 2VTEA 4QAJA 5E6RA 3QK7A 1V8OA 3GA0A 3JZDA 1YE3A 2WMOB 1HM5A 1HFWA 3PA8A 2PGXA 3B1ZA 3AP1A 3OIYA 5EXXA 2PYZA 4M7PA 4J3NA 3TLYA 5JS8A 3W6NA 2XWJI 1TU0A 4KGDA 2C1ZA 5M3BA 4NU8X 5BYKA 4RESA 5M04A 2UUPA 1L5YA 1AY0A 2WUFA 4GUDA 2NVUB 2A1TR 2H2DA 3MHPA 4KWIA 1YQTA 4RXTA 5FQNA 3TXAA 4Y2PA 4BLRA 1W88B 3AQIA 1QORA 2V6IA 1GFWA 4P86A 4YH1A 5T4EA 1E92A 2WV9A 3U7FB 5KNBD 4CBVA 2IOYA 4MWCA 4GPIB 1KJIA 1IMJA 5ALKA 5TGDA 3A4NA 2X3UA 2JLSA 3DZKA 3TLMA 1UZMA 1VG8A 5AWFC 2C4NA 4MWZA 1NW4A 4TMWA 3E3MA 4LC9A 3RUEA 3W77A 4E5NA 2FW8A 3U3KA 2IT1A 3PFIA 3CRNA 1I0LA 1KP3A 2IEGA 1GZDA 1KJ8A 2ZSIA 3I52A 1EYZA 4FN4A 1J9GA 5IJXA 5SY9A 3V80A 5FTLA 3M89A 3K70B 5DI9A 2ZAIA 3R24A 2YZGA 4JENA 4CNBA 2ZAMA 3UYKA 5ESRA 5A4KA 4YJ2F 1LSOA 3L8YA 4GPZA 5I3CA 1HUQA 2YC2C 4D4KA 1QH0A 3K9QO 3OO1A 3E7DA 4HS9A 1F0KA 4Q7LA 2BFBA 5KNLA 3Q5GA 1P18A 4DSTA 1N78A 3NEYA 4MROA 1AZWA 1I2BA 4TMKA 2X9GA 1FYDA 1VPTA 2GNOA 2IA5A 1GO2A 2VTKA 3BMCB 3KYJB 3PDWA 4ILEA 4JQYA 4W8HA 4XQCA 4BN0A 5K2OA 1IVYA 2ZRIA 2CYAA 4IJUA 4NULA 4X95A 1R4AA 4U2EA 1BU5A 1EX1A 1VGQA 3OKAA 3PUVA 4MP8A 3RUDA 4EFDA 1FFHA 1QIKA 4BMXA 4C2BA 4A6PA 2VT6A 5BUCA 4IQ4A 1K8QA 1YI1A 2ZT6A 2CL5A 4YHBA 2HD4A 4Y9RA 3R20A 2HRDA 4F3KA 1W4CA 3IXQA 1SEVA 2A5YB 2OFXA 4MVJD 4TZTA 2QXYA 3HVRA 1GTVA 1F0YA 3RKRA 2I7TA 5A5VA 3N8NA 3OA2A 1TCBA 3LDFA 2EW8A 2VDQB 4O6VA 3TJMA 2I2FA 2QN7A 3D0QA 3EY4A 3G82C 2EJWA 2QTCA 3GVXA 5HOQA 1Q0PA 3M4ZA 4DBLC 4E2YA 3U40A 3VR4H 3KSDO 4OLFA 1J33A 4MLCA 3RQSA 5B7PA 4IZOA 4D3FA 1DV1A 2QVCA 4UBKA 2PZFA 3PC8C 4N9WA 4Z2YA 4I8DA 4ENRA 2FWNA 2EQAA 2WJ6A 3HLKA 1YRBA 3PHBE 1QAOA 4XRRA 1U2PA 5J1TB 4EABA 4E6EA 1V4VA 3I92A 5C35A 4L51A 3OQNA 2AF3C 1XRJA 3WIEA 2WIFA 2D8AA 2RGWA 3DE6X 5K0LA 4DT1A 4GYWA 5J5CA 5KVVA 5F64A 4RHUA 2I8AA 5DF1A 1EXNA 3W78A 2Z4TA 4R2WA 4CMEA 3B2QA 2P6OA 1WU7A 1PTJA 1PKEA 4Q3AA 2JJ1A 4ZV7A 4OL0A 2N1BA 3BC1A 1U7ZA 3ZKWB 2I2XB 3NRJA 3I58A 1V41E 4KQGA 4EFKA 1PNQA 4S1TA 1Q0ZA 3PSHA 1FUUA 2W8BB 5DX0A 3WGGA 5AK5A 3HI6A 4D4JA 3CWQA 2C9CA 3GWZA 1UEJA 2BUAA 2FRXA 4UD6A 4IZ6A 5F2EA 2WU1A 1NVEA 1FDVA 4IKOA 3L7DA 4LC0A 4HX5A 4O5OA 5AUNB 2W4MA 3B38A 2JLWA 2BFEA 4DJJA 3F78A 2B8NA 1B8OA 3FX2A 4L16A 4Y9SA 5E7QA 5FXMA 5BQOA 3CHYA 3SZOA 1SVWA 2J4CA 2H48A 4NI5A 5GONB 1XF1A 2AJCA 4YT4A 3AEQB 3P9QA 3KSMA 2XB8A 1D4ZA 1K97A 3RAJA 2QPLA 1GPWB 3IUQA 1I6MA 2AVNA 2WLSA 4DG9A 2PGOA 4EKNB 4QL3A 4DJDC 4Y8VA 4F86A 5F4BA 3CUWA 1JIUA 2O7RA 4AZWA 4IDNA 4OI1A 4P82A 1XAHA 1T13A 1T24A 5LMNB 3F5SA 3V4FA 4BKRA 2ZBQA 1W44A 5ERYA 4EUSA 4PO8A 2QUZA 3L49A 1BQ3A 1BXKA 1UJ2A 4IDBA 5JYCA 2AF4C 4G0MA 4HXGA 1EE2A 4PV7A 3BL5A 3SDSA 4BNVA 4CMIB 1K7FB 2FFJA 2R8BA 1E2IA 1H5QA 3WRYC 4DDWA 1NF3A 4EI7A 2B30A 4TSFD 2XMRA 4G0VA 1P81A 1BHSA 4US0R 3W5DA 3M34A 3AP3A 1NASA 4FYHA 3Q3VA 4RACA 4U8HA 2P67A 2RC6A 1LX7A 5EMNA 1COWD 1JDPA 1NULA 1Y7LA 2OG2A 2TRSB 3C4JA 5EG5A 5BNFA 3F74A 3I2YX 2AZXA 1ACJA 3FPLA 3B53X 2WBLC 4GT1A 2C4TA 4H0CA 5DWDA 1T3SA 4DJFC 2PK3A 4UBLA 3AVYA 2PA0A 4QM6A 3N2YA 1QXSA 1U80A 3TQTA 2WF7A 2PWBA 2Z2IA 5T8KC 2IJGX 3WWPA 4W9NA 5ISMA 4BPBA 5J43A 5MHTA 2Q6KA 4NBWA 1BWSA 5FBLB 5EE9A 3W7AA 4BQRA 1KK2A 4KQMA 1DBQA 4MI1A 1YS2X 2QENA 2VHVA 4FFRA 1EWKA 2BJHA 3VU9B 3L41A 3JASB 1CUSA 5SICE 3C98A 3JD1A 4E2XA 1MC5A 5JDIA 4EPVA 5I01A 5HS6A 4CM4B 1G7TA 3HDGA 1E3QA 3LJKA 1JEYA 1KSJA 2W2XA 3WRXA 1Z5VA 1YKFA 1ZHFA 1E79D 1WTCA 4JODA 1UMCB 2FSVC 1UFQA 1K5DA 3L8GA 3H7IA 2A5JA 3RSZA 4QTXA 1Z6YA 3IESA 4OHVA 4Q3LA 3WMXA 3NFYA 1MN6A 4L4SA 4HNUA 2GFIA 1GTG1 1LLCA 3KOXA 5E0OA 4BV2A 2HT1A 2FP4A 3KJGA 4TN5A 3ZQ4A 3FVQA 4MW4A 2FPSA 2JAXA 3QLUA 1LEHA 2Z3ZA 3HP4A 4ZAFA 1NR1A 1O1YA 2E21A 3ZWNA 2QE7A 2ZCVA 4UBMA 1L7MA 5EQJB 1E59A 1PR4A 2EZ9A 2G70A 1T9CA 2QU7A 2V4ZA 2JA2A 4UXIA 4UVIA 3WICA 3CVWA 2C2GA 1MQSA 1SZDA 4WXMA 5IZCC 1SCBA 3BQNB 1EXWA 1B42A 2IY9A 3AHJA 2GCIA 2VPIA 1QLJA 2A1UA 2Z83A 2VUHB 3E3AA 4B9AA 4GGOA 