4D9GA

Crystal structure of selenomethionine incorporated holo diaminopropionate ammonia lyase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
387
Chain Sequence
b'SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diaminopropionate ammonia-lyase
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 119
structure length 387
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA01
5CGQB 4L3VA 1UBSB 4HO1X 4ZU1X 5KZMB 4LI3X 1CX9B 1K7XB 1J0CA 1VE1A 1WDWB 2CLEB 4PCUA 4Y6GB 3BM5A 2EFYA 3VSDA 3ZEIA 5D84A 4D8WA 1X1QA 5DBHX 4JBNA 3PC3A 1UINA 1FUYB 5KINB 1J0EA 1J0AA 5D85A 1KL7A 1KFEB 4AECA 5T6MA 4D9KA 5E0KB 4D9CA 5IXJA 1PWHA 1K3UB 5I7OA 4WX2B 3R0XA 2CLIB 1Z7WA 4NEGA 5B53A 1BEUB 4D9IA 3FCAA 4D9FA 2RH9B 2EGUA 1J0DA 1A5SB 2GN0A 3VSAA 4LMBA 5DW3A 2DH6A 2C2GA 3X43A 2PQMA 5C3UA 3HMKA 4D96A 1K8ZB 4F4FA 1KFCB 1PWEA 2ZSJA 3PC4A 4D9MA 1J0BA 1M54A 2Q3BA 1WKVA 2JC3A 1A50B 2GN2A 2BHTA 2ISQA 1QOPB 1QOQB 1TYZA 5IW8A 3SS7X 2Q3DA 4JBLA 5D86A 3TBHA 3AEXA 1TZMA 2TSYB 5DW0A 3V7NA 5JISA 5B1HA 4D9EA 2CLMB 3PR2B 4D97A 5HBGA 2J9ZB 3DWIA 2O2EA 1UIMA 3IAUA 2CLKB 3DKIA 4HPJB 5I7RA 3R0ZA 2O2JA 1WTCA 5EY5B 1Z7YA 4LMAA 4D92A 1VE5A 2BHSA 4HN4B 2TYSB 1C9DB 2TRSB 4L27A 2ECQA 1O58A 1TTPB 1K8XB 4D9GA 1RQXA 4KKXB 1Y7LA 1V71A 1P5JA 2Q3CA 2DH5A 5I7HA 1TTQB 2D1FA 3AEYA 4D99A 2CLHB 4HT3B 4D9NA 2RHGB 3RR2A 1TDJA 2WSYB 1K7EB 4L28A 3DWGA 1WBJB 5B55A 1K7FB 1OASA 4NU8X 3SS9X 2J9XB 1C8VB 5D87A 1TJPB 2GN1A 2C2BA 5DBEX 2RKBA 1TZJA 3L6BA 4HPXB 3VBEA 5B36A 3IQGX 3X44A 2CLLB 4COOA 1E5XA 1KFBB 1D6SA 5I7WA 4L0DA 1A5AB 5B1IA 4D8TA 4H27A 3PC2A 5IWCA 3CEPB 3IQHX 4ZQCB 4XUGB 3FGPA 5DVZA 2ZPUA 2ECOA 4I1YA 2ZR8A 4ZU6X 3VSCA 3VC3A 1F2DA 1TZKA 3L6RA 2CLFB 1KFKB 3L6CA 4D8UA 5J43A 5JJCA 3IQIX 4OFXA 5CVCA 1C29B 5BW6B 3T4PA 4OREX 5J5VA 1BKSB 2V03A 1FCJA 4AIRA 1KFJB 1V8ZA 5B3AA 1TZ2A 5I6DA 1CW2B 4QYSA 4D9BA 2J9YB 1A5BB 4IL5A 5I7AA 3SPXA 1K8YB 1VB3A 1JBQA 1V7CA 2CLOB
chains in the Genus database with same CATH superfamily
4J0IA 4O29A 5I8ZA 4A8HA 1DIHA 4BL5A 2BHLA 4NJMB 4WZ6A 5KVCA 2X19A 2ID9A 1CUEA 2KBFA 4PLYA 3ND6A 2FDXA 2OHHA 4GM0A 2NZJA 3R24A 4RYLA 1JZQA 2CHQA 3NBQA 4W9NC 3TPCA 3PG5A 5DLPA 1P60A 1CS4C 1I0LA 3BFVA 4KAAA 4P3NA 3RSSA 3GVPA 2EGGA 4OBEA 1ABBA 2QSJA 1C30B 1WSDA 4ZOCA 2E89A 4CIXA 1ODIA 4YJHA 2ACVA 3AGPA 1RJFA 2XIJA 1ARZA 4YO8A 3HYCA 3L0SA 4QQKA 2P5SA 1ZSVA 1OIXA 4C4AA 3H2GA 1Y7TA 1QV6A 4C89A 4U5XA 2C7GA 2G82A 2XNDA 2IPLA 1H3FA 3GN2A 1JIVA 4DLWA 4H7KA 5H4GA 5HM8A 2I66A 3QIVA 4R5HA 1Y6QA 1KI3A 1VMDA 1XN1A 2A5JA 2Z2ZA 3B53X 3DD5A 3GJTA 3OT4A 1E99A 3UXEA 3WAGA 4K2HA 4MW0A 1D2GA 1PV1A 2VTVA 2R2AA 4NARA 4F11A 3UATA 1W5BA 1P1KA 2BBSA 2PZKA 1CY6A 3K0FA 2FPWA 3LLCA 4D3FA 3QBJA 4L5YA 1C0LA 1UPBA 4CM8A 3PP8A 2OM6A 3U09A 3AKDA 1BN6A 3DTVA 4B4UA 1UBTS 1QG0A 2AN1A 1YC5A 3Q3CA 2VDWB 1H93A 3QOYA 4PNPA 4R83A 3DE3X 3FFAA 4HYYA 4MRPA 5GY7A 1VL6A 3F4BA 4C7BA 1DEHA 2F64A 2AXNA 3D6TB 4PY2A 2ZDHA 4JJ4A 3TM5A 5EE5B 4EEXA 3MS7A 4L4RA 1CZNA 1EBFA 1T5SA 1GCGA 1IDOA 3BILA 4R81A 4ZT5A 2FRVA 5T8KC 1TK9A 4R1MA 3DDUA 3NDIA 3O73A 4JWKA 3S5UA 4D9NA 4YR7A 4MIEA 3UG6A 1CZUA 3DMTC 5LA6B 1NLMA 5EMJA 4L4UA 5DHTA 1NI4A 1NYLA 4RMJA 1N4DA 2H4ZA 4TMTA 2ZRLA 4HCJA 4UULA 3MSXA 2GN1A 3MS2A 4MK4A 1KZ4A 3STVA 4AKGA 4BV2A 2DBQA 4DABA 2GI4A 3T5TA 3OCZA 1XZQA 4NFYA 4LTMA 1ID8A 1OFUX 3RTAA 2WABA 1VFNA 1UJNA 4ZOAA 2WBLC 3FJ1A 2PH3A 3TL3A 2R8OA 1C41A 1FYFA 2AR0A 2IY8A 3ACCA 1OX6A 1E1NA 2BSXA 4GBED 1SURA 4G25A 2XUHA 3LQQA 1GR0A 1XAHA 4YLEA 4PAWA 3ORQA 1E2HA 1EWRA 4Q3EA 3AONB 2WHEA 4OAPA 1A27A 1GGJA 1ZL2A 2PH1A 1PX2A 3D02A 4TMKA 1QZUA 4E5KA 3GJXC 4G0YA 1A7AA 2QSYA 2I7VA 4R98A 4D8VA 2OZEA 5LZ2A 1SNYA 1J7JA 1BMFA 2R7LA 1E7WA 1UQRA 4JAVC 5IDVA 3KSAC 2JAQA 1OGYA 2CZCA 1IHXA 1I01A 5EN4A 4TMWA 3UYLA 4KQ2A 4MPPA 2WPDA 4HVAA 5G1PA 3SZ3A 4LF5B 2H65A 4RPKA 3FDJA 1F14A 3WRYA 1I9GA 2QRVB 4TXHA 4TT3A 1UBSB 5EZ6B 2X5KO 3AR3A 4K9KA 3NTQA 1E0JA 2XNHA 1XVIA 5DCUA 3GQBA 5JMOA 3T7EA 2CLCX 3I6BA 1VE1A 1W44A 2IVFA 3ZQ6A 3GB9A 1E0KA 4P4GA 1L3BA 5JANA 4C1NA 1UZMA 2I6QA 4EJ2A 4CT4B 3QPVA 1J23A 1ZK2A 2RGRA 1Z16A 3KT8A 2RG7A 1H2ZA 4MQUA 2UU9B 3B1ZA 1K3UB 1EK6A 2PKQO 1FQJA 1U4SA 2EGUA 1U2TA 5CVTA 1AG9A 2WKRA 1MZVA 3SYKA 3FKSD 4HAZA 4KC0A 3IO3A 4BQRA 4B1FA 4JELA 1PRYA 4BNNA 1TCVA 1GFIA 4EO9A 1ZRSA 2ATXA 2BUAA 4HAYA 5JROA 4GMKA 4NF2A 1X6VA 4EB6B 1ODLA 1ZN8A 1HNXB 3SYNA 4A6XA 3TRJA 4DXDA 4DMFA 1N78A 1BMDA 1N2JA 2Q3DA 1CHNA 3EGDB 1H4VB 1FIUA 4CMEA 3R6DA 1H2FA 1DDOA 1M10A 3EWAA 3U61B 4K3VA 1U2DA 1N8SA 3D1LA 1QZXA 1P1JA 5BY2A 2FCRA 3OHSX 4REMA 1J07A 2HF8A 1ML4A 5HKBA 1DO2A 2WFMA 1X87A 3RU2A 1X39A 1XD2A 2YJGA 3DEIA 2Y76A 3HB0A 3ORSA 3LUKA 4YAOA 1QANA 3TOXA 3WHKA 1DBQA 1FX1A 4S24A 3HDGA 1OH5A 4XEHA 2XHZA 1RKXA 2O8CB 3CWQA 3MTDA 1ZCAA 3JVEA 1FRNA 1BZYA 1TQ2A 2V0NA 3KVRA 4DG9A 3QLTA 5DNYB 4GNRA 1PCXA 2P4EA 4EMSA 5I7HA 2Y8EA 4ALMA 2CLHB 1RYYA 1V3TA 4W7SA 4JI6B 3W6ZA 2QN6A 2NOAA 3GZJA 4CV2A 1D2RA 1FXSA 5DX8A 1I10A 3UF0A 2VLIA 4JL6A 2X42A 3T99A 5LP6B 4PLCA 1PJ3A 3GNSA 1ZK3A 4FLEA 2VEOA 2XI4A 4QSHA 2C3OA 4PC7A 1T9DA 5JVDA 2PMBA 3IILA 4CMKA 2EX0A 3QPDA 