4D9GA

Crystal structure of selenomethionine incorporated holo diaminopropionate ammonia lyase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
387
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Putative diaminopropionate ammonia-lyase
total genus 119
structure length 387
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA01
2EFYA 1V7CA 4COOA 5I6DA 2ECQA 1TZMA 2J9XB 1P5JA 4L0DA 3DKIA 2CLHB 3DWGA 5C3UA 2EGUA 1TZ2A 3DWIA 5D84A 4XUGB 1A50B 5DW0A 3T4PA 1K3UB 1V8ZA 1K7FB 3VC3A 2JC3A 1PWHA 4L3VA 4LMAA 5B36A 1WBJB 3ZEIA 2Q3BA 4D92A 5DBHX 5IW8A 3V7NA 5IXJA 3SS9X 1TDJA 2C2GA 2WSYB 1E5XA 1C29B 3FCAA 4NU8X 3VSDA 3IQIX 4D97A 1WDWB 4D9NA 5B55A 2GN1A 3IQHX 3BM5A 2GN2A 4WX2B 1F2DA 4HN4B 2DH6A 1OASA 3L6BA 4I1YA 1CW2B 1K7XB 4QYSA 4D96A 4D99A 2ISQA 1UIMA 2V03A 4HT3B 4D9GA 4ZU6X 1J0AA 1V71A 3X43A 1TTPB 2CLIB 5I7HA 2D1FA 1KFKB 4D9IA 2RH9B 1KFEB 4HPXB 1TTQB 4ZQCB 2J9ZB 1X1QA 3TBHA 4KKXB 4D9EA 1J0CA 5I7OA 5DBEX 5D85A 5KINB 4D8TA 2ZPUA 5CVCA 5HBGA 5B1IA 3L6CA 4D9MA 1FUYB 4JBNA 1TZKA 4D9KA 1VE5A 5E0KB 5T6MA 3L6RA 1A5AB 3IQGX 3RR2A 5IWCA 1QOQB 2RKBA 5I7AA 2CLEB 1WTCA 5CGQB 5J5VA 1O58A 1QOPB 1TYZA 2CLLB 2Q3CA 3VSAA 5I7RA 4D8UA 2PQMA 1KFJB 4LI3X 4HPJB 4D9FA 3CEPB 2ZR8A 2TSYB 3PR2B 2J9YB 3AEYA 3X44A 3HMKA 4HO1X 5JISA 5DVZA 5B3AA 4D9BA 1J0DA 1TJPB 2TRSB 2CLFB 1UBSB 1VB3A 5D87A 1D6SA 1Z7YA 2GN0A 4ZU1X 3SPXA 2TYSB 1J0EA 4OFXA 4H27A 4JBLA 5B1HA 1Y7LA 5D86A 5BW6B 1JBQA 1KFBB 4L27A 4F4FA 2DH5A 2CLOB 5EY5B 1Z7WA 2Q3DA 1CX9B 1KFCB 1K8ZB 3PC3A 1C9DB 1TZJA 3R0ZA 2C2BA 1J0BA 3FGPA 3IAUA 3VBEA 4D8WA 2O2JA 1M54A 2CLKB 4L28A 4NEGA 5JJCA 3PC2A 1C8VB 5DW3A 5J43A 1VE1A 1BKSB 4AIRA 1KL7A 1WKVA 2CLMB 1FCJA 4D9CA 4Y6GB 1PWEA 2ZSJA 3PC4A 2BHTA 5KZMB 1K8YB 1K7EB 1K8XB 3AEXA 5I7WA 5B53A 1A5BB 2BHSA 2O2EA 1UINA 4LMBA 4PCUA 3VSCA 3R0XA 2RHGB 4IL5A 2ECOA 4AECA 1RQXA 1A5SB 1BEUB 3SS7X 4OREX
chains in the Genus database with same CATH superfamily
3R20A 1CJBA 4P5EA 3LFTA 4P82A 1V7CA 2VBGA 1IL0A 2ET6A 2WU8A 3C98A 2ID4A 3CX4A 3I04A 3O74A 4U4AA 2WJPA 1D1SA 3VR3D 4LJLA 4LE2A 4EX7A 2APJA 3I4CA 4K9KA 1NC1A 2XE7A 3B5IA 3BRSA 4HYYA 2PPLA 4B3HA 2YFKA 1QPGA 2W6JA 4NE2A 1OLUA 2G40A 4QO8A 3CXUA 4EUHA 1KSGA 3O90A 4MYTA 4XSHA 4YQZA 3C41J 1F4LA 2EKZA 4MIKA 1L9XA 2KBFA 3DE6X 1G9SA 3QKRA 5IBRA 2ORVA 1G2PA 5KDOA 1RE0A 1TX4B 1VG8A 4CMEC 3GF4A 2VYNA 1LRKA 4LECA 4YPVA 1A27A 1KAMA 4Y9RA 1U5AA 1DAGA 1EGHA 1GGEA 1WY7A 2GFQA 2Z2XA 4ICIA 3M9WA 2QBYB 4TLDA 1R50A 2JI8A 5T67A 4BO0A 4QA9A 3W7AA 1LWNA 2HA6A 3IPAA 5HK8A 1L6RA 2JEOA 3GLKA 4WK2B 4KFRA 1A7KA 3AHFA 3G1UA 1W49A 2J0UA 1KHHA 2WIAA 1I4DD 3V2IA 2ZI3A 5G2OA 3ZY2A 2MR5A 2XA2A 3ND9A 3ZHXA 1RU3A 2ZVPX 1P60A 3F6RA 3TMYA 3QPUA 4U2DA 4DCVA 1HDOA 2VHTA 4H17A 4ZVSA 1DOZA 5FOQA 3K70B 1Y1PA 1SXJD 4RQTA 2YWHA 5ICSA 4J3JA 4IAOA 4GDMA 3TH5A 2PKQO 4EHLA 1I1NA 1XHEA 5CW1A 4DEYA 1HL3A 2V6GA 2W6OA 1RVDA 4OJKA 4QU5A 1UKCA 2AUTA 1E8NA 3AJ8A 3L6RA 5H9VA 1L2TA 1MRNA 4B3XA 4Z7JA 4BX0A 1T2VA 1GL3A 1KYYA 4TS4A 2K6GA 3QIAA 4N3CA 1T2CA 1O58A 4M37A 2H4WA 1QHEA 2W2LA 3OJWA 1SY7A 4YUWA 2WM3A 1N2GA 3NDPA 4H0FA 4H3KB 4HS4A 4IF6A 4YI3A 4D9HA 3BTSA 5F1YA 4U7PB 5KHAA 3BEDA 5TVGA 1G17A 2IHTA 1HMPA 3II6X 3R0VA 4I5DA 1JI0A 5AJZA 2HJ9A 3BHJA 2WNIA 2P8SA 3O8RA 2A58A 3CR8A 1ZLYA 5CU7A 4PZDA 4MA4A 1H2BA 2GPTA 2UYCA 2GJ8A 2PRYA 2OGUA 3FOCA 5KYXB 4B09A 2DH5A 2AE1A 3HR8A 1V5GA 1F6DA 4RYDA 1QGDA 3A2LA 4XWGA 1TB4A 3ELDA 4PX5A 2JKYA 5FO1A 1U2ZA 2PRKA 3Q7QA 2R6FA 1PWXA 2P5TB 5FFNA 2H18A 3JWEA 5DIZA 2VAVA 5G3YA 5JJIA 2AFHE 4D42A 3QYJA 2JLUA 1XAIA 2G9UA 3L07A 1AE1A 2NQTA 4L8GA 1AMOA 1O0BA 2R60A 2IU4A 1PO7A 1WCYA 3GFVA 4Q4DA 3VDMA 1HSZA 1C0IA 1WMEA 2AXPA 1XFAA 2OHOA 3GDHA 3A4IA 3BVPA 4LYYA 5ICCA 1OTYA 1ZZEA 5YASA 4PGHA 4QBKA 3GLIE 3AEKB 5K3SA 3ZI4A 3M1IA 5LNK1 3WDSA 3P2YA 4Z4FA 2A78A 4QJ4A 4HH0A 1I9CA 4BGIA 1GYRA 1MAHA 1W36C 1SHKA 2I4IA 1BROA 2E4ZA 2EX0A 1DJLA 2NUAB 1E62A 3FHOA 4PC2A 1Z2PX 1D6MA 3DNMA 4M9SA 3X3HA 1UBKS 1GL6A 1ZCAA 1E9FA 3JQPA 3JSXA 2R87A 1N3LA 3OCZA 5F9FA 3PFWO 1A50B 2VH2A 3KD2A 3E2IA 3U31A 2VDMB 1NBHA 3OZEA 5TQ2A 3ZNQA 1A0OA 4JP2A 1BN7A 1CDOA 1CRPA 2W22A 2D2IA 3W2EA 2BEWB 2QL7A 3MWEB 4ZQGA 4A73A 5A05A 3AHIA 3IQIX 2VXBA 4HUQB 4LA4A 2QJFA 3ACCA 3HVRA 2NLOA 1NX6A 1DDOA 4JJGA 1CY4A 4B33A 5HIAA 1X13A 4Q19A 1DPFA 3UFBA 4MV0A 3ZWCA 5JRDS 1MRZA 1UXJA 3QKWA 4RA9B 1J8MF 4FGKA 4RLQA 1FP1D 1KYWA 3KNZA 3MIIA 1PD0A 2XI4A 1Z62A 3N7TA 4BJ3A 3IBFA 2JASA 3CF4G 4CV0A 4Y6LA 3IXLA 3ZLUA 4ACBA 1XO1A 2JBHA 2NZXA 1RXCA 5E3HA 4F9EA 1VLLA 1DEKA 3OBIA 5C34B 2V7WA 4YIHA 3EIEA 3N2EA 4TKUA 1XQ1A 1ZNYA 1YFJA 4ARZB 1KH2A 2YN0A 4PVCA 3HI6A 1FS6A 3MJEA 4ITUA 2PT7A 3A1VA 5EKXA 4XYLA 4AUEA 1PJAA 1ZPDA 4B1FA 1AGRA 5BUZA 5JR3A 4NXMB 3LD9A 1Y5IA 3D6TB 3OOHA 3SY8A 1ZW6A 4YROA 2C3UA 3C2QA 3QVMA 5TPWB 4S35A 1FJHA 1M8FA 1HE1C 5DOZA 1JXOA 1UBRS 5LLSA 5C1IA 3CX3A 5BNFA 1YSCA 4H08A 2V0NA 4LFBB 3PR3A 3T3EA 4DG5A 2AQ8A 1EK1A 4LRXA 3CZ9A 4LI3X 4YJ3A 1UEJA 4NATA 3NVKI 2BRUA 2VATA 4HAWA 1RQGA 2HI0A 1FP4A 4S1PA 1BGVA 2JH3A 3N2LA 2H16A 3AF3A 3IQZA 5TS2A 1CQWA 2QZ9A 4H3VA 3TS1A 1KAOA 3NTLA 1V37A 1XCOA 