2NM0A 5ALGA 2QRUA 2VSOA 4NMHA 4MIOA 3V7WA 2NACA 4JVOA 4YFVA 5AHKA 1CWUA 1TF7A 1OBCA 4YLGA 3K5WA 2ZOSA 4HWPA 4XUCA 1UBLS 2WWYA 2WTXA 3MGAA 2JIDA 3CTMA 4AJ1A 4LDAA 5C5DA 1RPNA 4JJKA 4L3WA 2QZPA 2EF1A 2G08A 1ZJWA 3CSDA 3GLVA 1YZVA 3MJTA 1FFXA 3OFNA 4RORA 4CTNA 3U13A 2BZSA 5ECGC 3L07A 3ND5A 4RY8A 2BGMA 5EKSA 4DNPA 4YRJA 1FA9A 3VHXB 1Z0SA 1X7YA 1U2RA 1LK0A 1RKUA 1TA9A 4KKXB 4BJ3A 4FEYA 1H8EA 1Y4ZA 4LC1A 5CFMA 5K0CA 2II6A 1QCDA 3G6WA 3FXAA 1IM2A 3PDCA 2BKUA 2O3UA 4MINA 3AVXA 5DHTA 2UXDB 1Z4NA 3BWDD 1X3SA 2V59A 3DVQX 3G7NA 5HBRA 5AVXA 1D6JA 1OFGA 2P2LA 1JHDA 3K09A 4MQEA 4UHEA 3TRJA 1GADO 2FK7A 3R3JA 3ZKAA 4Q4CA 4D80A 5TEWA 1XRSB 3AIOA 2X7XA 1W46A 5CVJA 4BGUA 2JD0A 1J9EA 1ZMTA 1H2EA 1PJCA 3CZ5A 2Y93A 5FOTA 2VZLA 3TPCA 4E13A 4MAMA 1E2UA 3BA6A 5DT9A 4R05A 2ZSUA 3NVMB 1Q21A 4RF3A 2WY2D 1LDEA 3RPEA 1T9GR 4IWNA 4CM7A 5L8VA 5LJLA 4DCOA 1R50A 4FP9A 4RIEA 4TL7A 3ZWXA 3KQHA 2J9YB 3TZHA 5B55A 2Q21A 1KI1A 4HQKA 4R71A 4AM8A 1WF3A 1C29B 1ZOIA 1EUDA 5DHQA 1B43A 2AYZA 2CCJA 2CVOA 1DMRA 1IE3A 2FTKE 3NOVA 5EWMA 2MYPA 1OWNA 1KI8A 4Q21A 4J91A 4AFNA 3HZZA 3ONWA 3DQPA 1IHUA 4KXNA 1IC6A 5JNRA 4RGYA 1E6UA 3RASA 3IAS6 3U3OA 4K9LA 4D1YA 3R7FA 2YVLA 2EV9A 4TMXA 1WWKA 4V0NA 4B3RB 4KRXA 3TMAA 2BY4A 4YI5A 4DBLE 3TOXA 1QFYA 3W5AA 3IB6A 1Q3KA 4A15A 3IUYA 1N9GA 5AESA 2P5TB 3HXMA 1RJ9A 1YQUA 3KHKA 2AMFA 3MLAA 2PN1A 1D1PA 3AVUA 4TVKA 4HN9A 4OG2A 4LXGA 4P98A 1QB8A 1V5GA 5FWXA 3ZE0B 5KTNA 1FTGA 1OX4A 3PNPA 4JGGA 3IIEA 2VRBA 1CW2B 1YIAA 4AY4A 2ZT8A 5EYPA 3DXZA 4LNHA 2QAIA 2HA2A 1HG0A 2YWJA 2NV0A 3O94A 1JVSA 1ZI8A 1W29A 4REQA 4NFYA 4EI8A 3A1WA 3MD9A 3AEUA 5DTEA 3TRKA 1W36C 1E7QA 4WFIA 4UNSA 3QHPA 2FI1A 4M53A 4P3PA 2PMEA 5HWSA 4OHWA 3ZDQA 5LP6A 1W4RA 2D5AA 4RENA 2IXGA 3ZI0A 1SZCA 2C95A 2DY1A 4X8OA 3D81A 1IUOA 3GL9A 1QQ7A 1PW7A 3HN2A 1BE8A 3ZWVA 3D5QA 1TZKA 2CFRA 3LC0A 5I8ZA 4QE3A 2VHCA 2TSYB 3GO4A 3M4JA 2PFGA 3CVJA 4QYTA 2G72A 2WWIA 3GGJA 4MVJP 1KJ9A 1EIWA 3T35A 1V5FA 1IK4A 2GLTA 1OSNA 3NAGA 4U39A 2YWBA 3R76A 1F20A 1OHHD 1TZMA 2F8LA 3JQ7B 4J1TC 4Y2GA 5CH5A 2HV8A 3NGLA 4UDOA 1U9IC 2OK8A 3R4VA 1JMVA 3W4KA 3GHHA 3M4YA 4PXAA 4FYVA 1Q7TA 4BKUA 2XMSA 4RDIA 1SHLA 4KN5A 2QLLA 4B3JA 4TM7A 4ZAZA 5AKHA 3IEXA 1OXBB 4HNTA 5JCZA 3T7IA 1O4VA 1BHJA 1XL1A 3X1MA 2XBUA 3R7WB 4GP6A 4R9NA 4I4TA 4Q12A 1K5PA 4WOPA 3LY9A 5EXSA 4WL0A 5JNLA 1NWHA 2PQ0A 2M6SA 3FCEA 5TV2A 4LF6B 2FKNA 3DQQA 1CULC 3HR8A 1YR3A 3CLTC 2B92A 1WULS 3VZRA 1U8EA 1U0LA 3I1JA 4LJ6A 4IDFA 3MB5A 2IS2A 4W1PA 1DCMA 2PM8A 2OZLA 2ZJYA 1SR8A 1V5IA 2IYVA 3BBPA 2C2HA 3OESA 1KE2A 3WMRA 3KYBA 3IE1A 1YJCA 1GNQA 2FRVA 2QTZA 3ER8A 1K1EA 2PVSA 4PZPA 1NNEA 2FFQA 2QSUA 3OQBA 4JDUA 5LDGA 5DLDA 4OGKA 5I9LA 1SB9A 3VXKA 1WSBA 4FS8A 1BWRA 4HEJA 3UB4A 4MUGA 3ZGNA 4H27A 1FTYA 2DHDA 1GPDG 2GXAA 5A62A 3HM9A 3E7XA 3BN3A 3H1BA 2H1VA 1V43A 3V32A 1PZMA 2FEOA 1Q3TA 3FPHA 1LBTA 2DFNA 3ADDA 2C00A 1QJCA 2O5VA 2ZTVA 4R2XA 1ORDA 2BBTA 3BE4A 3EZ9A 5AM4A 1E5QA 1FSZA 2W11A 2ILVA 1LTQA 2VK4A 1UP4A 3IMCA 5C3MA 5F9FA 3CWZA 4BLSA 3D6VA 1Y9AA 4DIOA 4YCNA 4HAZA 4B3TB 3RC2A 1OV6A 3KEGA 1VA5A 3HA2A 4V0QA 3KPUA 1M0TA 2UZ0A 4LZWA 3TRIA 3W8NA 4KQFA 4CQLB 3WOVA 2DUWA 2G0NA 1S89A 2EYQA 4FC7A 3ROMA 5JTTA 2PV7A 1CZRA 3LCMA 3R3WA 3LP5A 3CVYA 3E7PA 4W5TA 3L7OA 2QTAA 2JAWA 3JD2A 5H81A 2XOKD 3A70A 4NZMA 3K1YA 4U9HS 2IVZA 4NG4A 1BU8A 4P4LA 2R6FA 2XITA 1JA9A 2DPMA 2G06A 2I2CA 4JEHA 1TUEA 4UM7A 2RHCA 2GD0A 3DFZA 4OBEA 4GMDA 2J0VA 2X0RA 3EGXB 3DTYA 3GAMA 2IEIA 5ADHA 4RHEA 1JDBC 3C15C 3AX6A 2EZUA 2W4QA 4PZDA 2OXIA 4DLUA 1ACMA 1KDYA 1G8PA 1ND6A 2A67A 2JATA 2QVGA 1OXTA 4M8LA 3BE6A 4FUTA 1YFLA 1A3CA 1EM8A 2FQWA 1M1NB 2QL6A 3QLJA 4ALJA 1D0VA 3OZXA 5EJFA 1T0HB 3BSFA 4LJLA 3U3JA 2WHRA 2C4VA 2G6BA 1X7DA 1JLLB 2ZT5A 3CW2A 4MUFA 4OB6A 3UGKA 5BURA 2GA9A 1GQYA 2JJYA 3T5GA 4BNYA 2V5VA 3L40A 1B14A 4LRWA 2RGRA 4X91A 3C3DA 4WCFA 2H2IA 3PQ7A 3BXFA 1T6YA 