3AUTA 2W00A 4O02B 4X62B 1NN0A 2H0QA 3C1UA 2QTHA 1VPLA 3H2ZA 3HCFA 5FQNA 4EPTA 1Z83A 3LWNA 5EE3A 1QP0A 2F00A 3FIJA 4D8TA 5T4BA 4B7UA 2YY5A 3SNHA 2A14A 2ADMA 1B26A 3FHOA 2NTVA 1Z6XA 3DL0A 3NJ8A 4OG2A 1A9RA 3OJXA 2W42A 4MYCA 2QQGA 5DYGA 1G19A 2BI8A 2XB2A 5LBUA 3SQWA 3GT7A 4FW9A 5TRTA 3OIWA 3LUAA 2QJFA 3OPXA 4YAWA 1HMPA 2RH4A 5I8PA 2H1RA 3OQNA 2BVNA 5CJ2A 2WSSA 1CLEA 3FSGA 4MROA 1J5EB 1KQOA 3QYAA 4DR1B 2Z09A 2ZBUA 2XUKA 4IL5A 1T4CB 3RVKA 3Q4GA 1PD1A 2V1UA 1ZINA 2J3LA 2XD9A 3OU7A 1BTOA 1E3WB 1BSVA 1EFCA 1KAEA 4MH0R 1V2GA 4WK6A 4WV3A 3BTSA 5D3MB 4CCYB 2CKMA 3FYDA 5FBVB 3QEBZ 1LVGA 2IEBA 3Q0EA 2O8NA 1E6UA 2GETA 4TL6A 3EZ6A 4MQFB 1NJ6A 4G0UA 1CRPA 2FN4A 2PFKA 2X0DA 4P0PB 3K9GA 1ZBDA 3TAHA 4LW8A 1ZM7A 5IBPA 3V00A 3PPWA 4B82A 4BLRA 4M36A 3TGLA 4CL8A 1S1MA 5E6UA 1DO0A 3M4JA 1X2EA 2Y77A 1L6RA 1I2BA 2OO5A 1TZBA 1IWOA 5G4KA 1W36C 3G7NA 5B1SA 5U1PA 3T0IA 2A86A 4EFNA 2H07A 4DCJA 2FMTA 4BQPA 2UYCA 1R9GA 5FWYA 4OH1A 5KS2A 5BN5A 3K5PA 1KL7A 2HQ1A 4KIFA 5I7SA 2RHOA 3ES9A 3AHIA 1M1YA 2VHJA 4ZOLA 2DFLA 4OXXA 1NN3A 2AOUB 4NULA 1FC0A 4RS4A 4WRRA 1B93A 1KAQA 2GVNA 3T9CA 3K6RA 3KUUA 4QVIA 2XZTA 3PQ2A 4JC8A 3LFUA 4QVGA 3QOFA 4UARA 4QTUB 2CK3D 1IJBA 3O90A 4FS8A 4QASA 3OTQA 1OXTA 2J07A 4RLQA 2AG5A 4UVHA 5ARCA 3T1QA 4ZCIA 2FFBA 2BFFA 2HLNA 4H18A 4H3VA 5M5BA 5CVDA 2FOLA 1T9HA 1TF5A 4OYYA 3G82C 4FM9A 4LSMA 2ACEA 3N53A 5DCWA 1EXMA 1W88B 2QD1A 5DSZA 2C7QA 2E18A 4L0QA 4YRCA 1X8LA 3E9ZA 4YWJA 1YI8A 2D0PB 4GYJA 4RIHA 4J7CA 4XRGA 1U3DA 1UK8A 2WW8A 5E0OA 2NO1A 2J8ZA 3R4CA 2WM9B 3MWJA 2HUNA 3IT1A 3LLSA 4LJLA 1O94A 4DBLE 4EB0A 1NNUA 2WD7B 1S8NA 4LK3A 2JGJA 2ZATA 3B7GA 4GI3A 2A4MA 1C9DB 2HBRA 4NMLA 3U16A 1XN4A 3ESYA 1CY4A 2P79A 1Y82A 1ZK4A 3D3QA 3M7IA 3NATA 3VPAA 3HXQA 2ZB7A 3LE8A 1R6TA 1C4KA 4PVCA 3DEKA 4RF5A 1E98A 5IN5A 3ZS9A 2JASA 3ZHXA 4J6EA 1VTKA 3MCZA 2J0EA 3FLBA 2OYRA 5ADWA 4M0PA 1FU7A 2QVCA 2XUZA 5K8TA 4HR7A 4MQMA 1MO3A 4NQZA 3I0ZA 3MILA 4H1UA 5AI9A 1DIAA 2AQIA 2Q5CA 3L4SO 2GHQA 1I4DD 4IH9A 3U6KA 1A5ZA 1PFQA 4JLDA 2K4MA 2NU7B 5F5NA 1PJAA 2REQA 1Z0ZA 4B4DA 3OZFA 4BO7A 3OURA 4RD0A 3GFBA 2BM0A 3B9RA 1C5KA 3G8BA 2H51A 2VT3A 3V4PB 5J4YA 4YJGB 2PX0A 1Z8HA 1QVWA 3L6UA 3SM9A 3B89A 1U4NA 3DYVA 1ISPA 3P0EA 1Z9BA 3WGTA 1KDZA 3TLGB 4L95C 4EJSC 3S1SA 3IH5A 1SUDA 4YDRA 1XG5A 1LV7A 3VAZA 1NT4A 1UC5B 2PXXA 1CUIA 4RMNA 3OPYI 1WQ1R 4Q7JB 3WKBA 1U02A 1UWKA 1X8XA 1Y81A 2EBHX 1SG9A 2A0UA 3DTYA 4J16C 4JI4B 2FA9A 3HS3A 3UAXA 4BMVA 5BOSB 3AXSA 1Q7GA 1V45E 4Q6BA 2CJWA 3E3MA 1PTJA 3MTIA 1SC3A 4YCAA 3M9WA 2AXQA 5JRDS 4OHZA 1K6XA 3QKRA 4GU5A 2D5IA 5JMTA 3R6TA 5ALUA 5A05A 4MRAA 4L74A 1KE2A 3JR7A 4W63A 1Y1TA 2MYTA 2WD9A 3HG7A 3SGLA 1DINA 3TCXB 3IO5A 1CC1S 3REGA 1JF8A 4RGBA 2WWWA 3NRJA 1C0PA 5T4FA 3LT1A 2A5GA 5BWNA 2AI3A 3RSGA 1FFEA 3SKYA 4BCDA 3GRFA 4KITB 5COQA 1SHUX 5JZVA 1QK4A 2H1CA 4RSGA 2CFOA 4LV6A 1DQYA 3QMVA 3HCAA 4NS1A 4BMOB 4GWLA 4LYYA 3A70A 4PHHA 3DEHA 4G5FA 4UPEA 3SZMA 2P9QA 4Q1DA 1B74A 1HC7A 1LV8A 1Z7WA 4Q3AA 5TF4A 1IY9A 2IWRA 5C8VA 1PL7A 1RHJA 4RCVA 3V3TA 2Z58A 2VF7A 2FMXA 2GBCA 2WFLA 3LSTA 3QGMA 3R3YA 2H08A 4HZIA 1RR6A 1XP5A 1EVZA 4PZZA 4XPIA 5DGHA 2I4MA 4K9QA 4M9QA 1IC6A 4JU8A 4MLPA 4XA8A 4B7AA 1G2IA 1JG1A 4EI2A 3H18A 2QUHA 3PFCA 3KJHA 1RABA 4R84A 1YZQA 2O2GA 3H5RA 2OHOA 1H5UA 3O91A 4LQLA 4J7AA 3PLNA 1XQXA 4LE2A 3WV5A 3NHPA 1NUAA 3D0KA 1LD3A 4L4ZA 2FPUA 3L7CA 3ZHOA 1G64A 4EF6A 3IP6A 2YIDA 3TD9A 4XWKA 1VE9A 1Y8QA 4RKFA 4BO6A 5CK4A 3GAFA 1KIFA 2Z8XA 1H0HA 2ZB2A 2NAFA 4FUQA 3FBGA 1M2EA 1JN0A 1RQ7A 3RC3A 1QGED 4V0RA 2WJGA 2Z04A 5IH7A 3VTAA 1H2HA 5DNAA 4QYMA 4F1WA 1RXYA 1Z4PX 3RNLA 1HTBA 2VWPA 3AM5A 3NV7A 4RPGA 4C6HA 3KFXA 5A06A 1O54A 1Z56C 4FDTA 4HDRB 4Y6RA 3AHEA 1W6UA 2FQWA 1EK5A 5JT1A 2DETA 1TD9A 2A8YA 3WHPA 4HRAA 5FYQA 1PR0A 3LY7A 3BTUA 4E33A 4IMRA 5D3KA 5BVGB 3LXUX 3NVMB 3JPYA 2AOXA 1FQOA 3ECCA 3MG9A 4MMYB 3RTBA 2C98A 2RKWA 2OV1A 2IPOA 1FTWA 3A6DA 1OMOA 5A9SA 1TEXA 1W2HA 3LW8A 4B9EA 1JAXA 4R8LA 2H0RA 3SJCA 3VC2A 4RZUA 1L5VA 3E8SA 3MAGA 4D74A 3L0CA 1Q57A 3RIGA 4RQAA 3THXA 5IAAA 3RWOA 1KHTA 4N3CA 5U4QA 3D6VA 4WAUA 1CR4A 4DV4B 3CO0S 3U4HA 2AFRA 5BWMA 3CB2A 3LECA 3KKEA 1SOVA 1VBMA 2Z2YA 3LHSA 1Q83A 1SCJA 4Z9XA 1LI4A 3SN6A 5BV0A 1OZGA 2GPJA 3I4FA 3RSHA 4Z8YA 3GBPA 1ZN9A 5C8YB 3VOAA 2EC5A 2OE2A 2IOFK 1L8OA 1WMBA 3N2KA 3ROKA 4EWLA 1KFJB 2ZW9A 4ZV4A 3PWZA 5K2OA 1XVVA 2W6OA 2A3RA 2AEEA 4TMFA 4TTRA 1XR3A 1TB4A 3V4LA 3GEPA 2YN4A 3MTQA 3ZZUA 5AI8A 4H7JA 4G5HA 3LZCA 1M1YE 1I33A 4E4YA 2VFAA 5K4AA 4N3AA 1U2QA 1DKMA 2E1PA 4IOKA 2IF0A 4L2IA 2O8EA 4EPVA 1OWNA 1IQUA 1DZ3A 2GEUA 2YVAA 2PDAA 4BJ1A 4RK0A 4PXYA 3UPTA 3GLIB 3ZE6A 5JVDF 1G9TA 1NM5A 1NBHA 1T0PA 3IQWA 3ORRA 3FOAA 3PQFA 4RAOA 5B2ZA 4L5JA 3EVCA 4FEAA 2J87A 1I6MA 1MOPA 1NXWA 1VJGA 1FSSA 2WZQA 2FGKA 3BRWA 1WZCA 3ONNA 1NF3A 3ZW7A 4OL9A 1U3CA 2EOAA 4KGXA 4HDSA 5DYIA 3TQTA 1RKQA 1V1JA 2JJ1A 3IE0A 2H1LA 2NZYA 1XPRA 2HLDA 4GG1A 1CZLA 2YFKA 1C1XA 1DFHA 3QKTA 4X71A 1E9AA 3RW9A 3VU9B 1M76A 3Q6MA 5LSAA 4AWXA 4LSGA 4YP7A 4Z4IA 1MLDA 1TGVA 2XA1A 5K01A 4JBIA 1G3UA 4CKCA 3T35A 1JKXA 1AKMA 4X7MA 4G01B 4JJAA 3U4QB 3P9YA 4ALIA 3D7NA 