4D9GA

Crystal structure of selenomethionine incorporated holo diaminopropionate ammonia lyase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
387
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Putative diaminopropionate ammonia-lyase
total genus 119
structure length 387
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA01
3V7NA 1V7CA 1VE1A 5D84A 1PWEA 5T6MA 3FCAA 4D96A 5B3AA 1J0DA 3AEYA 5D87A 1A5SB 2C2GA 5DBHX 3TBHA 5B1HA 2ECOA 5J5VA 1WKVA 4D9NA 5I7HA 3R0ZA 4AECA 1JBQA 1VB3A 1WDWB 2CLFB 4H27A 1V8ZA 5KZMB 1KFCB 4D8TA 5BW6B 4D8WA 2ZSJA 5I7AA 2CLMB 1C29B 3ZEIA 1VE5A 1CW2B 3CEPB 5DBEX 1TZKA 2D1FA 1Z7WA 4HN4B 4PCUA 1FCJA 5JISA 2J9ZB 2EFYA 1FUYB 5CGQB 5DW0A 5B36A 2V03A 2CLIB 2TSYB 3HMKA 1Z7YA 3X43A 3X44A 1WBJB 1A50B 2CLOB 2RHGB 1UBSB 2CLKB 1E5XA 2O2EA 2CLLB 2GN0A 4OFXA 3DKIA 1TTQB 4L3VA 1K8XB 4QYSA 2ZPUA 1TZMA 4ZU6X 1TTPB 4IL5A 5HBGA 4D9EA 1KFKB 2J9YB 2JC3A 4ZU1X 2CLEB 4D9FA 5B53A 1KFEB 3IQHX 3PC4A 4HT3B 5E0KB 2ZR8A 5KINB 5C3UA 3PR2B 3IQGX 4Y6GB 4JBNA 1TZJA 1OASA 3VSCA 4LMAA 3VSAA 1WTCA 5J43A 3PC3A 4NEGA 5I7WA 2BHTA 2GN1A 4D8UA 1K7FB 4KKXB 1BEUB 2BHSA 2O2JA 4NU8X 2PQMA 2TRSB 4COOA 4D99A 1V71A 2CLHB 1BKSB 5DW3A 1RQXA 1K7XB 5IWCA 3IQIX 2EGUA 3L6BA 2GN2A 4JBLA 1J0BA 1P5JA 2TYSB 3VC3A 4L0DA 4LI3X 3RR2A 1J0AA 5IXJA 1UIMA 3BM5A 2ECQA 3PC2A 3VSDA 1TDJA 3R0XA 1K8ZB 5DVZA 4D9KA 1K3UB 2J9XB 1QOPB 2WSYB 3SS9X 5EY5B 3SPXA 5I6DA 1J0EA 1KL7A 5CVCA 5JJCA 3T4PA 3SS7X 3L6RA 4ZQCB 4D9CA 4XUGB 4D9BA 1A5BB 1D6SA 1M54A 5B55A 3IAUA 5I7OA 1CX9B 4LMBA 4WX2B 2RH9B 1QOQB 4D97A 1KFJB 5D86A 4I1YA 4HPXB 5I7RA 1K7EB 1C8VB 2DH6A 3DWIA 4D92A 1UINA 4HO1X 5D85A 5B1IA 3AEXA 1PWHA 4D9MA 2DH5A 1O58A 3L6CA 5IW8A 1Y7LA 1TYZA 3FGPA 2ISQA 1J0CA 1TJPB 4L27A 1TZ2A 4AIRA 1C9DB 3VBEA 1A5AB 1KFBB 2Q3DA 2Q3BA 4HPJB 2C2BA 4D9IA 3DWGA 4OREX 2RKBA 4F4FA 1K8YB 1F2DA 4L28A 2Q3CA 4D9GA 1X1QA
chains in the Genus database with same CATH superfamily
4J8PA 1VB5A 3LLVA 5CX1A 5FI1B 1ZQ9A 4EK9A 4QT0A 4NWIA 3CVYA 1CY8A 4CLDA 4IGKA 3HE3A 3AH8A 3BCSA 4QJ4A 3NORA 5AJUA 4ZCLA 1A5SB 1I0ZA 4ZOLF 5IDQA 5IS2A 1J5EB 4Y2TA 2IYUA 1JJVA 1QS0A 3EEBA 3F46A 1GAXA 1PJTA 3IV7A 4UJ5A 1F6WA 1DG1G 4U39A 4QBIA 5ALKA 2ZTVA 2Q5IA 4RTPA 1DIAA 2I4TA 4DRYA 3FYUC 1ZD5A 5JMOA 4JNCA 2NP7A 2DUNA 3L8FA 2H4JA 3GUHA 4UHCA 2HT6A 2JARA 2LRHA 2XDQB 2OCDA 2WJ4A 4B2YA 4MV4A 1SXPA 1AB5A 4P98A 2WHXA 1EWKA 4BO4A 1E8DA 1V6AA 1E7RA 3A1SA 4H7JA 4HDRA 4Q1CA 3VYWA 3X44A 1RRKA 4M8IA 4E12A 2P9BA 2RGRA 1P18A 3GEMA 5DZSA 4DRXA 2C2ZA 5AVUA 1BCSA 4W63A 4Y2GA 1VIVA 3F97A 3UUFA 2AW3A 2GKOA 3WA6A 4II7A 4P4GA 2LDXA 5EXDA 1L1QA 4MNTA 1JXOA 4KR7A 3ZBPA 2LWIA 1FX0B 5KNDA 1HURA 3RU7A 4C4ZA 4TSFA 1IJFA 2AWOA 3KSRA 4YV2A 3AVVA 1PFGA 2FPXA 3K4HA 5C1DA 3E6AA 1GCUA 3RI3A 1FSZA 2E4WA 2JEYA 2COKA 2SCUA 3ENVA 4Q9LA 4NQRA 2OEPA 3OETA 2FPLA 3BHIA 4KR0A 3R8FA 1XZKA 4HWOA 3HDYA 1VE9A 3ADBA 1U3DA 3QPWA 3F9RA 4PXYA 4C3ZA 4WY8A 1W36B 5AKYA 1NVMB 2B36A 2VBGA 3GPDG 4Q4HA 1RM4A 3BXFA 4K3UA 4F9GA 3PK0A 1M6VA 2B25A 3ORHA 3HCFA 5DW3A 5KTRA 4V1CB 1UODA 1XV5A 2FNAA 3DFFA 2AQHA 1O3YA 4S05A 2HTEA 3V9AA 3NGXA 4L0DA 2QIPA 1XNQB 4KITB 3BM5A 1WCYA 2XD9A 3KSDO 3M33A 4UDXX 4EHBA 5KNDH 3EA4A 3H2IA 3HVRA 4CEJB 4AI6A 1KO1A 1AJEA 1G21B 3RGWS 1K63A 1WUTA 1GD1O 2ILTA 2Y0PA 4K0RA 4WLVA 4Z7OB 2BD0A 1JDVA 1RJ9A 4LV8B 4PG4A 3VJMA 2ZYUX 1O6GA 2FN4A 3OZBA 2JLRA 3DXZA 3PEVA 4DAOA 4E1AA 1TT7A 2W6CX 2WVHA 1RYZA 5BSWA 1H9CA 3H5NA 1RIFA 5JZMA 2YRXA 3MG9A 4OGGA 2ZBQA 5DF1A 4O5AA 4YRAA 3B9QA 1EJBA 2JFFA 2FJUA 4QICA 2CDAA 3FLAA 3TZBA 4DV6B 1SC9A 2PU7A 1VQ1A 3N7UA 3DAOA 2O2YA 3K1ZA 5HIIA 1IN8A 4HO1X 4CT0A 5CTAA 1ZY2A 2PBLA 4LV5B 2QUAA 4DA7A 4H1WA 2YV3A 4MYTA 3IDZA 3A3OA 3QH4A 2B0JA 2NUTB 2NSJA 2J3LA 2XYPA 1ZCZA 4KLCA 4EHAA 4C78A 4FQ5A 2A8YA 4JC4A 4TMXA 2Q3DA 1JZQA 4KL8S 4LYHA 1P62B 3EXIA 2VPYA 3I45A 3R3HA 5IDXA 2OC4A 3N0RA 1R00A 1HYQA 3DW1X 3GNSA 3EZXA 1SXJC 4PZZA 3GEIA 4Q66C 3ZI0A 4DJJA 1XKTA 4F1WA 3JR3A 2DWQA 4UCWA 5CB4B 1PWEA 1I2BA 3G2OA 3JQEA 4YASA 1QRUA 2HD4A 4KLZA 3C3CA 3UMRA 2UU9B 3VNRA 1X86B 3NRCA 4PNHA 1S7CA 1WP9A 2YUTA 3QVUA 2C61A 5AVXA 1DKQA 4QRDA 1M1YB 1CUZA 2B8WA 3NNNA 4KZPA 3H1BA 3EOAI 4OUKX 4X0EA 3EZGA 1L7PA 2AN3A 1FFHA 4IIHA 2C5FA 3KHUA 3PQ2A 4YP7A 3U3RA 3GVIA 1WRBA 3IP5A 3LL7A 2IUFA 1P19A 3AR6A 3G2LA 3NHLA 2FG6C 3RFFA 3UJ3X 2XH8A 2UVPA 3HLTA 4C6HA 5JS1A 2E49A 1IBSA 1GT91 1P7YA 4PPYA 2PUGA 3IR6A 3QE3A 2NWQA 1R16A 4PX3A 3FHTA 1HE1C 4I55A 3IUYA 5L7TA 1ZP6A 5KX5A 1EXNA 4PLCA 2VYVA 2Y1GA 4NG5A 4LJYA 4TZTA 4UARA 2RI6A 4YPVA 5L3SB 1FJGB 1TU4A 4D8XA 1FQOA 2B2NA 2JZNA 2ZETA 3T06B 1FFXB 4BKUA 1YI0A 2DFNA 2P8SA 2ZI6A 3Q6IA 2PLFA 4U8HA 3T3PB 4C0LA 1E9SA 1XZQA 4MO2A 5MGBA 2C9CA 1GR1A 4Y6GB 1G8FA 3NC0C 2DP4E 2C95A 1ISIA 2OM6A 3BGOS 1N75A 5KPJA 2DR3A 3Q5EA 4E6EA 4LN1A 3S99A 2C7OA 1O9HA 1Z5WA 2HK8A 1VPLA 3ELWA 4FFNA 2N47A 4AW9A 4BVBA 3MPOA 4UOZA 4CIAA 1BWPA 3BA6A 5DLDA 5DXAA 1PS9A 1KEWA 3D4BA 4ISBA 4N8SA 5EE5B 2BEVA 3RJ9A 5EJ4A 2AVNA 2PRIA 3GT3A 2C3UA 1JIIA 5DI3B 5IJ0B 2JS7A 1EZZA 4ZYZA 2RD2A 1YQTA 1SKUA 2P6OA 4C7VA 3ESZA 5GZ1A 4HMOA 5KX5F 1LW6E 4G0VA 4WCFA 