3LRXA 3U4CA 3WK6A 2JGKA 3C3EA 1H66A 3DTVB 1UXJA 2HXYA 1HDZA 3K92A 2K2WA 4GIBA 4KJXA 4P83A 1ISFA 3K8OE 4B8ZA 3N07A 4ZCRA 2ZBPA 2QTRA 1UZLA 3FMPB 4ZVPA 2X9VA 2BPOA 2ROQA 3O3OB 1M34B 4MJ7A 4MIEA 3U44B 2J1LA 4DUGD 3LT4A 4ECAA 2QEQA 1H2BA 1OE0A 4PEVA 2DPLA 2WM2A 3BRWA 4FGZA 1X38A 4XD7D 5FUYA 1WR8A 3VR5D 1MEEA 3W9UA 3WJ1A 4FB4A 5GJBA 3G2IA 3FHLA 3GF4A 4UPEA 2ZYHA 4LE0A 5KNDH 3PEYA 3QFTA 2W9XA 1H0RA 3RVSA 1KOFA 1R0WA 3UUFA 1OIVA 2DWOA 2BOVA 4WWHA 2VQFB 2YVUA 1WMFA 2ZTUA 5BV2P 3MILA 3PL1A 5K8UA 1R4NB 3BZBA 1GLNA 2VXCA 3QVGB 1N5IA 4TWAA 4RDXA 3RAFC 2IXAA 2POCA 2PXXA 2X8JB 5EIBC 1AKEA 1GT91 4WZBE 3H4VA 5K3AA 5AI4A 1VYTA 3N2GA 4N1AA 1PTKA 1TVKB 1M2KA 1Z4PX 5C0OE 3SJBA 2VAWA 1JXAA 2HA4A 4DRXA 3PEWA 4XR4A 1KRWA 3RS3A 3KOOA 1ZOLA 1RWNA 1GV1A 1I2CA 2AFRA 5JEEA 2GAAA 2P5YA 4WZZA 1LH0A 2JKZA 4WY5A 1CVIA 1DKQA 1ELOA 1PNOA 1CS0B 2EBWA 2WKRA 4MVWA 4UM9D 4UZSA 5KTYA 2G4CA 2FAXA 2HC9A 3CA8A 1EVZA 1ZVVA 2FF7A 5IZ4A 2W6JA 2CNWA 1B26A 2VAXA 3ETEA 2HLDA 3FZGA 3F6YA 3PK0A 4R84A 3RTDA 1E2BA 1C4KA 1WXFA 1Z62A 4L0QA 4QYIB 1ZAKA 4YRRA 3UWMA 1MB2A 1LLQA 4KNYA 4NFHA 4WKOA 3PQDA 2VKTA 2I22A 5TQ2B 4K28A 2YFQA 1NLFA 4CHTA 2XRMA 1E6LA 3RAEC 3AUUA 4J76A 1QKJA 2CVZA 4D4IA 4F3TA 4X1KB 3TD9A 3HKBB 2HCTA 1EUCB 1JHRA 1ZH0A 2GHRA 4PX2A 1UPFA 2PH3A 3HUUA 1R8SA 3R77A 4Q1AA 3IAFA 1UM9A 1IN5A 2P7HA 3KHTA 1JB1A 1I6KA 3RNOA 1E1YA 2C2ZA 1TJYA 2Z3WA 4KDEA 4BX9A 2GASA 4WXEA 1TIPA 3VO2A 4KN6A 3REOA 4F9EA 1O94C 5J63A 5HYVA 3K20A 1KVRA 1Z26A 3PD1A 5AKGA 5JS1A 1PZHA 2JIZD 2ZB2A 1Z38A 2F3SA 5C34B 5BWNA 1SUFA 1BD4A 4HDMB 1XRRA 5LQJA 2YV4A 2WT4A 3AHDA 4J2OA 4NZNA 1OZ0A 3LD9A 1WQ1R 1O58A 2C83A 2D0OB 3W5JA 3ELWA 1YOVA 3QF4A 3ER9A 3IUEA 2EOAA 2IYPA 2ZIGA 1XLWA 2G71A 3H0KA 2P35A 4D8WA 2DHQA 1FOEB 5ADWA 1G3RA 1KYYA 4QEDA 2IDJA 5FOUA 2L69A 3CLRC 1MVLA 2ACWA 3OCVA 3OURA 3SS8A 4BBPA 1QO7A 2DZDA 3GDHA 4EMBA 1DCTA 4X60A 2PJRA 3C70A 1ISIA 1ZWKA 3A6ZA 5SZHB 2OVBA 1S1MA 2WUEA 3P9NA 3SSAA 3ITNA 1Y4UA 5BSHA 4A9AA 3RRMA 4LISA 4A0GA 1RLUA 4XX1A 1V9LA 1Y7TA 2GEBA 2X2PA 3IQHX 4A1OA 3NTOA 2BGTA 3FI0A 4UHBA 1KP2A 3O1HB 1ONNA 3LLCA 2PMCA 3N75A 4JP3A 1UQRA 1NQUA 3EXEA 1HDXA 3IPAA 4WK6A 5G0SA 4B79A 1XTBA 1XOIA 4XW2A 3FHTA 1EP3B 4LBWA 3KZXA 1F8UA 3H9CA 3LLMA 4QGFA 3IOYA 5GOZA 3S29A 2IZ7A 1JKIA 2PPVA 3KJXA 4CI0B 4UTPA 4LHWA 3E58A 4UHJA 1E5DA 3S2FA 4BNTA 3FSEA 2Z2JA 4MQFA 4PG4A 5JQWA 3KL4A 4R31A 2WTAA 4HN4B 3EYAA 3EPPA 1AGXA 4F3CA 2Q3DA 3GLKA 1ML4A 5CB6A 1X13A 1SUEA 4OHUA 1KY5A 2Q3FA 2B4KA 2DFLA 3FKQA 1JIIA 3I42A 2ZANA 3OA0A 3Q3EA 4PAQA 4R5HA 4Z9XA 5FTKA 3V3TA 3VBEA 4OQFA 2I6UA 3W5VA 2BTOA 4F92B 1S2GA 2GAIA 2RAFA 2PRZA 4FFMA 4EYKA 4E4YA 1KMHB 4DWOA 4IV5A 4OXIA 4RKRA 2I2WA 4XVCA 1DPFA 1QIIA 3EH1A 1HDIA 3WL8A 5TX7A 2DOKA 2ZRQA 4R3UC 4X7PA 4BNIA 4D97A 5HIAA 4K46A 1W5AA 1MMFB 1R9MA 2H3HA 4FEGA 5AI0A 5DGDA 2QRHA 2OV4A 2B5VA 2C9OA 4OAPA 1F2UA 1ZJYA 4U1RA 4JLBA 3G8CA 2VDRB 4RV9A 4W99A 1BROA 3H87A 1XQ9A 1Y33E 5I7VA 5IH7A 1OX6A 1NJGA 4S1PA 3W2FA 3ZCTA 3EQ9A 1YDGA 1UKYA 3UJCA 4EA7A 1KZYC 1W36D 4R1OA 3K2EA 4X90A 1V7CA 1K9SA 2Q9AA 2J48A 4YAJA 4AKGA 4DZTA 1D9XA 1A9SA 3B5IA 2UUCB 1NNUA 2W6MA 3H11B 2Y0BA 1RKXA 3G8BA 1USVA 5FV4A 4TQAA 4F56A 2OE2A 2DQZA 4E2WA 3ZIAA 4L5IA 4DLRA 1LDYA 4YR9A 3VNVA 1U5BA 5FTNA 2YHBA 3PJFA 1CETA 4IXTA 4WOCA 5J40A 2P7IA 4I3GA 1UK9A 5CCEA 1S9DA 1XXHA 3T7JA 2UKDA 1N1MA 1OGJA 2VQEB 1IPHA 2YZ2A 5F5XA 1Z45A 4J1SA 3SE0A 4AY3A 3A3PA 4TKUB 4FWBA 4P2GA 3AVTA 4G6ZA 3KZ1E 4JNCA 5AHOA 4NSNA 1GNTA 2H2FA 2OP1A 3A3OA 4GPAA 4MUMA 3UT5B 3PWSA 1NJ5A 1VPEA 4CCWA 5CT5A 5IDVA 1ZD2P 4QBFA 2BEJA 3DR5A 3ROGA 1R4MB 2V6FA 3R44A 4JSRA 2FPOA 2FEPA 3CLTD 1YBVA 1NOJA 4FYJA 4WJLA 4DDVA 3QMWA 4ZO8A 4N76A 1VJ5A 3ZHOA 4OQMA 3C5CA 1ENPA 1BMDA 2H1FA 3VSCA 4S0ZA 3DOJA 3DSRA 4JDPA 4UCXA 1U8YA 2XE6A 4GVLA 4FB5A 2XUGA 3C8MA 2BLLA 3D6JA 3EEYA 1QTQA 4B09A 5CDGA 3WKAA 2O2ZA 4Q66C 1OLSA 3AYZB 