1QH9A 3HNPA 3D8HA 4YRZA 8GPBA 2A35A 4FGLA 4F9GA 1P0IA 1USWA 2C9BA 5C7LO 1LPAB 5FH9A 4FXPA 3DZKA 1CUFA 4CMEC 3GLFB 2AFHE 3CEMA 1ZGHA 3DGFC 1SU8A 3PYLA 1JQKA 1U2DC 3N0WA 4HXYA 2QNIA 4WKNA 2C42A 3T41A 4XD7D 5BMVA 3UMYA 2VRBA 4OMFG 4ZO6A 2B92A 2LKDA 4TXJA 4OI2A 3P2EA 2NYAA 4JLKA 4TSKA 5AXCA 3STHA 3B2EA 1XZNA 3FY4A 1LSSA 5FKJA 1JAIA 4YRQA 3A10A 1E1LA 3GAZA 2NGRA 4AUEA 4DGQA 5KOIA 2QBYA 4Z7JA 3FYTA 3D5EA 4XM0A 3O75A 3G2QA 3PC6A 4JQZA 4YALA 3FYUA 2OXIA 5ALJA 2NUAB 5KYXB 2F55A 4TYQA 1I5RA 3WLTA 5JNTA 3KJQA 3GY0A 4FWIB 3E5MA 3L1IA 1FDWA 3PSHA 4PZLA 2D4AA 3DLTA 4OB7A 1SBIA 4RPLA 4Z9BA 1B6GA 4DCCA 3R7WA 2F2TA 4M99A 3AU8A 4MMZB 1U5BA 3AEZA 3QH4A 3H3JA 3VFDA 1IULA 3ADDA 3NJ4A 1F4PA 1NE7A 2NLOA 3QF4B 1QE5A 5ALEA 3QXXA 5JARA 1T25A 1ZFNA 3O0TA 5HJ2A 4DQUA 1GIAA 5AMXA 1R3DA 3HUUA 4OKIA 2OFOA 5AK5A 1IOLA 2Z57A 3SBEA 1IXRC 1DJNA 4QBIA 1GARA 1Q0PA 1KIMA 4FDVA 3DULA 2ECOA 4B3FX 2NTJA 3TLZA 3M81A 4G9GA 2YV4A 2AH5A 1DO8A 3C45A 1N1DA 3WWDA 4XQGA 4O08A 3Q8WA 1YULA 2GN6A 5TNXA 1IONA 4PCAA 2IYSA 1J70A 1NPDA 2XUJA 4JVNA 5TVGA 5REQB 4CGZA 4AIRA 3JQAB 3I9KA 5FL7A 2VBIA 3TQCA 3BZBA 3R9KA 2YJ6A 4JLNA 4LYJA 5BNZA 2XMZA 2F6RA 1QR2A 3PZBA 1TT5A 3I30X 1BA2A 2ZSIA 4PPFA 1T8PA 4XM2A 4Y2HA 2AMJA 1VB3A 2GAJA 1EB8A 1UBHS 4OI0A 2ETVA 1Q6ZA 4CJXA 4M1TA 2QD4A 1U2PA 5THQA 1BHSA 3C2QA 2MJLA 3WFJA 4FR5A 2VRCA 1R4NA 4ID9A 3LVRE 5DF1A 1QYIA 4DTIA 3PVSA 4LDJA 1KGDA 2IV2X 1EMDA 2ZQYA 1JDTA 2EFYA 4XGIA 4DR7B 1R6VA 3AL0C 1Y89A 2JFNA 4IEEA 4QPCA 5IS2A 3EFOB 1E4VA 1MC8A 2KLHA 2Z1NA 1RNLA 4AZWA 3L3BA 4BWYA 2JCXA 1XB2A 1RLJA 2W6ID 3HV0A 3UMRA 3VOBA 5ER9A 2QSZA 1FSPA 3MOSA 1HGXA 3O2JA 4P0QB 4B2LA 1RCFA 2WIGA 2OAEA 3GP5A 3VHXB 5KCMA 2DY1A 4D3ZA 3FOBA 1RLIA 5GOZA 3A26A 2XNJA 4E21A 3A6JA 4EO4A 5BWLA 2EBUA 4BFUA 3HXKA 4PAOA 1IM8A 4UOQA 2VYVA 4RV5A 3DLHA 3AHCA 3QU4A 1R0XA 1LBQA 3FPCA 4Y8VA 5E8JA 2GCIA 4BMDA 2CBGA 1G59A 1B23P 2GN2A 1X0XA 1Z2CA 2I78A 1KAHA 4R6XA 2XAAA 3P9NA 2B4YA 3GX1A 4KWCA 5CLGA 4UTVA 3N7AA 2AQKA 2JFVA 5CB4B 2HMSA 5DW0A 2GYWA 3H0EA 3IVCA 5AVVA 5H16A 1N1GA 2FPGB 2H1HA 1P29A 3NIBA 4KDRA 3CJTA 2KB0A 4NI5A 5HEKA 2WTNA 3OX2A 4W82A 5DLDA 1TO6A 1MEOA 1GZHB 5FULA 4BB6A 3JZDA 1SULA 3MXTA 3KV1A 2XCRB 1N2CA 5EZ5A 2OVBA 1O94C 5LYJA 4QM6A 4B3SB 3EJ6A 3PHIA 1XQVA 1VLJA 4KI7A 2FX3A 3QF7A 3ENKA 3QPWA 1Y5NA 4DSAA 1ZNWA 3VVLA 1U3TA 3IE1A 1EFRA 4X8MA 2FEWB 3LUJA 1G9XA 2QQ0A 3G85A 3O1LA 1EVLA 3WA6A 3WWZA 2V6IA 4LKRA 1ABEA 3L4BA 2P9HA 2WT8A 4ZYYA 2KI5A 1K7EB 1VLZA 2BFDA 4MI9A 4PO1A 4L28A 4X63A 1TE2A 3W79A 3F46A 3ME5A 1CQJA 3WS7A 4A8JA 4IMJB 2KJQA 2HT1A 3O03A 2ZUEA 5FT9A 4FCCA 3QXSA 4QATA 3QKSB 1G8FA 3LHKA 2YN2A 2V6FA 4CIDA 5A2QA 1SO8A 2YFQA 1DUVG 2MR6A 3V32A 3B6EA 4RADA 1YS1X 3CF4A 1OB2A 1CT9A 4KR6A 1NSTA 1WHTA 3LRPA 2VP6A 3N58A 3SX4A 1IWBB 2IA5A 3WGGA 4WZBA 4EG4A 4OQXA 5A04A 1ZGJA 5E1OA 3UW3A 1P9RA 2GZDA 5FBLB 1A7KA 4MR8A 4BLUA 3OSUA 3U39A 3HUTA 3ZYCA 2VJKA 1XXLA 1GZDA 4JQCA 4M9XA 5F4BA 1WJGA 3RK0A 4A3SA 5AW4A 2DP4E 5IASA 5KJCA 4B80A 3GDWA 1JJBA 4FMCF 2C7BA 4W6ZA 1GA6A 3ETNA 3ZLUA 1EUDA 2BEKA 5C3MA 1T36B 1BDHA 5IKMA 1EUCA 2GN9A 5FWXB 2I7TA 1V48A 1W49A 1HTTA 1GGHA 2OD9A 2WKQA 1X13A 3SC3A 1QQ6A 2JLCA 2X3FA 4Z53A 4GKJB 4QXPA 2NP6A 1FPQA 1XDZA 4EKNB 3OQMA 5FX2A 2BE7A 5HIMA 3FWNA 3P26A 2ZIGA 4DYVA 3MELA 4L8WB 3L02A 1T2AA 3CUYA 4AJKA 1LI5A 2HA3A 3I2IA 3RTGA 4HGQA 1NKSA 1GZ4A 4HNAB 5HS4A 3E9DA 3Q88A 2RHBA 2XMRA 4P86A 3JWPA 1N9ZA 3ZXXA 3DOIA 1HL3A 2V7XA 1UJCA 5DTMA 2QRKA 4I81A 5FA8A 2GCOA 5FWNA 1FLVA 2GM3A 1I1HA 2JVIA 4P53A 4JH0A 4RJTA 1T9KA 1UDXA 3K7EA 3KXDA 4D6YA 4FMCB 3DBLA 4AY3A 2IZZA 2XXBA 1QGUA 1C7ZA 4PQGA 1IQ0A 3L8MA 5AW9A 1ZN2A 2FP4A 4W7IA 2VNKA 4R7ZA 4UAUA 1SVLA 1NDQA 2UYYA 4YK7A 2HDOA 3TD2A 2HRBA 1MAWA 4M54A 4BNFA 1VE7A 5I9TA 1H6CA 1ZMTA 3AH8A 4X94A 1TQ4A 1Y6JA 3GGJA 4ENWA 4Z1OA 2QI9C 4XQ0A 5KSYA 4RF3A 1CUUA 4L16A 4L50A 4W8HA 4J7UA 2GZSA 2X6RA 2VPPA 3W1WA 1II9A 1NYTA 3LKBA 3VYUB 3FAZA 1QOQB 4BRWA 1MAUA 2DR3A 2VIIA 1AUPA 3VKGA 1YFZA 1E7QA 2PR2A 1F12A 3IPXA 5HF9A 3OZGA 4U39A 4B3TB 3H6KA 3JVVA 1QO0A 3OPVA 3URMA 4B4WA 3QE9Y 4XGNA 1T2EA 1U7ZA 2CFCA 4LXIA 3AKCA 4LBZA 2XZPA 4B85A 3L49A 1UDAA 1X92A 3CF6R 4G0VA 3PGJA 4Y1EA 4DQKA 5KSOA 1Z5ZA 4TV8B 4QL3A 1L8XA 1RBYA 2TYSB 3EUWA 3IRVA 1ZIOA 2XSZA 2ZI4A 1E18A 3KS9A 3Q3VA 3F47A 5KAPA 5GM1A 4M1ZA 1NNEA 2ECKA 3H7IA 3K72B 1II8A 2FPOA 4WDRA 5BP7A 3A1DA 5DSXA 3D7LA 3OFNA 4H0FA 3UB3A 1KAOA 2EZ9A 2IHUA 4LVCA 4OJKA 4LOIA 1GPYA 4UW9A 5AKJA 3JQBA 4DLTA 3AKZA 1ZDMA 3H8SA 3NPAA 4JB3A 4IDOA 2PZFA 4YYEA 2WM2A 4G41A 2CV2A 1ZRMA 3D0QA 3TG2A 3HJBA 1RJ9A 3WGUA 2IH2A 3OAAA 3SIPA 1NFQA 4U7FA 4XCXA 2MT9A 5EE1A 3SHQA 4ZJZA 4YUZA 2VJQA 3DMPA 5HTOA 3OA0A 3KQHA 4RF4A 3ZGOA 1JWBB 2DE0X 2WJ3A 4FGUA 3ZY4A 3VNSA 3OCJA 3KD2A 3HO6A 1U2GA 2P69A 2VZ0A 3DNPA 3KLMX 1PDWA 4ILEA 1GGNA 4K1XA 4Y1FA 4ZAXA 4UOZA 2CNDA 4RYDA 4Z3OA 3R8FA 1QHEA 4LJRA 4OXKA 1MXFA 2IVZA 3DXFA 1STOA 1T8SA 4A6EA 2XUFA 3CW8X 1KI7A 2XD4A 2KW5A 4KQ1A 4YJ3F 3O4HA 4UVDA 3X1MA 1THZA 5CW2A 3U44A 3KTDA 1DWQA 4OHUA 2P1ZA 4UM5A 1T3TA 3R7DA 5JDIA 3MS4A 1LC0A 3C5WP 3T1NA 3SVZA 1NXTA 3EQ2A 3QPCA 2QAJA 4IGKA 