4D9GA

Crystal structure of selenomethionine incorporated holo diaminopropionate ammonia lyase from escherichia coli
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
387
Chain Sequence
b'SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diaminopropionate ammonia-lyase
molecule tags Lyase
source organism Escherichia coli
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
total genus 119
structure length 387
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9gA01
4L28A 5D85A 2CLKB 3VSDA 3HMKA 4ZQCB 2CLEB 1M54A 5B55A 4WX2B 1A50B 5KINB 2DH5A 5KZMB 3IQHX 2V03A 3VSCA 1FCJA 2BHTA 2RH9B 4D92A 2J9ZB 3AEYA 5B1HA 4KKXB 3IQGX 1KFBB 2GN0A 1TYZA 1BEUB 4HPJB 2O2EA 5T6MA 4I1YA 5D86A 3SPXA 5JISA 4D9GA 3R0XA 2CLLB 2ZSJA 3X43A 3TBHA 5JJCA 5IXJA 2CLHB 3VSAA 5J43A 1VB3A 3VC3A 4D8WA 2CLFB 4D8TA 1KFKB 5DW3A 1TZJA 5I6DA 3PR2B 4F4FA 1CX9B 4LI3X 2TRSB 3VBEA 4NEGA 3DKIA 2Q3BA 1TJPB 1TZ2A 5B1IA 2RKBA 2J9XB 1WBJB 1E5XA 5CVCA 4HPXB 2GN1A 1V7CA 5D84A 2EGUA 1C9DB 1D6SA 4IL5A 5DBHX 2Q3DA 1VE1A 1K8ZB 2D1FA 1RQXA 1FUYB 3DWIA 4HT3B 2CLIB 1UINA 1V8ZA 3FCAA 4Y6GB 1Z7YA 5B53A 2J9YB 1C29B 5I7OA 2ZR8A 1PWHA 4AECA 5I7WA 3CEPB 1PWEA 5C3UA 1J0EA 3L6BA 1KFEB 1WKVA 5J5VA 2CLMB 3L6RA 2CLOB 4QYSA 1TDJA 5CGQB 2PQMA 2ECQA 3V7NA 4LMBA 1QOQB 4OFXA 1JBQA 2C2GA 1TTPB 4ZU1X 1A5BB 1F2DA 2ISQA 3PC2A 1Z7WA 1A5AB 1J0CA 5I7RA 4L27A 1C8VB 1J0AA 4PCUA 1TZMA 4HN4B 1UIMA 2TYSB 4JBLA 3AEXA 2ECOA 4D8UA 4D99A 2WSYB 1Y7LA 1K7EB 3PC3A 5DVZA 1J0BA 4H27A 4D9KA 1K8XB 1OASA 4LMAA 1WTCA 1J0DA 3T4PA 3BM5A 5I7HA 1K3UB 5EY5B 5B3AA 5DW0A 2RHGB 2GN2A 1KFJB 4JBNA 5D87A 1K7FB 4D9NA 4L3VA 4ZU6X 4XUGB 2EFYA 4D9BA 1CW2B 3L6CA 5HBGA 4AIRA 5B36A 1TZKA 1WDWB 5IWCA 3FGPA 2TSYB 1K7XB 1O58A 3IQIX 4D97A 2Q3CA 1P5JA 4D96A 4D9IA 4D9MA 4L0DA 2JC3A 1A5SB 2BHSA 2ZPUA 5E0KB 1BKSB 5I7AA 3SS9X 3PC4A 5DBEX 1KL7A 1VE5A 1X1QA 1UBSB 3X44A 5BW6B 2DH6A 3SS7X 4OREX 4D9CA 4D9FA 1QOPB 4HO1X 3RR2A 3ZEIA 1V71A 1TTQB 2O2JA 4COOA 3DWGA 1KFCB 3IAUA 4NU8X 5IW8A 1K8YB 4D9EA 3R0ZA 2C2BA