3C3MA 3I8SA 3MHPA 3GARA 1CRZA 2J4FA 3NC1C 4X8LA 4U6SA 4UOQA 2HMVA 3PRJA 4CMGA 4JJ6A 4RTKA 1NIJA 4CF3A 1CF4A 1ISJA 5IAOA 3H8WA 3SYTA 4IG4A 1JQ3A 5B3LA 2Q4TA 2X4LA 1GPNA 3MQ4A 2CXXA 2DQSA 3P71T 3KCNA 2PAFA 4BO1A 1AXEA 1LLUA 3B60A 3M89A 4J75A 3A70A 3Q3EA 4DMRA 4Z4CA 5A9SB 1ND5A 1PEDA 1E6EA 1VOTA 4CCWA 4LRTB 4JN6B 2GZHA 4UUMA 3PL5A 2J1LA 4UCFA 1FQOA 3ANMA 3KKPA 1K7EB 2XADA 2HGSA 3NBYC 4B3CA 3KTAB 1UBCA 4OBWA 1IH8A 3LWDA 3H9JA 3QV1A 2F8TA 1J1IA 1VL1A 1M6VB 4QZVA 1A5SB 1KORA 3DOIA 4H0NA 5EYPA 5C4MA 4QARA 1GQQA 3BPSA 3LZCA 4EEKA 1FFBA 3AM1A 1Q7TA 4JBIA 1Z0SA 2FCAA 2IYPA 3DBLB 2JKVA 3UC5A 3W04A 1IHDA 2ZR0A 4UBJA 1P44A 3N2ZB 2GZ1A 2JZOA 2W2XA 1THMA 1P2DA 3OM1A 3GFPA 4MGYR 3RG2A 3N8IA 3F5QA 2W6ZA 3DEKA 1DJNA 4M1WA 3NEYA 3V7NA 1U8AA 3T1HB 2Q5IA 2IH5A 4D8XA 1GSIA 3BGDA 1T2UA 2PS9A 1UDWA 4R9UC 4BQFA 5CUQA 3KU1A 2GCEA 4MOWA 4YQYA 1J2YA 5J2UF 1RPZA 2HDHA 1N6OA 4K6MA 3T3DA 4BTEA 5K6TA 1N3IA 1OFUA 1DFHA 2Z5FA 3DFIA 1BCSB 5JSYA 4C3ZA 4AF6A 2XNSA 3FAKA 4OB7A 4TS3A 5LP6F 1DWPA 1BHQ1 2NSJA 4LJKA 1IM5A 2WNSA 4DSUA 3IAHA 5LMNB 4OK5A 4G5YA 4HVAA 4JL8A 4X1KA 1S7GA 2XWSA 3UWKA 4RIFA 4KBGA 1H1TA 4MX8A 3FVWA 4WE3A 1LTHR 5GPBA 5CH3A 4FILA 3TLKA 1YZNA 3C7CB 4U02A 1XNJA 1FVXA 1XVTA 3J80A 4AIIA 3B8HA 2W0SA 4GNRA 5LMCA 3KYCA 5CVUA 5FV7A 3FZQA 1NP3A 3O4IA 2H1FA 3E3OA 4GGMX 3GAZA 4IFEA 1EXDA 1E1NA 1G18A 1MGOA 2V9ZA 4EZBA 3O2QB 4J90A 5G1NA 2C5FA 4QEDA 16PKA 4HEA1 2OM2A 3BN3A 1SH7A 4Q7EA 5D3MB 1QOQB 2QVZX 3I1YA 3FB1A 5JWHA 1C1DA 2ZWIA 4FD2A 3M2TA 1XL0A 2CXSA 3O8CA 3GRUA 4ZHQA 2OQRA 1AK9A 3HLTA 3DMFA 1M6NA 1Q0SA 4DM7A 3WJ2A 4DLSA 3GDFA 1JN0A 1G5FA 4I6EA 3X1MA 4K05A 4L5BA 2M9MA 2B8NA 5IDVA 3IUPA 4UXIA 4P4UA 4OTZA 3ISVA 5BQOA 3BWVA 1UR5A 1M2NA 2FUEA 5L8VA 1NM5A 1M7HA 3FUCA 1E6KA 2NSLA 1HO3A 3DZCA 3TI7A 4CNBA 4DOMA 5BORA 1OFGA 2YZMA 1K89A 1YWGO 4QDTA 4RKFA 3WQHA 4E14A 1QCCA 2ZTLA 3IQWA 1LEHA 4NRDA 3S7ZA 1OTXA 3UF0A 5CCBA 1HYEA 2BFFA 3CZQA 2LV8A 1FYWA 2O2YA 1U8CB 2IE8A 1LTQA 2VJBA 4R7TA 1ZHOA 3JY6A 2IPNA 1D3AA 1VG9B 1QJ4A 4KFCA 3UUFA 2Z6AA 2F17A 2FUCA 4EY5A 2QX8A 2A4MA 5KYYA 1L7QA 1VP3A 2J48A 2QTCA 2Z8YM 2FI1A 4LJYA 1POXA 2AZTA 2XCRB 3M6XA 3A6FA 4QOHA 4FSXA 1E3WA 4HNRA 3WRXC 4BFZA 2BGRA 2ZSUA 4DW8A 5BN5B 8OHMA 3F73A 3U4HA 2W2NA 4RZSA 4FXOA 3NP7A 1UANA 3C1UA 4LJ5A 4A8PA 3OQMA 4FMPA 3ZCRA 2BJVA 5DIFA 4REOA 4ER7A 4OLAA 2QN8A 3BFXA 2J6BA 3UANA 1IWPB 1Z2NX 2C20A 1GNLA 2XB4A 3QNUA 4ANFA 1U9IC 4RUKA 2QUBA 4L8YA 2JCXA 4YPFA 1X70A 4MW7A 4CEHA 2JJ1A 1R0LA 3G8DA 1VXRA 3HC7A 2X0KA 2C8LA 3BOSA 3I39X 1JIVA 1LI5A 3WA7A 2XKJE 3G2PA 1J90A 3K9NA 4MW6A 2XB6A 2FX5A 3V46A 3V8NA 2ESRA 2PXCA 3DZKA 3EXFA 3OCXA 1E66A 1EDDA 1S2IA 8LDHA 5FUYA 5JJKA 2A88A 2M2IA 3LP8A 3LC1O 2RD2A 4IQ4A 2G6BA 3JZAA 2G80A 3LG2A 3A6DA 4FYIA 4KEAA 4P6VF 4KVFA 4TTRA 1PS8A 5ESRA 3TQTA 4EUFA 1ISSA 1TNDA 4WX2B 3RS9A 1PV1A 2FR8A 2JJ2D 4HMQA 4LKOA 4HC4A 1Q50A 3WYNA 4KR3A 2FPWA 3VM6A 4NS4A 2BZ1A 2PN1A 3TD2A 1UF9A 4E1BA 1EP3B 1SD5A 2PGDA 4YIKA 3FJ1A 2JGLA 1OLXB 2VHWA 5J63A 2RGDA 1CB0A 4EA7A 4RMIA 2FN8A 2ZYHA 2IHZA 4LN1A 2F9FA 1CRWG 1KMIY 2UZ1B 2R7KA 2Q41A 3R3VA 1T2NA 4NBWA 4BUZA 5G0SA 4CM1A 5K4HA 3N8KA 4DPMA 2D6FA 1XVLA 4JVNA 1VLQA 1RWBA 1TJ5A 3EZXA 2BM9A 2UZIR 1Z4JA 5GZ1A 1M2FA 1EX1A 4IO1A 2PWYA 5K0BA 4OLBA 1EGAA 1NW3A 4NH4A 5BNTA 2ZFUA 5HR5A 5K8TA 3L8EA 4S24A 1NRWA 3LRPA 4C87A 4Q3EA 2DPLA 5EIBD 2R8PA 4GI7A 4JJKA 1E6WA 3R3WA 1M2VB 2X2FA 3AERB 2BEVB 3D81A 5M04A 4EPRA 3IRVA 4Q05A 3L05A 1E5QA 4CTNA 2FFJA 2NQ2C 5KTMA 1J8YF 2DQZA 4XYBA 1UWKA 3H75A 2KQUA 2RBKA 1D4AA 1RI1A 5BRJA 1T4DA 5K0LA 1KMCA 3HSYA 2HHLA 1YQQA 4JUCA 1RP7A 3KJHA 1NVVR 4G1BA 4YJKA 1WUIS 1F9AA 1HG0A 1NKSA 3U49A 4W5NA 4HQ6A 5HQ3A 1B0PA 4RQUA 2WNHA 3K0AA 3RIMA 4AX4A 2Y68A 3B1YA 1PFWA 3SXJA 1RBQA 1PNRA 1NBAA 1NVKA 3ZOZA 4QJ5A 4PYKA 2AXQA 4TLMB 1QJCA 5CMLA 1E4EA 4E94A 4XW2A 2WJ3A 3VH1A 5EIFA 3KQQA 1M2OB 2BEKA 2XQJA 3N0VA 1PGOA 4EW3A 1A4IA 3BERA 2BY4A 5DZSA 4QXPA 3HO6A 1VMEA 2P6PA 1EG2A 3WSTA 4B47A 5B58C 3FBTA 1WUJS 3RT7A 5K4AA 1W35A 2C95A 3HJRA 4GYYA 2VF7A 4KVAA 3OQIA 5ALIA 5EL0A 5IDWA 3QW2A 2JLVA 3W8RA 2C2KA 3GFFA 3HY4A 4QHTA 1U6IA 4DXAA 3PICA 3OQOA 4Q37A 1BXGB 3FWYA 4Y2PA 3GAAA 4B80A 1VHTA 1IHXA 1A77A 2XH8A 2JGAA 5CJPA 4UDXX 4E4TA 4JFAA 1M8JA 3GGGA 4OFBA 3G9TA 5HMLA 1NASA 2RCNA 4S1NA 3ROGA 1IRXA 1TW2A 1W1UA 3PE6A 1Y1LA 2XGGA 1GGVA 1CJMA 1HKUA 2E7ZA 2IXEA 3F7NA 3HB0A 2J30A 3MB5A 4QXOA 3J7TA 3ETNA 1M2WA 2QNBA 4X62B 3H2KA 1COWA 3GRZA 3MWGA 4Y18A 4GT1A 4RL4A 2OP0A 2XVMA 4QEKA 4MDYA 2BISA 2GEFA 1YRAA 5IN5A 4DBZA 1E5XA 1QVAA 3ZHYA 2FP3A 3LECA 3IVCA 3C3DA 3OTQA 2YJZA 2IZZA 4G9EA 4LQCA 1RQ7A 3H2BA 4L8FA 4TN1A 4G4GA 4DLPA 821PA 1SG0A 2H4JA 3TVDA 1JHPA 4N5NA 1UXHA 4NESA 4CMEA 4BZZA 5B4VA 3SR0A 1GZSA 2H9AA 1J7JA 3CZ5A 4ZV4A 1C0EA 2AKEA 3SJZA 2QVYX 1L4HA 5DTQA 3G7UA 3MS2A 3MT9A 4GKAA 3HHEA 1NR7A 3OY2A 2JHGA 3IT3A 4LBVA 3T5GA 1ZP6A 3CUWA 3H3FA 1T2EA 5FNVA 2CVOA 3I37X 4G0WA 4TMTA 1YZ3A 1RTKA 3D31A 2AFIA 2W6QA 1NBIA 4DB2A 4HX9A 1VKJA 2YVQA 1MABB 1JFFB 3F9IA 3KQWA 4M6WB 3ABOB 2PJRA 5JNWA 1UC5B 4AP9A 2QLLA 2JGDA 4CR7A 5B6PA 1DAEA 5DHQA 4LF8B 4KO2S 4LXUA 