5DISB 4BE4A 2YC2C 4CT0A 1GNPA 4EG0A 4ESVA 2ATIA 3FX2A 2VEDA 3N0VA 3CXUA 4QOJA 1EUQA 1ZIYA 2FSGA 2IHVA 2Q5EA 4KE6A 1JBEA 1DIGA 2BUBA 3BCHA 4N5MA 3EZ2A 5C9ZA 1AJEA 1DADA 1T0JB 1O9HA 4FZJA 1IIBA 1RWNA 2WI8A 4NFHA 1HZZC 4ONEA 3MBIA 4Q1CA 2C4HA 4LDRA 4CU5A 1FFAA 4D44A 2FJ0A 3JD4A 4KQWA 1QF6A 1EVEA 4DV6B 2XE8A 2I55A 3Q7IA 4GQAA 3VYTB 4UVEA 4YJDA 2WM3A 4R1OA 1QQ7A 3ROZA 1JFSA 3P9QA 3OJ0A 1N7HA 5BT9A 3ZWBA 4P82A 1QYXA 2BWJA 5K09A 2WJ6A 3OC0A 3UBMA 3V55A 4ZZIA 2IYUA 4WX2B 3SK0A 3BL6A 2INGX 3O4RA 3AM1A 4M8KA 4YN3A 4NATA 1NXXA 5AKKA 1WE2A 3D6NB 5BN4A 1X1EA 2HRZA 3JTEA 1CJCA 5DW3A 1N2CE 3HJRA 4FQ8A 5ALQA 3QEMB 4LFCB 2QB5A 4FI3C 2F7SA 5L3VA 3EHEA 1VKOA 3LKZA 5H81A 1KK2A 4JD5A 4HAOA 1ST3A 5H9VA 4EY4A 3WB2A 3GJ8A 1RI5A 2JIOA 1R3UA 3N0RA 1AE1A 4UEWA 1LX6A 4PS1A 1KBQA 1E2KA 1Q7BA 1F9AA 2OM2A 3OF2A 3OG9A 4MW9A 5DTQA 4Q4AB 2HUPA 1KMCA 2AJCA 5IX8A 3FPSA 3OI7A 4K28A 4L75A 3WKEA 2OD2A 2DLCX 1BGVA 3F9CA 4IQ4A 2VPIA 1Z5WA 1QTQA 2L42A 4L3WA 1O57A 2HU7A 3FPJA 1MB3A 1E1MA 2ZE5A 3AR8A 1E1DA 4E3WA 1EA7A 1EIZA 1YDFA 2YX1A 2TMYA 3TZHA 1Z12A 2LZ0A 1VRWA 2H4XA 4D92A 4Q48A 4K03A 3T7CA 3UG7A 5B4UA 5KC9A 4WZBE 1CE8A 3S7TA 1XEWX 3K73O 4JK3A 3BREA 1ZC4A 3EZ7A 1K9SA 1XJ5A 4J49A 3O7MA 2OAP1 1P19A 3RF7A 4O2RA 3ANXA 5K9ZA 4BKPA 3PGMA 1C2YA 3UBTA 1GTZA 1Z4JA 2Z5VA 4DC9A 1CEXA 4NU8X 2BF7A 2ZBVA 1H85A 1A7JA 3B3JA 2ZRAA 1LC3A 1SVUA 2HU5A 4NNPA 3LGSA 3RUFA 2YQZA 2Y66A 3LQRA 4FOOA 4IDBA 1GQSA 4IRXA 2HSGA 4J0EA 2D7JA 2VPTA 1H1TA 3HJGA 3ORYA 3P0JA 3RG8A 4CQLB 4CL3A 2RKOA 5A7FA 1RXUA 2R48A 4OGGA 2WIKA 1HT3A 5EGSA 5L6LB 1BAPA 1V95A 2VSFA 1HDOA 2AG1A 4NX2A 3HZHA 4D8UA 1E61A 5ESRA 2NPFA 3RRNA 1Z6AA 4E5YA 2C7OA 2JZNA 2NYVA 2OCIA 4HL6A 2GKGA 3QE4A 2Z3ZA 4Q18A 4WT7A 2AD1A 3AUJB 2P9CA 4OJTA 4RE6A 5ICEA 3FTQA 3AIOA 3BXZA 1YZNA 3EGCA 4GW3A 3RS0A 1SVNA 1MU0A 4QT4A 1SUBA 3GROA 6CHYA 4IHAA 1B00A 4XPZA 2IH4A 4DY4A 2HKIA 4Q3NA 1ZNYA 2FXIA 2RIPA 3M3PA 1SUSA 3RFXA 5KVAA 1Z45A 2F17A 1JWLA 3EVGA 4EJMA 1KC1A 2PT6A 2E21A 1NVBA 4B75A 1X9GA 3VNAA 3SHWA 4AMYA 1QHGA 1G7CA 1Y0BA 3CZQA 5D5QA 5DZSA 4ZCQA 4RVHA 1XTBA 2YCBA 4HMOA 4D0RA 4MR7A 3ZC3A 4C05A 4CE6A 3K15A 3I9JA 3NTLA 4XVQA 3HCNA 4I50A 1JFLA 4GM1A 1Q5PA 1L5YA 3AR7A 1J39A 4O5OA 2HHCA 4P7BA 4PN3A 5HVNA 4LOKA 1OT5A 4XVRA 1K6MA 3LX8A 4G1FA 3VR3A 1N4AA 4OIFA 1MV5A 1SWWA 3H75A 1P44A 2FP3A 4C0AC 2DBRA 2VS1A 5DIFA 5KYTA 3WLAA 3AILA 2IODA 4RK6A 4IMPA 3EXFB 4OD0A 3TEJA 4C22A 4GOLD 4PRZA 2A59A 5CLJA 3HABA 2JA1A 4DDKA 2X5XA 2H3HA 2VWHA 1R0BA 3F3MA 5AI5A 2PGIA 1YAHA 2D1QA 2FSFA 2X7XA 3LUFA 5PNTA 3SSMA 2QRPA 1Z4LA 3RVPA 5CEEA 1GU0A 4CLOA 3H9QA 3LNTA 2P9JA 5IJWA 1PQWA 2FPRA 4GL2A 2J0UA 2ONZA 5LQUA 2H2FA 1A8IA 1KQPA 2MSKA 2K87A 1U4OA 3IYLW 4RMHA 2SBTA 1NAIA 3LX4A 3Q3EA 3TIFA 2A9KA 4IVQA 1E9FA 4GH5A 4RHTA 4L7QA 5LQAA 2ZSUA 1YH3A 1FRFS 5J9FA 4RD4A 2ZZMA 1IB0A 3PICA 2EW2A 4PANA 2ZBFA 4KXNA 4TS9A 3TW0A 4F86A 2J0SA 3T5MA 4E7PA 2CZQA 3A14A 3SICE 4AQ7A 3ZCQA 5ADVA 4E5SA 1U7XA 4RVCA 5CXSA 3VMFA 3DCNA 3V7YA 2VTBA 1PDVA 4JYMA 3OHMA 3H4IA 1OX5A 3H1EA 4I4NA 1I4LD 3DZIA 4K2AA 4A8JC 5AKLA 4Q9NA 4MYTA 3EIWA 4LTDA 1M2NA 3QW4B 2NU9A 2FEAA 1EAMA 2O8BA 4HX2A 2X13A 2ZZKA 2PFSA 1N25A 3HLYA 3USZA 4IZ6A 4I19A 4BQNA 3HDHA 5JALA 1TEHA 3CEPB 2PT9A 4CLHA 4DZZA 1YQDA 5H68A 4MV7A 1KI6A 2C5LA 2IF2A 2IEDA 2C0CA 3C1OA 3IKVA 4KQ6A 4NBVA 4TRJA 2VWGA 5ITSA 4PAQA 2W6JA 1KFKB 2YVLA 4RKWA 4Y9DA 5A5FA 3UPUA 3STUA 2NZVG 1VYHA 4MW1A 3UC5A 4OHPA 1NFRA 3PUJA 1R8SA 4MWEA 3IL2A 1ILEA 1DSSG 1UT5A 3P4UA 1PNQA 4QDKA 3LFTA 2BLLA 3KJEA 2C31A 3ANSA 1ZICA 2WJIA 4UBOA 5I6DA 5KNCH 4OHFA 4P81A 3LIIA 2OD7A 1JEYB 2ZIUB 2CLDX 2D2EA 1GR1A 1MGPA 1SEVA 3X2SA 2J6BA 2BLNA 4KVGA 5L4NA 2UUCB 4FT4A 4FJ2A 3NDBB 1W34A 2DBYA 1QU2A 3HWSA 3FNHA 1Z4OA 3VU0A 3BK2A 3EPRA 1FPMA 1D2CA 2WY2D 4A0RA 5B2EA 4M2LA 5F23A 3L7OA 4MHTA 2P4UA 1I8TA 1FNSA 4PC1A 4BVEA 3BH7A 3GCDA 1DG1G 3DF7A 1CQIA 2FDRA 1EDEA 1LH0A 3FLMA 3IMKA 4AF7A 3I5UA 4FD2A 3K70B 1SIOA 1M72A 3A0RB 1JXMA 2NTYC 1OXSC 4FWBA 3VO2A 4CRWB 3E9EA 2QM8A 3FNBA 1PHRA 1WPQA 1DBPA 2G63A 1AQYA 3G2OA 1DEKA 1FP7A 3Q0TA 2I0FA 4OK3A 4PBTA 3V33A 2D06A 1N8KA 3FGNA 1P62B 2KMLA 1KO4A 2WHPA 2ZDGA 1UKYA 4IWYA 1P9WA 4BX0A 3T3NA 2JGDB 3LCMA 4K6KA 4ZU3A 3ZTWA 2G8NA 4DM3A 1ULHA 3ZWOA 3K96A 4W5NA 4NMMA 4AZ3A 4N5HX 3SSAA 1OLOA 2BKEA 3I58A 2BZ1A 4UAJA 5DO9A 5AM0A 2JI9A 5CXXA 5H70A 4DCSA 4UM7A 1TKCA 3BGSA 1X1SA 2ZJ8A 3FOCA 3ITDA 3MRSA 5LD2B 4KMSA 5IP5A 2D5BA 5ILQA 3RF6A 2A9PA 4OXRA 4NV1A 4YT4A 1C1DA 2C5BA 1FYVA 2Q4BA 3NT5A 3JQFA 1RYNA 3N28A 2CF5A 5TC4A 1RWVA 3FZQA 4NS4A 3UT5A 1FLDA 1GKKA 2XAUA 1FRVA 5AYVA 3ZVRA 5FUMA 3NHFA 4RANA 4EHBA 3KRTA 4IJMA 5KI6A 4D6PA 2P4HX 3OQHA 3AETA 3IAS1 1A88A 1ESNA 4Q3DA 4MWSA 1W87A 3RRXA 1RXVA 4QNMA 1VE6A 4QYIA 2OHIA 1HBJA 1ZX1A 1N2SA 3KT3A 2ZT8A 2XR1A 3VR4D 4ZCMA 5CYOA 2FH5B 3E58A 2QTGA 2QE6A 2JLQA 2AK2A 1ZR4A 3DTNA 1JMKC 1BVYF 3HFJA 1Y5LA 3IIJA 4M46A 1D4FA 1QHFA 1H0SA 1ECPA 1LJLA 4IDDA 5DYTA 2CE7A 3RU3A 5AP9A 4DMKA 5JZSA 1SQ6A 3OE5A 3PYXA 3CR8A 2QLMA 1CP2A 2DUWA 3RCBA 3ZW8A 2GM9A 4GKAA 4BFVA 2V4MA 4A6DA 1SG6A 1AZTA 3KJIA 3QVOA 1XNHA 3SF8A 1YVEI 4H6VA 2WFAA 