3BCSA 3LHSA 2OHXA 3KYCB 4PVCA 4KRFA 4HSGA 3QVVA 2R1VB 5FORA 4I66A 4R2LA 1XNHA 4LCBA 3MIZA 5CA1A 2MDTA 4GOKA 1YR2A 4H18A 2Q3BA 3H3JA 1YZKA 1U3UA 3IUPA 4ER3A 3TX6A 1IEWA 4KXYA 2ZDHA 4DVGA 2QP9X 2PUEA 1EVEA 4E14A 3AR9A 4F12A 1DT5A 4MR8A 3T5TA 2B8EA 2OVFA 3NDRA 1Z0KA 3CXUA 4GDMA 2QRVB 5J2UA 4WBSA 4JI8B 1EKXA 2I34A 4XM2A 4BEBA 2HQRA 2XGSA 1OXVA 2IEYA 2CCGA 3DOFA 4Q16A 4ZU1X 4Y6QA 2ZTLA 1I80A 2QAGB 2QYTA 5I9SA 2IGBA 1E1LA 3WYAA 2GRUA 4EZBA 2VHUA 3ON5A 2R751 3Q5DA 1Z74A 5IKOA 4FNGA 3MS7A 1EK6A 4V0SA 3G02A 3U7EB 5IG2A 4CLOB 4E1BA 3X1XA 3MB8A 3Q12A 4L3VA 3RF6A 4E22A 4QNNA 1VYVA 2ODPA 3OIDA 2AX4A 4M8KA 1U5CA 4CIBA 4ITUA 2PZMA 1BMFD 4H17A 2PL9A 5G0TA 1SJ9A 2R11A 1SVOA 1WCWA 3C1AA 1RC1A 3K8YA 2FZCA 4IVQA 1BE6A 4IIUA 1ORTA 5AKEA 1SIWA 4Y1GA 5BSWA 3EHEA 2XZOA 5JLJA 3SNKA 3P9IA 4MYSA 3DZGA 3HKEA 1V3UA 3PIIA 2G28A 3DKPA 4ML3A 3DNMA 1VG9B 1L4KA 1F2TA 1X7ZB 2D74A 3EDQA 4HDSA 4LHSA 1ZN7A 3I01A 5JNTA 4GH5A 2QIOA 1VZ3A 4MUJA 6Q21A 4A0QA 5EI5A 3V4ZA 1PJ8A 1XP5A 4FQ5A 3ZHZA 3KWMA 3FVRA 3O9ZA 1PNTA 3TBHA 3AESA 3MBIA 3UA4A 4DLTA 1Q0LA 5JNUA 3F6BX 1ISRA 3FB1A 1H22A 4X3OA 3CF2A 1L1RA 5MN5A 4MCAA 2E48A 2ET6A 3N87A 1EWYA 1HSZA 3T3HA 1FVXA 1PVOA 4K9DA 4WVLA 2WF5A 2G5CA 2PH7A 3CUUA 3OE1A 3VR6D 3QVOA 3KBOA 2G9NA 4A2WA 4YMVA 4A8PA 3WY9A 1QVVA 4G1FA 1RS0A 2X6QA 2BDUA 3CLHA 4TROA 1RDFA 1CJBA 1GEGA 1KC3A 4UASA 3T3IA 1L1QA 1VE3A 1KPHA 4FGSA 4D92A 1W0JD 3UJHA 5LB2A 1U90A 1Z6AA 3LCUA 4OK3A 2CEKA 2PGLA 1C3OB 4JLNA 4Q39A 4Q7KA 3SQNA 4RKYA 1T2NA 5KHAA 3TEFA 2CV0A 2XQKA 1VXOA 2PIAA 1PGQA 1M5TA 3PHIA 4GLLA 5JZOA 4L9AA 1EVKA 3UXHA 2MINB 4PC6A 1ZUHA 5K3DA 5FWNA 2EDAA 3LMKA 3F1KA 4ZT6A 5KYYB 3P2OA 3RGWS 3QJ5A 1PFGA 1QG6A 1XHEA 2P41A 5FPQA 1M73E 4UEKA 3LZ6A 3RROA 3EGCA 3SDBA 2VPYA 1CUHA 2XBMA 4YAIA 3HVKA 4LF7B 1IIRA 3INGA 4YJ3A 1H2XA 3KQUA 4UFOA 3A4MA 3DZDA 1EGMB 3CJQA 3GJ7A 4IGAA 5DHPA 4E5MA 3V42A 5CYFA 1KWKA 3UO8B 1OZAA 2F17A 4I4TF 5JH7A 4J9VA 3WDKA 1AKYA 2V7TA 2K7FA 4BAUA 4ZOLB 9ATCA 1BCSA 2GPJA 1V3TA 2RHLA 1G4AE 5FLKA 3ESDA 2IBSA 4C43A 3G49A 1T36B 4RZ2A 2IW1A 3H97A 3QIVA 4PLPA 1QGYA 2A59A 4PWYA 1VP3A 3H1GA 2JBAA 2QTNA 1EX9A 1BVRA 2JVJA 4M0MA 5EJAA 1YK1A 2J3LA 3OZEA 2XQIA 1E9AA 1MIOA 3TMKA 3AL0C 2QTBA 3GR6A 3FSRA 2Z6QA 5DCUA 5EZ5A 4EM6A 1Q3HA 3CX3A 4M49A 3MWLA 4R7TA 2OSBA 2PZ8A 3ZCRA 2Y8EA 2BEKA 1NBIA 1QIDA 2J30A 1T1EA 2PX0A 2FPMA 4DSUA 3DVAA 2F00A 5ALIA 3RWOA 5JO0A 2FWRA 4WNIA 3HR7A 4EB3A 4ESOA 3CUKA 1UXKA 2GCPA 2X1HA 1OR8A 3F8WA 4JLDA 4PPQA 3TGPA 3JWHA 1KI2A 4MGYR 2C8JA 2RB4A 3DB1A 2RK6A 3T0IA 3BOSA 1U2GC 2BFCB 3EG5A 1ISGA 3QX9A 1G3MA 1BIFA 2PLAA 3WGMA 4JEMA 5EUCA 5ARDA 3O4HA 3SIPA 4AO8A 5BYAA 1JILA 1C9KA 1V8BA 2YDXA 1Z7YA 1U65A 1KO1A 3L2OB 5MGNA 2WV7A 5EE5B 2BFDA 4NZPA 1E6WA 3MMXA 4URYR 2IEBA 3Q9SA 4A8JC 1JGTA 3FOAA 4M21A 3O95A 3SPXA 5JCOC 2P6UA 1MFZA 2GXSA 1KMMA 2XTMA 3CLRD 2AI1A 3FRJA 4WGFA 2B21A 1JYSA 3JD4A 4O4JA 4AY6A 1KQPA 1P5FA 4P4GA 2HIMA 2R3SA 4IIDA 3W2EA 3N2KA 1WP4A 1VL8A 1YRHA 8ATCA 1E5XA 3EUFA 1IK6A 4KQJA 1KI4A 3A36A 2E9SA 3PU6A 4XPZA 2K5UA 1QHSA 1DIBA 1ZSYA 3BL8A 3OU7A 2E37A 2EKZA 5ICSA 4HSEA 4KG7A 4CLEA 4C7XA 1J8DA 2AR7A 4C4ZA 2J4FA 4UMDA 1F51E 1SXQA 3AFGA 1X8LA 5B7QA 1JDSA 3DE1X 1Z12A 2WINI 3GCWA 1UJ5A 3KLBA 3O4JA 2VJCA 1EFRA 3L7MA 3NBUA 4H9GA 3RWMB 5J4KA 3NIWA 1UXGA 2VNHA 2NVBA 4K9KA 2GRAA 2GPYA 4MITA 4MARA 1ZVJA 2RI6A 4KOEC 4JYBA 2A1IA 4CM8B 4PNZA 3CBQA 1TOAA 4NBUA 1AK2A 1C7RA 2MR5A 1JKJB 3H6HA 3OH8A 4C21A 2CHEA 2X1MA 2YTZA 1B3BA 3GT3A 4D0LB 1NURA 4FFOA 3G8AA 3EW9A 4R8MA 2HR1A 4L8WB 1LQTA 1QGDA 3FSJX 2QLJA 2Q99A 2WKSA 4QU9A 1CNEA 4Y3UA 4NNPA 1G2IA 3NTUA 2UZ1B 1U0GA 4ZQHA 4TWBA 3AGQA 3M5PA 4I1RA 3PNLA 3SEZA 2XSZD 4EQZA 5L3QA 2D5LA 3D8BA 5K3BA 3FDZB 3UFBA 2JIPA 4JB3A 1FNNA 4CT4B 4NXNB 2GPWA 1IY0A 4G1CA 4L7QA 3NVDA 3WQSB 1KETA 2VEOA 1OU4A 1XU9A 1FP1D 4GMFA 2PT9A 4J0QA 2NZJA 1DTEA 4JB0A 3T12A 3UB3A 