1HC7A 3GY0A 1PBTA 2KHZA 1AQIA 1WZIA 1XZIA 3T7KA 5A04A 2PQ2A 2HJVA 1PV4A 3A7DA 1J5EB 3GLIB 2V6FA 1FUUA 4I50F 2E2WA 3H4IA 4YAEA 1OWPA 1TYEB 2IV2X 2RAPA 3LYAA 5CH8A 5KNBA 2FSSA 3QE3A 1HDZA 4OD0A 3P0JA 5J4LA 1QFZA 5H02A 1Q0PA 1HRDA 4FDMA 5ESDA 4AAYA 1KP3A 3WIDA 3MUNA 5IFLA 1U0NA 1AKNA 3GN2A 2J9YB 5EXXA 1CRQA 3OA0A 5AUQA 4JLPA 5JZVA 5I7FA 2IUEA 3I2GA 1EVKA 2IIVA 2R7LA 3I9OA 3K3PA 5BQPA 2Q29A 3GJ7A 5KJEA 3AVYA 1OKKA 5GAJA 1O97D 3R5TA 1BYUA 1KI7A 1NFQA 2MSNA 4LYGA 3SYLA 5IM4F 1YUMA 2D7CA 2GN9A 5I9SA 1N9GB 2X0EA 4DAOA 1TFRA 3KPWA 1L7DA 1MAUA 1XMSA 3DV0A 4WECA 1Q5PA 1E9EA 1YMVA 3P7MA 1A98A 1DKQA 5ALDA 2PWAA 1E7YA 5BSTA 2JCYA 4NMMA 3FZYA 1D7OA 3V4OA 2HY7A 3WDMA 3SS8A 4KUEA 2DERA 3S2YA 1GCOA 1JDJA 4R2KA 4HVLA 1LVGA 3EVGA 3LF1A 2FFBA 3DF9A 3P2KA 3LU1A 3C5VA 3P19A 1H5NA 4HEA6 1RI3A 1BSVA 1QIGA 4EZEA 1D5WA 3CRMA 4QPDA 1GPBA 2X7JA 4O2AF 1OB5A 3PC4A 1EUDB 3M6UA 4O5OA 3SQMA 2NYAA 5FI1B 1NW9B 5K3FB 4C4PA 1CEEA 2UZ4A 3MFYA 2VEDA 3HJNA 1WDLA 2C88A 1VL0A 4EHJA 4V0MA 3O8OB 3R40A 2PBLA 2VZLA 1ZL2A 2H7CA 2P2LA 2YW9A 3CUYA 2PSHA 3G9UA 3JATA 4MB2A 5A7HA 4DR1B 1JDVA 2DFKB 2GYVA 4M76B 4OOFA 3BE5A 5I6DA 1LPMA 3ER6A 2VSQA 2TECE 4WASA 4DCPA 3L0YA 4DQVA 4OEHA 3TZQA 4FI3C 4BMVA 1P1CA 4GM4A 3VVLA 1GPLA 1LW6E 1RJGA 3GJRA 3ZY3A 4ADSG 1DBVO 4QDKA 2G88A 4KCGA 1QYVA 1NJ1A 4MIYA 2XECA 1RCUA 5IBPA 2X0FA 3HCEA 3KSZO 4A2PA 1MB3A 3EQZA 3EZLA 3HYNA 3PA8A 3AM5A 1XN4A 5CA1F 3OICA 3WWCA 3ZVKA 2VLBA 1C7JA 1W59A 2FAXA 2OHJA 2Q4EA 2X1VA 1SQ5A 3GFOA 3M9XA 4CV2A 3TW4A 1H2HA 4PZYA 3AO0B 5AOCA 1GPUA 4EMSA 1KDRA 5HUQA 4GMGA 4MINA 1O6BA 4D4MA 4UZEA 4G8BA 1QAOA 4RXUA 2R7NA 4ZVQA 3AGPA 3C1AA 1IATA 2WF6A 4HUJA 2E5WA 3OOEA 2WT8A 3DEHA 1W0CA 4HDKA 2VJLA 4K5QA 2B98A 2O52A 5ER9A 4UZSA 5GIOE 5ARBA 4TMKA 2YKGA 1RWPA 5ADWA 1NUSA 2Y1OA 4CM3A 1QUEA 1XEWX 2AYXA 2UUAB 2YVKA 2FZ4A 2W0MA 3CNOA 1VI5A 1T4GA 4QM6A 3N75A 4LOJA 1XZKA 1ZO8A 4FN4A 4NJEB 4F8YA 4TSFA 3VNUA 4GXTA 4I1SA 1P4GA 4IDGA 2IZ6A 4XFDA 4DA4A 3D54D 3CN9A 5HBGA 4B81A 1G38A 1JQKA 1M7GA 3HPRA 3ZWWA 5BSKA 1ISGA 2PGNA 3ZK7A 4WCFC 1TZKA 1UPFA 3LTEA 4V0SA 4AZ0A 5C5CA 1NG9A 1Z16A 5HBRA 3LAWA 4UMEA 1LFAA 1CY1A 1R5JA 4UHEA 5D6NA 2NUPB 3IDQA 3O7WA 3V4FA 1QLWA 2O14A 1C30B 4X64B 2J0QA 1H42A 4PRLA 5CD1A 4LJ7A 1VCMA 4ZZ2A 1N0WA 2J6IA 5ITSA 1WWKA 3UJ7A 1E1YA 4AG6A 3V2UA 4ZA2A 4H1VA 3AEYA 3CPSA 4L6AA 4JP5A 2OK7A 2I87A 1X94A 3L7IA 3MRSA 1UEIA 3N28A 3Q3GE 1XQ6A 4JVOA 4BNYA 4YCCA 1ATZA 1T5OA 2QBYA 3P9KA 4I5EA 5DCYA 3O8OA 3OZUA 4I0WB 4C76A 3MD9A 3INTA 2A92A 3HADA 2HV8A 3GUVA 5HOQA 1IXKA 1VA5A 1XEFA 2VNHA 4I9GA 4OQXA 3CH6A 3TFWA 1QS0B 4Q02A 1BS1A 5KX5F 5LP6A 4FM9A 4AS2A 4LZZA 1KDTA 3JAKB 4KLNA 2XXAB 1D6NA 1EFPB 2RIRA 4UEWA 2ZU0C 2XCIA 1N57A 2PT9A 2C78A 4JB2A 5LUBA 4NHEA 3FBWA 3SQXA 2R8RA 1UPTA 3C7AA 1PRYA 3DQPA 3WL4A 4EPXA 2GD6A 3QVTA 5DFAA 4UNPA 2EW8A 4ARZA 1O6ZA 3RVDA 1MX3A 3OUUA 3UT5B 5I4CA 4W6ZA 1U8ZA 1B0ZA 4QTUB 2G5TA 3PNKA 1SO8A 1XV5A 1Y3BE 3S2UA 3K2EA 1XFDA 3BQNB 1HYHA 4FHGA 3FNHA 1LVHA 4UMVA 2C2OA 4P8RA 1AUVA 3W7VA 3U62A 4RTLA 3DLIA 4MKHA 1Y7PA 4MAFA 2BF4A 1G7SA 4IFIA 1XD8A 3UT5A 5JAUA 3HFSA 1TXGA 4KIFA 1DBSA 1RWVA 3EUWA 1X7XB 4QXQA 1ODLA 4KPUB 4UVHA 3CLHA 4EO7A 4ARIA 1ZBQA 4FFNA 2DQ4A 4QKQA 2LP4Y 2ZIGA 3UWOA 2J7PD 2R8YA 2QU7A 4HDNB 4KACA 5JRJA 1W36D 1PNVA 1PR1A 4MV8A 3R7DA 3EN0A 4CIYA 2J09A 4X60A 4LC9A 3K1ZA 4ZKEA 1NBWB 4DMUB 2ZWVA 2QIPA 5B6IA 4YHHB 1XTJA 2ZT5A 2JRLA 2XZDA 3OF5A 3FF4A 1SZDA 4FYJA 4RXMA 1LD3A 2NN3C 2Z04A 3FTEA 4TMZA 2VNAA 1Q0RA 1Q1ZA 1K7XB 1P9LA 3CPEA 3D8NA 4M54A 4UW9A 1DJOA 3HE3A 2Y1EA 4DUGD 2IX9A 1ZJWA 1W4BA 4CFYA 3GJ0A 3I01M 4HT3B 3A9WA 4DLUA 2I54A 1GPDG 1MW9X 3I52A 4CZ2A 1FRVA 2DJ5A 1RP1A 2OL4A 1PJSA 3NAQA 4LEIA 4OYRA 4WRRA 2X86A 3CKMA 5BMVB 4FBGA 1KO5A 2O7SA 3R7WB 2FZ5A 1W46A 3LI2A 3WMWA 2I2FA 1JKMA 2OHXA 4L0MA 3GD5A 2WAMA 4XWYA 2R1TB 1J0CA 4B7AA 1NM5C 4JLSA 1AV7A 2VZ0A 4BEVA 1X9GA 1AQLA 1ZW1A 4POOA 3E18A 2VJAA 1JHUA 1I80A 3I09A 4BVHA 2XR1A 2W2PA 2RONA 3UJDA 4HGRA 2O8DB 3AL3A 4CTOA 3W6OA 1P77A 4B4VA 4IFBA 1JFRA 1CZHA 4V39A 4DLLA 2YXLA 4TKZA 5KNBH 2DETA 3ZDCA 2BGWA 4NZOA 3WHIA 4WFIA 4CMJA 3OY7A 4Y2HA 2Q3CA 2OBYA 1Y1SA 2F3QA 2XKBA 5HE8A 1L5KA 5BXQC 4MVJE 1YC2A 2HHAA 4FEYA 2WB2A 4HXYA 5AM5A 3ILHA 3QVLA 1BU8A 2HLHA 3UXYA 4M7OA 2ZRKA 2RIPA 3VHLB 4X7MA 2QQ0A 3O4VA 4FK8A 1OC2A 4XWWA 2R79A 5AK4A 1KDZA 2BTQA 4A6EA 3IAM6 5ALUA 1U9CA 5LQUA 3U4MA 1KYZA 4WN9B 1YB7A 3RHSA 3B9BA 3M6AA 1F8GA 5KKNB 1ENYA 2MINB 4IIHA 4PHHA 1N5LA 3DG9A 1BDMA 4WHMA 3S0JA 3VTKA 5JEDA 2QDKA 4MPTA 3C5WP 2P4HX 2QNIA 5H0IA 2HT6A 4MLZA 5K0ZA 1Q1BA 2Y1LA 2EQAA 1UJBA 3GGPA 3JQAB 4U6NA 2HB6A 5C18A 1UKBA 1WUTA 4MS1B 2J5QA 3GJ6A 1MGPA 1FSFA 4HI0E 4TPKA 2FF5A 2YJGA 3GA5A 4YP9A 3OM9A 4LKRA 4C6TB 3PF9A 3U5TA 3MUFA 4RF4A 1ZUNB 1OBVA 4NTZA 1TEVA 1V1RA 4ONEA 3W5IA 4Q3CA 1CUCA 3UAXA 4D02A 4Y6OA 3R0XA 3EA4A 3I4LA 1JKJB 3N07A 1J56A 4GU5A 3KUDA 4JROA 4CNQA 3LTNC 2BTOA 1BCRB 5G41A 1W19A 2QXYA 3PTLA 1Z5VA 2VC2B 4RX1A 2R6DA 3WO1A 3ZE1B 4RTSA 3ISJA 3P9CA 2NZWA 2LDXA 1L5HA 1DKPA 3W4IA 3F6BX 2C5HA 4XVHA 1WU8A 3UYLA 1NA5A 1OU4A 1PAUA 2CC2A 2YBDA 4QWMA 3PFKA 5GV8A 