4G4JA 3TH5A 3M5PA 3Q87B 4MO2A 4V0KA 4YRGA 1XZHA 1JB9A 1A5AB 5DT2A 1Y5IA 2I4OA 5KUTA 3SYMA 4RFVA 1D03A 2B4AA 3VNRA 1Y1KE 3DPSA 2IYVA 5E2BA 3ZGLA 2W2LD 3IKMB 2NZ8A 2OV3A 2RGAA 3ZGXA 1N8TA 1GT6A 3A06A 5EG5A 4TUYA 2X0RA 3I6ZA 4OAOA 4DLKA 1MB9A 1FCJA 1QH1B 1CRWG 5JXWA 5T3UA 1GZUA 1GG8A 2SICE 4PAMA 4PGAA 4XCQA 3KIPA 1KRXA 1EVYA 1TU4A 5JDIC 2J9YB 1A9XB 3K05A 3VTZA 5LZ9A 3DT8A 4S1OA 5F9HA 2VTEA 4GI5A 2PPVA 3CSSA 3O2QB 5AKXA 3SSNA 3ND5A 3SWWA 4YX9A 1QIFA 4MKGA 3CLVA 1AQ6A 2ZRQA 3ICPA 2P9ZA 3E0XA 1I7QB 2FAXA 3BUSA 3FZEA 2YW2A 4RKQA 3E7XA 3JQCA 3NLLA 3TO5A 3DS8A 2DY0A 1DI0A 1T1EA 2VF5X 5JMWA 4PYQA 5ED4A 4DR2B 1IVYA 1QCZA 2QX9A 5H02A 4Q3CA 2RGWA 4MKRA 2XVZA 2ZBDA 1GZ3A 5J4VA 3QY0A 1O5IA 1VBNA 1EP3B 2YXBA 2I22A 4IWXA 1XLUA 3B51X 1ZI6A 2JDIA 2JGLA 3DBIA 4TTIA 2WQ7A 4X1YB 1KZ6A 2GD1O 1BU5A 1PNVA 5GV8A 2E6KA 1KMMA 1L8AA 1O96A 2A5YB 3MGGA 3KLPX 1F06A 3BYZA 5A6SB 4O33A 2PMWB 2RH9B 2CMHA 3ADPA 5JBIA 2JIZD 2XYQA 3A9TA 2YWJA 1GCUA 2GHIA 3FM9A 4TKUA 1XWIA 1I4WA 2QW8A 1MAHA 1JDBC 4KQKA 4D3SA 1CG6A 1U8AA 4ND4A 3C6YA 2HX1A 2D1TA 3IEXA 3LYAA 2HIHA 4PXAA 5IAJA 5B4VA 4HG2A 1XTPA 2P1RA 1SQ0A 3CPHA 1ZU4A 1WXDA 1XTQA 4RKRA 2GX6A 1XWWA 2PLWA 2HB6A 2WYUA 4N49A 4NYIQ 4UUMA 4D9MA 4XWOA 2JC3A 2COEA 4DJDC 3EVZA 4TTPA 1JKJB 1R18A 2FFHA 1L1EA 3UJ8A 2GK4A 2I3GA 4BZXA 2NXCA 5J5AA 3ICEA 3ASYA 3QLEA 5HMLA 4B7XA 2HNAA 5AIBA 3ZGVA 1QRUA 5AOBA 3P9ZA 3D6MA 1N2OA 3NZEA 2WJYA 5KBYA 2P67A 5HJ7A 1G5TA 2IU4A 1UAYA 2AKAB 4PINA 4X44A 3U0VA 1GNVA 4Q37A 4ZYVA 5BQFA 3KO8A 4DAEA 4I50F 2YWFA 5JCOC 1Z35A 3HK2A 3TRFA 1SK9A 1GN9A 4OMDA 1YB7A 2G67A 2EKDA 1PVOA 1RJDA 1TF2A 2C2XA 4LYEA 4XR4A 3TTUA 4E6EA 5CRIA 4G23A 4UEOA 1E6LA 2J1LA 4M6WA 3KU1A 4OXYA 4IVPA 3FRJA 4N47A 4OHVA 5FD8A 3REFA 4EDFA 5LQRA 2GO1A 3PCXA 4V03A 3A4IA 2YZKA 2ZQ5A 4OV6B 4Q82A 3HM9A 2IXGA 3IJPA 5TT1A 1AQIA 3ZHCA 4HTFA 3E3LA 4M0UA 4U7GA 4R2KA 1UMCA 1HH4A 3RYCB 1PS8A 1M6NA 1WBJB 2QZPA 2Z5GA 3B85A 4OXIA 4RY0A 4BCCA 3CF4G 2QL6A 2C2YA 2IOFA 3A1VA 4RJJA 1RHRA 2PU7A 3AL2A 4ZT7A 3TB4A 2YDYA 4N5IX 4FDUA 1HE2A 3MD9A 1MDBA 2P3LA 1E9EA 4LJYA 1H9CA 4JQSA 4C03A 1QGZA 2Y1FA 3CW2A 3A1NA 3OLZA 4ABTA 2W2KB 1HRKA 2PUHA 2I4IA 3NHRA 5BRJA 1UANA 1YS2X 3I8OA 4ENVA 5K99A 4BBPA 1NLUA 5E7IA 1E4EB 1UPCA 3COWA 4TTVA 5SZKB 4RACA 3JARA 4XX1A 1FW8A 4DNOA 1S9DA 1TC1A 5KTNA 4MVYA 3RS2A 3T3MB 2PZJA 4V38A 4KNYA 4OKNA 4IXMA 2FR1A 3M6VA 5BRAA 5ALFA 1CUGA 5DHAA 1Y7IA 2VF2A 2VJPA 1GPKA 3GLSA 1UP4A 4J8PA 1SIBE 3H11B 3IAM1 3R5XA 4CTMA 4PNEA 4QBKA 4POAA 1KPIA 4ETWA 3VHQA 4HAUA 3CVVA 1P91A 2JAUA 2Q5QA 2H59A 1ZA1A 5EHGA 4XDZA 1S96A 4L08A 3UWOA 4M9UA 1CX9B 3IHKA 1EA5A 4G8BA 3R5FA 3GGOA 4M1WA 4RHCA 1BFKA 1NQVA 1P9LA 2BV3A 3K0AB 1WCIA 4HVCA 3IR7A 4GECA 4GBGA 2WZCA 2PWZA 4Q7MB 4ZDIA 3S6JA 3H5IA 2RHHA 4TXLA 5J2UF 1HYEA 1IHPA 2Q0QA 4N48A 3IAAA 4TYPA 1W5AA 5TX7A 3TPFA 3U9TA 2OG2A 2OXEA 1JW9B 4A92A 2EZTA 1CQZA 3SF0A 4MKHA 2JFBA 3P7MA 2VUHB 3A3YA 3VKVA 1GVNB 3CRNA 1MN6A 1T1IA 1UOEA 2GZAA 4KXLA 1Y3CE 4E1BA 2X8LA 1TTHA 1RLTA 2ZUBA 4FHFA 4PSCA 5LB2A 4EB8A 4CIBA 3QJ5A 2VHUA 2O2CA 1Z62A 4QOIA 4I3FA 5LR6A 1T9BA 5DWVA 4XWAA 4O1IA 1K8RA 3ND7A 5JAZA 1BDIA 4PGGA 4TROA 1DC3A 1Z34A 4J4HA 3DE2X 3CRMA 2O57A 3F5MA 2Q5HA 1WDKA 1C8BA 4H4EA 2V3VA 3RUIA 3OWHA 4OFZA 3DEJA 3TBHA 4C29A 2XYPA 4HQRA 3BB4A 4Q7QA 1S2MA 5GP1A 3RANA 4PC6A 3JQ8B 2IGTA 3SQMA 3D9QX 1N8NA 3EGEA 1DHRA 2BEVA 1WU7A 3BIOA 4M7RA 1EVKA 5J2UB 3GIWA 4HVLA 1U2SA 3IAFA 2DKFA 4LMAA 5HG0A 1BKDR 3CUSA 4V2IA 4OLHA 4LVUA 3FTEA 2CJYA 3EJWA 3ETJA 1U90A 2AHOA 2PNFA 2VZLA 2GK3A 3BF8A 3EVAA 4FKBA 4UUAA 2QY9A 3F96A 4E51A 1VJ0A 4YV0A 1SBTA 1VGRA 1B43A 4MS3A 1OBCA 2CXUA 3EFHA 4L6IA 1UUFA 2WICA 1EZ1A 2PUAA 5KNCA 1DC6A 2QZ4A 3MTBA 4U9UA 2P2SA 2WSYB 4R2JA 3AR4A 3Q40A 1XKLA 1K7FB 4LZJA 4FX2A 4H7DA 2X9VA 3EPPA 4WLVA 5AI6A 1QRSA 4AC9A 2WKWA 2Y6UA 3QWIA 1OTHA 1EQ2A 2V9PA 1T35A 1YOBA 4ZHQA 2NSYA 4KXXA 2W6NA 3GLQA 2BFAA 2WWIA 1N5OX 4ZJYA 4IFBA 3PPYA 4FIDA 5ER6A 3UK2A 4ZZ0A 3CZMA 1JFFB 1P7CA 3SZLA 4ZYWA 1G7TA 1R9MA 1Q16A 3HMQA 2ZYAA 4G1UC 4JLWA 4PFJA 3O8QA 5EJ4A 2RH8A 4DNFA 4ZVRA 3P2YA 5K8VA 2ZSBA 5E9WA 2ENUA 3ASZA 5ALVA 4IO0A 1BXZA 1YR8A 2HHLA 3N70A 3NCTA 3U4AA 2A6PA 5TMEA 7AT1A 1DELA 2VT7A 3DT9A 1T5LA 1CERA 1R0YA 4QC2A 5AIAA 5E3JA 3KLBA 4HBGA 1ZS9A 5TMDA 2IYWA 3VO8A 2M32A 1BYUA 4PF1A 4RA6A 2YJ4A 1EUYA 3ZOZA 1BQ3A 1K8QA 1JRLA 1J8FA 3SXJA 4OHYA 1WV0A 1JHAA 1M34A 4L3VA 2NO6A 3L9WA 2IV3A 3M3DA 2R2GA 3JASA 2Y05A 4HO1X 1XDGA 2O3SA 1R0WA 5BUCA 3HP4A 3I1IA 1GHTA 3SHVA 1XVLA 5KNDD 1L5MA 2V0GA 4ARIA 3OTIA 3ZCTA 1AQJA 1C9EA 3CKYA 3FRHA 2I29A 4WSOA 1OAOA 3K9CA 5JSYA 1UKZA 2J41A 4BKQA 4DCOA 3FDIA 5JWOA 3OKPA 1JIUA 4JBNA 3E61A 2MIIA 3RBAA 1S3GA 1BDJA 1QUEA 2GS9A 2RGEA 3CUKA 4FYHA 4F8YA 1UP7A 3DDHA 3TL6A 3GPDG 3BORA 2FW9A 3VYSB 5JBQA 2GPTA 1YA8A 5E0KB 3UV6A 1BRMA 1C3XA 2GEDA 3SLRA 5EJ5A 2IS1A 2XBUA 3KKQA 3TJZA 1WUIS 3JS5A 1FOEB 3UXMA 3MW8A 4FGJA 4QO8A 3ONDA 4AJ1A 1UPXA 3ANMA 1FDSA 1D7AA 3M4NA 2IW1A 3RKUA 3LD9A 4YNBA 4TUYF 4AKTA 2FMHA 2XMGA 4EFKA 5EAIA 1N5IA 1YCFA 2QXUA 1W36B 2ES4A 4KTVE 1R0SA 3LG2A 1BCRB 2QP9X 3SNKA 5GAJA 1AQNA 2AYXA 3B3FA 3C8DA 