2PIAA 3T9DA 5GY7A 3IP9A 3KUXA 1R4MA 2QI9C 4RH1A 3W05A 2WJVA 4F9TA 4IF6A 3UJ7A 1J7KA 3VR2D 4JU8A 3ACDA 3DEFA 5FD8A 5LKAA 4E7PA 4GLJA 3HXOA 1FP4A 1C50A 1SUEA 4JEUA 2J5KA 4RA6B 3W8NA 1JL3A 1TM2A 2VPIA 4RMIA 1NHGA 2VPXA 5ILOA 4EIWA 4C0AC 1BJRE 1XTJA 1S2DA 1YB4A 4TL7A 5AXCA 5EJ9A 1EJ6A 1U0RA 2WD8A 1BX0A 1AS0A 5JFGA 5DX0A 4W8OA 1XZHA 3AY7A 3AIKA 1H5UA 2Y6VA 1H66A 1YZTA 1WO8A 3T1HB 3PNQA 5CVDA 1AUOA 4YN3A 5HF6A 1DJMA 1Z8FA 2GN9A 5EEHA 1K9VF 3FUUA 4XPIB 3X2SA 4CM8B 5JU6A 2WU0A 1QBKC 5KYYA 3OM8A 3GT7A 3PGKA 2ISCA 2PGJA 3DZHA 2O8NA 4CHGA 3O3CA 3BGSA 3L3BA 1EFVB 4LX8A 3WTCA 1IJKA 3NKLA 4GG1A 3TLJA 4Z0TA 3TTUA 3OM1A 5DTRA 2ZRNA 1Q6ZA 2UUPA 1W36D 1RACA 5CBPA 2JIBA 3GI1A 4Q4LA 4UE6A 2D74A 4PC6A 4OHCA 3E0XA 1OAKA 2CJYA 2DBZA 2I7VA 4MPTA 1HSZA 3GJTA 4BX3A 4PYIA 3PDIB 4E70A 5A5VA 4N76A 2Y4OA 1IRIA 1N3LA 4N0MA 3M34A 2AEFA 1MG0A 2FUG1 1Y9AA 2MHCA 1GO2A 3SKYA 3WV5A 1K08A 2V7EA 4BNUA 1QHXA 4ZT5A 2LZ0A 5J2UA 3JSXA 4E46A 3THWB 3I01A 4H0NA 1C7IA 3LWZA 2JAXA 3TQOA 2WQ7A 1NX6A 2J45A 2PT9A 3UWPA 1YB7A 1Q0SA 4C0BA 2B4YA 1VJ1A 2HRDA 5KWEA 2CMHA 1WD5A 2PMBA 1PCXA 1T1SA 4XH9B 2CSUA 1DIBA 1N0IA 3UGQA 3OFND 1A71A 5DO9A 3H3XA 3T7TA 4DKXA 3ZR4B 4AJ9A 4H0CA 4M1ZA 2QMZA 2WKQA 1MX5A 1B0AA 3QG5A 4C76A 4P53A 4ETWA 5E6UA 2XNCA 3FUVA 3V46A 4FXPA 1XX6A 1ZK3A 1LF5A 4YFYA 1EFDN 2VSOA 1RZRD 2E87A 1R9GA 4B85A 1QHEA 2DFVA 3WGGA 2BONA 5I51A 4UNIA 3DEZA 1BSVA 4EG5A 2Y99A 2OPHA 3GQBB 1O94A 2P2DA 1QQBA 2MIIA 4MV0A 4HQKA 5H80A 2GCPA 1GKKA 2LUOA 2Q99A 5ITZB 4B6QA 5DLYA 2QAGB 3Q1LA 1KOJA 3GGPA 1NQAO 5B3LA 5I8PA 2ORED 1SQ5A 5FB3A 2BGNA 4RKRA 5K6AC 3BPSA 4MP3A 2HRZA 3UW3A 4IQ8A 4PEVA 6REQA 2BKLA 3GO4A 2YXLA 3K1AA 5EUCA 2BTQA 4HCJA 2AJDA 3FF1A 3NM5A 3ZNNA 2JFHA 3LNCA 4IUYA 1V4NA 4MRAA 5EJ6A 2EP7A 4Y2YA 2C8KA 4EY4A 1IY1A 4L3WA 3GT0A 1BKSB 1HR0B 5BVGB 5THQA 3HKCA 1L4NA 4XIJA 5FLXA 1E0AA 2BMDA 1BHSA 2FR1A 1HDZA 4YONB 4ZVOA 3ETNA 2XVYA 1DV1A 1EGAA 1X42A 2VQDA 3TH5A 5K01A 4AXBA 3EX7C 4FYWA 1YCGA 5D00A 2B98A 3O74A 2SHKA 5HF5A 4LGVA 1ZIDA 5ARDA 4D5EA 1SUDA 3VSBA 1Y4ZA 4CFSA 1GXSA 3P5BA 2H9YA 4L5AA 2OFPA 3ET4A 4LSZA 3E7FA 3RVJA 4P4UA 1F38A 1TC1A 3FF4A 4UW9A 3VRHA 5KTMA 3V4SA 5KSYA 2HJSA 4B33A 3K35A 2I6XA 1JIUA 3A1FA 3L05A 4MV7A 3ZY4A 5ALVA 3BSFA 2GKGA 4V0SA 2CMKA 5T5QA 2OBXA 3DEAA 1M10A 2NAPA 2GF0A 2IUSA 2V3VA 4A10A 4P0PB 1N3IA 1U31A 3OSZA 3VXKA 4C0XA 3AVYA 1NQUA 4F7DA 4LISA 5EMLA 3CE6A 1X7DA 1BDMA 2CF6A 1E2HA 1QDLB 3TD2A 1JU9A 1XRMA 3DE2X 1NN3A 3EFHA 2OBLA 3HLYA 3INNA 3WWYA 4BEVA 1XCOA 2P2GA 1ZKDA 5K8LA 3SVLA 3FPCA 3IAFA 4DLKA 3TAHA 2IIBA 2WTMA 3ZD6A 4C7MA 1NJ8A 4IW3B 4JJAA 5DX8A 5BPHA 1SWVA 1AMNA 3TOSA 2OL4A 4R6WA 1EVZA 5EJMA 5FHQA 3I01M 4ZAZA 4BMVA 2VHZA 4H1HA 2WWHA 1Z73A 3HZHA 1DAOA 3L7DA 1W19A 3QHQA 4GNRA 4YQEA 3PJFA 2ZWAA 3DV0A 1OX4A 1QCDA 4DLUA 5BYBA 1YULA 4EKGA 3K0FB 4GYKA 1OLXB 3LCMA 3UNXA 3WK5A 1I3NA 3K8QA 4GZLA 1J9EA 3SYLA 4BFVA 3TW4A 4DA6A 1M2FA 3DFMA 4IXDA 2C7PA 1EQUA 5EP2A 2O3UA 2ZRMA 4BYGA 3S2FA 1GA4A 3AFHA 1HRDA 2V6IA 5HZGA 5LKRA 5FBKA 2JLAA 2ZPAA 2D13A 4K03A 1QHHB 1RCFA 1RC8A 1J09A 1TIPA 4AJHA 3LLSA 5LDHA 3RSOA 4BVLA 4D2IA 2GM4A 1KK3A 1BQ4A 1I3LA 3V8BA 3AK4A 4AYWA 3AJDA 2B4RO 1JTEA 5DU2A 1IEVA 1Y5RA 1ZJZA 3NAGA 3QEMA 4PYLA 4YP9A 4F0JA 1T2NA 4S1VA 3G0DA 4XCQA 5ECGC 2FR8A 3JQBA 2WKSA 4HZUA 4KO1S 1GRCA 1KFKB 1WUYA 1YUBA 4TN5A 2AB0A 4DJDC 4M2LA 2GNAA 4MAMA 2XDYA 3ZU4A 5AK0A 4HT3B 1FS4A 2DR0A 4CKBA 4XYGA 3N8KA 2FSGA 3BJRA 3CA8A 3FKSD 4HAYA 2VP2A 3SDZA 2H5LA 2ZPTX 3G13A 3D3QA 4ARSA 4GWGA 4CMEA 1X1TA 2RG1A 2RGNC 3KLMX 4OQYA 3BRWD 5J43A 5ITZA 1JSCA 1WP4A 5THXA 5CA1F 3AZPA 4U3JA 3QNWA 3LIIA 2DKFA 1FB5A 3R4CA 1E8MA 4J90A 1EKXA 3VR6H 5IWAB 1BJTA 1C9JA 4O2LA 2XYQA 1EFTA 4BGIA 1Z08A 1E9FA 2A92A 3MLAA 2XKKA 3M9WA 1JHOA 4B8WA 4FHGA 3ZKWB 5EJ5A 3U17A 3COZA 1K4KA 4PHGA 3L4JA 1KVQA 2P6RA 4HR7A 3OA0A 4YCSA 4Y1RA 4DV2B 5CDUA 4H1TA 3HDGA 3IKTA 2CFTA 5F1KA 4BEBA 1U2DA 1RJGA 4M22A 2XWQA 4D4IA 5B58T 1DCMA 3QX8A 4DV5B 2XUOA 3HB0A 2FFRA 5T3UA 3EDYA 4JBWA 1TJ3A 5K0TA 3A28A 4E3ZA 2NSHA 4EMSA 2I67A 2FTKE 1O08A 3ESXA 1E2PA 5BNZA 1U1DA 3DYIA 3H4IA 1NLMA 1MFPA 4NULA 1P6XA 4X63A 4GRAA 3C7AA 2RH8A 4Q1FA 5HKKA 5AUOB 4DDMA 4YJKA 1DG9A 3U7HB 3LDHA 1CP2A 1DPGA 3KJNA 4JZYA 4UATA 4E4TA 4DNOA 5HS6A 7GPBA 1QR2A 2ZUCA 4ZYXA 4RPGA 2Q5CA 4A03A 2PUHA 2X15A 3I72A 4NZ9A 3GGSA 4ZKDA 2OXCA 3I6BA 4XQCA 3ZOZA 4HB2A 1MEOA 5B57C 3ENKA 2ZI9A 5C5IA 1KHTA 1T0PA 1WW2A 4CCYB 1HDIA 1SELA 3B1YA 1N1EA 5J3JA 2QX8A 2HBQA 2FCAA 4MYRA 3QMMA 3TXYA 2R8EA 4R5MA 2GPJA 3E22A 1W7AA 4IGEA 4P0QB 4DQ0A 1F7UA 4AZ0B 4HS9A 2A9QA 2RHHA 3UM9A 5AW5A 2D5AA 4N65A 1FMFA 1U8UA 1G41A 3WKDA 4J0EA 1XMOB 3OJXA 4J2OA 2H8KA 3R41A 3O95A 4GIBA 3DONA 3W90A 4TVKA 3GFRA 1JEDA 2C4WA 1GTMA 1VE6A 3PE4A 1Z15A 3S68A 5ALJA 2Z3ZA 3NBAA 3EJWA 3BICA 4ZFNA 4EO4A 1NE7A 5LZ2A 4M8SA 2ZM6B 5JMWA 3IAEA 1PFWA 1ZWKA 2I6GA 4Y6PA 4PINA 3HY4A 3HBMA 2QEQA 4D57A 1G3RA 1O4WA 3JWPA 3ZGNA 1JSRA 2ZB8A 2LKCA 2HADA 2SKEA 2V6MA 1VG9B 2WF8A 3N87A 4HAXA 1E6EA 1R0WA 2J0UA 2BKUA 3EMKA 5BPFA 3AF6A 4QYTA 2AK2A 3IHKA 1WDKA 3ZIUA 4BQQA 3KQSA 1KI8A 2FP4A 5CT6A 3MQ2A 3PQ6A 1Y1KE 