2IH4A 1U2DA 2A9JA 3ETHA 4FE7A 4WOPA 1O6GA 3OJXA 2V74B 1YV9A 3L18A 5LCXA 3RYHB 4NBSA 1JV2B 3LZ6A 1XVVA 4BQPA 1X92A 2CVHA 1WDWB 4R71A 2BBTA 3E8XA 4PINA 1I4WA 2WZCA 3K6KA 1CJVC 2ZYWX 3TEFA 3T94A 4ILKA 5F7OA 4DHWA 3UHOA 3FVTA 1WEHA 3NHFA 1BWQA 1X9IA 1XCBA 2GF9A 3CLUC 3KS9A 4NEHB 3RGGA 5FWYA 4ZOLF 2Z0MA 1RABA 3LPCA 3HO8A 1ZVMA 4N7MA 1Q22A 4V0NA 5C1BA 2HL6A 3EC7A 2PVSA 4KHPB 4WEQA 3ZU6A 1D0IA 4JEMA 3UJ9A 3A32A 3WLSA 1QANA 4C14A 3OEEA 3UT6A 4QJ3A 4RY0A 5DT9A 3PEWA 3C1TA 2IYVA 7ABPA 4NABA 3PEEA 2ZTHA 1Y34E 1C1XB 2EL7A 4M7PA 4MO9A 1F3LA 1GYQA 4E21A 1KI1A 4RTNA 3ETEA 3ITEA 1L9KA 3VZBA 4TXMA 2ZI9A 1XZMA 2IL1A 1U0TA 1YCGA 3KKEA 1GQSA 2I2DA 3MT7A 4ZT5A 2IUUA 1MO2A 3WMEA 1JSZA 3R9KA 2YL2A 1KJYA 1UZMA 3HDYA 3TUZC 3LVRE 3OZFA 3PC8A 1BMFD 2BUAA 2V5AA 4G84A 1SOWA 4DSNA 5JHGB 4M83A 3T1VA 2V7BA 3AF6A 4YR7A 2AOVA 4N18A 3P0IA 2ZDHA 2AC4A 2L69A 4HFMA 1FNSA 1R4ZA 3RANA 3VTAA 1Q17A 2IW1A 2IYQA 3SE7A 3SX4A 3BCSA 4GC9A 3MCZA 4UMFA 4C0SA 3SPXA 1XPOA 3G68A 3I3SR 3O38A 3UFXB 5GJBA 3E8MA 1XHFA 2CMHA 2XOXA 3AUKA 3LRTA 4FGLA 4C88A 1QGUB 2JFNA 2Y92A 3GRAA 2DECA 4NS1A 3ELUA 3L1IA 3AB7A 2XJ9A 1Z33A 2REQA 3LLSA 3P0RA 1ZONA 3DCNA 5AWFC 3FYHA 3X1XA 5JD5A 2NO9A 1EVIA 1NRIA 5TT1A 5AXAA 4KGXA 2ONJA 3EEYA 1SVWA 1ZRSA 3NEAA 4K3VA 2FUKA 4UFNA 5HILA 4AC9A 2O8FA 2P9TA 4MLPA 4AUNA 3F7MA 3LWBA 1A8UA 2CFOA 3JAWB 3HYSA 1RM3A 3EGEA 3VGPA 5I7UA 1Z38A 1EWRA 4UNRA 1BMDA 4HNUA 2PUJA 4L3WA 4N40A 2QTMA 1Z5ZA 3K32A 2NV2B 4H6VA 2QAGC 5K2OA 1DEXA 5J5CA 2PZLA 2FRDC 3DHNA 1O7JA 3ASYA 2Q7OE 4AMGA 3ED5A 1SG6A 3U5ZB 1QK5A 1UBGA 2Q0QA 3D7NA 4CUZA 4QVGA 1VKHA 3HNPA 3SWWA 2HSEA 3JD3A 1ZL0A 1IY1A 2ZBRA 3B3QA 5D5PA 5CHYA 2FETA 1PN3A 1PS9A 5FHRA 4C22A 4Z4HA 2Z2ZA 4X00A 1T8YA 3NHWA 4NV0A 5C5IA 1BZYA 2I7DA 2NO4A 4IIUA 1YR1A 5BYKA 4GLLA 3PGA1 1QGED 2R96A 5CB8A 3R0QA 1CVIA 2DWCA 3DOOA 1BXRB 2EWWA 3W9UA 1K6JA 3FDZB 1GL7A 4PHTA 4J94A 3ZQUA 5IVPA 2YH2A 2ZYRA 2HNKA 1LDBA 4N0QA 1Z74A 4A0SA 1HDYA 1JDZA 1FDUA 1QMGA 1CETA 2CWDA 1T3GA 4YRJA 5BWMA 1DXYA 4Q9HA 4D9NA 3A8TA 2I1QA 4MGZR 1VMDA 3AG6A 4JEUA 4JT8A 4CUJA 2P1RA 4RHEA 5K8CA 2WHEA 4CM7A 3VJMA 4M1OA 4A0GA 3GLFA 2IWRA 4RHFA 5HP4A 1MKYA 2N1MA 3PNVA 2FSHA 2C4KA 4O2BF 3U1BA 4LXIA 2GT1A 3DO8A 4GR9A 1LX7A 2P8JA 1YRBA 3H99A 1D2CA 1AM4D 3G2JA 4DS3A 4DDTA 4X1KB 4EATA 3NBZC 3AJ9A 1B00A 1QZZA 4Z7OB 4DCOA 1I6MA 4V24A 4S1WA 1CB7A 1YASA 1DIAA 4RE5A 1K0FA 4YALA 5A7GA 2HA5A 3WWZA 2ZYIA 5CHEA 5A3SA 4B79A 4C4AA 1I32A 2B78A 3TXXA 3BSSA 3CZ4A 3MPUA 4KI0A 2ANCA 1B43A 3ZR4B 1W93A 3NETA 3ZWPA 5ADHA 5CVCA 1U1EA 2QPLA 2GYYA 5HEKA 3IVMA 4ZN6A 1P81A 1H8HD 3LUJA 4FIDA 2CJFA 3IMCA 4XWAA 2CYAA 3ZYCA 4ZAVA 4EGSA 2QMHA 4CMIB 2QX7A 1YFLA 4Z9YA 3TNJA 3HFRA 2CEAA 2OQIA 4N47A 3K0KA 1TC1A 1G2OA 3BWBA 2RGEA 3K2BA 2QTGA 3AI7A 4QUKA 5B1YA 1VSVA 4JI5B 1VSUA 4EFNA 4FZ3A 4CDGA 1UAGA 2J5RA 1F0YA 2V45A 1UK6A 1Y8RB 3HMKA 4O4HA 5J4KA 4B2YA 7MDHA 2HPHA 1PR9A 3CB4A 5KTRA 2FJPA 3E7FA 3HNOA 3PP8A 3VHRA 1KQOA 3TLZA 5GM2A 1CEYA 5EXEA 4WOBA 3KELA 1X39A 3A4TA 3VNAA 1PGNA 1Y7LA 2ADFA 1Q6ZA 3EIUA 3GZNA 4M87A 4N3GA 3DMDA 1E2QA 4LYFA 2QW1A 3D4PA 4L22A 5DCWA 4G1UC 3PUVA 2ZAGA 5BQ3A 2FZCA 2K5UA 1H9AA 4C0XA 5IYZA 1UM8A 1AQNA 4GW3A 3DMPA 4C4OA 1T3LA 1AQYA 3IQDB 2Y1GA 3NHPA 4AKHA 5JY6A 3P9NA 1CZUA 1TIBA 2FW8A 4XEUA 3EG9A 4WQMA 1DC7A 1ADYA 3D6VA 4LGCA 1F1BA 1K5GA 3D6FA 3NZEA 4NK4A 3S1AB 2PSEA 4RVSA 1C8VB 3DW1X 1JFSA 3PITA 3AYXB 1PJ8A 1GDDA 1YJ5A 2YOFA 2C5LA 4Q6WA 4GZ5A 5I5GA 2A5JA 1LC0A 1CZRA 1QBGA 1T35A 3MYRA 5IC6A 2N9UA 4YX9A 1J99A 3KT8A 4IIJB 4E5KA 1RR6A 2GD2A 2HJSA 2P4UA 4G4SO 5TMBA 2DC1A 1NVGA 1UC9A 4DN6A 4XLLA 2V6BA 1SAYA 2AG8A 3JQEA 4XIYA 2R68A 4DG8A 2HUNA 4R0MA 1N8SA 4ZJUA 5HXAA 1SOMA 1NZJA 1MV8A 2HCBA 4BVJA 5J23A 2EGUA 1XMXA 2HHHB 3WIEA 2O06A 3TUJC 3UHAA 4CLRB 3QVWA 4R7GA 1WSAA 2AN9A 5ALTA 1XA3A 3OU2A 4MW4A 3RIEA 3HL0A 5KVCA 4PQRA 3JZDA 3LBNA 3QI7A 3ZPXA 3VNBA 1UMDA 2VNKA 4HGQA 4ND7A 1G21B 3KJNA 4M1SA 4YCAA 4BEJA 2C9YA 2QRZA 2XGSA 4Q4AA 2P4SA 4R3NA 3NHBA 4KPFC 1T4CA 2JIPA 2OFPA 3PWSA 5FI3A 3CR7A 4JQSA 1HNNA 4G3XA 2AW5A 4PAOA 1ZUWA 2C98A 3ETLA 4JHXA 2VSOA 3BMXA 3V8EA 4D80A 2ISQA 3R9XA 4TKUB 5E1MA 3OPNA 3NLLA 4ID9A 3TLJA 1RE1A 4EJSA 1ZOIA 4YO8A 1AHHA 3DPUA 4F46A 2HR1A 1LS6A 2CLIB 4N0EA 1IUOA 3WMRA 1H1DA 3NHYA 3WWYA 2NYRA 3BDVA 3R6TA 3DULA 2ODQA 3GYGA 2OO5A 1G0NA 4YMUA 5CITA 2GMWA 1MAVA 4PX3A 1Z0KA 5L53A 2E1RA 4PRKA 4BWVA 4RA9A 4GVPA 1ADGA 1ZMBA 2A7XA 4GM0A 3FGZA 6GPBA 1PT6A 1B1AA 2ENWA 9ATCA 1NW7A 1CP3A 3SHQA 5B1IA 2CYCA 4B0OA 4XQ0A 1TKAA 1Z68A 1DAOA 5LP6C 2AI2A 2LVBA 4H4EA 4LS3A 1G8FA 3GNLA 3U60B 2JW5A 4BFTA 2IA5A 1V48A 2MSWA 1IM2A 3N2YA 3GG2A 2Y6UA 2DR2A 4BE9A 1K6XA 3RQIA 1QOPB 1K5HA 3AHCA 3GLRA 3H5OA 3SHFA 3U7QB 2H7XA 2BMWA 2O2HA 1SCUB 4TMWA 4P86A 5AO9A 5H80A 2LW7A 4QYIA 1LLDA 1NVBA 1C7ZA 5CPBA 5AXBA 5ANRB 4UOEA 1I6WA 4YQFA 2TSYB 5C81A 3LOPA 3EDQA 2CB0A 3E22A 2JFQA 1EU1A 1P2GA 4JJIA 5ETJA 3AESB 5E6RB 1TJ4A 2TRSB 2PU7A 2NU9B 1RYMA 4P5PA 2GN0A 3OKCA 5JO9A 3WJ1A 3NC4A 4RQBA 4KPGA 3DFUA 2PY6A 2QZSA 1BO6A 2UVQA 1GPWB 1A9TA 4X95A 5EUBA 3PQ6A 1JSCA 3ZDBA 2CN1A 2NGRA 1CYDA 2JD0A 1ULAA 