3HFRA 3K9QO 3HR7A 3PFKA 5KQGA 5FUYA 2PUDA 1TK3A 1CUXA 1SBNE 4LMRA 1QIDA 3KFVA 3DONA 4YGXB 3T7TA 5YASA 3D0RA 1PZHA 3A27A 5JNUA 3JQRA 3ZV3A 2CLMB 3P71T 5CCBA 1BA3A 2LCIA 4TSFA 4YS6A 1Z5UA 4D97A 1IQPA 4KLCA 4WZAA 1SOWA 4TVBA 3SLKA 1ZSYA 3QKIA 3STWA 3U37A 5AM3A 4WCDA 3OU2A 3WWEA 1L7AA 1X7DA 1Z26A 2M1XA 2RGBA 2C78A 3HYNA 3EULA 3UH0A 3V1TC 3ZZMA 3ISVA 3L0IB 3P1JA 1RQNA 4OOEA 4WCFA 1AK1A 2F4NA 3OOSA 1N92A 3AYZB 4JZKA 3SKXA 1V16B 2G0TA 1PFGA 4G4IA 3E7DA 3O94A 2BGKA 3PEVA 4D98A 3JSAA 1JR2A 4ZZ2A 1UQUA 2FRDC 5A5EA 2ODBA 4L73A 3G5MA 3NKLA 5CT6A 1W85A 3ZHVA 1ZCZA 1PLKA 2JJ2A 3X1WA 2I71A 5IANA 4MUFA 4L4YA 1I4OA 5I48A 3T7RA 5B6PA 1NU8A 2J9XB 3IP9A 4DIEA 2NU8B 3G9QA 5CDSA 1J5PA 2UAGA 1KYYA 1FFWA 4JC4A 5JD6A 5G53C 2Q4OA 3FWHA 2YXPX 4DNXA 4F85A 2SHKA 3NQ41 3OIGA 4ZQCB 2POCA 3FGPA 5LMCA 1FMCA 1YUBA 4YGYA 1VL1A 2FUEA 4PYIA 4PBSA 2R1VA 4A1OA 3HJNA 1KEWA 1ZH6A 2ZJ3A 4C5AA 1V8FA 1S3IA 2AFIE 1VSQA 2R5NA 4XWTA 1QU3A 2FHPA 4R6WA 1HT2E 3V6MA 3FXAA 5KX5A 3D7MA 3R1IA 4YO7A 1FTSA 5H3CA 1ONSA 2EP7A 2ZCJA 2FUG1 4PG4A 4EY6A 3CKMA 3F73A 4N18A 3INRA 1XAIA 2IW3A 4INPA 1EU1A 3KP1A 3K53A 3V1UA 1EJ6A 4HGPA 1MOQA 2POQX 1BFUA 3PC8A 1KO8A 1WMDA 2GM5A 3LGAA 2CZGA 1LPBB 3OECA 5F21A 3THWB 4UHJA 2A30A 3UGJA 5KOHB 1R88A 1OH6A 2OPHA 4NE9A 3AKYA 4F4HA 1JIIA 3UN1A 2G1PA 2JB9A 2Y1GA 3C7AA 4EJSB 2FX5A 5EERA 1W1UA 1XFAA 3ZU2A 4FFWA 3U7IA 1N5KA 2QUBA 2P65A 5KB3A 3AVPA 4MV3A 3HSSA 1I6WA 1NVVQ 3UK0A 3NH9A 4DIKA 4YV1A 5KKCA 2C77A 1L4EA 5CNMA 5AQ1A 5C4MA 1N1EA 3ECSA 3VJRA 2XWPA 3K1TA 3R6GA 3UJAA 1OI7A 4O3FA 4DSZA 4FMDF 1B42A 4JKOA 5T6MA 4I1PA 1FK8A 4LZPA 1VMKA 1ZUWA 4TTSA 3TZKA 2H29A 4MDHA 2ZWPA 4XR9A 1T9ZA 1AOXA 5LVAA 5AXAA 5C1BA 1UMKA 1KOGA 4BO2A 3A1SA 3FTFA 2ARKA 2A9QA 4P3OA 4FQ5A 2E4AA 5ITZA 4EJ6A 3TRKA 2WAMA 4M22A 4ZVMA 3ZE2B 3KAJA 4C2AA 3C3KA 5HKAA 1H2EA 1J33A 1RWWA 3M6XA 4FD3A 3CVOA 1VKHA 2PBZA 4HH3C 1PEKE 5DK6A 5AW7A 2G06A 2DCMA 4FFBB 1G5FA 5F5LA 4Y2QA 3N9IA 1X1DA 3OLXA 3E9MA 5P21A 3RVBA 1NMSA 3S68A 1GRNA 3VMMA 4BVKA 4D56A 1P7WA 3F9RA 4C0HA 5G2OA 2ATVA 1RMYA 4Z6KA 1EHIA 1NW9B 3L7BA 1GILA 4HSEA 4IIXA 1SVOA 4OGKA 1HF3A 5AJTA 1UBMS 4WESB 4XSHA 1CUWA 1SKUA 5U4XA 5JAHA 1XTIA 3D81A 3S5JA 3VKWA 1XRSB 3KVVA 4N4AA 5L3QA 1FMJA 2I76A 3AHGA 2Z8YM 2FEKA 4KZPA 4LYGA 3DVRX 4YI5A 1CLUA 1VIDA 2J45A 2BRUA 4IV5A 3ZX4A 1ISHA 4OQPA 2X0EA 5ALHA 2SKCA 2IJGX 3G0IA 1K98A 1U8EA 2HQRA 3HGMA 4HXGA 1GTVA 3BB1A 4GOJA 1IMOA 4MV0A 3CNEA 1R0LA 2XVMA 1FNNA 4N0PA 4R1LA 4YFVA 3HN2A 5F2OA 3X2EA 2REXB 2QN1A 1CTQA 2WUVA 2ZS7A 4S1TA 3NTXA 2AFIB 2CWDA 4UTZA 2OFWA 1TAQA 7ABPA 2Q1YA 5CT9A 3D8RA 4C6TB 3EAFA 4HS9A 1V39A 4YP1A 5GMOA 5HCNA 3KLNA 5DH9A 4JI2B 3OMLA 1G4UR 2OL4A 4Q9DA 3U17A 5AW3A 3PT5A 1FVOA 2Q4EA 4LRTB 1Q77A 2C9YA 3VXKA 5ILOA 2GAOA 4FZ3A 1QC5A 5HOQA 4E13A 4GQBA 2QNBA 3ZJUA 2C4NA 5HILA 3KT0A 3DDZX 4YRAA 4LKOA 5BQXA 2J3JA 4IDFA 2UUBB 1QYDA 1B3RA 2QOEA 4QFMA 1EGHA 5E1MA 5HUQA 1U7HA 2E4UA 4BFSA 3G7SA 4CQNA 3QWFA 4NBRA 1BJKA 1M8GA 2QX7A 4K9MA 4EENA 1SHZA 3AG6A 1A7UA 1QIIA 2CN1A 2WWHA 4KH0A 2ZSHA 3KYIB 1RI2A 2GXUA 1AVTA 4ZEOA 4DIOA 4NCNA 3QTTA 1WETA 1Z18A 5EJGA 2JW5A 3ZEIA 3HXTA 4P4NA 3MLBA 3HA7A 2P62A 1HQKA 1N5DA 2FE4A 2JIQA 2BELA 1A2QA 3QPBA 3ZIDA 2CDRA 4ZHQF 5KHLB 3SYRA 4X61A 2DWCA 5IMBA 4KSBA 5I9NA 1LSUA 4CDGA 2OXRA 4QUHA 3E22B 2V7WA 3M6MD 1L7PA 4EGJA 3K30A 1R4MB 1T2UA 4K9RA 3GUYA 2JS7A 1G20B 3TX6A 1KAMA 3EFBA 1N57A 3GN1A 3WG9A 1XRJA 1QS0A 2QMOA 3QXHA 2JRLA 1SHKA 1ZM2A 1SCAA 3OE4A 2IRWA 2GD6A 4R7TA 3UMJA 2WP0A 4WZAE 4JT9A 4MVWA 3RS8A 4DLZA 3G2LA 5CAEA 4ZTUB 2D3WA 2QJRA 1YZTA 1VGVA 1YU9A 3D6HA 3UAGA 4ENPA 2PKCA 2C7PA 2ZJAA 3NEYA 4WOCA 4RV9A 3SQOA 1I94B 2BFBB 3EWSA 5K0BA 4JQYA 4Y2VA 3PNMA 4J2HA 2P2LA 3DEAA 1UXOA 3W2IA 4BN0A 2DFNA 2X22A 2RJNA 2JZOA 2HCBA 1W1WA 3IODA 4X65B 2F3PA 3EEFA 1LRJA 5AVUA 5AOAA 4MI1A 4W1QA 3PHBE 1N3LA 2Z3VA 4OB6A 3KBBA 5LYYA 3RABA 4QXRA 5AKGA 4DMUB 5SZJA 2E3JA 4PIPA 3WGLA 4EY7A 1EH5A 3NVDA 3V2IA 5E6RB 3RROA 5CLQA 3VDXA 2EFHB 3EZXA 1GEEA 1GSAA 4QUBA 5GZ6A 3X1XA 2OFPA 2R7MA 2XE4A 3GPCA 1EDOA 3JAKA 5FL3A 4CV0A 1R0ZA 3UMFA 3QX7A 4BMXA 5BXYA 5FJJA 4PO9A 2ECQA 1RFGE 1WCYA 1O5OA 2EIXA 4PYOA 3ZNQA 1ZHHA 1MKYA 1UBEA 1VHWA 1Y7LA 2C96A 2QG9A 3MGAA 4H7EA 4KDCA 1E0SA 3O1HB 4LPSA 1MZPA 5JCJD 2QAGC 3HR8A 3HCEA 3HYRA 2ZRIA 3A32A 3KBOA 4TTQA 1KSGA 1QZZA 2DR0A 2IZ6A 2NX2A 4F3KA 4JC0A 4JYPA 1UBRS 4P84A 3KDAA 4DNPA 1BEZA 1KO5A 1W46A 1XTTA 7REQA 2M6SA 5IMSA 1UK7A 4LY6A 3TQQA 2R6DA 3WMXA 5A62A 3IDQA 2J4FA 4B3BA 2WA1A 5F2KA 1C7RA 2WSLA 1ZXLA 5DBEX 2J5XA 1QNFA 3SSOA 1BKYA 4HP8A 1K89A 1SXQA 1NVEA 5AHWA 5B37A 4QECA 1YZGA 4CW7A 4F6LA 2YV3A 1DBVO 1NR7A 1P18A 5EUMA 4ZAVA 5FAXA 5JNRA 4PZYA 2CUNA 1CRQA 4G0PA 4LNAA 3WYFA 1Z4QA 4W5JA 3N6RA 2DR2A 5AOVA 3WX0A 1DWPA 1KVRA 1FJHA 4MVJA 1WDLA 5JJIA 2YHAA 4PICA 3L7LA 5HFJA 3BHJA 2X8JB 3P32A 4EYSA 2RGNC 4B45A 1XZLA 2CV1A 3IJ5A 4IGEA 3D2CA 3Q9SA 1I7DA 5CCEA 4WXRA 2YR0A 2EG9A 2FK8A 1XXHA 3FCUB 2F1KA 5ITVA 1JILA 3D8SA 4UQPA 3U49A 1OFUA 5B2FA 1JSCA 3LLMA 1DCMA 2VHTA 1F2TB 3TYXA 1BE6A 5CM9C 3M83A 4OSEA 4LN1A 2D4HA 4IEFB 1KKLA 1GL9B 1BX0A 2O7RA 3WLFA 1PT5A 1C3VA 