chains in the Genus database with same CATH superfamily
2OMEA 2WNHA 1EZ1A 1P1IA 3DLAA 5IJWA 2W6ZA 2TMYA 2FGKA 3HY4A 4NOMA 4G0VA 4B3BA 4IG9A 3U0BA 1CRWG 2BMFA 2WF5A 4GPTA 2BW0A 4B5KA 1GTZA 4LCBA 3M33A 3IQHX 3PT9A 3JW8A 2PMFA 1X92A 5GY7A 4QU8A 1TCBA 1R0CA 3LT0A 3CMMA 2LP4Y 2XNDD 3TQRA 1BKYA 2WD8A 2QQGA 4MGYR 1GUBA 3INYA 5MFZA 2NVWA 3UXEA 2ZWIA 5G0SA 1JQDA 4FEYA 3SC4A 1WUYA 2D2VA 4DMRA 4G0OA 2BBOA 2JCVA 2PQ2A 1ES9A 2BFEA 2CHFA 1RWMA 4LE2A 1HQYE 1XDSA 4DJTA 1KMCA 1X14A 1CY0A 3ZTWA 1XA4A 2I5PO 3KKOA 5DRYA 4DKXA 4EGJA 4XTRA 3L79A 4P4SB 2HUPA 2QZSA 2IY8A 3KVOA 5KEIA 1T1SA 5HQJA 5K0FA 5JARA 4HX9A 3G2HA 2WJZB 2ZAGA 3HXKA 1JDZA 2IYTA 1AXGA 3MNFA 4W5JA 3LM8A 4B87A 5FEUA 3R5FA 1KEZA 3NC0C 4UTVA 4BLWA 1D6SA 2AXNA 3LT4A 2BGMA 5JWHA 2HNKA 4KE7A 3JPWA 2FSPA 3RAEC 4JKIA 5LQAA 1ZGCA 2LCFA 3AHEA 4OU5A 2NZXA 1SCUA 2WFAA 3ROQA 3B2NA 2O8FB 2NAFA 2VKTA 1TJ5A 3E82A 3UWMA 1XRRA 4CNQA 2WKQA 2YWXA 1KI4A 1KYYA 3ME5A 4PSVA 4ZEOA 2XIQA 1CNEA 3A4IA 4BWVA 5ADHA 1W1IA 3L6RA 1QGAA 3OBIA 4K7JA 1L5VA 2HXSA 4DIOA 3N2KA 5IAOA 2BFFB 3HNOA 3IAXA 4CU5A 1PLKA 3W2TA 4DDVA 3HDTA 2PLRA 4RMGA 3G23A 5JSZB 2MINA 3PSHA 4DA7A 5TEWA 4X1YB 2CVQA 3ZJYA 6PFKA 3PEUA 1FRVA 1YO6A 1TVKB 1E7QA 1PD0A 1E1QD 1J8MF 1PEYA 5L40A 1DRWA 3CB4A 5IKXA 4FT2A 4KWEA 5KVQA 4YGXB 1ACJA 4NBLA 3S27A 4PPFA 4D9KA 2I2BA 3COZA 4CV2A 5F5NA 1RQLA 5ECWA 1VKZA 5FQOA 1V8OA 3OWOA 2GN2A 1IHUA 4JLSA 4RFLA 2AC7A 1Z47A 2RB5A 4OAQA 1NAIA 1MJHA 3UOGA 2B7BA 4ED9A 2CY0A 1N7GA 2F67A 3CUTA 3QKSA 4O4JB 1KI8A 2GGSA 3TEMA 2DGDA 1F9EA 1ZA2A 3JCZA 1SBIA 2A9QA 1EUCB 3HB5X 3N8DA 3PHHA 4HNRA 4ILEA 4S0XA 5FTMA 2IIBA 