4C6TB 1GLVA 3PD7A 3G9ZA 3IDSA 5JMTA 5A6SA 5AYVA 1L1RA 1CB7A 4OQXA 4XX1A 1KE2A 4NPCA 3LUCA 2RGEA 4CFZA 4I1PA 2PSSA 1GAQA 4FE7A 4LAFA 2A1IA 1B76A 3PX3A 2OC9A 1T4MA 3G0CA 5I7FA 2WMNB 3OU2A 3PE3A 5MGNA 4I36A 2IH5A 4UHJA 4BMNA 4QU9A 1P4SA 3KB1A 1RXCA 2VR1A 3IIEA 1A3CA 3EXIB 3QWIA 3LUJA 4TTSA 3J7AC 2DSNA 2JFBA 4PPQA 4G9EA 1CQIA 3HUUA 1ORRA 4CTKA 2PGOA 1RYHA 3BUSA 5K0GA 1UPBA 1T1RA 2TS1A 5ALSA 1ZLXA 2Q4BA 3TLEA 1OF1A 4UHBA 5DKFA 3UH1A 1CQJA 1T0HB 3FPKA 3H4MA 3L6BA 5CVUA 3WK9A 1SKMA 2RGNA 3O1IC 2HA3A 5ALIA 4YWJA 5L7WA 1IVYA 5J1TB 4BVJA 2QTFA 1Q7BA 1BN6A 2GK4A 3GJYA 4IICA 1UKZA 1Y1RA 4GYJA 4B6JA 2A3RA 3LHSA 3QKRA 3THYB 5G0TA 4KN5A 5MN4A 5HM6A 2AUMA 3BFJA 4RTQA 4UUAA 1AIPA 3SIPA 1E92A 2IU3A 1REQB 3EQ7A 3WK8A 1OWNA 4UEJA 2Z09A 4NXNB 1EVIA 4OHZA 5JJCA 1L4MA 1Z12A 3L7LA 3Q8MA 4CUJA 3E61A 4CMKA 1P6UA 4RQTA 4X8MA 1PVOA 2PUAA 1A7AA 3AG6A 4H0FA 4LBYA 1M54A 1FNSA 1UFVA 1W96A 5TQ0B 1DCTA 1VL2A 3O03A 2ES4A 3VHRA 3H4VA 4A2PA 2RAUA 5F35A 3HUFA 5BSFA 4LJRA 3DDCA 1LLCA 3OTOB 2SKCA 2I5PO 3T1YB 4ND1A 4PYRA 3FRJA 3WFIA 2FLKA 3DAHA 5D85A 3HEBA 4QO8A 1HPLA 5EJ2A 2JVJA 1QR6A 3NAMA 1Z18A 3ZOKA 4MHSA 5JWHA 2GEVA 1MH1A 3S4YA 2J9FB 2OBMA 4J0HA 3F4BA 5ALQA 1F20A 3H1EA 4AKGA 4L9AA 4MQEA 1XZIA 1GQFA 1KJJA 2J3QA 3H6HA 3OEWA 4QYMA 4UZEA 1NNI1 3MWYW 5AKJA 1FSFA 1CF9A 1KOFA 1IY0A 1K06A 1N2CE 1NU8A 5IF3A 1C9KA 4QC2A 5HNKA 2H8GA 4A8JB 1JFRA 2G77B 2EQAA 3DOEA 3FYHA 1KDYA 3M3HA 3W04A 1ZVKA 5DLQC 2VP5A 3COPA 3UPUA 3Q3CA 4IDDA 4HRXA 1E5TA 3T1OA 4L0MA 1GSAA 4KE9A 3HACA 1QHHA 4L8VA 1U2PA 4F4JA 2JFQA 3RHZA 1SUWA 2PKRA 4JNKA 3JQ9C 4PGFA 4DREA 1MPXA 2XOXA 1YKSA 2DFDA 4F8YA 2X58A 2J9ZB 3DCNA 4FFMA 1XZBA 3CVVA 1EWRA 1QQTA 1D6MA 4EO7A 4O5OA 1N6NA 4OXIA 2YV5A 1DKNA 4A4DA 1Y5MA 3KVYA 3Q5DA 1WQ4A 2GTPA 4UHEA 4WOCA 2C54A 2ZBUA 3W5BA 2IKQA 4UHDA 1USIA 4NJEB 1QZ3A 4NXMB 3DTTA 2QP9X 1DAPA 1PGQA 1RFGE 1S3GA 1SIOA 3B51X 3HA5A 3CFYA 2IZ1A 5G4KB 3RNOA 1R9MA 5F7XA 2CLCX 5EHZA 3VHLB 4I5GA 4EDFA 2F67A 3D8HA 2C1EA 3BIXA 3M1IA 1THZA 5K3SA 3ZBQA 4TTJA 1EG7A 1W73A 5C81A 121PA 1ZN7A 4JJ4A 3STWA 4MCHA 3OJOA 2EJBA 2EEPA 4IZIA 4JITA 3R7LA 4IXTA 5EZYB 5GWXA 2K2QB 1LGYA 2FEOA 4LVUA 4R71A 2QG9A 4GAEA 4Y0NA 2OO5C 3WYNA 2X8BA 5D6OA 2BKEA 1DQRA 1V71A 4U6NA 3HXTA 1QB7A 3PUYA 3P1JA 4NMHA 2R6ZA 4MRPA 1M8PA 4PYKA 4MWTA 1V8DA 4BNWA 1QG0A 1G55A 3BC1A 4O29A 5J2TB 1Z5GA 1YKFA 5ALNA 1XRRA 2QV7A 2ZDHA 3JAWA 2QS9A 1NURA 4AURA 1W1WA 4A8JC 4OO3A 1C7ZA 1J0EA 2C4UA 4LZWA 2KQUA 3K6JA 1DDGA 3YASA 1ADJA 4RTLA 3HN6A 5C7OO 1KQFA 2W42A 3LX8A 4AQ7A 4MRVA 4X85A 1RYEA 2GJKA 4UMVA 4CDGA 4RKFA 2EHDA 3FUCA 3O0DA 4WKCA 1Y8RA 1NW6A 3UAWA 3L92A 3CGGA 3PJDA 4KGXA 1W5AA 3JZAA 1VLQA 1H6BA 3BXPA 3HPRA 1P2DA 3TQHA 5KTPA 4G56A 4ZEMA 1ZR2A 5TNXA 1R3UA 3VUEA 4AD8A 5BN3A 5CH8A 2JLUA 4KUEA 4J1NA 4PX5A 3W5VA 2GUGA 4IM7A 1VBMA 3BK7A 1L7RA 3V8PA 3WQQA 3ANTA 3PRKE 2O54A 4ZWNA 3H6KA 4YJGB 3ML1A 4RDXA 1C0PA 2N0SA 3H8JA 4UD2A 3TIIA 3LMKA 4NU6A 3R6LA 4MRRA 3KHTA 2G1KA 1JW9B 1ZEMA 4HNGA 4YMVA 3GFGA 1MAAA 1I6WA 2JI8A 1JAIA 4LUCA 4P3YA 2A67A 2PMDA 5JCJA 1QYVA 3LUHA 3RRMA 3UANA 2XIJA 4X71A 1RQRA 3SXJA 5FEUA 1VCIA 1FUEA 1T8UA 2LR0A 3N7AA 1RQNA 2FMXA 1CR2A 3JQ8B 4LS3A 2YS7A 3PHHA 3I9JA 3MGBA 1R10A 2PR2A 4DGSA 1WDMA 1LVGA 5IAOA 1NZJA 2CZQA 2VAPA 3I9V1 3KOYA 3LY9A 1IZ0A 3QK7A 4YTEA 5B1HA 1U3UA 2FN3A 3BTOA 4LNUB 2IYRA 5FT9A 3RREA 1H1TA 1D07A 1RMQA 3FIUA 1PW7A 1H2WA 5HQTA 1W8IA 3ASZA 2ZBFA 5KZMB 4RPJA 2C94A 2C5BA 4L9SA 4X90A 5IM4A 5I9SA 2CJWA 3FMGA 1A9XA 3ZJVA 1FDRA 1KZ4A 1O0SA 4GQAA 1QWOA 3AT1A 3BILA 2WZQA 3EFOB 4K9MA 5G2OA 5TGZA 4Y6RA 1ZNZA 1DEOA 4KXMA 4URUR 2WM2A 3UAOA 4AAYA 5A5DA 5HZMA 3SC2A 1I94B 4FEYA 3TSOA 4JL5A 1GG5A 4OXRA 3UCXA 5BQOA 4HQ6A 3D0OA 2C31A 3CURA 4L57A 1NVVQ 1NXOA 2XZDA 4CEIB 2VNJA 1NVVR 1ESDA 2G9NA 1RWVA 5BT8A 5ADVA 4QELA 4ZCPA 2VT3A 2G36A 4RAOA 5ICSA 3BDIA 4Q4JA 2CDRA 2Y67A 4XWGA 5EMHA 3EIUA 3ZDEA 4B7CA 2PGNA 5BV0A 1E1KA 1NKVA 4EY3A 1PJ8A 3ADDA 3FNRA 1XZ8A 1W35A 3BWXA 3JARA 2JZOA 5BR7A 3OZIA 1IXYA 4YFVA 5FADA 4QOJA 4AG5A 3G82C 3C3YA 2PJZA 4TZKA 2YZNA 2IWRA 2BC9A 2ZXUA 4KKXB 4BO6A 2DWUA 1J33A 4MARA 1K6MA 1ZH6A 2PRKA 2ZS7A 3HCEA 5DE3A 5C34B 4BZXA 2J0QA 2OP0A 4TQ9A 2VCEA 2FQXA 3BSWA 4RQAA 1P0IA 2VH5R 4LRSB 4OXQA 4DMKA 3QEBZ 3Q11A 2YN2A 1CE8B 2C59A 1LFAA 1UCFA 2KM1A 1XTQA 3AHJA 4Q48A 4YRDA 2B35A 1X7ZB 3MFYA 4M0PA 5CD9A 2EFCB 1GFSA 1JLHA 1XEAA 2JGAA 4X20B 2A78A 3E1SA 4IXWA 3ZH2A 1I6MA 3KD2A 1P17A 1S8NA 1N2IA 4D3XA 3A26A 3QVGA 3QE4A 1DTSA 2WAXA 1QV7A 4G4GA 3ZLBA 4IIJA 8LDHA 1JR3A 1Z37A 2FF7A 2F48A 3DWEX 5KOIA 3JXEA 3QU5A 4B32A 1GTJ1 4NYIQ 4ZP1A 3RTEA 1AUPA 1DWQA 2H7XA 3FFWA 3UMVA 4OLBA 3H84A 2OVBA 1LPNA 3DGFC 4DVJA 4U63A 5FULA 3BBLA 4N5LA 5T41A 2CBXA 3SYKA 1JIJA 5EJAA 3JYLA 1SO8A 3BHJA 3UATA 5AW4A 3B38A 1YB1A 5C7YA 3VZRA 3QE9Y 1KTVA 4INZA 4XSGA 3JRWA 1GCOA 5GOZA 2E4VA 1TAGA 3C6YA 4YR7A 2ADOA 2PY6A 4NAHA 4CMEC 5JPCA 3QLUC 4PFSA 5BRAA 4L22A 4PLGA 5LMUB 4L28A 4HEJA 1U7UA 1KDTA 3FTCA 4GKVA 1E4EA 1MOQA 2XQFA 3CIOA 1CS0A 2GOYA 1BCRA 1XNHA 1XQYA 3L7YA 1ZU4A 2DFPA 4KO4S 2ZQZA 1BH6A 1IPFA 3CISA 3CXRA 2K7ZA 2NVBA 3OWXA 4Z53A 4MPDA 