2BBWA 3KKNA 3Q7SA 1MJNA 4EGSA 4AJPA 1G42A 1W48A 3RODA 3B5EA 3QP9A 2FPXA 4M9RA 3U7GA 5GV7A 3DKPA 1GUBA 3IQFA 2DWPA 2IHTA 2IZ0A 2CBZA 3CONA 4HGYA 1MV8A 3G1TA 5BSKA 3KDSE 2I54A 3PNKA 3GRZA 1B1AA 2JH3A 5E2AA 5JRJA 3DE0X 4TL9A 5DI3A 4PZAA 3RFVA 3UWPA 3FVVA 1DAOA 1EVJA 4YP0A 4YV7A 4MGEA 4QFBA 3K8OE 2N1MA 3TMKA 1L4MA 2PHZA 2R86A 4RO0A 3G8AA 5DASA 2OILA 2BEJA 5G0SA 4P3YA 4YRJA 2Q99A 4WFKA 5CDGA 4LC1A 4RDCA 4YQZA 2QLLA 2C9MA 5KX5F 4DM4A 1C7IA 4AFNA 2GBGA 4LNUA 4NU0A 4EY3A 4DIFA 3MJ4A 5HNKA 3M1YA 1LJ8A 4L1KA 4DZTA 2SCUA 5J4LA 3ST7A 3JQ7B 5CMLA 2FR0A 1WMEA 2HWUA 1UDRA 4RABA 5F98A 2OGSA 1FVXA 1LF5A 3ODPA 1N1MA 4CUKA 2A4KA 4HEHA 1XWFA 3F3YA 2MSWA 4XTRA 2SECE 3PR2B 3M0EA 2ZULA 5KHOC 4KBYA 1Q95A 1TU3A 5GGYA 1K86A 1LK5A 2DC1A 4PM4A 2C5HA 5JSZA 5F3WB 1WG8A 3KB8A 4JUFA 3D8BA 3T54A 5K51A 4BGEA 1QAOA 2C94A 3FVWA 4BVFA 1N0HA 4C06A 3C16C 2ZYIA 2B4RO 2H54A 2JLUA 2HBYA 1V9LA 2OBBA 3OCVA 4IJUA 4WCFC 1DC8A 1ZVQA 4FMPA 3KUDA 4RGQA 2WF6A 3MCVA 5AW6A 4KRXA 2XLCA 2HK9A 3B70A 2RI0A 1WWKA 4ZC1A 4G0QA 1YA4A 2P4SA 9LDBA 3AINA 2B83A 3RJTA 1SA0A 4WOJA 1YJQA 1O1YA 4CMCA 3P94A 4ZT6A 3ZQJA 1AO0A 4ITRC 5AM4A 3EA0A 2ZANA 3UM9A 3IV7A 2YVKA 1NPTO 4C6SA 1YVUA 3M5WA 2ECPA 3NBMA 4LIPD 2XNDD 2HSWA 3M5CA 1Q20A 3GEHA 1OVMA 4NABA 1X70A 2WJWA 5BYAA 2QM7A 3BN3A 4FW8A 1PUXA 3I34X 1OXXK 2F4VB 3H2JA 3FOZA 1CR2A 3AF0A 4P4LA 1NNLA 1D1QA 1L4GA 3I76A 1TKBA 2XQGA 5LLSA 1L1RA 1TQ6A 4JENA 1WMSA 1BDMA 4AB1A 4G07A 4G9BA 2DWOA 5CP8A 2CNWA 2GJAA 4FILA 2XCOA 3QVKA 4JU9A 3ZTYA 4GE3A 2B3DA 5EPOA 2PIDA 3B1YA 5TJHA 1XZAA 1JG7A 2OGWA 3U4GA 1X7YA 4DWJA 3QUSA 1RLMA 2FR8C 2OHGA 3G3EA 4HEA6 5HF8A 1PSZA 4WY8A 3VVMA 2BGMA 5EEGA 4II2A 3B1FA 1SM4A 4QGFA 3IX7A 3PC8C 2JFQA 4FUTA 5K3CA 5LMZA 5TSDA 2J09A 3RH0A 4U7DA 2AJTA 1J06A 1AT1A 1RQPA 3QVMA 3TI9A 1OLUB 4UFNA 4OQFA 1ICIA 2X4DA 2J4CA 4AF6A 4B6SA 4C0SA 2DZDA 2HL6A 4DRYA 1SC9A 5JH7B 5ICSA 3JALA 1NVTA 1ZXXA 1M1NA 4TTTS 2IEYA 5FUQA 5A02A 3T61A 4CEHB 4DB2A 2JBAA 4RWZA 5ABPA 3EE6A 1T15A 3PFHA 1KBOA 3BK7A 3UAYA 1V47A 4B47A 5CD9A 5J4KA 4AWAA 5IBCA 1HNWB 2WUGA 1TL7C 3OX1A 1LRKA 4TYMA 4GI7A 5JCZA 5FTJA 3DZBA 3WLSA 1E0AA 2P7IA 4LHSA 3VJMA 4W5RA 5K3AA 1QZTA 3G2HA 4G8DA 4QFCA 1OLSB 3CUVA 1KC3A 3A9UA 4MGYR 4C5BA 5HKKA 4C08A 4IFIA 3KAKA 3HA2A 2IHZA 3LT0A 1KI9A 2YV2A 1E2QA 3R7LA 4ZICA 4DRXB 4XM1A 4G0WA 3OQ1A 3DOHA 2H8GA 1DG3A 4HDKB 2P35A 3H9EO 2NPIA 2JLYA 1ECFA 1ECCA 1SKQA 2C7RA 2DFPA 1BMFD 5FUBA 3RYTC 3DWEX 3DE5X 2BL4A 1P9NA 4L51A 1FS4A 3UJCA 4F7WA 2BI7A 2UUPA 3A1FA 1Z36A 5CNIA 1S8AA 1EFPA 2ZUSA 4NYIR 3DMRA 1V3UA 2C84A 2FJUA 2OK8A 3DMNA 4O4JA 1V26A 2VKTA 4WFJA 4O2AA 3RUEA 4B6EA 5AVXA 2EV9A 4TT3D 2CFSA 3O3OB 4WQMA 8ADHA 1VIMA 4N8DA 4I7EA 4CF3A 3CZRA 3VNQA 5FBRB 2H00A 3GJZA 5EIAA 4ND8A 1PO7A 4LZAA 5A7HA 3UFXA 1KOJA 3C85A 5TPWA 3BWDD 3GYGA 1NR5A 1E2LA 2CVQA 2JNWA 3BKWA 3NOOA 4MVJE 4BMZA 5MDHA 4BFWA 4PVDA 5CVEA 4CKWA 4G8CA 5LU8A 5SICE 3DV0B 3RYHA 2O6HA 1KS9A 2QTAA 4O4IB 4Z3DA 4WGFA 2DERA 4F3CA 2PO7A 3LPAA 1DFIA 2FG7C 3M5DA 4I46A 2HAEA 3BL8A 3DBRA 4MGIR 4N5DA 1ISFA 1ENYA 4LOJA 2L19A 1XXHE 3RVMA 5BW4A 1MC4A 3RSOA 2CLLB 4YCSA 1KR5A 3JQGB 4P7KA 1PJBA 1YRBA 4ZMBA 5IWCA 2P68A 2Q29A 1V11B 1W0KA 1Z0AA 2ZI7A 3KTAA 5ENVA 3OEYA 3Q6NA 4ENRA 3LNCA 3WO0A 3L6RA 3ENNA 1IHDA 1DQNA 1EPUA 1TIKA 3NANA 4QGSA 1G2PA 3MERA 3QVLA 1T3SA 3CCCA 4I36A 4AIIA 4BQSA 2IHKA 4X24A 4ZVLA 2YYYA 4OJQA 1BE0A 1UOPA 2UZ0A 3DB2A 2UVPB 4OUDB 5DTEA 2GASA 3I92A 1N33B 1HFJA 4C2TA 1OWLA 5C5IA 3PLAE 3PD1A 3C4JA 5FPYA 5IVHA 3HCOA 3AF3A 5GONA 1BXKA 3DCYA 3I0NA 4GXQA 2ZK7A 1II0A 2FWAA 4FKMA 2OT3B 4B8YA 3R5JA 2DG2A 4HUQA 4PLVA 3RRMA 4Y2UA 2HJHA 5CDFA 1WS6A 1BWQA 3BRCA 2Q0HA 1FRQA 4ZVOA 1L7XA 1TCUA 3T1OA 4GVXA 4ALLA 2JK0A 2CCKA 3E6AA 1XRPA 1XHLA 1F3OA 5FV7A 2R65A 1T0HB 2V7UA 2WJHA 3B8HA 3JAWB 3LQFA 3NX4A 4IICA 3OY2A 3OZTA 4FVTA 4O8CA 4OMCA 4P7GA 1N6OA 2X9LA 5TF0A 1VKNA 5CX1A 3X1ZA 4KRGA 4HQ0A 4TN1A 2YJNA 2BH9A 2ZI9A 5EZQA 4CETA 2C4WA 1EX7A 1ZP6A 4MVJF 2PUVA 2YOHA 2BOVA 5JAPA 5L4LA 2W2XA 1EFVA 1DAEA 2GN0A 4DQDA 4YRBA 1FFXB 3WL8A 5GJBA 1GPH1 1CZRA 2J3EA 3QBDA 3EF1A 4B84A 1MX5A 9ABPA 3AJ9A 1GAJA 2OKCA 3GA5A 4PNZA 4EFLA 3WI7A 1IBRA 1PWEA 4WJLA 3BZWA 3QQPA 1Q1NA 2PT5A 3NASA 4MRSA 1NBEA 1P17A 5F73A 2Z5LA 3JD0A 4BAGA 4U7TB 2IXFA 3U4IA 2QR2A 2HA0A 4Q39A 4UHCA 4CDRA 4DCTA 3TPZA 4E12A 4CI0B 2OQRA 1KDYA 3FSGD 4QNRA 3TX2A 4BQFA 1JHVA 2QG6A 2XNSA 2J48A 3KUKA 3ORFA 1GRCA 1B8NA 1E9SA 1VIYA 2YHIA 4MQEA 2BKXA 3HVIA 3RVDA 2FSPA 1O7JA 2FB9A 3ABOB 1GDDA 1ORIA 2PL5A 4G8JA 3F71A 3KKLA 1GO2A 1EINA 2JF0A 3LXMA 3V4ZA 2P7HA 1ENZA 1P77A 1NT2A 3SJZA 2FN3A 3GA7A 4JLBA 2BGNA 1JEAA 1WTAA 3K94A 2V0CA 2XMSA 5AJWA 5EP4A 1I7PA 2OZPA 3FUCA 4ARZA 3R0IA 3HDJA 1LLQA 1TM3E 1Z7EA 1V5FA 2GHTA 2VYND 2N75A 2OQ2A 3IOCA 1TIPA 5F3RA 5P8WA 4UNIA 3VKFA 2ZUWA 4LYHA 1NRIA 4LVOA 3PNPA 3TKLA 2HMVA 1B0UA 4JUIA 4JC5A 5T6BA 1MA0A 3PPXA 2YMPA 4G5SA 5ADUS 3TG8A 3NO4A 4QOFA 2ZB3A 4JT2A 1PUIA 5LDHA 4C4TA 1P5FA 3JRXA 3M3HA 4NL4H 4QDOA 1GL6A 5KMGA 1PT9A 4I1VA 3RDPA 4B76A 2NXNA 2Q0XA 2W48A 1YXMA 3MUNA 2X41A 1TEVA 5MHTA 1OWOA 3DVSX 3QLVA 4U1RA 5I5GA 2Q28A 1JQBA 4JMPA 