3TR6A 1G4AE 2ZIZA 3WRXA 3PQ4A 1KOGA 3MZ0A 1TA4A 4O2LA 4KXWA 3CF6R 1EJ6A 2XSZA 2IBMA 1E1RD 4XJSA 4PHCA 1KEKA 2Z8YA 3IEMA 2IYNA 3AL3A 4K9RA 4MW5A 1EGHA 1WLYA 3N1UA 2A88A 3R76A 3FWHA 3NBXX 4LTDA 4CF4A 3N58A 1Q3TA 4UU1A 5HKLA 4AJKA 3DEIA 4AY5A 1L3IA 2EZUA 1D2HA 3NVAA 2FSFA 3CU5A 4R9UC 2I6TA 3MTQA 2GEFA 3DOHA 4L5IA 1TPYA 2JJ1D 2ZP1A 1VI5A 5B57C 1E6EA 1M6VA 4J7CA 2Z56A 2VP0A 5EHNA 1EQUA 1F1JA 1U5BA 2R6GA 2GN4A 2AEFA 4AT1A 1OLSB 2ZZNA 3O8DA 4C7VA 4FDTA 3ER8A 4RJJA 5E2IA 4WIAA 3R3WA 1XVAA 5KKAA 3C6XA 3PA6A 2J3DA 2JI9A 3QGMA 1QLHA 2KBFA 3VM6A 4C7OB 2X9VA 5HZMA 2YMLA 3A31A 2Q2NA 2ONCA 4C0AC 2VS1A 5LN1A 1LS1A 2ZUUA 4N76A 5BYJA 1DDGA 4GMGA 5EKSA 5HDQA 3HV0A 1PS8A 1T4GA 1FU7A 1GNVA 1JJBA 2DECA 4IWXA 4MITA 3RS4A 1N36B 4Q48A 3CLTC 2WTMA 4TM7A 2Q6KA 4GMHA 2OUKA 2X8JB 2A94A 5AK6A 2X9GA 2RHJA 1QBGA 1MRZA 3RRBA 2G28A 2NM0A 2IHUA 4QPNA 3T95A 2HB6A 2BMDA 2C3UA 1B1AA 1Y37A 1SUCA 4DYVA 1IM2A 3OHPA 2P30A 3GUHA 3LKVA 4JROA 2IOYA 2OOSA 3RTGA 2XCSB 1U0BB 2GFQA 3BCSA 3NHWA 3FCAA 4EA6A 1IUOA 2QVBA 2Q5FA 2H85A 3AUTA 3EVTA 3MBKA 3SM3A 3WE7A 2QS9A 3QBDA 1XTBA 4QTXA 2V98A 3NDRA 1J0EA 4BYMA 4BZWA 1GU0A 1MVOA 2BFDA 3QPVA 2GHRA 3FTQA 3NM5A 4DZZA 2PRZA 1ZUWA 1N5JA 1C0KA 1OI4A 1U9IC 2AXPA 2BL4A 2NLOA 3MTEA 1YONA 3NXSA 1OX6A 1ZL0A 4HNAA 2FG5A 4RTOA 2DR2A 4CMGA 1C5KA 5J1TB 4KP7A 1E3IA 3O93A 3PXXA 4V0SA 3ESYA 4ZYYA 4RVDA 3DMPA 2VYQA 5JI3E 2ACKA 3AQIA 5I47A 1M6WA 2YXNA 3OCYA 4Q9IA 3WB1A 1FJ2A 1GPJA 3GJRA 3AINA 1JTFA 4BGIA 4LC1A 3H1FA 2AOUB 1M74A 2AQKA 3SQWA 1QG2A 4KR3A 2CNWD 1J2JA 5K5EA 5KTSA 2DMRA 4HDOB 4JJ7A 3RD5A 4Y7DA 1CF2O 3UWPA 2HF2A 5IJXA 4LFCB 4OA8A 3T4PA 2YWHA 1I6LA 4INAA 4U63A 1CS0A 1U90A 3EVFA 3WYDA 4BO6A 3ZLUA 5JOQA 4NG4A 4E5KA 5F2NA 1J90A 3N39C 3P52A 4HZUB 3EIFA 1G7CA 3AUYA 4PLZA 5HG0A 3K0SA 1Y8ZA 1PK7A 3SF8B 1U0GA 2FEMA 4KE9A 1OIWA 