4LFAB 3ZQKA 2QGNA 3DAFA 4G63A 2X23A 2OCKA 4NOMA 3TTSA 1L3IA 1YDFA 3RM3A 3OZDA 4KSCA 4IG9A 2PKCA 3NPAA 5AK3A 5EZQA 5EVJA 3TQSA 3K31A 5F9FA 4CEJA 1CYDA 3I5UA 3I83A 4N47A 3UA4A 5BXYA 5HRAA 1E32A 1YQDA 5FLYA 4UTZA 4WOKA 1ZOPA 3DG9A 3CEPB 1TK3A 1WULS 3T5CA 3CPHA 1FRVA 1Q7RA 4Q3KA 4WBSA 5JRDS 3WNCA 3L0BA 5DW0A 3VO9A 1H93A 1Z5ZA 2VKQA 1B1AA 1JDSA 3CUKA 4OIMA 3R7NA 4EJ0A 4Z5XA 3PRHA 1OWPA 3V34A 2A9VA 1Z4NA 3IPLA 1PQYA 4LJ4A 4CMIB 4MTLA 1GADO 3M3PA 3HR7A 5E7MA 2BRUC 3OZCA 3B2QA 2J87A 1XXHE 2J5QA 1QIJA 1HDYA 1WW8A 1CEXA 3ET5A 5HBRA 1TUBB 4MZDA 1CZNA 3R9WA 2UUCB 3GZTB 3SR4A 3H1GA 1P2TA 4HSEA 4UOQA 3WJ2A 1KGSA 3GFPA 5PGMA 2HM7A 3ZJ4A 1F8FA 2WP0A 5EKDA 4HGQA 2B4QA 2VHVA 2ZBVA 2XCIA 4AJEA 2V0NA 4JUAA 2I3DA 1QOZA 3DMDA 3HN2A 4QRHA 2UYHA 5LUAA 4PZ0A 4LWQA 5JNWA 1UXHA 3K0KA 1W1UA 2A4KA 2PG3A 4KIUA 4WPGA 4HXEB 1CIVA 4MWCA 3W4KA 1X1EA 4A0HA 3KQQA 4YP0A 4L76A 5GMOA 3R8CA 4DLPA 1ODIA 4ZYVA 3AQIA 2OYRA 4CT5A 3FHCB 3LCUA 1FNDA 3CZAA 4MVXA 2IIPA 1LA2A 5IMBA 3ZWDA 1T26A 4GE3A 3RADC 1KR5A 2NO0A 4XRRA 3GOQA 1I3CA 2ZWPA 3NANA 3O7WA 5JHGB 1PEAA 3WDLA 1JHPA 2DWPA 1Q74A 1CUUA 5JATA 3P2IA 1JIXA 1GGKA 2POQX 4HADA 3MAGA 3EGDB 4PIVA 1K4MA 4UVHA 5T6BA 3M1AA 5THKA 3RFTA 3NX4A 3WADA 1SOMA 4F60A 3DP9A 5ICGA 3GUYA 1RLMA 3B6EA 4X92A 4YJ3F 2Z8YM 4A2WA 4YV0A 5ADHA 1J07A 3GGGA 4M9UA 3GCXA 3KCQA 3RBVA 2XUKA 1L7EA 3C16C 3INRA 2ZUTA 5KEIA 2BFEA 3GLIB 3I5XA 4KWIA 5F7ZA 3W7AA 4JGIA 4A82A 1ZN9A 4RHCA 3UTCA 5B2FA 3ZU3A 4WINA 2R79A 3MGGA 4HKTA 3ZK8A 3DUWA 4RS4A 1RYNA 5AP9A 4ID9A 4JL6A 2RIPA 2GF2A 1BN7A 3HRHA 3QV1A 4G0MA 4R81A 5SZHB 4PYNA 4O4HA 1FFYA 3KX2A 1Q1EA 3EWAA 1IQRA 1NMEA 1QYIA 5CPBA 3B89A 5A9SB 1A5AB 4NRDA 1EGHA 4B45A 2YOHA 4TZ0A 1JPVA 4TS4A 5FNVF 2P9ZA 2VP0A 4J1TA 2QRGA 3OP1A 3L2OB 4AULA 3R5JA 4GYYA 1V41E 1W6UA 4ZI5A 4MGKR 5CNMA 2RJNA 4LE0A 3AMVA 4NECA 1XU4A 1Z4QA 1PDVA 5DMHA 2OO7A 2ZVQX 1EDDA 1PGPA 4GUDA 2O8EA 5DBHX 3OOSA 4MW6A 4UVGA 1SMKA 2CHEA 5LZ7A 3TMYA 2FPIB 2WIJA 4Q6BA 1ZCBA 2PUJA 2PH5A 3I4LA 2O57A 3R0ZA 2XDQA 3CT4A 1O6FA 4EJSC 3SZMA 3RS2A 5CW2A 4XVCA 3NP9A 1A5ZA 2Z4RA 1THMA 4ZCSA 2WNSA 5AW6A 1DTEA 4Y2PA 1B6TA 2E4AA 1RQ7A 4ER7A 4HL6A 4PLVA 1AV6A 5JANA 3HC7A 4P7KA 4RDIA 3EDQA 4MITA 4C30A 3I3OA 4JLOA 3ZGOA 2C1ZA 3AU9A 2I3GA 4MV5A 4POAA 5GZ6A 4B6OA 2ZJBA 3BH6A 2ZSFA 4RHFA 4C4XA 1VL6A 4EKNB 1GPUA 4H35A 3DULA 4KQMA 3W9SA 1MT0A 4PO1A 4ZEOA 4TTRA 2K87A 5K05A 1BHJA 1FXUA 4EABA 1Z2NX 3EMVA 2HV9A 4REQA 5EXTA 5FBRB 3K05A 2QZZA 4RKEA 3SDSA 1QE0A 4MUIA 4OB8A 4C22A 1D09A 1GFWA 2RG7A 2OA0A 4MVWA 4GKJB 1B8UA 4XPIA 2HX1A 4G1FA 5DSXA 1BYIA 1ONOA 2R66A 4OTZA 5EG5A 4ERNA 1SVNA 3WNQA 4C89A 5EUMA 1NYRA 5DYGA 4LF8B 4GDMA 1EAMA 1QQ7A 1UC9A 4J0CA 4JLDA 1IULA 5F2NA 2HOQA 1EX1A 1I5EA 1PFYA 4LMAA 3TOZA 2GXSA 1TCCA 4TV9B 1RVDA 1P2FA 1J39A 3KPJA 3VZPA 4B0OA 4W7HA 2I1QA 2YYZA 1P7VA 4IKOA 4DV1B 1HLGA 1VI6A 2F1HA 2EG5A 3IQFA 5FPSA 4EZBA 5ICCA 1Q1NA 2F1OA 2FXVA 4KXUA 2V4ZA 4HMPA 2BIFA 2H1LA 1NXXA 4FBMA 1LDBA 4IMPA 3W6UA 2B6NA 4F3NA 4EGJA 1O6CA 3IILA 4B74A 3I05A 4W5WA 3P2MA 4OHXA 4PSKA 1WUKS 3WGHA 4TLMB 3Q3VA 1DKOA 1K3UB 2O20A 4X66B 2JIDA 3DMTC 1ZUD1 2NTVA 1A69A 4GLLA 5LWQA 2X0FA 5DH9A 5C8YA 1CUYA 1DC7A 3DO8A 4Y6LA 3VPFA 2K2WA 4V0NA 2FEKA 2ZRFA 3PCTA 4ZI7B 2W83A 1DPFA 2M6RA 2X4GA 5EKSA 1WF3A 4UOEA 5JARA 1DUSA 3QF4B 3PA6A 1JEJA 1G16A 4KQCA 1A8QA 2R7KA 4LZLA 1U7HA 5B4UA 4KVFA 2EW2A 4UKDA 3VKHA 1RVV1 2GXUA 3U9LA 2O0HA 2X5KO 5KVQA 2F00A 3WMRA 2R44A 5J47A 3V32A 4BNHA 3HDQA 2WWTA 3V7FA 1KU6A 4C3OB 3DE3X 2H92A 5L3VA 3GUCA 1BGVA 1OD6A 1P2VA 3GEGA 2RGWA 4HXYA 3PZRA 4KQJA 2YY6A 1QH8A 4PE5B 4RSMA 4QXRA 4COKA 3JATA 1H0HA 2VPTA 4EQ6A 1LTQA 4AWAA 1NSFA 1W0JA 1GPJA 3JQFC 1OZ0A 2FJPA 2Q50A 4Y1FA 4PRZA 1FS6A 3V7NA 2RHCA 2VXYA 1JYFA 1UBOS 1H4TA 2KI5A 3NOXA 2VKTA 3QVXA 4QGGA 4AN0A 1Q0LA 4MVJH 4X1YA 4WFKA 2JRCA 2P6PA 4GC5A 3GW8A 3PJGA 4JVLA 2YVQA 3Q8LA 2VH2A 4J76A 2OSBA 4OGKA 4IHAA 2ZRQA 4KAJA 1QMPA 1LDNA 2BMWA 2VBFA 4KVAA 4JJGA 2QJRA 4YDHB 5JPDA 1MC8A 1PYGA 3D02A 3SYMA 3NG1A 3VH3A 3OH8A 1TTTA 1S3FA 3A4TA 2C7RA 3B20A 2YYYA 1YTUA 5JLJA 1B14A 5CJJA 2C5SA 3U48A 2Z9DA 3RIGA 3VU1A 3IP3A 1WLYA 2AQIA 1V1RB 2LTAA 1ARZA 1DUVG 3DZFA 3GP3A 1Z7WA 3BMQA 5H3HA 1EVJA 5DN6A 4IF4A 4KJZA 2WWIA 4OA5A 2Z3VA 1NUQA 3Q98A 3OLXA 4YNBA 4JGGA 2EU8A 2IXGA 1EFLA 3A0UA 1D2MA 3BWYA 1Q0HA 3HH8A 3FMPB 4H1VA 1ZVJA 4CR7A 3T1NA 1JKXA 1PSWA 4ME6A 1YU9A 4TTVA 4I4TB 1XZAA 2FSHA 1N6HA 1VLHA 4Z2YA 3OAAD 1SQGA 5I4CA 4DS3A 3S1AB 2H4HA 1P39A 5FPYA 2ZRHA 4BGEA 1OFIA 4OLFA 3FA2A 1KETA 3K15A 3FTNA 4M53A 4UDOA 5AW8A 4G89A 1NVGA 1ODJA 1G5TA 3QKSA 3TLGB 4BO5A 5JJBA 2ODNA 5J58A 3T3NA 4U2KA 1WV1A 3DHVA 4IDHA 3KYDA 2JGDA 4P2GA 4RXMA 2YV4A 3T7AA 3IEIA 2W6OA 4ZVQA 4F1KA 2D8AA 4MLDA 5A1TA 4QOHA 3TWOA 1A1SA 4G5GA 1L8AA 3BJIC 3ROQA 3ENZA 5H68A 2WHPB 1RXYA 4Y9UA 4G23A 1GL3A 1SKAA 1AGNA 4KX5A 1OYVA 1SNYA 2JJ8A 2ZJ1A 1JJ7A 2JL1A 2UYQA 3D0QA 3LBAA 3Q8XB 4V2UA 5AXAA 1KYWA 1F3LA 4L15A 5DHUA 2QTNA 2W8BA 2WSYB 5B7QA 5C4IA 3EW7A 1MTZA 2WD7A 3TECE 1KI6B 2I66A 1ZD1A 2G82A 4UBNA 3AKZA 1PJLA 1H3FA 2QW0X 3S55A 4LRUA 2JEOA 4PX2A 2OAGA 1I24A 2YJTD 2YMQA 