4XVRA 1C8LA 3OSUA 2NTVA 2NW6A 2O1XA 2GNOA 4NEQA 3X2FA 1H93A 1MQ8B 1N5KA 2BONA 2YXBA 1PLJA 3ORSA 4RHUA 1JFTA 3VU3A 1S96A 2FXVA 3GUCA 5DK6A 3ZKAA 4DV3B 2M6SA 3K6SA 1MN6A 1XQXA 5DULA 4MRMA 4Y2JA 2WZQA 3EXEB 3OT1B 4MV1A 5BQ5A 3VU0A 1JECA 3BXEA 4J03A 1JIIA 1OBOA 2FEWB 3QBDA 3N87A 5TQ2B 4OI4A 2P3SA 3TQIA 1P7CA 2PX2A 3ZDXB 4FHEA 3TLAA 1DC6A 1R6UA 2GSWA 1XXHB 1SBTA 4DCUA 1EAMA 4ZYZA 5LU9A 4KVZA 3BE4A 2B8TA 5E2BA 1R8QA 5GIPE 4MUGA 1PQPA 3E48A 3AFHA 2VBFA 2ZOSA 2P2ZA 3LWZA 1GPKA 2O0MA 3X2SA 4EG8A 3O94A 4ETIA 4MICA 1Y98A 3DAPA 1VPLA 2WWVD 1WHSB 2AD1A 1BS2A 1XUOA 2JIRA 2O2SA 2X77A 3EQ9A 2RK6A 2XMPA 2IEGA 3N59A 3ORQA 3ZCTA 1H0SA 1TPZA 1XXHA 3EEIA 4M7RA 3WLLA 3ETDA 3C70A 3BS4A 4F3KA 3GR6A 3F4KA 4IMRA 2ZIWB 1PZXA 2ECPA 2VQ3A 4PLWA 5JS7A 1LI7A 4X61A 1JTEA 2IBTA 2QSZA 3PI6A 1E4VA 3K8OE 4KPEC 4D6YA 1KK2A 3F74A 4QUBA 2VYQA 5LQDA 3V8MA 1CR4A 2JRCA 4ESVA 3S5JA 1ORHA 1NXSA 1ZGCA 3PPXA 4FHZA 3BJZA 3UC9A 3UEOA 6PFKA 2GPBA 2VUUA 1FA9A 3KB6A 1XDGA 2Z2YA 1XIVA 3GJ5A 1W30A 3B1WA 2WD9A 1G8GA 1L7XA 3LVBA 4OGKA 4U5XA 2QVBA 2NVBA 3FZNA 1JT9A 5IKEA 4GEKA 4HEJA 3LCUA 3WE7A 1N6HA 3K1AB 4KZKA 1E2MA 4OHVA 4WNCA 1MV5A 3KEQA 1KOGA 1X6VA 1SC4A 2ZB7A 5K3FA 3GLHE 3ZVNA 2HC9A 2Q6TA 4WCDA 5DYTA 2V58A 5IM4A 2PZ8A 5COBA 4W9MC 3HWX1 1EQAA 1OOEA 4LFCB 2Y9MB 1HFEL 5JBQA 1MRSA 3D5QA 3L41A 1OWOA 2I6FA 1I14A 3H0CA 4CETA 2ZAYA 1SKYB 2IFTA 3FCCA 4M55A 2XCTB 2UXBB 3IEUA 2FLKA 2H2WA 1Q1NA 3ZHZA 4WXPA 1EFHA 1F14A 2EJWA 4L7QA 1T8WA 2C3YA 1MZVA 3MYYA 4GLOA 2C8VA 2YJ4A 1U11A 4J16A 5T6MA 3HU2A 2ZROA 2WAOA 5A3RA 4UEKA 4FEGA 1RIFA 5IUKC 3VKGA 4L4RA 2QN9A 4HDNA 2PL1A 2ES4A 3LH5A 3SHTA 4EAAA 3K0BA 3UK0A 1TLLA 2I3ZA 4G86A 2QYTA 2FSVA 5AESA 2I67A 3K4HA 2AG6A 1MEJA 2EC5A 2VTDA 3DOFA 3F2VA 5EJ9A 2I91A 5EFZA 3ZWDA 4F85A 3F9RA 3ZDDA 1E3LA 3A06A 1HYQA 3OBBA 3ENWA 2H54A 4HQLA 4BO4A 2ONKA 4NY1A 3TSCA 1BJTA 3EE6A 4MRRA 1JF8A 1XXLA 2O0KA 3WLJA 4JIGA 1OW3B 4Z2YA 2GB4A 3A4NA 4EDFA 1KYXA 4LVNA 2VZEA 3TUIC 1QCDA 4E2YA 4LVUA 1C9DB 5C8DA 2VAXA 1UIRA 3FKQA 4XX1A 4EG5A 4OUDB 3O3MB 2OY0A 1X86B 3KJQA 2AK3A 2IRWA 3L8HA 1G63A 4W5HA 3TNDA 1VIDA 6CHYA 2X0IA 3PX2A 1E4YA 1UMBA 3QVGB 1YL7A 2Q3EA 3KEOA 1T26A 5E38A 1E6LA 3SYMA 3HYCA 1BFDA 3RJ9A 5HDBB 1KY5A 4JMPA 4WUVA 4DARA 1R8XA 1IBCA 2BZSA 3L5OA 4FGZA 4AKGA 1WD5A 4GMDA 2IC5A 4MO2A 4MUBA 3W6UA 4M1KA 5BUQA 5DGTA 2N1BA 4X41A 1II0A 5SYMA 4J91A 4LF6B 4QD3A 1PL0A 2PQ0A 3SYKA 2P9BA 5DPMA 3RJ5A 4B35A 1PE0A 1VHQA 1LV7A 4IIXA 3UJPA 4DY6A 3BBLA 3O3CA 1LBSA 3OC0A 4R1TA 2JFYA 1ZD1A 4XGKA 1SU7A 1ZHHA 4FOTA 5DMXA 5GQSA 1FFEA 4GR5A 1S3GA 2BJHA 4JCCA 5K3BA 1X15A 2RGBA 2UU9B 2C03A 4EELA 4ZGGA 4X6YA 4XEHA 5DMHA 5TRTA 4PNEA 3ZEIA 5CFRA 4UE2A 5IXJA 1NJ6A 4MS3B 2BMEA 2AKAB 1PFKA 3KPJA 4BGUA 3W3AH 1J2RA 1JKIA 1P6XA 2WYWA 3E9YA 3H8VA 4XJXA 4PXSA 3RFVA 3S2ZA 1L5SA 4DCMA 1ZH8A 5E7MA 1WXQA 4YRFA 5IEBA 3SZOA 3U26A 2Q8NA 3ROQA 1U8UA 4O2AA 3G0CA 1OYVA 5KX5B 2P2SA 2Z3VA 3SIXA 3T7SA 3VU8A 4C4ZA 4DKXA 3I2KA 4QQKA 1FFXB 2NACA 4JA0A 4UDNA 5FXMA 3LO5A 3Q98A 1QIJA 5DHFA 3ICEA 3UXMA 5KTYA 2WVGA 1Z39A 2Q2QA 1C2YA 2PGLA 1FP2A 3O2NA 2VJCA 5TNXA 2WHPB 2H92A 4HQRA 4DT1B 3K9BA 5HX7A 2XGMA 4QU8A 3IKMB 1XDSA 2ZK7A 3V32A 5BV2P 1XB2A 4LYHA 3PGXA 3OU6A 4Z9AA 3DSRA 4KKVA 2BKAA 4P3PA 4PAMA 3FGNA 3C6BA 2PLAA 3PJFA 4QUHA 2PL5A 4DLBA 1I5OA 1C3VA 1AZLA 2PH7A 3MC1A 4LV8B 1HL7A 4O4JF 5AQEA 2B92A 3SEQA 2OCIA 3KQSA 3QYAA 3V6LA 3GUZA 1CRLA 3PS9A 2I5PO 5LL6P 1AUXA 1X1RA 3IBGA 4MQ5A 3VR6A 1HDCA 2MYNA 2X5XA 3EPPA 2ZXUA 4JJEA 3RD5A 4Q48A 2Q5LA 1EDZA 3K09C 5CT9A 1H4QA 2JFZA 3RVPA 3X44A 4BIIA 2AE2A 2ZTVA 3OQNA 2GASA 4D9BA 4KLCA 3SLGA 5C1OA 2HGZA 3I5AA 1E6CA 1XTVA 2D4AA 2ID8A 3PNBA 3T7CA 1D6SA 3M4XA 3ZD9A 4AJPA 4EX6A 4YRSA 3T7TA 2GPJA 5DM2A 4IXWA 1IMOA 1YDMA 2H51A 4BYMA 1P45A 1FJ2A 3I9V6 5IKMA 1T5IA 1QK4A 2W4MA 1NAIA 1U5BB 3AF0A 4F2HA 2J9FA 1HTTA 4HH3C 5GONB 3SLKA 4YONB 5HJ5A 3TFQA 4QFDA 5CDHA 3HVKA 3JV7A 4PRYA 4R69A 1M8KA 1TVEA 3E5HA 1YVDA 3OQ1A 2OKCA 3ECCA 1K0UA 1ZSVA 2AJCA 2FPUA 3RSGA 3A1CA 5LYJA 2AZMA 4M8IA 2W9XA 2R1UA 3Q9NA 2XBMA 2P6OA 4ITRC 4NCNA 2I3BA 2P90A 3IAEA 4PZ0A 1KOJA 1WM1A 2DG2A 2F59A 3N0TA 4Z8YA 1EDBA 1J1ZA 3A6KA 4DR5B 1BDJA 4YLGA 1XLWA 1N1MA 2I76A 3OA2A 4QYXA 1BWPA 2FTKE 3HGQA 5AK5A 2WY2D 3E1SA 3PXEA 1AS2A 2ZXEA 3TTYA 2H2DA 1SWVA 2QJWA 5JTTA 3P9RA 1IJBA 2QL9A 1D1QA 3EVFA 5AJHA 3KBOA 4ARBA 1QNFA 2HEGA 2J9XB 1YS4A 3EHEA 1MENA 2E0IA 5F2OA 2OWEA 1KOLA 4BMDA 5LKAA 2B7LA 1CJSA 1QKIA 1KJ8A 4W1QA 3W0LB 1L5LA 4Z54A 3IEPA 5D3KA 5BR1A 3QKSA 4PS1A 4ZALA 4IDPA 2DBZA 2LR0A 1OX5A 5JZSA 3AZPA 5H8WA 1YF3A 4CKBB 3PGMA 1ONSA 5F9HA 2B2NA 1P4AA 3BEOA 4YRLA 1ECCA 3NH9A 1BVYF 2ZU6A 3V8BA 1W25A 1DKLA 3ZV6A 2YS7A 4OK3A 2HZ7A 3K9LA 1OASA 1Y7IA 1WW3A 2TMYA 4WJLA 1FU8A 1F48A 2MHCA 1U8FO 1JFFA 4EOGA 2OXTA 3WLHA 1P17A 3QJGA 4ML3A 4Q9LA 3F3YA 3QLJA 4HPWA 1O9GA 5A4JA 4MCIA 1R9JA 2LGJA 1XX6A 3KSRA 4FYPA 4QQRA 5KTSA 3L4JA 2FK8A 1UKYA 1QNLA 3B3FA 3NAMA 3HKBB 3PHCA 3I2IA 2C84A 1KZ7B 2VUHB 1PL8A 3JZIA 4FBMA 4NL4H 5D3ZA 4EW1A 3OIFA 3OTOB 1JDPA 1VJ5A 1Y9DA 1Z6YA 2PH5A 1NBME 2MSCB 1UOEA 4M9RA 2CF6A 3OCYA 1RHKA 2DY1A 1FL9A 5IJZA 