3ZHBA 2O7QA 3VR6D 4EKNB 3RKRA 5K0CA 4DV7B 3W6ZA 4HLNA 4PCAA 2Y05A 2VDJA 2H0QA 3U7IA 3RE1A 4D9IA 1EU1A 1CK4A 1DUSA 1UBJS 3R9KA 4M87A 4B47A 4PX9A 2FDCA 1AK1A 2DU8A 2E21A 1Z5WA 3OCJA 4M36A 2ZJAA 5C52B 1E0AA 3WA6A 4ZZ1A 1YZFA 2W2OA 3CISA 4ENPA 3IQXA 4HWRA 4KQMA 3QPBA 2HR1A 2DQ4A 2ZSEA 3KWJA 2GVZC 3BYZA 4HRAA 4YS6A 3ZEIA 4AJ1A 1UPXA 2AQ8A 4LQDA 2GAAA 4Q1FA 3HKBB 1M1NA 1I2DA 4BP9A 3MMXA 2EKPA 4ARBA 2PSDA 3PJEA 2XE4A 1S1CA 3SLKA 1QRTA 1E99A 2YJ5A 4MICA 4UM8B 2YXDA 3IHLA 3ICQB 1PJ4A 4YRCA 4BGVA 1WEHA 5I3ZA 1JMKC 3OEHD 4UCQA 4AZVA 4EARA 3K7EA 2JLUA 2FTKE 4GKAA 2FP3A 3W8DA 2PKWA 1LW7A 4WPGA 5A9RA 1NY5A 3K0FB 1NW8A 1YE3A 1FL9A 2G3YA 2NU7B 2R00C 4QU0A 2QSJA 3G9XA 4GM1A 3WS7A 4EL0A 8GPBA 1IN1A 2WWVD 3K2EA 1C3OA 1F60A 2ZJ2A 3UKDA 1C9JA 4GX2A 3RIMA 4DSNA 4XEUA 5LQMA 1U11A 2WWRA 4C4RA 2QT9A 2ECKA 5I3CA 3K9QO 4PTLA 5IZ4A 5GZ3A 2W2KA 2I66A 1QQ7A 3QELA 2ODPA 2Y71A 4OB7A 1C0PA 5ANRB 4X91A 1M5RA 4Y9UA 1GAQA 4DR7B 2MSDB 3AL2A 4TVSA 1JXOA 4G5OA 3ZYZA 3B1VA 2WJYA 4TVKA 1VFNA 3CONA 4RV4A 4WBNB 2QV7A 4I4LA 2OCXA 4M1WA 3MVEA 1ZOIA 1C2TA 4IVNA 2CZCA 3LF1A 3F73A 1TM1E 4E3ZA 2A9KA 2Y2VA 1T6BY 4MR8B 3IPRA 3RH0A 1NVBA 1M2FA 1W88A 4Z4FA 1ULSA 1C1XB 2YV4A 5B7NA 3GIWA 3V6LA 4F4JA 4RXUA 3T3HA 3HFGA 3ZWKA 3GRZA 4JYZA 3CUWA 3GJXC 3BHMA 3LOUA 4URZR 2Y6UA 4YR7A 1E0DA 4ZK6A 1IC6A 3A9VA 1J49A 4I4NA 2AOXA 1L7MA 3LT2A 4KDFA 4LOJA 3T3DA 4CKBA 5KOHB 1XUOA 4M9CA 1SUDA 2M2IA 4HWOA 1L7VC 1C3EA 1LA2A 2LZ0A 3HUUA 4JBLA 4BRSA 5JAMA 3O31A 3OVMA 5BWBA 1GSHA 2ID8A 1B93A 2X0NA 2XTAA 1WHSB 1E2MA 5HF9A 4GBMA 4TYMA 2ONYA 5EKXA 4F11A 3ZGXA 4LJKA 1SB9A 1MNAA 2CB9A 2YW9A 2FUCA 3O38A 3IKJA 4FWIB 4RKEA 2EYUA 4J3JA 4DAOA 2H59A 2XE6A 3UBMA 1NM5C 2FOLA 4TV8B 3WIBA 4E2ZA 5A3RA 2EEZA 1Y3DE 4KIGA 2HRZA 2AFHE 3RAJA 1QV9A 3G5UA 4A92A 4UBKA 2O3TA 2NGRA 3GZNB 4QJBA 4L5YA 