4AJIA 4B4UA 5IJAA 3P2OA 4GKAA 1YDWA 5AKHA 2YKGA 1VI2A 2XGMA 5C32A 1H0RA 1D4ZA 4D97A 2R5NA 5T8KA 1PZNA 3V8NA 1XLUA 4CKEB 3WWPA 1WX1A 2Y0CA 1CUFA 3HZZA 4HWGA 4UAJA 4UAGA 3HU5A 1W0KD 1M2GA 2J1LA 4BRUA 5ALEA 4MQMA 1RKQA 3W2FA 5MF6A 4M88A 4J0KA 2R97A 2WJAA 4HEA1 1NJFA 5LQUA 2WC1A 3BWEA 5C4GB 5PNTA 5AHKA 1GRVA 3PGXA 5TPWB 1XXHA 4I50F 1XZGA 1YQWA 2ZYAA 1XNRB 5KC8A 3R2JA 2XLBA 1FUIA 1WG8A 4GBED 3WO0A 5JNSA 7MHTA 1UBRS 2AG5A 3UAYA 2OWEA 1PW5A 4M6WB 5BSEA 1FYDA 1Y9EA 2ZQ5A 4WGFA 5TR9A 3C3PA 4B80A 4A6EA 5BSTA 4CQLA 2IK8A 3H11B 3N2KB 2JLYA 1E89A 1JG6A 2QZ4A 3EY4A 5HCIA 3GCDA 1A5TA 2VTVA 3GWGA 3FFAA 3JQ9A 4MVJA 4DBVO 1AHIA 3DTNA 4DJEC 2L2QA 1UBEA 1Y3IA 2ODPA 2W2LA 4QNMA 3EOBI 4UEKA 5JH7A 5DM4A 2H48A 2CV2A 2HU5A 2H4FA 3VPSA 2P5YA 2Q6TA 3EDCA 5J23A 1IYZA 2FMFA 3GCZA 3SNHA 4XWAA 2P79A 3JVEA 1SC3A 3N58A 3CQ9A 4TWAA 621PA 1N8SA 3WGYA 2W2KB 2N42A 1A72A 3ZDCA 3X1WA 1MIHA 1B6RA 3KTOA 4I0WB 2AQKA 2E6UX 2V7XA 3GRRA 1XEFA 2IGBA 4Y1GA 3ZLTA 1KVUA 1K3TA 5SY9A 5KYGA 3LS2A 2VF5X 3MJHA 1ZK0A 4Y2XA 1YDMA 3RVQA 2H52A 3UWOA 1VIAA 4BAUA 4X6LA 5KYWA 4FFRA 3P2KA 3OZGA 4I7EA 1KGDA 4O4IB 1I80A 4N6NA 3ZHYA 2BMJA 1EGMB 3FVTA 4MQ5A 4XIFA 5FLKA 2OK7A 1H0SA 4NATA 1L5MA 3IQXA 2MCFA 1V16B 5EHQA 1X3SA 3KR9A 1UDCA 4Z6KA 3OHPA 4J94A 3ZIDA 1G5PA 4EPTA 3DC7A 4HQRA 1XHLA 3I4CA 3L0SA 4B8ZA 1QB8A 1G8SA 4IQ0A 4TLDA 4DR4B 2L69A 3NP7A 3TBFA 4FMCB 4NTZA 3ZUPA 1EAYA 5DK4A 3WYEA 4NBLA 1JXQA 1BKYA 3QMPA 2O8FB 5KTNA 2A5JA 2R751 3FDZB 1LXCA 3I37X 4O1HA 4W5TA 1G5IA 1RXEA 3BXHA 3PFIA 2JF0A 2XUDA 3GZ4A 5DN6D 5KVVA 3ZCUA 1I4EB 3IAS1 2Z57A 2ECQA 4KHZA 3VI4B 3V8VA 3VYVA 3ZHVA 5CHEA 3E3AA 5FI3A 3SLRA 4Q3EA 3P9RA 2CZGA 4HQ0A 4IJQA 4M1MA 3ONVA 4NOKA 1B42A 1II0A 1Z0FA 1ZITA 2PA0A 4BO8A 3ZTYA 1EZ1A 4G4SP 1T9AA 1YQUA 2DGDA 2XB8A 4HQLA 1Z25A 4B9EA 4NK4A 1TUIA 2M2IA 4OMFG 4OMUA 4J03A 2DQSA 4JVOA 4WACA 5EWLB 1DQSA 1O9GA 5J5CA 2H2WA 3M1LA 1F0PA 4IIYA 4GP7A 5JZOA 4QFCA 2ZLBA 1JGTA 5D86A 1EQ2A 4I55F 3LA8A 2QQ0A 3VR4A 4X8HA 4XM2A 3RCBA 1KWGA 3H2GA 4P4SB 2ALJA 2Z1NA 3TL6A 1O94C 1NP3A 4UQLA 2X3UA 3C7KA 2OD7A 2W71A 3GMSA 3K20A 2IOFK 4BL5A 1C9DB 3A6HA 3TOCA 2WFAA 4YMUA 1CR6A 1FQKA 4ZIRB 4J7CA 1QHSA 2AS0A 2R4UA 3VNQA 3WMFA 5KNBA 4QUIA 1MAHA 3N5CA 3CZQA 3JY6A 5DWDA 3V7YA 3EPKA 4OXNA 1M5UA 3WL5A 3R5TA 4Q1AA 2AC7A 4D8VA 1JIKA 1EMDA 2X1MA 5F2EA 2AMLA 2CUKA 2EZ4A 3TIVA 4J2HA 1U2GA 4NCIA 5HCNA 3ZZ0A 1XBTA 4AZWA 1H2AS 4J9VA 1A27A 3VFDA 3H97A 2R87A 2IV3A 1U98A 1TQ6A 4M6WA 1C0KA 3O8LA 4RVCA 1GDHA 5IM4F 3ZE6A 4XX0A 1JT9A 1PV1A 1YB6A 3RYTC 4MWBA 2ICAA 2AKYA 1UJ5A 1TYDE 3PT5A 4RIEA 3IB3A 4P5DA 4NARA 2I3BA 2Z98A 4HDRB 3QUBA 1LBEA 2GHIA 5AI9A 3D6NB 5C8VA 3QUTA 3OQ1A 1RBYA 2ENWA 3EG9A 4D6YA 3I58A 4M1KA 1JG3A 2DHDA 3DQZA 3RT1A 4N7RA 1Z33A 3VPXA 1L8XA 2WWVD 1E2JA 3EPRA 2KHZA 4FIZA 1ADYA 2E82A 2V8BA 2GCIA 3A37A 4NS1A 5NULA 2X3FA 3AM5A 5DGXA 3STYA 2JC3A 1C3JA 1EWYA 4PQEA 2B37A 5M5BA 2IXDA 1U9JA 3K6SA 3UKOA 3A9VA 4BECA 1EINA 4QNNA 4WK6A 3I12A 1YR3A 3MINB 4MIYA 1JEQA 1V26A 3F4LA 1YFZA 4OSPA 4R2KA 4CQMA 4MS4A 4UNNA 1EGVB 1PT5A 4IV0A 3KAJA 1KIMA 1DBQA 2B7BA 2CDCA 1YMVA 5WRFA 3HKBB 2QAGA 4P83A 1JS1X 4IFBA 2D00A 3EASA 2JGLA 1GGNA 2J85A 2IU4A 3KP1A 1J8VA 2YIDA 2CLHB 3O90A 1AKWA 1KI7A 1PFVA 1QG6A 4RESA 1NA5A 2EGHA 4TROA 3AVWA 4UTVA 2AI1A 4Q7KA 4ND8A 3TLAA 2BGWA 3DT9A 1ZEJA 3DDWA 3U6BA 3LHIA 1WE2A 2CXQA 1E3QA 1FNMA 1SXIA 1BZYA 1W87A 2JATA 4WJKB 4WY5A 3KBOA 2CXNA 2XOKA 3K9CA 2X0EA 2I91A 3HYSA 1E96A 3CJRA 3IUPA 1WKCA 1LBQA 1MN6A 2HMYB 3MSXA 4BV9A 4Y8VA 4NCBA 4UUBA 5HKLA 3P2EA 5A5GA 4HUTA 5DYTA 1EDZA 3NC4A 4O8CA 1UIRA 2NW6A 2HZ7A 5EPEA 4GI7A 1KC1A 5DK6A 4MS3A 4GXQA 3ABIA 3DV9A 4K9OA 3WFJA 1Q11A 2ON6A 3HXLA 3R3XA 2IHTA 2JJYA 2Z0MA 5BV8A 3OLQA 3QLUA 3A6LA 5LQSA 3E9EA 1U2ZA 3PYMA 4OFWA 1TJNA 2VTDA 4BRSA 5JVDA 4IMJB 3GFSA 4LYYA 2OZKA 4PHCA 1WB5A 4ZV7A 4E07A 1G18A 3GXOA 2XMSA 3RDPA 3NBZC 5GJVC 3VR1A 3UT6A 4KE7A 1XDSA 1MAWA 2QM3A 3H5VA 3NJRA 3OE5A 5BQPA 3TFQA 4XWKA 3PR3A 1WVGA 1JA1A 3MCTA 2JD2A 4G0NA 5DHQA 1EXDA 3O2JA 3E27A 2GBFA 3EZNA 1U6IA 3EEIA 1JLKA 2Q5LA 3QPBA 2FETA 1CZKA 1J9ZA 3G59A 3ITDA 3KEFA 3T9AA 1VE1A 5JJ5A 2F55A 4G07A 1J06A 2ZUFA 2Q9BA 4M0KA 2AOWA 4C0JA 1CETA 5FJIA 4J29A 2P4QA 1HC7A 2H5EA 1SN7A 1YXMA 1TO2E 1CZLA 2I54A 4GNKA 4PR3A 3BGVA 5AKGA 3TYXA 4CM9D 5AKLA 4G0UA 1HNNA 3EK2A 2Y92A 1RC0A 3ZXSA 2O2ZA 3Q3IA 1KXJA 2OR3A 2EWMA 4S0XA 4QLBA 3ISTA 1JJIA 4C9BA 2E5WA 5B4TA 3OZAA 1U3GA 3SSMA 1RBQA 2IY9A 4FOPA 1IN1A 3GPIA 4PWYA 1HNXB 3MUNA 4BV2A 1P75A 1Y3FE 1QO9A 1RBMA 1SQ0A 4E5KA 1E1DA 2D1FA 4KPUB 1QGZA 4HN4B 4MV3A 1R12A 3PGJA 4JA2A 3HSYA 4X6UA 3AESB 2BUCA 1PK7A 4LBWA 3OT4A 2JLQA 1NBEA 2Z2KA 4LDAA 1EDEA 5CCDA 3VYRB 3U16A 3L8DA 3RSFA 5HCUA 1XL0A 3DKIA 5A3RA 1KZ1A 4BNXA 4XLTA 3OQIB 2HWKA 1DQPA 2VG8A 2Z5LA 3DL0A 4MEAA 5ALGA 4MGZR 4BB5A 3F6PA 3I8XA 1T13A 1EVEA 5E2AA 1PNRA 1TVCA 1YIDA 3NB0A 4H6VA 2IUEA 2QX7A 1K5DA 3KJQA 1XPUA 1NPDA 1WNFA 1WPXA 1B8VA 2HMVA 4KXWA 5IVDA 4HWTA 3VZQA 4E94A 3TF5A 2QGZA 2FZGA 4GBGA 5ALLA 3VSAA 2J3EA 1D3AA 2GEDA 2Y9PB 3AO0B 3FZGA 3T7KA 3AUXA 2DQKA 4PCAA 2AK3A 3DKRA 4UE3S 2IHVA 3QVTA 4RV9A 3IEVA 