4UZEA 3V6MA 4DBVO 4ZHSA 3LXUX 4BO5A 3TF5A 1JDTA 1BXGA 2PUJA 3O4IA 4CUKA 2RHBA 2RJ3A 2PDAA 1W8DA 4GNKA 5A4JA 1SCAA 5I7UA 1RHRA 1F38A 1ST3A 3E5RA 4MX8A 1GVNB 1NI4A 1QTIA 1JEQB 4GX1A 2BE9A 4HPWA 1IZZA 3P4UA 4ZCSA 5IJ9A 3MHTA 4M1QA 2EL7A 4AMZA 5LXTA 3ZU6A 3P0JA 3S2UA 1Z34A 2AH5A 4MGIR 1C9JA 1GOTA 2FOXA 4O2AB 1RXUA 4CLDA 5A4FS 3C2QA 4B84A 4QSMA 1SK8A 3AL2A 3VJMA 1ESMA 4FFBB 3QU2A 1E4VA 3IFSA 1CY6A 1JA1A 4BV3A 5F1KA 3RODA 3WAJA 3RFFA 1M54A 4R51A 1DV2A 1XMSA 2VUTA 3LUGA 4E7OA 3PCTA 3D8RA 4UARA 1ZXBA 5CVEA 1KVQA 3T3DA 1FVHA 4F5DA 5FUMA 4JJ4A 2H2WA 5CJ2A 3WFZA 2FHPA 5HE8A 1V9CA 4ZT2A 4UAJA 1KYIA 1SCJA 1ABBA 4TTAA 1GPUA 1JQAA 3QPCA 3MJFA 4JD5A 4BUCA 3GLHE 1QYDA 4XSVA 2BM1A 3RRJA 4AVYA 2GYUA 3EFHA 3EZ2A 3GP5A 1Z25A 3H83A 4NRDA 5F7XA 3NVKI 3MIIA 2EQBA 4W6QA 2M98A 3I1FA 8OHMA 1YKSA 3WLEA 4R0MA 5HR5A 3L6BA 4C4SA 3K0CA 4DLSA 2O54A 4BIMA 2VJBA 5CXUA 4QATA 1JFFB 4L4XA 5D3ZA 1BMTA 1W19A 3AXTA 2NT4A 4INAA 1V47A 3KKPA 2ZPUA 3PWTA 4PC1A 4M9ZA 5LBUA 3TGWA 5A2GA 1B6GA 2XMQA 1H8HA 1MO6A 5EWJB 1CJMA 1A2OA 4AZ3B 1UF9A 4DV4B 1CYEA 2WAXA 5DNYB 1B00A 3FNQA 5AJHA 1JSCA 1I13A 3KTAB 1T3TA 5DLQC 3AY0A 3BMQA 3LGXA 5C8ZA 2FGKA 2J45A 2JFHA 2E4WA 1I4OA 1QGOA 3OMXA 2W2LA 4L5JA 4S12A 5MGBA 1TMOA 4QELA 1EFDN 1XYVA 4XB6B 3LPNA 3NLLA 4HO1X 1WZNA 2A5LA 3AUAA 1TA4A 4GL4A 4J7UA 1U9ZA 5IKMA 2CUTA 3M7IA 2DCUA 1QHNA 4L0CA 4OVKA 3PNYA 2ARKA 2ZEJA 4LVNA 5FO1A 4BFCA 1HF3A 4YCAA 2AFVA 1QG0A 4AICA 3EARA 1YK0A 3L6UA 2ZJ3A 3M1IA 4FJ0A 5EZYB 4B7UA 4IDCA 5K3EA 4YIKA 4MWTA 3GYGA 1CR0A 1IPEA 2O2DA 3MC1A 2XB4A 4W7SA 1WKCA 2JH3A 3FVVA 5EESA 3UWDA 1ARZA 5BOVA 2PZGA 2JVIA 4Q3OA 3X1WA 3GEGA 2CSXA 1YMQA 2PNFA 2WMDA 3HY4A 5EINA 3IP3A 4CCYA 3UCEA 1NBOA 2VRCD 3MRTA 4JY7A 2F8TA 3LYHA 3M2PA 4M1WA 4U2CA 4ZZ2A 4HQNA 1TJ5A 3WISA 3LTNC 1B23P 1E4EA 4D3DA 5AW7A 4MR7A 1L0BA 1PFVA 3AI1A 1KP9A 1T34A 2IKQA 1JSXA 2AXEA 1H3EA 3QI7A 2BGJA 1C0IA 1FP4A 2C9ZA 2V6BA 4W63A 3DAOA 3OHPA 3BMXA 3AJEA 4BX3A 1KO4A 4WXYB 4ZYUA 1NBEA 3IKJA 1YCDA 2PX3A 3N2IA 5D7BA 3ZTYA 1GZHB 4G0UA 3AVQA 3BILA 2VDOB 2FN3A 4E1VA 5A06A 3GFQA 3E3LA 5LIPA 2PO7A 2ZP1A 3NV9A 3UBTA 4ETWA 5CFNA 4QSHA 5FNVA 1DKMA 2VPWA 2XLCA 2R6AA 1Z37A 1U1CA 9ABPA 4FZRA 1USUA 2WUWE 3TIVA 4RLHA 3BHMA 4XX0A 2EJCA 3T5CA 4W82A 4WFJA 4F5EA 4FX2A 3KFVA 1DBPA 2QDKA 4LSZA 4H3HB 1GSHA 4IEFB 3DCNA 4K9PA 2Z6UA 3FPCA 3UAZA 3JWIA 2C2KA 4KR2A 2PMDA 4LCEA 2A8YA 2RJOA 3SYKA 3CEPB 2ZTHA 3NHFA 2R8OA 3HCRA 3WJAA 3CR8A 1KTVA 2ZXFA 4BCCA 1FXSA 1HKUA 2JFOA 5IH3A 2BLNA 3CXRA 2B2CA 4YREA 2X58A 3I2HA 3V1LA 5LU9A 3KTDA 1VP9A 2ZIUB 1AHPA 2Q5HA 1KAGA 3QEJA 2OLJA 3ZVLA 2RK4A 3UMCA 4EUKA 2HN9A 5AJZA 3LRTA 1W581 3T7DA 1KO7A 4LBYA 1E7RA 3MBOA 2ZIAA 2VA9A 1P1HA 1P5HA 1TFRA 1NY5A 1NYTA 2A9JA 1VFNA 4RK4A 3QSYA 2O2XA 3BICA 4KFSA 1A69A 3A9VA 5F51A 2JHFA 2P30A 4QGSA 1K8XB 4CFSA 4LDRA 4M37A 5FBVB 2GZAA 3ETLA 4GUAA 3D0RA 3DBHB 5C8DA 2C96A 1K6MA 1DBVO 2C0QA 4KH1A 2JLRA 4P35A 5EE3A 5ES3A 2YASA 4RPIA 2XVYA 3RU9A 1YJAA 1L4GA 1W2GA 4BN5A 2H4ZA 2NZVG 5KJCA 4ZT7A 1LBEA 4ZICA 3KELA 3SF8B 1KI3A 4LI0A 1F8GA 3TQOA 3JAMA 1X8KA 3DFKA 3VJKA 4WJKB 5DLPA 4ZHQA 3N6RA 4INOA 2LP4Y 2FQ1A 2GX6A 2PJDA 2QD2A 1PK7A 2QD4A 3ECAA 3NP9A 4BMZA 1QWSA 4DHEA 4LOIA 3PEEA 1CUYA 3DYBA 4HB3A 3PDHA 5F12A 1K4MA 2HCJB 2EVWX 3KT3A 4ZVKA 3EAQA 1JLSA 3EK2A 5EOVA 1JR3E 1TYBE 4H2DA 2LE0A 1L5RA 5B6IA 3U1BA 2ENWA 1NBHA 2ZI6A 1BQEA 1I6WA 2J4DA 4MJLA 4MPDA 4NYJR 3OPQA 3EQ2A 2BUBA 4Q4DA 4OXQA 3G3EA 4C03A 1NG9A 2IHJA 1PJQA 2G1AA 3H2ZA 1Y3IA 3IVAA 3QKUA 4MKFA 1FBNA 4R83A 4RIFA 1QIEA 3MGBA 1P74A 2ADMA 5HS4A 5EMHA 3R5HA 2QN6A 2XY4A 4CVNA 3L6EA 2G88A 4U2KA 5I7OA 2P91A 5JFTA 5KQRA 1A7KA 3M6LA 4LRYA 5C7IO 2AN1A 2SICE 4IX1A 4LSMA 3KQLA 3VZQA 3MK31 1U7OA 2H1LA 4JSTA 3V7YA 4BJ1A 2O8NA 1EVYA 1B2RA 3DULA 4MUHA 4RZHA 1XT6A 1M7HA 1KEWA 5JNSA 2UVPB 2BHNA 4FW9A 1LZLA 2D2FA 1AUPA 2I6SA 3DDHA 3HKDA 4G36A 3HH8A 3ZU3A 