5CCXA 2AQHA 3FYCA 4KRYA 2MSKA 1T5HX 3W2FA 3A0UA 1W581 2QP9X 2YFQA 4S2UA 4KOEC 3I2JA 1NNEA 5H4GA 2WM9B 4PLTA 1WBBA 2DUJA 3IPXA 4LK3A 4TVSA 3SX2A 3RUAA 4LXXA 3UAZA 4B3GA 1HBJA 3N5KA 2QRPA 4EHHA 2HRZA 2C54A 4XXHA 5EHZA 5DLEA 1N1DA 2G06A 5C3MA 3VHXA 3QU9A 1USVA 2P9FA 1MVOA 3EQ2A 4G26A 4NICA 4RM2A 2QV0A 2D7DA 2PKCA 1KBOA 4AZ3A 2BBSA 3WKDA 3KE9A 5JNSA 4JKIA 4EQ6B 4MR8B 5EZYA 5JBNA 4BL5A 4BYGA 4GBGA 2R0QC 2KM1A 4HF7A 2NWQA 4JS0A 2QAGB 3W9SA 1KO7A 1QQ5A 1IN1A 1PGPA 4MJLA 2WQ7A 1XPJA 3FNBA 4ZC1A 1N5MA 3JQFA 3JYOA 2GI4A 3WLEA 5K3DA 4F12A 1R6VA 1SQGA 4LTNA 2XYPA 1W73A 2WIBA 3EVBA 3G5MA 4MRMB 3UA4A 1SURA 4B8WA 1BH2A 2YY5A 3FNIA 1IBLB 5K6AC 5DP2A 5TT0A 2EFGA 2Z1DA 3Q7EA 3VPBA 5BSMA 3VZRA 3QOXA 1SXQA 3EVCA 3G6WA 3V4PB 1SXJA 1YI8A 5HM8A 2BC9A 4MWZA 2GYWA 2H0QA 1SKBA 4QUJA 3NG1A 1FS5A 2NNLD 1SOUA 3HQ4O 5AW9A 3U6BA 3E7PA 2XMBA 3CJTA 1RIIA 4I8IA 3BMOA 3KKLA 4MP6A 4IL5A 1FZTA 2BFBA 1ZICA 2X6RA 3CSSA 3QVKA 1DOAA 1YKFA 3D3KA 4U9HS 4NCXA 5ALYA 3FMVA 5IYZF 1V9SA 2O3TA 3VKWA 1O4WA 3WGKA 3NJ8A 3DVSX 3JYPA 4FFLA 1H1LA 3WZMA 3F6EX 2B4AA 2JAXA 1II8B 1PR3A 1XQWA 3CV3A 1M0SA 1R0RE 1YJBA 1U0GA 2PWPA 3FLMA 3PYLA 1YD7A 4HLQB 4P4LA 1JHXA 1JIJA 1NVTA 3PQDA 1YI0A 3S2EA 2DQYA 3PFFA 4FGSA 2HSGA 3T5BA 3E9NA 3KQKA 4K28A 2RJOA 3MTIA 2EBHX 2M1XA 3EFBA 4JITA 5HF9A 2CNNA 1YR9A 4OSPA 1SMKA 2G9VA 3S55A 4L4UA 1BA2A 4V1CI 1ORTA 4FMCB 4MYSA 1PGQA 2I29A 5ADVA 1LFDB 3H2ZA 3I8OA 4INOA 5A4IS 2BGJA 2GUWA 3QMWA 3PJGA 4UREA 2HHCA 3JQRA 1KYIA 3WMFA 4MDFA 1B7GO 2E4UA 2WA2A 1M34E 1Z3IX 3UKOA 4AKTA 5CVJA 3ICWA 3OIYA 2QKYA 4DIKA 2ZYVX 4FNAA 2HWKA 4HUTA 5KC9A 2DY0A 4Q21A 2G4CA 2HT1A 2YMQA 3PVZA 4DRXA 3A1NA 1ORWA 2WAAA 3QI2A 3EQ8A 4HADA 1JIKA 4JLMA 4QPJC 3W34A 4EITA 7REQA 1P91A 3GEEA 3NRJA 3GLVA 2QJTA 2F8LA 3THSA 3UXEA 2H4FA 2ODBA 3AI1A 2GCOB 4RIIA 4P93A 5DASA 1I7NA 4BNDA 1R12A 3FDXA 3UHJA 3V7WA 4D9MA 4FWTA 4PIVA 3LXMA 4UHCA 1EHCA 2AZDA 1BDIA 4JI0B 5BN3A 3KTFA 3FLEA 4YBZA 5T6BA 1RI2A 2B1JA 4HLDA 3WGGA 2OAEA 4PTYA 5C8YA 1MXHA 2Y71A 3TSYA 1XK7A 3EISA 3G23A 4ZKDA 2HPVA 3RS2A 1ZQ9A 3E7XA 1Q1EA 1NMYA 2FKNA 5DP1A 1J1UA 2Q46A 1QHXA 3A3KA 2NX2A 4O2BB 3B5EA 3UTCA 3GFGA 3CLVA 2A0YA 3WQRA 3GO4A 2IJGX 3N2IA 2A30A 2WUEA 5IX8A 3B9RA 3OQBA 1R5NA 4M1YA 5E4JA 1CNEA 1TJPB 1RRKA 1YAJA 1SRQA 3H1GA 1O87A 1PW5A 1UZAA 1J2EA 4MTCA 5I9MA 1JLLA 1P75A 3R3SA 4CKEA 3NM6B 4RV5A 4H1WA 3W9YA 2GM4A 1KFBB 3IAS6 3N8GA 2FHPA 4D1YA 1RVV1 4A8TA 2GAOA 2HN9A 3EH2A 4BNZA 1NDHA 3D4BA 1NZDA 1B6SA 2EATA 4P92A 4K9LA 4F6RB 5CDGA 4X6LA 3PXCX 5AXCA 2XDWA 2O4UX 4GLBA 4GX2A 3WRYA 5LUAA 2P5UA 3F6YA 4MVXA 5DXAA 4I46A 1DG9A 4YAJA 3TLXA 2BFDB 3TWOA 3ZGOA 1U7OA 2JH9A 2CLKB 3BQMB 4UXJA 1YGPA 4IXDA 2VP6A 1AX9A 1YB5A 1FVFA 1F3OA 4HVTA 3MTEA 4CEJA 2I6XA 1K86A 2XHEA 3R5KA 4J0JA 5BN4A 4ZVUA 1VPWA 1B8UA 5EP3A 2WP8J 2WSMA 4V0OA 5AD1A 1JWLA 2P2NA 1C7RA 1QM5A 2I65A 4CV3A 1FFYA 1U3CA 3I9V1 4ZVNA 4MR7B 1GNRA 3ROTA 2II6A 1SUCA 5BOSA 5MN5A 3LGAA 3COYA 5EINA 2ZJFA 2ZRDA 5CVVA 3P9QA 4N03A 1RM4A 3JYLA 2E9SA 3G8BA 3ZTTA 2B82A 5F52A 1GTRA 1D2HA 4C7BA 1D09A 4QPCA 2D1RA 4GQBA 3WIUA 1Y8ZA 2IS1A 3ZHCA 1Z9BA 4QBFA 4L5AA 2XBUA 1QGZA 3GGOA 2FFRA 2XF8A 4L3VA 1O2DA 1SELA 1YVRA 2HSDA 5I7EA 3OX3A 5T3UA 1H3NA 1MO4A 3CZCA 5KOJB 2VDUE 3VH3A 3VR3A 4MQLA 2MT9A 1ZK1A 3BJRA 3EVDA 5JDIC 1SNYA 1PT5A 3ONDA 4UATA 4Q7LA 3GLSA 4KR9A 4LRWA 4MPJA 1KAEA 5SZHB 1RPNA 3RDPA 2RGNA 1ZOPA 1RMTA 4I81A 3HKCA 1QYWA 3HXQA 2CNLA 2YWEA 1V8OA 2Q5FA 1WSWA 2FWBA 3WIOA 3PXDA 3PFBA 3GXOA 4H3HB 1P6UA 1US8B 1XJ0A 3ZDYB 1EP1B 5DCUA 5HSGA 1X8LA 2XSZD 3FVRA 2IPMA 3BWYA 3DMTC 4D9IA 2ZRAA 4R2MA 2GUGA 2OV6A 3LYUA 2GEVA 2J85A 2Q3HA 2H17A 3FPCA 1YL5A 3GBVA 3UMBA 4XVUA 3EFHA 4C6TA 2C9ZA 4HDSA 4Z99A 3VOTA 4EI8A 4AY2A 3IOYA 4V3CA 2GKSA 4A7PA 3M5CA 1Z7BA 4NBVA 1Q91A 2VXCA 3HR4A 3MMZA 4Y1FA 1KQPA 1UFQA 1VL8A 3UVEA 3IGFA 3IILA 3UJAA 2COEA 1QKKA 2IEBA 3RGWS 3ST7A 1C9EA 3WNBA 4GZ3A 2F3UA 4DV4B 4R9SA 2O8NA 3T3OA 3VYWA 4A0FA 4KBYA 4F21A 1EZZA 5JVDA 5L3QA 4Q93A 2XUAA 4BLSA 2FW6A 2X0JA 5JDCC 3S7TA 4AZ0B 3GGSA 5TR9A 1Z2CA 1BE8A 5CEFA 1M1NB 4C6HA 5DX8A 2JKZA 4E09A 1EDEA 1NE2A 3N8HA 2V7TA 3F6PA 4KQHA 5JYCA 2BFWA 1ZGZA 3HYRA 3RASA 3VZQA 2GRAA 1VHDA 4A8JC 3AMVA 3N74A 1LV8A 1U7UA 3DGFC 1HDXA 3GD7A 5K99A 1RWMA 3B38A 4N5HX 3T4XA 4DWOA 5DTEA 1U81A 5CA0A 4EYEA 2XZLA 1U0OC 2QT9A 2IBMA 1RLIA 2WC1A 4UD6A 5AIAA 4AY5A 2ZCJA 1QHIA 2A6PA 3F5MA 1EQ2A 1Z83A 1TKRA 1Z63A 1GOTA 1JEQB 4IJ6A 3ZD7A 1VHLA 3QTLA 1KQ3A 5ILQA 3PD1A 3BF8A 4LK2A 3BORA 5FJIA 2RK3A 2AMYA 1M6HA 2IU6A 2O2JA 5A3JA 3UMCA 5MF6A 1Z4MA 3F1KA 4ZVVA 4QWWA 4ND1A 4ATNA 5U1PA 3V7FA 1UXIA 3TQQA 3DBHB 2PR7A 4YNBA 4AXXA 1IXYA 2VTEA 1QTRA 5DKFA 2PZGA 4IGEA 1QCZA 2Y0PA 1T15A 3EUFA 1WOMA 3PQ7A 1EJBA 3ASZA 3N2KA 1NNUA 5BVGB 3AF1A 5KKCA 1KQGA 2OXCA 4AJ2A 3LC2O 4OJNA 3FOAA 4IJMA 1Y4AE 3CZPA 1L5FA 4JR0A 1YB2A 2NAPA 5BVHA 1AHNA 4M1EA 4IH9A 3A1UA 3LLCA 2QD4A 4NJMB 1U0RA 1NW8A 2ZUTA 4BU1A 3I72A 3KJXA 2EFHB 3OFSA 4HWPA 3Q7PA 3NDJA 4YWJA 1CS0B 1KS9A 1T2AA 4LDAA 3KUUA 1Y7TA 2BIFA 3DL2A 1UBMS 1WLSA 5GONF 3W8NA 4F60A 1KEKA 1ECBA 3EGXB 4TROA 1P2TA 1FMFA 5IK2D 5IK2A 5C32A 4BNGA 