3FMPB 3NRBA 3TQFA 3ZDEA 3QQ5A 3P9XA 4UBNA 2J30A 1G9SA 5JJCA 3L6CA 3Q9NA 4HFMA 1Y1LA 3KQKA 3AW9A 4AMBA 3ZNPA 3HR4A 4P2BA 3AY7A 2YTZA 2UZAA 5EHIA 3O9MA 3OJCA 2YICA 4RQUA 1JHMA 1UWVA 3IPYA 1NVWQ 3N7UA 3BERA 4KAFA 4URHA 5TEWA 4A0SA 4P1ZA 2H1VA 1FYDA 4XSVA 1ORRA 3ZHUA 5TY0A 4AG5A 3ONFA 4KPFC 1O94D 2VHCA 3FH0A 1G2QA 1B8OA 3WWPA 2E4VA 3EXIA 3F98A 1RKUA 5CGQB 1ACMA 1G5HA 1O3YA 2D1YA 5DHSA 3SR0A 2RG1A 1MDFA 1RHKA 1OC2A 4NJOA 2NZ2A 2I4LA 3QRWA 9MHTA 1PW7A 2BY4A 4DF3A 1HL7A 1SC6A 1OWPA 2GHRA 3ZDBA 1CY8A 3EEQA 1PNOA 5AW5A 4BWVA 4RZQA 5LBIA 1WNTA 2OCXA 2VJCA 1I2MA 2A0XA 1E6KA 4AYTA 3KE8A 2NYUA 1ITZA 3E15A 3OUZA 3PI7A 4GVPA 4Q1FA 3UWSA 4RIGA 3WLKX 4EA7A 4YRKA 4H35A 1FS5A 1OUMA 2ADOA 4C3UA 3I6YA 1L5LA 3EQ8A 5JAQA 3Q72A 4J3FA 2X9NA 2WUDA 2XLBA 5TB5A 3ZKWB 4CFSA 4FEEA 3H5OA 2HZ7A 3GBVA 4BLWA 4DC1A 4TLCA 2ZTHA 3D1VA 2I91A 2E37A 2ZG6A 5HDQA 5B58C 2P8SA 3TVTA 3EF3A 2GEFA 4LZNA 3UMGA 1Q91A 3ZDRA 3RUCA 3KETA 3OM8A 2WTBA 4XB2A 2ORWA 1JG6A 3AIKA 4KAXA 3LTEA 3GOHA 1AHIA 3PHCA 1VOTA 2HZBA 2O8DB 2O3TA 1P75A 1UFVA 4LC0A 1EGVB 1S6YA 3ML1A 1OREA 4NJEA 4W4TA 1ZAYA 1QX3A 4J1SA 2BFEA 3ZDAA 2OO7A 2IP2A 4C14A 3CG0A 4Z4CA 2VQ6A 5CA0A 1IHYA 4EI7A 5C5CA 3EFEA 1PNRA 3P2MA 2I6XA 1JGTA 1YB6A 4GEGA 2Z30A 2QR5A 1NSYA 4K9PA 4MJ3A 1M2OA 3GG9A 4NNOA 4K0KB 3CPJB 1ZOIA 1UADA 2C4KA 4LE1A 1WDMA 1AU9A 2VPQA 3MT9A 3PQDA 4P08A 1Q2UA 2JI7A 4O4HA 3N2GA 4OYHA 2LIPA 2FZGA 3PJDA 3EOAI 4H3SA 4RVGA 4AJLA 4DAOA 3OD1A 2FKAA 3SAJA 4E08A 3ZK9A 2G7MC 4J91A 5CD1A 3O4GA 4U2FA 2EQAA 3WADA 5T3YA 1H6DA 2FWJA 3WDSA 3WBJA 3OZCA 3D4LA 3UKOA 1HYGA 1XSEA 4BNZA 4F2GA 5LP1A 1E64A 1HDXA 1VHJA 2VG8A 2QTBA 1BHO1 1BH2A 1C3OA 4IRMA 4AICA 4DSTA 4XYLA 3RAFC 4L0DA 2KE5A 2C5FA 4CCSA 1TYBE 4BXOA 3EQZA 3A6EA 1CR1A 3COVA 1XBTA 3AP1A 1DOHA 2B6NA 1YRLA 2ZIXA 3AR9A 1KK0A 3EXEA 3IP3A 2OBMA 4GPAA 3MMZA 4ISBA 2E1RA 2VC2B 4JGBA 3EXHA 1S4MA 4QRDA 4TRMA 2O0KA 4UVIA 4O1HA 4NWIA 3DOUA 3PTZA 4A8JB 2H7XA 1SBZA 2HEIA 4IJ6A 4GYWA 4O4JF 4Y2GA 3TXYA 3G2MA 4WNIA 1NNI1 4FFSA 4EKYA 1V8ZA 3W2HA 2PKQP 3OEED 2EEZA 1N2GA 1TQDA 3DJYA 3CLUC 4TS4A 4A2QA 2HGSA 1CS0B 4BFTA 4DXAA 1KXZA 1QWOA 2QRLA 1FXWF 2WYHA 3CCFA 3WK5A 4B32A 1B7GO 2G70A 3L1JA 1SJ9A 5CJPA 5EZYB 3HP1A 5HIIA 3LUPA 2G1UA 1TYDE 4X1IB 1W9MA 1IEQA 2BFOA 5DCLA 3HO8A 3SVTA 2RIRA 2GD0A 1I3CA 1UEIA 2X1MA 3NBXX 4KZKA 2WWYA 1WZ2A 5K7SA 2IYYA 2UUAB 2WLTA 4Q1BA 1NXQA 1GAEO 4NK4A 2IHNA 3KX2A 4R54A 5BW8A 2QTMA 3PFBA 1PUJA 4Y6QA 3EOBI 1U1GA 1LPOA 3CR3C 3PUWA 4XRRA 1BE8A 4Q47A 4DQXA 3C5EA 5I45A 2BCJQ 3NV9A 4OP2A 2V97A 4B3IA 1H22A 1MGOA 2QN9A 4FWTA 4RBNA 3W5JA 4D46A 3L46A 4MVJP 3MXOA 1DEAA 3ABRB 5CH5A 5ALYA 1T91A 2QIPA 4G5XA 4HDQB 1S02A 2YRWA 5TPZA 5EIXA 3RUDA 1G3RA 5C1IA 1OSNA 1AF4A 1JKMA 2I3DA 4GLBA 3C24A 1NVVR 4YJFA 5TXGA 1OZFA 3VTKA 5IDWA 2WWRA 5JAIA 1OX4B 3CX8A 2PS0A 3K9LA 1G6Q1 1JPUA 1VLQA 4YQFA 4ITVA 3U7RA 1CXZA 4D42A 4V0LA 5GONF 5K3FA 5LN1A 3LX5A 4OQZA 1W4RA 1TW2A 2Q1WA 3SEQA 5IWAB 1A2KC 3N74A 3NHAA 1NGSA 4YRIA 1L4LA 2AXEA 4DNQA 2B1QA 1DZIA 4A2PA 3KZVA 1AKYA 2VCHA 1Z0FA 2P0YA 2QX6A 1CUSA 1T2CA 5DX1A 4C0XA 5IJ9B 1PQYA 1KSHA 4NMHA 5LOVA 2Z6AA 3WBFA 1R6BX 4HPJB 1GUYA 1OBHA 1RDFA 1USVA 3R3HA 3AZPA 1MT3A 4QDXA 2JBWA 2V96A 3PDIA 2B6HA 1GYRA 3OJEA 3JWJA 4QBTA 4XJSA 4GMFA 1PYOA 1H66A 4A0QA 1KJJA 3QUBA 1XF9A 4IKOA 4HDAA 4KV9A 4LY9A 4L8LA 4A4DA 1S01A 1IHUA 5KTPA 5BR8B 1G21E 1CULC 1VCIA 2PZLA 2IIBA 2XE7A 1SCQA 2ZJYA 3KT6A 4FHGA 4JOCA 4OXNA 3S2IA 1EZ4A 1NUQA 4AUMA 4TKVA 1KSFX 3BRWD 4L5AA 3QE2A 4N3GA 3AP3A 3AEKA 3L82B 1DX6A 5A0VA 1AKTA 1M74A 3A2LA 4KO4S 4PRKA 1RD4A 4REQA 2JJ1D 1A2OA 2Q62A 2JH8A 4NE7A 1P73A 3LC1O 3N6XA 4HB4A 4MQ4A 2K7ZA 3DHNA 1EDBA 4IIJA 4PWZA 2AEMA 4LBWA 5DGCA 4BQEA 4N7RA 4MVJG 1YE5A 3SOPA 2QVLA 3GLTA 4O4LA 3TIXB 1GA4A 1X7XA 1BD3A 4ZO9A 2EFGA 5F78A 3OQOA 1X7ZA 5J58A 4KV7A 2RK3A 3FOEC 4RORA 3RU9A 4XX0B 4WBNA 2AB0A 2WEKA 3I2KA 3K0CC 2FLVA 4NOMA 4NPAA 1DU4A 4NNJA 1W4ZA 5HF5A 3EZNA 3EDOA 4LF7B 2AD5A 1S7CA 3NM6B 5IM4F 3BTVA 1L5ZA 4KDFA 3BE6A 2JFFA 2OENG 3BSWA 4RD1A 4Y2RA 3TVYA 2YRFA 4EG1A 4YAGA 3JXEA 4D02A 4V1CB 4YB8A 5EXEA 1ZCFA 4HI0E 3TLMA 1WZEA 4RH1A 1E2IA 1XX6A 3DG9A 4CXMA 2PLAA 2Q6IA 4EPXA 5KO2A 2ZXEA 4I6EA 1WHSA 4NG5A 3ZJ5A 1NBIA 2R79A 4YIKA 3WGOA 1US8A 2HLHA 1AKNA 4O2BA 4R2HA 5TQ0B 5EHZA 1GQYA 1UM8A 3TXXA 4ZO7A 4M76B 4ZVKA 1VBKA 2YWCA 3DWFA 3QNMA 1T8RA 4MYUA 2NTEA 4I4TA 3CR7A 4QGBA 3D6AA 1X38A 2W6PA 2V5VA 3VH3A 2J3QA 4BDTA 4PPNA 2I1WA 2Z6VA 5E1DA 3FMFA 5HGJA 1JDVA 3PEWA 1QP4A 1VCMA 4XUEA 1WL8A 2WU8A 4Y67A 3RAEC 1R16A 4YRMA 4CR6A 3WA7A 1D4ZA 3ZQUA 4GMGA 2WF9A 3VOSA 5JXHA 1G8AA 1L5OA 3ELWA 3QI7A 4KWHA 4E4TA 5DNEA 3CXRA 3RC1A 1G8JA 4GS5A 2G80A 1F0KA 4IVRA 1FZQA 3I72A 4LMBA 3V8VA 2O52A 4AP9A 3WYGA 4K87A 2AK3A 2PN1A 3B1XA 2TECE 4ED9A 4R01A 3A9VA 1IBSA 3IPCA 1ZW6A 3L0BA 4TMZA 1UPAA 4KK4A 1LDYA 2OEPA 4BN5A 1GADO 1F2UB 1U04A 3HU5A 3QBEA 4BTVA 2Q5LA 1Y7PA 5GGXA 5FL7D 2WYOA 2ZLBA 2XRMA 1XZEA 3L8DA 1KJZA 3UOWA 1NTRA 5DTJA 2QUKA 2XTMA 3E23A 5B1HA 2IYPA 3NAMA 4QJ5A 4QGAA 2FXVA 1XRQA 3C3JA 3HU3A 1ZGGA 2IEIA 1D2MA 4IUYA 3EISA 1JDBB 2EJBA 2O2JA 4PQYA 3CH6A 5BN4B 1Y3HA 1KQFA <