3HA5A 1O95A 4MI6A 1N75A 4F1JA 2CNLA 4OI4A 4LYJA 1S96A 5LQKA 1KZ6A 1Z83A 5CLFA 1DNPA 2AQKA 2ZUEA 2B0JA 4URZR 1M6HA 1FTSA 1OVGA 1OFUX 3K1ZA 5HE9A 2HW8A 4Z9FA 5TPWB 4BWFB 5KKCA 4UM9B 3RM3A 3N1UA 1Q1NA 2HWYA 2Q9BA 2A5GA 5FFFA 4JQZA 1O6ZA 1FUEA 2G5PA 3QVTA 3AI7A 3F97A 4IVNA 4AUEA 3RWBA 1FYWA 1N0IA 3I37X 3VR4D 3EZNA 4XJXA 1TLTA 2P9CA 4R2MA 3T61A 1MPXA 3U9SA 2X5JO 4DARA 3EQZA 5DGXA 3EVCA 3AJ9A 2PUVA 4P3KA 5NLLA 2ABWA 3O83A 1YTLA 4L78A 5JG7A 1ATZA 1J2JA 3FETA 2C9BA 4GOOD 4KAJA 3IT3A 5EQTA 3BGIA 1Z0UA 2OCXA 1E5TA 3G2KA 3PT9A 1D1QA 2CYCA 3QUSA 1NW5A 1YBMA 2JB9A 4JJEA 4NAVA 4E88A 2QRQA 4P08A 4DXDA 4R2JA 1G6Q1 1SCKA 5FI3A 1FQOA 1XZIA 1UBUS 4NJMB 1SY7A 3GLFE 2C5EA 3R0IA 1JR3D 1TDJA 2J3DA 2P9TA 3FN4A 3DXFA 3L7KA 4P81A 1DQSA 2CUNA 1DIAA 2NUAA 4FW8A 2ISCA 3A6DA 1F4LA 2YCBA 4YB8A 2Z5VA 3VO9A 3SIXA 4RM2A 1NBME 5G02A 1KTIA 5IJWA 5AK4A 4O4HB 3UV6A 1OROA 4DWVA 1SKMA 2I29A 2KWIA 3AR3A 1GAWA 1IXKA 2IPXA 3DKKA 1ZCJA 1VJRA 3PTAA 1BGWA 3ELDA 3K6KA 2X13A 2D1FA 2PUCA 5FB3A 1JIXA 3AILA 1YR6A 1RJDA 4Q4HA 4C6RA 3PPWA 1YDEA 4EY8A 4X7RA 1RI1A 5EPEA 4WZBB 1KZGB 1R0ZA 1ULHA 4PLWA 3VSEA 1DAIA 3O8QB 4WMLA 3ZY2A 2JDID 4KQCA 4Y9UA 3RRNA 2XVAA 3TVYA 2V0NA 2JZOA 4IJQA 1JEDA 4DCCA 5DBIA 2H54A 4UQOA 1I6LA 3I9V1 1GQRA 4NHOA 1I1NA 4IIGA 4EJ6A 2YNMA 4UTVA 3NPAA 1TTQB 3DL7A 3RRYA 4F8JA 4UOZA 4LJRA 1D6SA 4YJ3F 2BE7A 2WMYA 4YQYA 3SU8A 2J9XB 5K0JA 1PNVA 2F43A 3LBAA 3CR7A 4S0XA 4G0YA 1PU2A 4DCPA 2ZYDA 2J31A 5JH7F 3EVEA 4OMFG 5BQPA 3VPDA 5KOJB 4H0FA 3ROXA 4ARAA 1YS4A 3CINA 4KIWA 1E9FA 2AG5A 3ZS9A 4N9QA 2R86A 1F7UA 1N7GA 1QIGA 2ST1A 3DZBA 1SUWA 1L8QA 4I1UA 2GHQA 3QVMA 1V7PC 3GD7A 1D5WA 1YS9A 2B4AA 3OE5A 4KIFA 4MA4A 5DGCA 4B17A 3GMTA 4ZYWA 4LEIA 4HAOA 3N0XA 2MCFA 1N5RA 1P0CA 3WZMA 4MW0A 2AEMA 1KY4A 3RSGA 2OORA 1JWAB 4Q1CA 4X66B 5A3JA 4GNRA 3P19A 3DNFA 3WNDA 4RTRA 2RD2A 1EFPA 2ZRBA 4P4SA 4PGGA 4RMJA 1YUBA 1T2FA 1XZCA 4R81A 1K8YB 2NZWA 4L9WA 2VG8A 1NBMD 4MV1A 3STUA 2DBQA 3BFVA 1HLGA 3TS1A 2OC9A 2FZKA 1FSGA 1OLOA 2XRFA 5BSVA 3CKYA 1HKHA 4WK0B 4AJ4A 1X1SA 2GVDC 1Z22A 3OOWA 1JPJA 5LZ8A 1H05A 5C18A 4RVGA 2B0CA 3HN6A 2JFXA 2AUMA 4TS3A 4DJ5X 5BUZA 2OHHA 1PQWA 1TJ3A 2LCFA 1WMDA 2WWHA 3A2NA 5JJLA 1FFCA 1OKKA 3I4LA 3O47A 1NG1A 5DWVA 2GETA 1NVVQ 2VA8A 3PRHA 4G9EA 3VI4B 4C0JA 2G83A 2BEWB 2N0SA 1W36B 5JAQA 1U8UA 4R1SA 4O4JF 3RANA 2Z1DA 2NYAA 3S6JA 4CQMA 2BWJA 2HAEA 2V7BA 4Z7OB 2DETA 1X7WA 2X6TA 5EEHA 2IQ5A 3CPJB 5BSUA 3I09A 1I7DA 3ZOZA 1H1LA 3ZWAA 3L02A 2GCGA 1RXIA 2FUG6 2WPDD 3HUDA 3QKRB 4FHCA 2I66A 1IHXA 3QOFA 2ATXA 4G5OA 4GE0A 4X00A 2LCQA 1E64A 4UHHA 4F3RA 2WUGA 3AK4A 4KC0A 1JHZA 2QRNA 4AG3A 5FOQA 4ZCQA 1ZQ1A 1RM5A 4FS3A 5ITSA 1IZYA 2R8XA 3EAFA 3VNUA 2FFHA 4JUAA 1XJCA 4L57A 5GJVC 3H8JA 4YGXB 4OGLA 3COJA 2XT6A 2WP0A 3AY3A 1NONA 4RY0A 4XQ0A 5K03A 2ZR0A 3UVEA 1C3JA 4EELA 1AO3A 4RS3A 4KR6A 1M10A 3ILYA 4O2BB 3PS9A 2POQX 2G04A 4OJNA 4TKVB 3SEQA 3FY4A 4DPKA 1SQSA 2J9FB 3M1LA 3MVEA 2IE0A 1CG6A 2GM5A 2OQ2A 3DL4A 4WDRA 2PT7A 2VJYA 3V33A 1HZJA 2Y27A 4LJ8A 3GZNA 4ECEA 2X0JA 1NPTO 5KQLA 1Y37A 4OFBA 3V4OA 2ZIWB 1R0RE 1KSFX 4YDRA 4ZC1A 3ETDA 1TZCA 3WV5A 3OPYI 4PWZA 4KXQA 4MV8A 4JP1A 4OLHA 2ZRAA 5AKJA 3KTFA 1NV9A 1I3KA 1TCCA 3PCRB 5TQVA 1BTOA 2WNHA 1EDDA 4P38A 1XD2B 4AROA 1GAXA 3NKVA 4UJ5A 3ML1A 1GNPA 2X4LA 3GUCA 3TIFA 1XPRA 1HLPA 4FCVA 3LA6A 2CNKA 2XD4A 4W7HA 5C1OA 1NQ5A 2YIVX 1JQLB 3DMYA 3ABOB 4M0LA 2YOFA 4YECA 1F1BA 2OM6A 3GGGA 5FADA 1CRZA 1XSEA 3K9WA 1G21E 2WHYA 3QUBA 1D2EA 2WJHA 4Z4FA 2CE2X 3GP3A 2Q3CA 2RKBA 1TB4A 4B82A 3SI7A 4H08A 5CW2A 2FZLA 4CUZA 1V16B 5HKOA 4YY3B 2YW2A 1AX9A 3WAGA 4OSEA 1PSWA 3SHWA 5DMHA 3BVPA 1H1DA 3A1UA 3EVBA 1N5MA 3QXCA 4JUDX 5LXTF 4MO2A 3FOFC 1EB9A 1OLXB 3KB1A 1FY2A 3VHQA 1Q83A 2ZDQA 3I4CA 4NE7A 4FGUA 4OFWA 5I7SA 2J0UB 3OKCA 3NDJA 4JBIA 2E5WA 4UPVA 2C61A 3KEQA 4OQQA 4BV9A 1RM3A 5EJ2A 1IG3A 2WTMA 4HGRA 5F1OA 4C7VA 3GNSA 4ISCA 