2I55A 1ZD3A 2P2DA 2PSFA 4NZYA 5E8RA 1OH8A 2HRRA 2V54A 4WCFB 4ZO7A 4TLAA 2HMWA 2JVJA 3BA6A 4CL2A 3WBFA 2H48A 3W2GA 4YLEA 4EKNB 3S6JA 1M6EX 4URYR 1AA9A 1G16A 1SD2A 2DLNA 2I3GA 2GPSA 2QRVB 2SBTA 2JD2A 4WDRA 1BE0A 5CFOA 3DTNA 3WS7A 4RFSB 4BLRA 3THWA 1JHRA 2ZI7A 3U3JA 3AIMA 1JB9A 2E5FA 1XRQA 2X1HA 2JHPA 2O57A 3CO0S 3DV0B 3HGTA 3LFHA 3VKUA 4F45A 1QLJA 5I3CA 3L4KA 4G5HA 4B3FX 2PX5A 4S05A 2QSJA 1HFJA 1RYZA 4HZIA 4MLCA 4X1YB 4N41A 3EMVA 3K8ZA 4O4LB 1GADO 2JGMA 3OECA 1U8EA 1O95A 3KKOA 4N0PA 3OCUA 3AY6A 2IOFK 1GQ2A 1QP8A 4JNCA 4PYNA 1YQGA 3JRXA 2JIBA 3IV7A 4JU9A 4TOIA 2OGWA 2W6CX 1B8VA 3OC6A 1JR3A 1UMCB 2D06A 2WIJA 3GHYA 1RNLA 3GC6A 3KYCB 1B8NA 4JLJA 4GC5A 5SICE 1TRKA 1GV0A 2XGOA 3KLMX 4M0FA 4X90A 4D46A 2Z4TA 3BFVA 3MS7A 1GPMA 1KI6B 1U2TA 2ZTUA 2HHJA 4KQFA 4ALJA 5TPWA 4Y2UA 3RV3A 1U5BA 1RACA 2O1EA 4NENB 4Q4LA 3ILYA 4RVFA 4TTAA 5LC1A 5T3YA 4UHJA 1D1TA 2WVJA 3O47A 1H8ED 1E9BA 2J67A 4HQFA 4TTVA 4KDEA 3TSWA 4EKGA 4YPOA 1DOHA 3D7LA 4CM9A 4EG1A 3LUCA 3L7CA 1F0PA 1SM4A 4BNWA 3UMRA 5A9RA 3ZDAA 2H5JA 1C8BA 3SIRA 2R4QA 3K05A 1SU4A 3HH8A 1PQWA 3HUTA 4HX5A 3U1TA 5B30A 3I5MA 5EIXA 3NBXX 4HQKA 4KRXA 4F0JA 3TVTA 2Q4OA 2EBUA 1CUGA 4HNHA 1Y3FE 2EBWA 3ECAA 3KHSA 2H85A 1Z0IA 3QEOA 3Q11A 4RCZA 2O3JA 1CE8B 3BSYA 4Q3BA 4X8OA 5DTJA 2POCA 2VHUA 4CU5A 4Y1RA 1H22A 2ZIZA 3IVXA 3MINA 3OJFA 3LK6A 3SEFA 4KPYA 3KYDB 3VUEA 1UT5A 1YQ9A 1U9YA 2E49A 3H3XA 3OPXA 2IYZA 4JLUA 2XSZA 5DGHA 1JEQA 4Z1MA 1KI8A 9MHTA 1NJFA 3R7SA 3G6KA 2RGXA 2XODA 4NV1A 4Y6GB 4BEBA 5IXYA 3AUFA 3JQ9C 1Z2OX 1MA3A 4YCLA 2H52A 3UT0A 1FQJA 1UINA 2DUUA 4B32A 4H1HA 5CX1A 2YWGA 3H2IA 4OHFA 5CXQA 4MPDA 1BRMA 2ZRPA 1GA4A 4FLMA 4ZGWA 4ZQFA 1ZK3A 1E3IA 1IFXA 5BRNA 1ZK4A 2DT5A 1AKUA 2XE6A 4FD3A 3PRKE 1QG2A 1ONOA 4OYLA 1DTSA 3ITKA 4ND8A 4R2IA 5KVQA 4INAA 4UBLA 5SY4A 4EB8A 3BILA 1JKJA 1IBKB 4F96A 1FDOA 2C42A 3JW8A 3Q7IA 2YX1A 4F9TA 3GEDA 1YRHA 1C9KA 3OQIB 4FINA 1O6CA 1LPAB 1U3VA 2XUIA 3M9LA 4IJWA 4K3UA 4MLDA 1QIEA 2FZGA 2WSSA 4MYRA 4Y8VA 1Z35A 1T4MA 5FPQA 4LZPA 4ZD6A 1H8HA 2PYDA 3KSUA 2AC7A 4PR0A 1B8PA 4HDRB 1NVEA 3BIJA 1I7SB 3LYHA 5HKBA 4D97A 2H1LA 1D07A 1MVLA 2QR2A 3M70A 3TM5A 1FDWA 3ESRA 3ANTA 3V4VB 1HDEA 1DCTA 2CF5A 2OZVA 2DX7A 2QLNA 2V8OA 2RAUA 1KH3A 2Y1FA 3MWDB 3G7NA 3ODPA 2Y6VA 3OZCA 1C2TA 2DPHA 2RHJA 4MA5A 2HCJB 2D0IA 4Z8XA 5A6VA 5CEEA 3HRHA 3JRNA 4BKMA 1N0VC 1OBCA 2ZRIA 2VK4A 3D2LA 5FX2A 2Q9CA 2XMQA 2Z5LA 4GI1A 5BPFA 3GFTA 4IRUB 1QIHA 3IPYA 3KDSE 4BPBA 4AKEA 4C4YA 2WTUA 2PUDA 1KIFA 5DWQA 3HDJA 5HF5A 3MHTA 3G0HA 2VBCA 4JBGA 1G19A 1JHDA 1R27A 4O0MA 2IHYA 5DRTA 3TIFA 2ODEA 4PGMA 2I9KA 1QQBA 4PZCA 2QM3A 4RGVA 5K0SA 1ZM3A 3ML1A 3NC0C 1IOVA 4FFWA 4AJOA 3HV2A 5IABA 1XU7A 4NSNA 4V0KA 4FR0A 3P2JA 3ND6A 3O8NA 4XA8A 4G07A 4EJ2A 1ICEA 2CHQA 1AMNA 1X1CA 2JFHA 1ODFA 3NIGB 4MUFA 4EHFA 4F8EA 3EUEA 4UPEA 1TCVA 5HYVA 3F1LA 3HP4A 4TXNA 4DYHA 2ZP1A 2PRIA 1FYVA 3IPCA 5HM6A 3DZDA 3FN4A 2HFJA 4AN0A 3MAGA 3NFYA 5K01A 4CUKA 5FT9A 3D6HA 1R00A 3OEED 3PXGA 5KTKA 2YS6A 1EFTA 4PYJA 1SZCA 3NFRA 4F4IA 5AVRA 4GPEA 1G0OA 1V5EA 3OWOA 4BZWA 1P2BA 1IBMB 3LT4A 3CZRA 3UNXA 1LSJA 1Q7CA 1JYSA 4AU1A 4A03A 3TIXB 3IEVA 4E22A 1H2AS 3G0OA 2JJYA 1GLVA 4DA0A 3RH0A 3A4VA 1SQSA 4IW3B 2X58A 3H8SA 3MTBA 5EMNA 4EG6A 2QT1A 2JFOA 5CB0A 2WE8A 2FWAA 4BVEA 3R6WA 4DZRA 2IH2A 1Y3DE 1P5HA 3PQEA 5EGNA 5HOEA 1E6UA 1PUIA 2GOYA 2FPLA 5AM3A 2H2GA 4MS4A 3RU3A 1YE5A 1WPXA 1NN0A 2PD4A 2VF5X 3FETA 3C0KA 4JVSB 4PG4A 5GGXA 4EFLA 3K5HA 4OH1A 1RM0A 5FI5A 4PCAA 2BGTA 1RYYA 1JHOA 2NUAA 4RORA 4BQIA 3GVXA 3IHWA 1XDZA 4DNXA 3IAM1 2YCBA 2AKYA 4G5FA 4LAFA 4HY3A 1S2MA 2YIMA 3E9DA 4HRYA 4Z5XA 1SB9A 4Z4QA 1I0IA 1G7RA 2FMXA 2ZUWA 3A9CA 5IEJA 1QVZA 4I7EA 5C35A 2VHEA 3TKAA 5M2QA 4G1EB 4WV3A 4IJQA 1XU4A 3WB0A 2PSJA 1GEEA 2HOQA 3EXG2 1X7XA 1YZTA 2G4LA 2HLNA 3OZVA 3C8HA 2D5LA 3PE3A 4JU8A 4R05A 2HPZA 2BKEA 2OENG 2UYOA 3WGQA 4EHAA 1ZI6A 3QYPA 1DEAA 2VDQB 4G67A 2R3SA 2YCLA 3L5KA 1VTKA 4OKNA 4Y2XA 4ZOLB 5B1SA 4BPRA 3SMVA 4DQLA 2FSGA 3PIRA 2IYLD 6ADHA 2PZBA 1PWZA 5CNKA 1KK0A 1OX4A 2KLHA 4O2BA 3UICA 3V3KA 4DJJA 1SHTX 1V43A 2ZR9A 4JYCA 3T0FA 1U99A 1V4VA 2HDNB 2Z95A 3WLTA 4EF4A 5DBHX 3ZWYA 1AU9A 1PJRA 4Q47A 3STXA 2ZQ5A 2GZDA 2P62A 3MGBA 2WKQA 4C43A 5EQDA 4WLFA 5EJEA 2XRFA 5CB4A 3K35A 1NP6A 1MU0A 2ACWA 3BRWA 1N1GA 4Z9BA 1XG5A 2D1YA 2Q1UA 5KWJA 3D5EA 1Z6XA 4DLKA 1MB0A 3HUEA 1MNQA 1JMYA 13PKA 2YYYA 2VPYA 1CUAA 1AGPA 2Z4SA 4MKRA 4F8JA 3TQOA 3GG9A 4YASA 3RYFA 5F5LA 3R5FA 1AJEA 1OZGA 1RC1A 1SK8A 1FBNA 4MQFA 3SOPA 5CA0B 4R3UC 1U3GA 2D1FA 4KODA 5AKYA 5LOVB 1PTJC 4L08A 1GT6A 2ZI4A 4OB8A 2XYRA 5C8XA 2JFWA 2C1ZA 2DBYA 1VLMA 2A9QA 3AVPA 4BP1A 1P7WA 5A6SA 3THXA 3OJ0A 4MVWA 4RZ3A 5HCNA 5K2MA 3EXEA 1QRUA 2E87A 2JDIA 1IK4A 1IU9A 1R6TA 3LXUX 4X8MA 5LB4A 4O3MA 1CJKC 2HWXA 1RD4A 3M1YA 1D4OA 1DS6A 1AIPA 2K2WA 2YWBA 3CE6A 2JGFA 5TS3A 2JIDA 2YICA 2X4DA 4ER6A 5PGMA 2XWJI 1L4YA 5TX7A 3RYHA 1EWTA 1N77A 5JS8A 1T8SA 1OB2A 2V98A 1CE8A 1RJ9B 3OAAD 5EEHA 5CDFE 1HPLA 3TJRA 1O6FA 3TOSA 5HK9A 5M34A 3LT0A 1N36B 5A0TA 3HY6A 3RBAA 4L5YA 2A86A 4M38A 2YDYA 4RVCA 2JCSA 1QR6A 4W1RA 5AVJA 5G53C 4ZDWA 5TC4A 2VXYA 