3WK6A 2XD4A 1NFQA 2G0TA 3PLRA 1CY0A 3UMCA 4D82A 9MHTA 5E3JA 2EATA 1QLJA 1F2VA 2A5GA 5KWJA 2XAAA 1YB5A 4Z1MA 1ID1A 2VUHB 3TLKA 3PL5A 3D3NA 1FU4A 2Q1UA 4IDCA 3PKJA 3O1LA 4YXWD 3WYBA 1RP7A 2VJPA 3PHGA 2VJNA 2PFSA 4LNAA 3GPCA 1O6ZA 1ZI9A 3G88A 1AQNA 2DB3A 4FCCA 4B3BA 1E2FA 3TCNA 5JQGA 1H0KA 5ALHA 3PEEA 3MB5A 1B93A 1U02A 3C48A 3IAS6 3L5OA 4W7SA 5CVJA 5HMLA 3T54A 2QJFA 3GYBA 4P4TA 3RJTA 2DYKA 2QRKA 4QDUA 1QONA 3AWDA 5ESDA 4ZZ1A 5DNUA 5J4VA 3E7PA 1XJWA 2ZTHA 4QDKA 2RCYA 3M82A 1WTAA 2W48A 1T1EA 1TX4B 1WSDA 3UK2A 3EXG1 2AD1A 5KYYB 2I71A 4UQPA 3W7VA 1RIIA 4X8OA 1NUTA 3WB2A 2WPNA 2WTBA 4L6CA 1T3GA 2RAVA 2ZANA 1TECE 3CB4A 3G0OA 3L0CA 3PQEA 4FN4A 4OLAA 1S89A 2WFZA 4HB0A 3WDKA 3VM6A 4H7FA 3W8FA 4RZXA 4BP3A 2ZCUA 4G4IA 1H5QA 2J09A 1ILWA 1LLFA 3CZ5A 3K8YA 5HK8A 4PR0A 3RIYA 4R9SA 3QHPA 1JLMA 1BMFD 5G0WA 2PMKA 2OBBA 3WBFA 5JQGF 5K3AA 2B3DA 2JIMA 4QIHA 4BC1A 5E4JA 4QM7A 3N0WA 1TAUA 3CRMA 3PT9A 4GM4A 5EE9A 2GN4A 3VO8A 4DMRA 1U1IA 5KVSA 5AH0A 4XOIA 5AI4A 3I6MA 1I1QB 4C08A 2CNOA 3GPLA 3RTGA 3LNTA 4QTXA 3BDAA 4K9RA 2Q2NA 1USUA 4YJHA 3W6ZA 2VL7A 4TYNA 3ESYA 4B4WA 3ZWXA 4FFWA 1I10A 3A1WA 4LDPA 1NGSA 1C29B 5TS2A 2YHAA 4I4CA 3AI1A 4DR3B 1NBIA 1QCCA 1ZLYA 2VAMA 3KQUA 3AUFA 4M1EA 3SX4A 721PA 1U1EA 4EYOA 3HY3A 1VPVA 4PSDA 1TVKA 2QSYA 2QKYA 4GBMA 3I42A 2VOJA 3E05A 2W6ZA 4ZVNA 4YRMA 5KO2A 3V2UA 5HJEA 3F2IA 2ZCVA 3ESBA 4ID3A 1N57A 3AP3A 1ZGHA 3SBEA 3ULKA 1Y1PA 3WLPA 1UFRA 2AN1A 3B5JA 3JRXA 3NKFA 2AYYA 3PTLA 4OQNA 1OE0A 4NPAA 4R2JA 2VNIA 1UKBA 3THXB 3K94A 4DLVA 4CMIA 2IPXA 4GX0A 2Q07A 2VOEA 2Y1OA 4OHMA 5DGCA 2BGMA 1US8A 3ED1A 5LB2A 1RWXA 2M6KA 3T3MB 5EXSA 5IC6A 4DG8A 3HB4X 1NBMD 3GDHA 3CX8A 1I33A 3PICA 4Z54A 1PIWA 5AW7A 1OYYA 3V6MA 2GTHA 1I14A 1UAYA 3LO5A 4YXFA 5KMGB 5CB6A 2CE7A 1XXHB 3FNIA 2L18A 1CUGA 1BDBA 1F1BA 1JZTA 5AVTA 4KDFA 3UG7A 3BRSA 1Z6XA 3PNVA 5EGNA 3T94A 6ADHA 3D3JA 1MKYA 1RXSA 5JT1A 1UOEA 4UM7A 1YRQA 4JBLA 5K6AA 3N6VA 5KMGA 4MDEA 4QA9A 2VSQA 3HCNA 4JLSA 2A2ZA 4NLLA 1QCZA 1ZJ6A 3DF7A 2QP4A 3HYTA 3LBYA 4FOTA 4H15A 1IWOA 2IELA 2WMDA 5L3QA 5TIIA 1ZMRA 1S2IA 1EBUA 1IC6A 5LB4A 2WYHA 3WX0A 2V97A 4S1WA 1P0FA 2HUNA 3B6KA 3L43A 1BHO1 1QOPB 2QG4A 1BOFA 2OGSA 5JRJA 2XBLA 1CEYA 3TX6A 1DAIA 1HYEA 2XY4A 3QY0A 5KSPA 1E1QA 2DQZA 5EFZA 2HA2A 1Z22A 2P78A 3E18A 4MW4A 5TPZA 3FOFC 5IKOA 2QVXX 1G21A 1L5GB 2IYQA 1U6JA 5GAJA 4XSVA 4QWWA 3L1VA 4UM9B 5I7SA 3H5TA 1F8GA 3AHCA 5A02A 2FVXA 2GFHA 1JVBA 3NYWA 2ZTLA 5I5GA 2O3RA 3O82A 3FBWA 1E7SA 3E3MA 1N6PA 3FBGA 1KO4A 3TRJA 5IABA 2CXTA 5LMNB 4RYLA 4M89A 3GH1A 2PGAA 4IILA 2GAFA 1BXKA 1JZSA 4KXFB 2XUHA 3NJ8A 5TQ0A 5CD1A 5FBWB 5E9JA 1P7CA 1TYZA 1IWBB 3CVJA 4URVR 3ZDAA 2WQZA 2PSJA 1G3UA 1TZ2A 3P52A 4CXMA 1W5SA 1C4KA 1OKKD 4KDRA 1QQAA 4QSMA 3DOHA 1L7XA 1PNVA 2CZCA 1UJNA 2XNDD 4FLEA 3QSYA 4L0CA 3ZS8A 5E8RA 1LX7A 2F3QA 3A3PA 1RC1A 3EUAA 3MTBA 1LD3A 1JHVA 3PENA 4K9QA 1DX9A 1UMDA 4AROA 2MSNA 3RTCA 2WDZA 1GZ4A 3HFRA 4IUDS 3NH9A 1SM4A 2WHPA 5BN5A 1KY3A 5GJWC 2NAFA 4YUWA 1B4DA 1E2MA 1SHKA 4RABA 3MWEA 1WXDA 3NHZA 5AHRA 3SZUA 1ZC3A 1V48A 3K09A 3DZCA 1E2QA 2V6BA 1UEJA 4KQXA 2I2BA 3FTEA 2RHBA 2R86A 1T1GA 3HEAA 3RGGA 4AJPA 1E69A 2HLNA 1SKYB 3D1JA 1SQSA 4HQFA 3EIWA 3TCXB 1Z6PA 1L5RA 1MCZA 1E2LA 2G76A 2H5IA 2YIMA 2B1IA 3HCAA 3MN1A 1P9OA 2Q1YA 4YS6A 4BKQA 1YFKA 4CYMA 1PE0A 3NT5A 3KK0A 4JLWA 3KOWA 1VMIA 1PT6A 2H08A 2R2GA 3OU6A 4PC7A 2UVQA 5HGJA 3J81A 2Z2JA 5DFAA 2P7HA 2WJPA 4OFBA 1EXWA 4DA4A 2JLWA 4JVMA 4GKKB 1I6LA 1V9LA 2I2WA 3JTEA 1XJ5A 4C03A 2V7QD 4XIYA 3DV0B 4C3VA 1QZUA 3DD1A 1FX1A 2P9GA 3DMPA 1DBIA 2ZUDA 5JDCC 1UANA 3FLBA 1PL0A 3DJYA 2V5VA 4EHJA 1MB3A 1QRDA 1IHPA 3IBYA 3LUKA 1OX5A 3OI7A 4RVUA 2IS4A 2QUIA 1SC6A 2X9LA 2XEXA 3QPVA 1UT5A 2GBPA 1OGYA 3F67A 3QPAA 4NEGA 5D3QA 3FIJA 4EW6A 3KV3O 2DXIA 2B5WA 3QI7A 3P97A 2P90A 3ZNQA 2P75A 4URYR 1V11A 1EP3B 2O7SA 3H2SA 5AK6A 1YJ5A 4ZDJA 1E0JA 1ISJA 3A2MA 4UM8B 1PUJA 1G63A 1GPH1 4D4GA 1QU2A 1T4GA 1NVDA 4A0SA 1BD4A 4ZVRA 4TGLA 2ISSD 3D43A 1RYMA 2JCVA 1EFRA 5K3FB 1RRMA 2R85A 1HKUA 1K6IA 2G6BA 5FL7D 3R7FA 2C9ZA 3WY9A 3H5IA 5I6DA 5DI3A 1PDOA 2GT1A 2J4CA 4H59A 4ZQIA 2VA8A 4OEHA 4KV7A 3PPYA 4NYJR 4PGMA 4P6VF 2G8LA 4Z0HO 2QVYX 3PHBE 4IH4A 4XCXA 3TR0A 1AHHA 2DQ4A 3OPYI 4CIVA 1W30A 1B23P 1WKBA 3FDXA 3V42A 3VPAA 3T5TA 4NQZA 5ENDA 2NT3A 2VQEB 4ZO6A 1E61A 1QK4A 1JDUA 1XEWX 1QDEA 2VZEA 1RU3A 4JSTA 1E3DA 3SJAA 5B1IA 4YO8A 2EJTA 2C82A 3BXXA 4NCNA 3PGMA 2VDKB 5E9AA 5DEIA 3G68A 3HR4A 4NCHA 3IGFA 1OFVA 1X70A 3LWBA 1P1HA 5JXJA 5EOVA 3HU3A 3T5GA 1M6HA 3AIMA 2YFQA 3R77A 4D56A 2B69A 1LPMA 1FNCA 3GFOA 3QV2A 4L8YA 4F85A 3H87A 2I4IA 2J5BA 3I0ZA 3WIUA 2PUFA 3DLBA 2CVPA 2GPWA 1VRVA 4GDFA 4CM8A 2PD6A 2LPMA 2GASA 2VJAA 3DSRA 5K03A 4XARA 3DR5A 5AQ1A 3D1LA 1P5RA 1VIDA 3SYRA 5E95A 5K0EA 1P2GA 2A84A 3NTUA 1GPMA 4GPD1 1RM3A 3E81A 3AF1A 1UBUS 1E6UA 2ACWA 1E4YA 5H02A 3GJXC 3GLHE 1J70A 3MFQA 3ZHRA 4DCTA 2PZBA 4J4TA 3RIMA 5EHGA 4MB0A 4GOND 2C4TA 4W1RA 3ROPA 3RUAA 1O1YA 1PX0A 5JWRA 4YT4A 3GJRA 4HDNA 3GLFB 1BA2A 3B1WA 2A1TS 2Q62A 1OBCA 1Z5UA 4JY7A 1RFLA 2IYZA 2C5LA 3KS9A 1GITA 1NUSA 4YK7A 4YUVA 4QTYA 4JCCA 4R69A 2ZYTX 