3I6ZA 5G1OA 5JY1A 1B1CA 1CJMA 3VO2A 3OZEA 4HNTA 2ODWA 5DTRA 2CDNA 2WVAA 4XIIA 4OHUA 3NWEA 2D3WA 1DB3A 1QZUA 4B8ZA 4KXUA 2H63A 1ONNA 1RYMA 3T5MA 3KQKA 4E6EA 4CM8A 1G8FA 1K4MA 1ZRHA 3EC7A 1N6LA 1NVEA 2FUNB 4AMVA 4EX7A 3H3JA 2QJRA 4FI3F 4QLAA 4EYSA 3DO5A 3KTDA 3F6EX 4V0OA 3JYOA 2YC2C 5TIIA 2AN5A 1V8PA 1DO2A 2JFPA 3U1VA 4BS9A 3PV0A 3JQQA 4RTPA 2Y9PB 3HHEA 4CT4B 1PT5A 2CLEB 3GMTA 2G17A 4FEAA 4Y2XA 2GEVA 4D6XA 4OM8A 4DQKA 2QGFA 1JAYA 4PFQA 4FYWA 2YQ5A 5HMMA 4RFSB 5IJ9B 4ZTBA 3KQVA 2E87A 4UOZA 3JS5A 2WT9A 2GZAA 2YRFA 2ARKA 1C1HA 2ATXA 5KYYA 1BOOA 1EH5A 4QQKA 3WV4A 1IZ8A 3IR5A 1ZSVA 2JZNA 3MIZA 1JX6A 4GICA 4A03A 3HYSA 2BMAA 2C5HA 1Y7TA 4MQLA 3H5AA 1BHJA 1N1DA 2D5LA 3H5LA 1G5RA 3D0OA 4UE2A 4KX5A 2P9CA 4UDXX 4B4VA 4B32A 3ZGLA 4F8JA 3IGFA 3QXCA 1SA0A 1JI0A 1DZ3A 4ZCRA 5BY2A 2F8SA 2HBZA 2HSJA 3QVGA 3GPCA 1CUIA 3DAGA 2CD9A 4MVJD 1T26A 1CRPA 2MSCB 1SVNA 2ZEJA 2Z04A 4XVUA 4QHSA 1Z6AA 4AZ3B 4JT2A 3AJ8A 4IL5A 4U3JA 5JXJA 1WQ1R 4INZA 4QRIA 1VE1A 5LQUA 3A6JA 3QU5A 3DTNA 4Q6BA 2HSGA 4QL3A 3SG0A 1FXWA 3CMCO 4MARA 1NVFA 4YGYA 2FNAA 3BL6A 4QVKA 1MAAA 5LP6C 4ZVSA 4PWZA 2YMPA 3EVBA 4YJHA 9GPBA 1VGVA 2IHTA 3NKVA 1TW2A 1AV6A 4MW2A 2JGEA 4OF4A 3KQLA 2FN9A 4FHGA 1N78A 4UFNA 5A1JA 3W6PA 1HZZC 4ENUA 4O1IA 5AW2A 3RS2A 5DK4A 2CMFA 4PRYA 3IVRA 3CY6A 5CXQA 3LNTA 3R3SA 4WJLA 3ZWOA 4ZHQB 4JOSA 1NUQA 5AK0A 1OXKB 3HCAA 4DQUA 1RJ9B 2R5FA 2FRVA 4G5HA 1VL8A 1O6BA 3HUDA 4DT1A 2Q4BA 1DC8A 1NVTA 1P2GA 2XDWA 1LRLA 3EK2A 3RTAA 4KPEC 1V0JA 3RVSA 3N3BC 3CLSD 4HL6A 5AHKA 4LWQA 1NNLA 3C74A 5H4HA 3I6BA 2FWJA 2BP7B 4RHTA 1AU9A 1SJ9A 4FHFA 1DHTA 2C1EA 5K01A 2BR4A 2A35A 4BKPA 1P1FA 2P9BA 2C4TA 1L8LA 3LI2A 1T2DA 4JJIA 1QGUB 1FYEA 4GP7A 4I4IA 5DP2A 3DXFA 3AV0B 4WVLA 1HDRA 3RRFA 4ZDJA 5CBKA 4Q16A 4UEWA 3WGLA 4EY7A 2JZOA 4NCIA 4ZGGA 4HXGA 4UNQA 3INTA 2WJPA 1VLHA 