1E32A 4LC1A 3AHJA 5GWXA 4A0RA 3UOWA 1W4LA 1TC2A 4ZT6A 5K8LA 4KQMA 4OXYA 4V0ME 1GQRA 2JI4A 3TRDA 2RH8A 1XTBA 3D02A 1HLFA 1MPXA 1Y5LA 4ZU1X 5JYDA 4D79A 3HO1A 3T1OA 1JXAA 2VDOB 2WSSD 3FWKA 1M5RA 1Y5NA 4L8LA 1BW9A 1ODCA 3W79A 3TNFA 1SCUA 1QR2A 3CEMA 4AMVA 4CIXA 2YNMD 3X2EA 5JFTA 1K6IA 1LBTA 2VKTA 1TOAA 3N6VA 3Q6NA 3E3NA 4DBVO 1AV6A 5FTMA 1A88A 4UBNA 4LMRA 1R5BA 1I51A 2PX6A 5HCIA 3B6JA 3UMVA 3HKCB 1Z4KA 3VR5A 3PFIA 3G02A 5H81A 1XTPA 1USUA 2G8NA 2JPDA 4ZOEA 3TSOA 1PK8A 3IO3A 3LS2A 1XMQB 1OV4A 2O4CA 4MQ4A 1YE3A 1U8YA 5FEMA 5B2ZA 1E9CA 5CLIA 3I2HA 1CR6A 4B3RB 1ENOA 2PL9A 5HRUA 4YCBA 5CJ2A 1PR4A 2W2KA 4AMZA 4MW0A 1S1CA 4AY6A 3QPDA 3C3KA 8MHTA 1VDMA 2Q6IA 1A5BB 3PYMA 1V26A 2WWHA 2AUMA 1I5EA 1XCLA 3A36A 3R3JA 1BMTA 3JALB 4MW5A 4MR9A 4U2BA 3T1YB 5L7WA 3EVTA 5CNMA 3ORHA 3G2OA 3QE2A 4QDJA 1M9NA 3B1JA 3JATB 4RFVA 2D5CA 2R5FA 2R1VB 1IZ9A 3PX3A 1Z37A 3ZNNA 2CLHB 2ALJA 1GGKA 2HA3A 1IUNA 3P2OA 5KMGA 1HFWA 1QH8B 3T4UA 1M8GA 4BB0A 3BD6A 3Q12A 3ZYZA 4M98A 4WCFA 1S3FA 1V7ZA 2QVXX 4LNUA 1QP4A 1MBZA 2HMSA 3WZLA 1EBBA 1BOFA 3FCOA 4CKBA 3G0BA 2NYUA 3ZK8A 2ZIEA 4EI9A 5IFKA 2NU6A 2FH5B 1G7TA 4NU8X 3FOZA 1F8YA 4LWQA 2FWNA 3PWTA 2IIBA 3GJ4A 1Y48E 2E4WA 3KAJA 4WZBB 2W70A 1GA1A 3PKZA 5KMGB 3H1PA 5KNLA 3QPVA 4LVOA 5AK6A 2XQGA 3DVQX 4D96A 1LPPA 4EFMA 4EJSC 2ST1A 4RE6A 4REQB 2BKLA 3TGPA 4K9NA 2CY0A 3ZQKA 4C7OB 3BDIA 1H2FA 3PUYA 4IG9A 5GGYA 5AVYA 4DIOA 3I6IA 3VR0A 1CP2A 2E21A 3T99A 3U4AA 3HKDB 4B3JA 2YUIA 1CUYA 1G3UA 1MC5A 1O89A 3SZ3A 1P7VA 4B31A 4D5GA 3K92A 1A8HA 1XRPA 2H0RA 3PQ5A 4QASA 3H2YA 2EKLA 3MM4A 1E2BA 2VG8A 1E5DA 1N2XA 2IYWA 2R4TA 3EVNA 5D85A 1Y82A 2B25A 1GO2A 2I62A 4W9NC 4OHYA 2O8EA 1V11B 1H6CA 4HHEA 3FPLA 2LWIA 2ECKA 3ZGLA 4AF8A 1F5NA 1G8MA 4JBNA 3KZ1E 3UA3A 3H9QA 4AROA 1WCIA 4B84A 3SVTA 4JD5A 2CL6X 3D8TA 2PNJA 2OTCA 1TQDA 4US2R 3IKLA 2BSXA 1Y3CE 3S2GA 2IPAB 5EI5A 3ZHTA 3VJKA 2CT8A 1G6HA 1XTUA 2VA8A 5KDLA 1G7CA 1MR3F 3H0KA 3GPBA 1GV1A 5KNBD 1U0JA 3QVVA 1WQ1R 1DELA 3CN7A 4JZKA 4D3SA 1SUFA 3W3AA 4EB0A 1I10A 3QWAA 3D8HA 1UZLA 4OQ4A 1I4LD 5H68A 2DU8A 2HZBA 5HWSA 2VK2A 1Z4PX 5DVZA 1CU1A 1MAAA 1HE8B 4UBIA 1GLGA 1W5EA 1YVPA 4Q1AA 4II3A 4ILEA 4O63O 1HQYE 2WMYA 3KZNA 3GDOA 5IHXA 4UDOA 1GKLA 5BW6B 1JZQA 3HUDA 4ZHQB 3ENQA 2FQYA 5E4TA 3X1DA 3GDGA 1GGNA 4TZ0A 1TVKA 4GX1A 2DXIA 2WM2A 1QRTA 2Y0DA 2BCGY 2GCNA 2GM3A 3NV9A 3R6GA 3K1TA 1YA8A 4HTFA 3SM9A 4QBHA 4ER0A 3KQLA 2P9QA 1E69A 4IQ8A 4I4LA 1R0SA 4QHYA 4QLAA 5EC8A 5ED0A 2JAUA 3T6KA 2XUHA 1OA0A 4ZJPA 2IE0A 3TE7A 8ABPA 4CG1A 3DHVA 5EMHA 2PJUA 4NR0A 1JH9A 2X42A 1QH9A 1VC2A 4KQJA 4Q1FA 1JI3A 2Z09A 2W6PA 1SZJG 3BXHA 3LLUA 5H82A 3SJCA 3SIPA 1INLA 3KL2A 4BCCA 1JU4A 3ABRB 1I1QB 4IIFA 1B42A 3KQPA 2PWBA 1EVQA 4CKYA 4JLDA 5DYNA 1VSQA 3RBZA 2OAP1 4P0TA 1K9VF 1YRLA 4DEXA 1H1LB 3IA2A 3E9RA 3IDFA 3P1JA 2G5CA 1UBOS 3KYDA 4O08A 1QGYA 3UCEA 3QJYA 1XZAA 4KIWA 5GJVC 3ANLA 3E9CA 4GEGA 1S2NA 4YGXB 5D1NA 1Q0HA 5EJ8A 5IDQA 3MIZA 3U3RA 4LZAA 2BGIA 2BEUB 1SXJB 1TMKA 4F56A 3AJEA 3FCAA 3OUZA 5DN6D 3OZWA 1GN8A 4OHKA 1GNVA 3RS8A 2WOJA 4NV3A 4WERA 4TTSA 5KCMA 4HN4B 3LUFA 3FSJX 4OHXA 4TSFD 5TQVA 3W6PA 3RSHA 4BFLA 5JT1A 2DFDA 3KQHA 4XQ9A 2YN4A 2D3WA 4GO1A 3PHJA 2GAAA 1UBNA 3UJ6A 3EC2A 4HH1A 5FYDA 3NORA 1WXGA 1YQTA 4G65A 4EKEA 4OKSA 2FZKA 2ZBGA 3TTXA 3PCRB 2ZUSA 3DM9B 4ZIRB 1UWLA 2P2GA 3EGCA 4GHWA 5AJVB 1YUBA 4RKWA 1A8SA 3V97A 2XGJA 1WCXA 3TOXA 5LZ2A 1TADA 1IEVA 2JG3A 4IZIA 4NFYA 1WZNA 5BUSA 4BB9A 2GD0A 1R0XA 4KDFA 3PDWA 2C7GA 1B6RA 1JE1A 1OYWA 2O20A 3P9YA 2DPYA 3TMKA 4O1MA 4ZICA 1H5QA 3NP9A 2EIXA 4W5WA 5FUXA 1M0EA 2DUWA 1ZMOA 4CEIB 3JS5A 4UJ3A 3IT0A 5K1ZA 3MJRA 4GBJA 2GHTA 3TAUA 4L9RA 4F4CA 3LT5A 1B2RA 2I4TA 3X1WA 1N5DA 1T25A 1SKAA 1DVRA 1EWKA 3A6EA 2IELA 3LGXA 3K2QA 3K7EA 3F96A 1TT7A 3LSTA 3NO4A 2OHHA 4IPTA 2X41A 4EWLA 3OZXA 3PUIA 4Y1RB 3IBSA 1A5ZA 4PGGA 1W36B 1HDRA 4GMHA 4N5IX 3PDJA 4ZAXA 3ZWAA 4WNYA 4D5EA 4ENQA 5L3VA 3RBVA 3SFZA 1R6DA 3K20A 3GRYA 2B7BA 3PNSA 5JD6A 2Y66A 4N1AA 1YCFA 1QDEA 4TTIA 5JNUA 1H3FA 1X9HA 4L3OA 4ASUA 1NUHA 4K46A 4OYHA 1YA6A 1RAGA 4M36A 2ZJ1A 2ACKA 4PY2A 4WT7A 2C59A 4F5WA 2FJUA 4F86A 5HKKA 4H6XA 2GLTA 3NPMA 4DUZB 1S9DA 5EP4A 1JJBA 2ZYTX 1M54A 1G2IA 1XRMA 2VBIA 4BMSA 4WBXC 1F2TB 4NF2A 1QH0A 1QP7A 1IZ8A 4BGDA 4ZO9A 4S2EA 1L4BA 2AF4C 4QXAA 2EFEB 4CIAA 4PFJA 1LLCA 1SBZA 2R6CA 5FTJA 1X77A 3OT4A 4OATA 3RAPR 3H4MA 5B57C 3FOFC 5FNZA 4KTVE 5C8YF 2UAGA 3IUEA 1Y8QB 1QX3A 1A7UA 4LSWA 5JECA 3C16C 4PSCA 1W6RA 2G0NA 1ZM2A 3MEQA 5SZIA 4JBXA 4IZ6A 5JE8A 3TLYA 3ADCA 5JLAA 4NZ9A 2PZMA 2H4YA 2OO3A 4HWKA 3BYZA 3BWCA 4TWRA 3W1WA 1H2ZA 1KU6A 3HEBA 3NNSA 3BAFA 1DX9A 1T6YA 4B6OA 3KSDO 1YIDA 5AHKA 2ECFA 2P68A 4YMWA 2UXCB 4C3UA 1CBUA 1GSAA 2JFXA 2BF7A 4HSGA 4LDZA 2RI6A 2OE2A 1KJQA 1SEVA 2VL7A 2FXIA 5ALOA 1VJRA 4OAQA 3AUJB 3Q40A 3JWIA 3R6LA 4GWGA 1YJAA 1IXSB 4OFWA 4UD2A 5FL7D 1P39A 3TW8A 2KS6A 2ZDGA 4Y2SA 1UBLS 4UBKA 2FN9A 3RG8A 4BJ1A 4E5VA 1JT2A 4JUFA 3U3XA 5JVDF 1FPMA 3K70C 4Q3DA 4YUVA 3JQAD 4WNIA 2NVOA 3RHFA 1KVQA 1Y63A 4NMLA 2A5LA 2L17A 3Q2IA 4KQKA 4OQQA 5DK4A 3KV3O 1G98A 3GVCA 4RD4A 5BSGA 2G71A 5EHQA 5LVAA 1B76A 1R5OA