1PAUA 3CNHA 5FTLA 1PSDA 1TO1E 1W34A 2IOHA 3PJRA 1NRIA 3S2GA 1ZMXA 2PS0A 1A04A 2ZR0A 3A1EA 3O83A 4JUIA 5F1OA 5BORA 3C1AA 4II3A 2X7JA 4MJ3A 4GZ3A 1XF9A 1C9YA 4UM9D 3JATB 1GWNA 4BBZA 2TSYB 2QP3A 4EQ6B 5JTTA 2W11A 1WBJB 4XLLA 3N7TA 3OOJA 4YLEA 1X9IA 1E5XA 1FSSA 1OV6A 2OLKA 1P2BA 1COZA 3LQFA 1ICEA 2J31A 4JSYA 1GVHA 3PRJA 3CMCO 4G1VA 4LW8A 1EK2A 3WKBA 3ZDQA 3PV0A 3EQ9A 3JYHA 3TQCA 3PIIA 1JG4A 3IC5A 2G1UA 4V0ME 3RJMA 3WJAA 1XR3A 3AZQA 5CIWA 2HDOA 4GOOD 4RXUA 1N3YA 5IVKA 5KJCA 1OYOA 3E2IA 5E6SB 2VP4A 3TZKA 1MU0A 3UT5B 4ZVPA 2IYAA 2H18A 3NFYA 3SVZA 3IDFA 2WVAA 4XSHA 4JYZA 1A9QA 2ZJ2A 3B3AA 1JV2B 1TOAA 5LPNA 3DBRA 3PNBA 1UMDB 2FQ1A 2QRJA 1X0XA 1KJWA 2PK3A 4LPSA 2J6IA 3E58A 3OX2A 4TXMA 1AZSC 3SEFA 2IOQA 3RVBA 2O7VA 4V0QA 4ZT7A 2H7VA 5BN5B 4BTLA 3PX2A 1T2AA 2KS6A 1ZUWA 4OMDA 4QM6A 1NZDA 1T6ZA 4M7WA 2OMKA 1N5LA 2CJXA 1CVIA 4PW0A 4WGGA 4KEAA 3N6XA 3H1AA 1HDCA 3PC2A 2QX6A 4JOSA 3LKZA 1T1JA 4IDQA 1WCXA 3MTGA 1N7IA 2NO1A 1YCHA 2XF8A 3DAYA 1FYFA 4JBXA 3SFZA 2QN2A 3DZGA 2E55A 3HBFA 2B1QA 4S04A 2Z8XA 3VJKA 1Z74A 3M5CA 5CYPA 1CERA 4MUKA 1MVNA 4XYBA 1I32A 1TEXA 3E5NA 1C8KA 2YR0A 3F74A 3H86A 4DMMA 3GRVA 5B5SA 2PN1A 2XECA 1JI3A 2GERA 2FMIA 1S2GA 3GEBA 4KWEA 4LZNA 5AHOA 3WP0A 4D7AA 1M6EX 1IQ0A 3IXMA 3LUAA 1KFJB 4NH4A 5MDHA 3ANNA 1WPRA 4M7OA 1LPAB 4DOMA 4RTRA 1UBGA 2FB9A 5B4VA 3K9QO 3NVMB 3PUHA 5CUQA 5CT8A 3UIEA 5BR4A 1B43A 2SICE 2W7TA 2Z95A 2YCLA 3P19A 2EX4A 3OLWA 4EELA 1FYEA 1HE2A 4TV8B 3ZY6A 2VP9A 4RETA 3VZCA 2ZE5A 4V03A 1ADGA 4LKOA 4F8EA 5JROA 3QE0A 4F9EA 5KYUB 3KSUA 1BDIA 3MCWA 3A9CA 2Y27A 2JPDA 3E9QA 4BLRA 4Y2QA 2ATCA 5IAJA 4NNJA 1A2QA 2ZRJA 1N5KA 4WADA 3TM5A 4I4IA 4DLSA 1X1QA 2XMGA 2RH4A 3BKWA 1WUHS 4JQSA 3X1XA 2J3MA 3QJGA 1L7AA 2GA9A 2R9VA 1OZAA 4FOOA 4FYJA 3UB3A 7AT1A 1U4NA 4ZTBA 4ISCA 1RPZA 2ZSUA 4XEUA 3GARA 4ZGBA 2FWNA 2YZ2A 5C7IO 5EFOA 1EX6A 4ZA2A 1XDWA 3IV9A 2QN7A 4ILKA 3M3DA 1AKUA 2OPBA 4X3OA 2JCXA 4DE5A 4YXWA 1VLJA 4L8WB 4ZJYA 1QIKA 4PY2A 1QQ6A 4BQRA 1Z7GA 1ISMA 1OH8A 1G8MA 5FBVB 4NV1A 1VE5A 1EXMA 2OKCA 3C98A 4MWGA 4Q05A 1I4LD 2ZRDA 4HSGA 1BS1A 3L4EA 1YA6A 3PHLA 2OD9A 1WS6A 4HH3C 4PC1A 1Q3KA 2GH1A 3HMKA 1PTKA 3O91A 3P2JA 5L9AA 3GVHA 1A9RA 4KQEA 5DM1A 4G5XA 5U1PA 1EVYA 1W46A 1YVUA 1AGXA 2W2KA 3OX1A 4M1OA 1WPGA 4EHFA 3KTAB 1Z3CA 2EWWA 4D9EA 2GZMA 1PR9A 2IEGA 4QHTA 3N0TA 3G3EA 4AKIA 2VT7A 2CLEB 3HEMA 2Z8ZA 2YWFA 5DN9A 4D81A 2QLJA 2CXPA 3MWGA 3OQHA 2W6JD 3EPPA 3T0IA 5HKBA 3TW8B 2D4AA 2O2DA 1DEAA 2HJ9A 2KX7A 3OTQA 5L6LB 4CKBB 1L4KA 3OTGA 1CHDA 1UBMS 4Z4EA 2R1VA 1E9DA 4D99A 1YOVA 3F96A 1Y5LA 4E21A 2Q6LA 4TWIA 4U7DA 2GCNA 2WF6A 2IY8A 2KWIA 4O2AB 3VDNB 1IEWA 1VKNA 5LD2B 2AJLI 2DSTA 4C0KA 4A16A 1E9BA 2PTHA 3LV8A 3DQPA 2W2NA 1MZPA 3MWDA 3V4FA 4YCAA 4G84A 3IQEA 4QPCA 5FUXA 3TE7A 1Q7CA 5UKDA 3UFXA 1N36B 1FE8A 4X91A 1A9SA 4KXVA 3HRIA 5D7NA 5BNIA 5LXTA 2G1PA 4BDSA 3IP6A 2N75A 4HYTA 1Z07A 4LOIA 3SHQA 2RKOA 3WHPA 2GHQA 2J59A 1KAMA 3LKVA 1K8QA 4LDQA 2O4UX 1DBWA 1H65A 4L4ZA 4PSCA 4D9BA 4Y0AA 3PITA 4JMPA 3FZEA 5F9MA 1U2RA 3ABRB 3RC1A 4EPWA 3BB4A 2EFJA 2G72A 3ZE2B 1R74A 1F8XA 1XB2A 3IYLW 1I1HA 2BRUA 2WWRA 3GVCA 4S3MA 1RLOA 5JVDF 1KR2A 5JD5A 1ECCA 2ZJAA 1PX2A 4WFIA 1NXQA 4CMJA 1MW9X 2E0IA 1GTSA 1ISHA 1IRXA 2ONJA 3DL4A 3WGUA 1OJ7A 4TKVA 4R9UC 4XYMA 1N3BA 1NU6A 2QQFA 1Z88A 3D5QA 2R8ZA 1JJFA 2HWUA 3RRFA 1FVOA 2PUCA 1E1RD 1WXIA 2DOKA 3I6QA 4IIBA 1NF8A 5HDBB 1Y8QA 5GADl 1ABBA 2ZS9A 3DWGA 1ECBA 2EKQA 2VHXA 1Q12A 2OHIA 3LT1A 1F2DA 2GLUA 1SCNE 1Q21A 2P68A 2Q3CA 2VDPB 3IALA 5E4TA 2NUTA 3EHEA 2EZTA 9ABPA 1O94D 4H7IA 2BEWB 1P3Y1 3TPZA 2J33A 2NV6A 3AOGA 4ND2A 2AUTA 4M4SA 2GZRA 4YA6A 4X61A 5A4JA 4UBKA 5J59A 3TBHA 4DYVA 3OIYA 3WLMA 1DT5A 2BY4A 3Q41A 4PZYA 5EIFA 3AILA 3K70B 1TQDA 5FBZA 3LT4A 1FOEB 4EMUA 4NZZA 1JYEA 2ZIFA 2WYIA 1T9DA 1VDMA 2X13A 3WWDA 9LDTA 3IEPA 1FU8A 4BLQA 4URWR 5I7AA 2JFZA 1G7RA 4PTLA 4PQFA 2HRBA 3RS4A 5KQSA 3I6ZA 2VAVA 2RHDA 1RI2A 1Z28A 1NF2A 1WVMA 2XUPA 3ABZA 4RE6A 4LXUA 4DPKA 4E11A 5EE3A 2C58A 3H2YA 3I9V6 4F3CA 2F3PA 1BFUA 5KNLA 1I3KA 4IY1A 2F9MA 1YO6A 1J8QA 3NV7A 4H77A 3VPCA 2DECA 5LMZA 2PUEA 4IMRA 2GN0A 3HFJA 3DE4X 1YZKA 3BXEA 1EK5A 3QM1A 1ULSA 2HHHB 2AX3A 4MUEA 1HM5A 4YCCA 2YX1A 1WHSB 4TSRA 2I03A 1NNLA 4MV9A 3DHWC 1FLDA 3NALA 3Q0EA 5DNYB 1XPOA 5AM4A 3RFVA 2JAUA 4K7JA 3TQQA 3HK2A 1IZ7A 5BP7A 4R9VA 4Z99A 2P91A 3B3FA 3NV9A 4XVHA 4WVLA 1VGVA 1Z13A 1SXHA 3VPHA 4DCPA 3KT6A 3JQFA 2GXQA 1FDVA 5FNVA 4BMPB 4FMDB 1U0BB 1TLFA 1S3SA 1LBIA 4H18A 1PNTA 4ZHQF 2P5TB 4NAUA 3S81A 1BWQA 1T5OA 1ZCAA 1G20A 1ONNA 2H85A 1W5EA 3AGPA 1R5BA 2FE1A 4LY6A 4YIKA 3SJCA 3B3QA 3OICA 3ZDBA 2R00A 4ER3A 5A06A 3W06A 5BMVB 5FUVA 4HAZA 5C51B 4PONA 4F11A 2WZCA 4GP6A 3DVQX 3PDUA 2HQRA 3W2IA 3C24A 3AVPA 3CF6R 3ELUA 1PJQA 2AIRA 3KT3A 4LZPA 1ABFA 1RYYA 5IKMA 3D5EA 1V37A 4TVBA 1QC5A 1KO7A 4LQLA 3HWRA 4OP3A 4XGQA 1M83A 3OJFA 4OHFA 1DC8A 1NPYA 1N2EA 2BFWA 3JARB 3Q85A 3GLKA 5CBKA 4LHWA 4TSFD 1YQGA 2NUBA 2MYNA 2RH9B 4M86A 1LQUA 1ZRHA 5BN4A 2QWXA 4V02A 1XMQB 4HPXB 4NE2A 1IVSA 1WPQA 2VN8A 1RI5A 1N8NA 4LTDA 4QOEA 4DQVA 2B92A 3UW1A 1CR4A 3A4VA 4JENA 5U4QA 4RGVA 2QW1A 1UZNA 