1H8HD 3BXOA 1GL7A 4AG5A 1T4MA 4YJ2F 5CDYA 1TECE 2Q4RA 1F2VA 1HDIA 4J6EA 4DBVO 2HCTA 2I4NA 2GLUA 1LEHA 3EUEA 3IBYA 3NIBA 4C4SA 4D96A 4F6RB 2VOEA 3FUXA 2BKVA 5MN4A 1HMPA 4QPPA 4M38A 4JLOA 2R7MA 5AW6A 1W0JA 3F5SA 3LC2O 4Q3EA 2QQ5A 1OX4B 4R6WA 3L93A 1CC1S 2JPDA 4ZQBA 3USES 2A2ZA 4F4CA 1WF3A 1K66A 2XYHA 2VCYA 3HUTA 4RD6A 2GA8A 1N0IA 4COOA 4UU8A 2HV8A 1XSEA 4NIMA 3DPIA 1QF6A 1W44A 2YVKA 4FZRA 5EIBD 1N7IA 5IDQA 5LPNA 2O5CA 1G5TA 1A72A 5HCNA 3WLSA 6REQA 2GCEA 4FYIA 4RPIA 3TSYA 4GQIA 4G5XA 5DRTA 4A1OA 3DCJA 3OU7A 1WZUA 4WOCA 3ZDDA 2GN6A 5JCOA 2YH2A 3CRQA 4XZ3A 1AVTA 1Q91A 2JARA 2RK3A 5AUQA 1K8QA 5CNMA 3JAKA 2R25B 2JFYA 2ZIFA 3EXG2 3EZGA 3GV0A 3RFFA 2NSJA 3H1BA 5ALRA 3VC2A 2ON6A 1MC1A 5BPHA 3E35A 1V5FA 1AMNA 2NU9B 10MHA 1ENYA 2XDQB 2BN4A 2D5AA 5AOBA 3MJSA 4QNMA 2VA8A 2W6JD 3LZDA 2ZE8A 3TG2A 2QVZX 4RX1A 4HDQB 4BXOA 2M1ZA 3FNGA 2HHJA 4HAWA 3CLRC 5JXGA 2ZRPA 4QC2A 1RHUA 3GMDA 3KVVA 1Z5VA 1LI5A 1MFZA 2Y0DA 1U2GC 3D0RA 4P31A 4TN5A 2FGJA 5FUYA 4B2IA 3QMPA 2GEKA 2PR2A 3B3AA 5E3IA 2D13A 1YA8A 3SHVA 1O95A 4IIGA 2FSGA 2PH3A 4D3DA 1UINA 2HQRA 3L7CA 2V6MA 4Y18A 1UMKA 4DDWA 1Q16A 2QG4A 2V8OA 5B1SA 3CS3A 2C77A 1IEWA 5KNDD 4H0FA 4KLZA 5CB4A 5EHXA 1U0LA 3P97A 3DZHA 2H8KA 4MWDA 1KDPA 1TC1A 4KV7A 2R1VB 4MROA 4OI2A 2PYDA 2WU1A 3GJ8A 3H9QA 3T52A 4A6PA 4AROA 2V1UA 3ITEA 4EJSC 4LSZA 5J2TF 5AW8A 3DMFA 1QHEA 2PUJA 1NW5A 3W3AA 2ODBA 5JU6A 3WB9A 1HZJA 1J2YA 1M6EX 4PLPA 4YMWA 4AVYA 3IOMA 5AW9A 2J6IA 2HPAA 3BL5A 1NR5A 4AG6A 2F4NA 3H1EA 4C6TB 2RHOA 3W1WA 1DEKA 2ZBUA 5FI3A 1P0IA 3IP9A 3QVXA 3MRXA 2GD6A 4ITVA 4GSLA 4D6YA 4OAOA 3ZD9A 3LT5A 3K6JA 3NGXA 1PNVA 2RHGB 3QVWA 1Z88A 3U7JA 3GY0A 1I2CA 5EJ4A 4BO0A 2PPLA 1B0ZA 1BEEA 4TZTA 3R7SA 2FQQA 3EQ2A 2IEBA 4IJMA 2ADMA 3BH0A 3QKIA 3FGPA 5IJ0B 1QP7A 3KVNA 2W2MA 3BMOB 2OB2A 3EIHA 1P3Y1 2PKCA 2Q7XA 