3NHAA 2B25A 3ZDXB 3LU1A 4U9UA 4TLDA 5KTSA 4EFLA 3B51X 4JU9A 3JQ8A 4Q3KA 3GV0A 3Q2OA 1T4CA 3JQCA 4RLQA 3UJDA 1MJFA 2ATCA 3INRA 1MRSA 1W59A 4G85A 4DGQA 4X64B 1XP8A 1Y1PA 4EHKA 1R66A 1GPJA 1JDBB 3TRDA 1ADGA 2GARA 2ZVPX 3NEAA 3PE4A 4I1IA 4XPIA 5SYNA 4F3NA 5BOSA 1G2QA 1AQNA 1QOZA 1FX0A 4CDGA 1TJPB 5G0UA 5FUQA 4LHEA 1E2JA 2ZYWX 4H7JA 2XBLA 5LLTA 2YN2A 3PICA 4JGBA 3UA3A 2CK3D 2AA3A 2GEJA 4WESA 2GCEA 3PXXA 2VFAA 2ZYAA 1U4SA 3R5XA 4L22A 1Y8RA 3EXG1 2G09A 3I6IA 2BGLA 4XSGA 1ILEA 2DLDA 5KWVA 2JHGA 1DTWB 3FF4A 3K1JA 5DCYA 1H4SA 1ZXXA 1E1RD 1SCUA 5B3JA 2JL1A 5AM2A 5IFLA 2REOA 1GSAA 2X0FA 3W3AH 4TV8F 1TFUA 3B36A 2WSLA 3HUTA 3VMFA 1CLUA 2Q5OA 2DTDA 3KFXA 1ZMOA 5MN4A 5K20A 3IV7A 4WDQA 4DABA 5CFQA 3H9JA 2FDRA 2OAEA 4ABTA 2RGUA 1RACA 4R16A 2QM0A 1G8GA 2FE1A 4MTCA 4HAVA 5DSZA 4G24A 5JPIA 1OFHA 3E1GA 5JCJD 1NKTA 2JIOA 2VUUA 3ZIUA 2O8EA 2QNIA 2ZZMA 1GN9A 3L43A 3KK0A 1W4AA 4KKVA 1V8PA 1QUFA 3IAXA 4M22A 4X93A 5M29A 3U4MA 2D62A 1L8OA 2L42A 3ACCA 3JPWA 5EJGA 5EP4A 1JJ7A 2QMUA 3BG5A 1J2UA 2CXNA 1W0KD 2D1TA 4V2IA 4B6EA 3L1IA 4X8HA 4Z6KA 1Z17A 2ZYUX 2JGNA 2FUKA 1SU7A 1KGDA 2IUSA 3BSYA 3GOHA 4ND1A 4X8LA 3EPHA 2GLXA 2ATEA 1BA3A 1PZGA 1ZCZA 1KHHA 4M7WA 3OU2A 4AP6A 1UDBA 1V8ZA 1ENYA 1YQXA 4OUKX 1TUBB 3KBBA 2FPKA 3RFTA 3R8CA 1JIKA 4C0KA 4OQZA 3V55A 3KJEA 3E82A 5JQGF 3UGJA 3TLGB 1TTPB 4X6LA 1U2DA 3V8EA 4BXOB 2CSUA 1UBOS 4GR5A 4XYLA 3SS9X 3M6FA 1WXIA 1OX5A 4A27A 1NP6A 1J25A 4OYYA 1KYQA 2R7MA 1O5OA 1SUPA 1YA8A 3QYAA 3AM3A 3QPBA 4LZPA 4OUDA 5CUQA 3C14C 4ARIA 3DP9A 4JI6B 2GVZC 1V26A 3H8WA 3Q9NA 4MH0R 4XB1A 1EFVA 4B34A 5K8CA 3I2KA 5L40A 5FNVF 4NOMA 4WAUA 2BMAA 3WIUA 1KIAA 3SKYA 1WAMA 5DLEA 1JDUA 1YJQA 3I9KA 2QQEA 4EITA 1RLOA 2IYYA 1EVIA 4FBLA 2IHTA 5EPUA 2VP2A 2JKYA 2BFAA 3TZQA 2KBFA 3ZGOA 5F2KA 4LFBB 3GUUA 1E2NA 3CPEA 1RQXA 2LTAA 3I30X 1QP8A 1PTJC 4K6MA 4CMEC 5KOHB 1BNCA 2FOIA 1NF8A 4FSDA 1A95A 3UJ3X 1UIRA 1TO1E 1YBHA 2PUHA 4DEXA 4UCQA 3GVCA 4LWQA 4KIGA 1X8XA 1JJAA 2ZIZA 5LQNA 5F21A 2ZBUA 1TM1E 3CRVA 1E66A 3ND6A 4YCSA 2W98A 3Q3CA 4YYEA 2Q45A 3D4IA 2UU9B 3H2BA 4BZQA 2PV0A 3Q11A 1JAHA 2GF0A 4EQ6B 1MX9A 4R69A 5D3MA 4GLBA 4FUQA 1QFMA 1RRKA 5C4IA 4K6HA 1G9XA 3ZDFA 5KQPA 1X1AA 2R6GA 4UHKA 4GKJB 3K0BA 3OE7A 3IIKA 4GO1A 2WAMA 1UKAA 1CDZA 3FFTA 3DLAA 4JR0A 4CDRA 1XEXB 2CLEB 3OC0A 3OICA 3PHHA 3PQ4A 3L8ZA 2FX5A 4L72A 4C30A 5IXSA 5K4GA 1JHUA 1QH8A 2ZM5A 3KP1A 4OF4A 3A4TA 4Z7NB 2IBTA 5DCWA 1DBSA 1Y1SA 2H4HA 1YB5A 3QKSB 4Z4CA 2P2CA 1LPOA 2H5LA 4KITB 1H2ZA 1XELA 2SKEA 2HRQA 3TWOA 2IFTA 2V58A 4EO4A 4PRLA 4GC9A 1QPBA 4NG5A 3VC3A 4AZ0A 3CLVA 3HCDA 4Y6SA 3ZCPA 3GBVA 1QC5B 2CNOA 2G7ZA 2ZI7A 1NXOA 4NMWA 4DM4A 5IN4A 3PXEA 5A71A 5CD1A 4B73A 2H65A 1KFEB 5D3KA 3SBDA 4ZHQF 2I4RA 3H18A 4CKXA 3R9XA 1ZK3A 3SAJA 2IGTA 4GBGA 2B7CA 4IV0A 2Q27A 2QPAA 1ZKDA 3VYTB 5HDBB 2H2AA 4A26A 5AW1A 5H59A 1CQIA 4NECA 3GEBA 1WSDA 2VSYA 5EZSA 4TKZA 1NW9B 3IAEA 4CR6A 1Y8QA 1B6RA 3N8KA 4KO3S 1ZEJA 5TT1A 3RFXA 1Y1QA 4XWWA 5G4KA 1GVHA 4II2A 3QW4B 4M0CA 4ARCA 2G9RA 3BM5A 4W9NC 4V0ME 2WFZA 3TTSA 1XN1A 4IY1A 4BP3A 2A9OA 2ACVA 3O3NB 4OCZA 1VECA 2X2OA 3N7AA 3K5PA 2I7VA 4LHXA 3CQ9A 1J8VA 3BDVA 2DPGA 5FUVA 3D3NA 2Q3LA 3KKZA 2QD5A 3U3ZA 4BZWA 1A5SB 1NSTA 5JDIC 1J1IA 1BS1A 4EY3A 1PFYA 1U7XA 2P3QA 2R0QC 3VC1A 1KFCB 1TLFA 1YJ5A 4DV2B 1OWLA 3WRXC 4AU1A 2XCRB 3HLYA 4EJSA 4WACA 1MABA 1XV5A 5DXFA 3JVDA 1LPNA 4MHTA 1VMEA 2P1RA 2OB1A 3I6YA 5BR8B 1TQ8A 4TV9A 1DXOA 4JEIA 4OB7A 1N2ZA 2QT0A 3EIHA 1MJGM 1DKPA 4B35A 3VR0A 1BXRA 1PYGA 4FR0A 4R1TA 3T15A 3QLUC 1PJBA 1D5CA 3UGQA 1P2TA 4QUEA 4GQIA 3Q7SA 4LFAB 2A58A 4B7XA 4ZO7A 3E3OA 3QQ5A 4KRYA 3UHFA 3UQYS 4ARSA 4I99A 1O96A 1XXLA 2HMTA 3BMOA 4NOJA 4B87A 2JI8A 3AUXA 3NAMA 4MCHA 5BW5A 3BH6A 3ESRA 3U4DA 4BNMA 4RANA 1N6RA 4ICIA 8AT1A 5DBOA 5IWAB 1ADJA 3BREA 1QZZA 4LXQA 3KU4A 5HKLA 3U48A 4CF7A 3WB2A 2DQ4A 2L82A 5BWBA 2QJRA 4LFCB 4RPLA 5E1DA 