2I8AA 2JVKA 3AF4A 3GFVA 4X1KB 1J1IA 3RWBA 3WSWA 1TMGE 2XMQA 3MJTA 5CFMA 1EA5A 5JXHA 3CNBA 2B20A 2XA9A 4KCGA 1XWWA 2P6MA 1FXWF 2RDMA 3KQWA 3PNMA 4IVPA 5EI5A 3BZWA 3KYJB 3UQYS 1YR9A 1G8JA 2IZ5A 4YCNA 2GYUA 1QYWA 4A9AA 4JT2A 2QN8A 4I3GA 3LY5A 1J56A 4ETIA 2LCIA 5DGTA 3FDIA 1ZINA 3IBTA 4QOIA 1LJ8A 1X0VA 2VDVE 4OGWA 1T25A 5LOVF 4LJ7A 1LY1A 1XFAA 1ZSVA 2IQIA 1U0SY 2REQA 2VNHA 4PGAA 3DMYA 4YP6A 2CNKA 1DZIA 4BKPA 4DNQA 1DXQA 3LW7A 2VPQA 4DG5A 5L45A 4O2BA 3TLBA 3GZNA 3KE9A 3TG8A 3MGKA 5IT5A 3L7OA 1K1EA 4RXTA 1LF0A 5KOJA 3O8OA 3CPEA 1JH8A 2FLVA 1F2UA 2FZ4A 2VZ0A 2WILA 3B6ZA 3INYA 2HH9A 3I32A 3L6DA 3NWPA 2R1TB 4FONA 2PWAA 3HPQA 3MUFA 1Q5PA 4MUBA 4NZNA 4WOJA 1MENA 3VTKA 4B7ZA 2TECE 4ITUA 1RRGA 2YNMA 1DFHA 1M1NA 1NI3A 1ZGZA 2KYRA 1YNOA 2TMGA 5KVCA 1XZJA 1LSSA 4WBXC 2G4VA 3MTAA 3ILHA 3O3NB 1JJBA 1UT8A 5D3MB 4LJLA 4CM5A 2PYIA 4CIDA 2WUDA 4M83A 4WZAE 2E4UA 1BRMA 3QGMA 3JSAA 4WLFA 4NZOA 1L4GA 2PKEA 4KQWA 3VDQA 3DOOA 2A0KA 4L51A 4Z49A 1UAAA 1XAJA 1GCGA 2FX2A 1VDZA 1XRQA 2AMJA 3C4QA 3I2KA 3ITNA 2D7JA 3S2UA 4ASUA 4RELA 1NV9A 4B7AA 1NF3A 2ASVA 4CETA 5KINB 1UM9B 3R7WA 2XWJI 3KUKA 4XM1A 3U9SA 4CLRA 2QM7A 5JMPA 3W5IA 2BKVA 1UXOA 4JLAA 4PN3A 1QUFA 2CDBA 3LK6A 4JP8A 4FS8A 5ESWA 3R3YA 4S1TA 2BFCA 2RGXA 2BMVA 2DAPA 1LW7A 3B1XA 3N1UA 3K32A 2H54A 1WXXA 5E7IA 4ENWA 5JLAA 2ZZNA 4HAOA 3R0IA 1W29A 4IDOA 4WDQA 3WZMA 3A27A 1MG5A 5D7BA 3EIHA 3VQTA 2J7KA 1TIKA 2IU0A 3TQIA 3KJXA 3VAZA 5AUPB 4AX4A 1F51E 2V98A 3JWIA 4LOLA 1PI3A 1GU1A 3KKLA 1WLSA 4F9FA 2B1GA 5CHYA 4D4MA 1IN7A 3T15A 1L5KA 3TZLA 5F3DA 3NTXA 1PEKE 2AJCA 3W3AH 1ZVQA 3SHOA 1GV1A 1BW9A 2CDNA 1TUEA 2FRDA 2OCAA 2C9DA 2QN6A 3DHYA 3OMWA 2ZYRA 4DEYA 1Z83A 3PJEA 1M0TA 1TZBA 2QT0A 2FA9A 3QFCA 2NU9A 5LP6F 4BBAA 4AJNA 4I8XA 4F91B 4Z8XA 4L4UA 4WK2B 3LYAA 3NKVA 4NE7A 2X0DA 2RHMA 4UD6A 3T7CA 4U9UA 2WOOA 5IH3A 1J9GA 3FB4A 3W5SA 1UKYA 2F3SA 2HQSA 4RY0A 4X44A 3TD6A 5EIOA 1V2HE 3QOYA 1C1DA 1R0YA 4RLFA 4ZVUA 2ECKA 2FFJA 2R6HA 5ALTA 3RT7A 3WGKA 4GX5A 1R6UA 2IUYA 3C5CA 4DZTA 1P3DA 3UN1A 3EVAA 4CCSA 1B6SA 5F3WB 2OENG 1G9SA 4EF4A 3IESA 2AOTB 4A2CA 1X7WB 3RAFC 1CZUA 1HX7A 1UZAA 1MA3A 3V8QA 1I1NA 1GQSA 3BF7A 3UYKA 1JEYB 2FPIA 3I04A 5C31A 4C4YA 3ZX4A 1KORA 5HEKA 1SH7A 3RWOA 1JFVA 1OBFO 3JWGA 4A3SA 4GKBA 4M36A 5IAEA 1JDJA 1TM3E 2QPLA 3T38A 1PG2A 5AW1A 2JEZA 4ROSA 1JXAA 3U0VA 1OLUA 1AGPA 4JHXA 5HGXA 4D42A 3C5EA 3OF3A 4P34A 1UBKS 2XMBA 2Z30A 4BMOB 2D1RA 4WKGA 4AO8A 1KFCB 4MQ6A 1C3LA 2C2MA 4Y6OA 4ZMBA 2GAAA 2ZSJA 4U7FA 5K3OA 1MR3F 5CDGA 1OX4B 2BCJQ 4PBSA 5DBEX 3CXUA 2FK7A 4N40A 3C97A 1ZIPA 1GZUA 1FCJA 2WIAA 3PGLA 4WJLA 4HDQB 4DSOA 4BO9A 5K8VA 2GM3A 3VNVA 2Q1TA 3EARA 1JFTA 1ZWLA 1PFKA 1X7YB 3M0EA 1MB0A 1FDIA 1V3TA 1GQRA 2CLKB 3PLNA 1GPBA 4BFCA 4Q9KA 2ZXEA 3GLHB 4P38A 3WYAA 3GAMA 1NE2A 1FYVA 2VBCA 5EJEA 1ZNXA 3HWSA 1SEPA 1B0ZA 3MK31 5TJHA 2X6RA 2PYDA 1Z4JA 2IS6A 3K0EA 4DDHA 3LBHA 3GY0A 5HUJA 2CL0X 1JIQA 4JZKA 1ATIA 2WWYA 4O4IA 1J1ZA 1P3JA 1FP1D 1QU3A 3E9RA 4DRZA 1K97A 4XVRA 821PA 2AQ8A 3OCUA 5I8ZA 2AXPA 4UBOA 3THXA 3JQ7B 4X6XA 3GD5A 5LC1A 3N0XA 1WMFA 5B1DA 1STOA 3ZXIA 3N70A 1HH4A 1YCFA 4CG1A 1XTKA 3VPDA 5J1SB 5KYXA 1U2GC 4XAQA 3U9TA 2EF1A 1MGPA 4OHBA 4QG7A 1WUJS 1RKUA 3HRKA 1PUXA 3PXXA 3L6EA 2GESA 1BS9A 1JALA 1FDWA 1NMQA 4QREA 2P30A 1OUMA 3CRW1 3V6LA 4GFDA 1SB8A 3AYXB 2EKLA 2VCHA 1G2PA 3I9FA 3UMJA 5BYAA 4MV1A 5BR8B 1Y3HA 1M1NB 3LUDA 3ND9A 3JZDA 1XC7A 5AIBA 3FPEA 5FAKA 3VNUA 3AGQA 3LDAA 4Q7JB 3CSSA 1UPFA 4OK5A 5IXSA 3KQOA 3E9CA 1Q14A 1P6QA 1WL8A 1G5QA 5DMXA 3RWMB 4EG8A 3CRZA 3UA3A 2HNKA 1EWVA 4BPRA 1YV9A 3C14C 1N6KA 4JI7B 2XMCA 1FVFA 2V74B 5KJEA 3NH6A 4R1LA 3REGA 2IXBA 1DI0A 3PQ5A 4D9MA 1P1JA 3WQRA 3PPXA 4AN1A 2H4ZA 2IEDA 3WLIA 3KZ1E 1Z6QA 2AZTA 4FB4A 4CV1A 1U5AA 5KNCD 5JO9A 3EDRA 4BJ6A 4XRGA 4ZDIA 1K89A 2HHAA 5K6RA 3P9XA 4GI5A 2PRJA 4RC9A 3V80A 3MRSA 4NENB 3U09A 1C1DB 3Q7TA 1CZOA 3KUDA 4R7GA 3DUFB 3I28A 1BWSA 2I76A 1ZUHA 5JECA 1IY9A 1XT6A 2P27A 3HABA 2P2SA 4BZPA 5JCPA 2BYTA 1VCOA 3LF2A 5B3AA 5D87A 2VATA 3CRRA 1U3CA 3H9GA 1KEZA 3EF1A 1E20A 1T6BY 3QLEA 2BEUA 2KLBA 5BV2P 3I2HA 2QUHA 2QL7A 2QJTA 5DWVA 1H69A 4HRYA 4KFCA 2FWRA 5KAMA 3K5HA 521PA 3TEJA 4IP0A 5AVRA 1IHDA 2JNWA 3NIDB 4B81A 1WBDA 3PWZA 2XQGA 4WZZA 1EEHA 4LPKA 3VR5H 3U26A 3PLAE 2DQYA 1HLPA 4R0VA 4BAZA 1O5IA 2VUIB 3N3AC 4YCDA 3WLSA 2SECE 4A91A 4X62B 5EERA 4DUZB 5NLLA 1NHWA 4WNAA 4YIHA 2RGDA 5F3RA 3KOUA 3GOHA 2E37A 4TTPA 5IX8A 4U7WA 3WLEA 3BEDA 1YF3A 2IV7A 3CCFA 4NV0A 1HMYA 3EVNA 1WQ1R 2XCQA 1SY7A 3P9NA 1YKGA 1J8MF 2EYUA 2JIZA 4NVRA 4ZOLB 4CLOA 1CQPA 2WPDD 3BFKA 2F90A 2Y2VA 5CFZA 5H82A 2JJQA 3PVZA 2QLBA 2OGWA 3W9UA 2VSFA 1T4BA 4UM5A 1QV6A 3DR3A 3OOHA 5KAPA 3ZEAA 1XK6A 1R1DA 1XUOA 4KUHA 4L95C 4BQPA 2XQVA 2X76A 3OZWA 2YQ4A 1PKXA 1TZJA 3VH2A 3M9XA 4ZAVA 5KHAA 1KQNA 1VRWA 3LCJA 3TW6A 3UZUA 3ZDFA 3UXMA 3F73A 5SY6A 2ANBA 3TZCA 2JAHA 5IFKA 1Q7EA 4GE0A 3AERA 3CX7A 4KX3A 1KJQA 1SBZA 5AUQA 1MXFA 1ULTA 4UAUA 3FOEC 3EUWA 3N07A 1Z7EA 3WYFA 1RWPA 2EFHB 2QUBA 2Z5FA 1Y81A 5E1MA 2GN2A 3O4IA 4O1MA 2CD9A 1SU7A 4X95A 3IPRA 1O5OA 4HX5A 4IJVA 4EHDA 4Q21A 4NJMB 1A8PA 1APBA 1TA9A