5FD8A 3O82A 3JQEA 4JEUA 1RI4A 3LAWA 4KDFA 4M1TA 1ADYA 2AOTB 3GFBA 3U60B 2FVXA 2JVKA 3MWKA 1COZA 1YGYA 2VNKA 2ZZKA 3RIGA 1SXPA 2NAFA 1HI9A 1T8PA 1U3TA 3S1AB 3CTPA 5CFRA 2HOQA 3G0BA 2ZUDA 1JQBA 4IW3B 4QDXA 3TXYA 3WO0A 3TGLA 1EI9A 1MX5A 1NN1A 1K7SN 1XB2A 1W47A 2RAVA 2GSDA 3H1FA 2FUNB 3QP9A 1L7AA 4QUBA 2HJGA 5E1OA 5AXAA 2FQQA 3G9TA 3W8EA 2BVNA 2O7NA 3O8CA 1YDWA 1SU8A 3G2QA 2B4QA 2OD2A 1JFRA 1KJJA 3JPYA 4EA8A 4EWLA 3EWSA 1AM4D 4AO7A 4TYQA 5FWYA 4JP2A 1Q74A 3G9QA 2A30A 5KMGB 4QPPA 1X39A 4R3NA 4FGKA 5AJTA 1E0SA 1W85B 2E18A 1XEFA 3K09C 2Q62A 2XWQA 1V0JA 3GZ4A 5E1BA 3Q7EA 4CMGA 4EGFA 2L19A 2W6ZA 2FWJA 3GAFA 4ZREA 1MC8A 3OFKA 2JFQA 4G0ZA 2SCUB 4FI3F 1W5EA 1YBAA 2ZIEA 3MWGA 1K89A 4G63A 4TLAA 1INLA 1J56A 4C4TA 2PUBA 1YDHA 2QTTA 1CNFA 1XMJA 3W5UA 5KYTA 3ZDRA 4FIDA 4XH9B 4GKAA 2X8WA 7MDHA 4JASB 4E12A 1NPYA 1YL7A 3P0HA 4QXPA 3HGQA 4BB0A 3FUCA 3W2TA 5FCDA 1B1AA 3DV0A 3JQBA 1JB9A 4MB0A 4DA8A 1ZC4A 4RJJA 2W90A 1O8BA 3MFQA 4ND5A 1Y5MA 3MINA 1N1DA 4EAQA 5TVKA 4QQRA 4ZWNA 1XCPA 1ZEMA 4XCVA 2FZEA 3SE7A 1SXJA 4U2GA 4JXKA 3W4IA 4BMPB 1A97A 1SVKA 4KAXA 4EKGA 3IEVA 3DHWC 3DO6A 3GLHB 4E31A 3TQRA 1C4XA 2Y68A 1AKWA 2FPGA 4V24A 3GCXA 1W8IA 3RV3A 4DCNA 2EBFX 2B4TO 3MUEA 5IKEA 3PUHA 2REXB 3DOHA 4MV3A 4ZOQI 2BHRA 4R98A 3HO1A 3S2EA 1E89A 2WZQA 3K73O 4MDHA 3BWXA 4GX5A 2R8EA 1OB2A 3TN7A 3AFOA 5L3SA 4Z0NA 4DUPA 1FMTA 3UAGA 3S70A 4NBRA 4YUAA 3QTTA 5FH9A 5ICGA 2NU8A 4H7FA 2BI4A 5FV7A 3DMTA 4RTMA 4EJ2A 4HZUB 2BTQB 3QPAA 3F67A 4KEAA 5F2OA 3CU5A 5TE9A 3OIGA 3LQKA 1V2GA 1SC6A 5CURA 2BGGA 1R10A 2DG2A 3C7CB 1YQDA 2B34A 2OBFA 4JLOA 1GWNA 5GAJA 5SY4A 4CL8A 2Y92A 2YMLA 2JH8A 2XYHA 2GBCA 2EF0A 3GGCA 1FTQA 4M8IA 1L5ZA 4EG1A 4QJ3A 2X77A 3ASYA 5B7GA 1AKTA 1K98A 1TL7C 1TYZA 2Z9DA 1OBVA 5IUJC 2R65A 1NDUA 4HNAB 3LVBA 4L02A 2P9HA 4NPHA 3I73A 1MPTA 4YRFA 4JBYA 4H59A 4UHFA 3KV1A 3BTVA 1R9GA 4WBNB 4YXFA 5CM2Z 1ND5A 8LDHA 1GDHA 4OAOA 4W5JA 1S8OA 1JH9A 1C50A 5TNXA 1YH3A 3KUXA 4D43A 2GEFA 4RO0A 4R8VA 2YV5A 3CX7A 1ADCA 2W6NA 2JLYA 4CIVA 2NV2B 3UWPA 1FLAA 3ANLA 2CCKA 4U7JA 5HF8A 3ZE8A 2DB3A 2XDQA 3GDGA 1P2BA 2YWGA 4FGLA 3U31A 4AJ2A 4KX3A 2DWCA 2FMHA 4UUPA 3CN7A 2QSJA 4ZOEA 2VYCA 3SN6A 4UBOA 3ZBPA 4CV3A 4WK2B 4ZVOA 2XMDA 5HOEA 1C9EA 5IXJA 5A0VA 2A9RA 2WG2A 2PWAA 3DBRA 3LBFA 4C1NA 4NU0A 3WGYA 1SD1A 1I3OA 2GZMA 3VU1A 1H2FA 1UQTA 4L07A 2MT9A 5CM9C 1VC2A 4HQRA 3OT1B 3MJ4A 3U39A 2V98A 3MCVA 1JHVA 2VWGA 1L4UA 3QVKA 5F5LA 4OHZA 1NJ8A 2H5EA 1FDSA 2D5BA 4XWTA 1HQYE 4JS0A 1VL5A 3AF3A 4L8LA 1GAQA 1HQCA 4LJSA 4MW6A 3O03A 4QDUA 3E9EA 4GXTA 4KGZA 4QOIA 4UUBA 1G4HA 3EMKA 2ZJ7A 1KEVA 1OZFA 5JADA 5DHAA 1LJLA 1CHNA 2FPRA 2VQSA 4K3UA 1Z82A 1QQ5A 2AEFA 3B6IA 4GOJA 1YCHA 4RJIA 3VYVA 3K30A 1P4SA 3ETHA 3VOAA 1RYYA 2XRZA 3AM1A 1MO5A 3G8DA 3NOOA 1DAOA 1WCIA 3PC8A 4Y30A 4RD1A 1WLYA 1D2AA 3PL5A 5DEOA 5M2QA 4QIHA 3UH0A 5TY0A 4L74A 1KH2A 1A9YA 2FPUA 1W7AA 1FNMA 2Y0EA 4KWHA 3HB1A 4AMBA 2XQJA 3BXGA 3T4XA 2JJ1D 4EKEA 4DZRA 4YRZA 5CA0F 4A92A 2Z5GA 2H31A 4YV7A 3COYA 3UG6A 1IONA 1Q22A 1DMSA 2HO4A 4B75A 1E6EA 3GUYA 3V46A 5FHRA 4LYGA 3S4YA 4ZYZA 1VLLA 2D3WA 1YRQA 3HVUA 5REQB 1FRFS 2QYOA 3VU0A 1PR5A 2QVLA 3F5DA 4PRYA 3QJGA 4MIKA 5M5BA 5DTRA 1QU2A 4GRDA 4RVNA 5I7HA 2R5FA 2X5NA 1W1IA 1SC4A 3T4PA 4ENSA 1WW2A 3GRPA 1DS6A 4DCGA 5JRZA 2P77A 4V3BA 3GNTA 4PR0A 4H77A 3UMSA 4BKQA 1U63A 1GL7A 4LWOA 3UWOA 5CNKA 3IMKA 1J99A 2Q49A 4RUKA 1NN0A 3D8TA 5JU6A 1GNSA 2I3AA 2DTEA 4INPA 2ZKIA 4EDFA 1QHFA 1WPGA 2YY5A 5FFMA 2YXNA 2Q4BA 5IC6A 3WYBA 1MOZA 4WLFA 5A04A 1ULSA 4M7OA 4TL8A 4ZJUA 2VATA 2HLPA 4FMDF 4BO2A 2LVBA 1TYAE 3PITA 5EFZA 3EF3A 3RK1A 4C01A 1DVRA 3LKZA 1JRLA 3GA7A 1PKXA 3ONVA 1GL3A 4TSRA 2JLZA 1NWCA 1NX9A 2W2MA 4WCFC 3RSQA 3U9LA 2FWAA 1M8FA 3SX4A 4I6JA 1KL7A 2HCRA 2RGXA 4HMOA 4YFYA 3JTEA 2ZIFA 3WJ2A 2DX7A 4J07A 5CB4A 4DKJA 2MMGA 3LCRA 3VV3A 5JRJA 4C2TA 1L5GB 3JR7A 1ZUWA 2C5GA 4P8RA 4EPWA