1BVUA 4MLPA 5P8WA 5KYWB 4H3HB 3RU7A 4AYTA 2C99A 1GKUB 3OPVA 1P2VA 2EERA 2W6QA 3KE8A 3R7AA 1E96A 2ZIXB 4R0VA 3X1ZA 4JJKA 4WBNF 1JR6A 1E3LA 1Q19A 5HQTA 1TJYA 1QRDA 1T5DX 1ZK2A 3EMKA 3K5HA 5B3LA 2DEUA 2OXCA 3EBLA 4E33A 2OHOA 2WIKA 3I2FA 1Q74A 2VJOA 1UMDB 3E3NA 3Q11A 4G97A 3RVKA 2NTYC 3C8HA 3CGWA 1NW4A 3RJMA 1FVXA 4QEKA 4CQMD 1VMDA 1Z06A 3H75A 4KOEC 4TTSA 2GO7A 3ZHVA 1PSWA 2J85A 1E18A 4GPD1 3WKCA 3C5HA 4Q1EA 4LQLA 1PVOA 1S2DA 4ASUD 3V1NA 2XH8A 4Y6PA 2CFIA 4M37A 5DDIP 3PNLA 2A3RA 3IRVA 3RQIA 3TXYA 2RC5A 1N2GA 1TD9A 4LHSA 2DLNA 5IJ0A 3I9JA 5EMNA 4W5NA 4EAQA 1UDAA 5LU9A 1U0TA 4AY2A 2BEUB 1MZPA 2XKBA 2ATEA 3UAOA 3MT8A 2IZZA 1BMFD 1PAUA 1YJ5A 1RZRD 1DC4A 5KWJA 5CX4A 1I2MA 1PJCA 4LI3X 2Q4DA 3H6HA 1P5FA 1RLTA 1Z7GA 3CX8A 3DHVA 5CJJA 4WLEA 1L3BA 3UMJA 3JVUA 5FULA 3HCFA 4XD7D 3DGFC 4K87A 1I4WA 3BULA 5EC8A 3VZSA 4B6SA 1KH2A 4PHFA 5C32A 1EXVA 2WUGA 3LYAA 4BECA 1Z28A 3JWJA 3TO5A 5JSHA 2X5XA 3FOAA 3QWIA 4CCWA 3W3ZB 2J6HA 5CNKA 3SR0A 3FR8A 3ZGOA 1GPH1 3L7AA 3OMLA 2PRJA 4XQGA 5AW7A 4D4LA 2YHBA 4RL6A 5EZYB 4W7IA 3FFTA 5AUPB 4Q3DA 5IVDA 3AF2A 2O0LA 3H2GA 3CB2A 1DKQA 4YDSA 2PHZA 5H3HA 2O2XA 3TUIC 1NYRA 5IAAA 5K4AA 1AMOA 4WN3A 1ZOPA 1P45A 2W22A 1N5KA 4MQMA 4ZC8A 4ZCLA 3BOSA 5KSPA 1TOAA 4JLAA 2JBAB 2TMDA 2Z1DA 2EX0A 3GJ4A 3FMFA 1QOQB 1TKCA 4PGAA 3NX4A 2QVYX 2D54A 4LOKA 3I9OA 3PNQA 1JAHA 5GADl 1VSBA 3HK2A 5LU8A 3PFCA 4D0SA 3G85A 1VL1A 2WM8A 3HA7A 1ECPA 3LOQA 3MELA 1A7UA 4PN3A 1WHTB 4YRKA 3FOBA 3ZU2A 3BFKA 2O8VA 4C7BA 1E2JA 1EFPA 2VUIB 4HYTA 2YJTD 3M9XA 3E03A 3EF0A 4XRRA 3K5IA 2ZBFA 4UNIA 2B8TA 1PGQA 4IS2A 3G2NA 3DHYA 1K7YA 1GXSB 2YQ4A 4MO9A 3T61A 3G9QA 3OLZA 2ZYGA 4Z9AA 5IWCA 1E98A 3FZQA 1UBOS 4C22A 4DXAA 4KQXA 4R1PA 1FFWA 1P0MA 3L7NA 3MEQA 3T35A 2DCUA 1YTUA 5HDBB 3WL7A 5JSZA 2OC9A 1KMQA 4DG8A 1ZD5A 5GP1A 3ESAA 1FSFA 3NI2A 4FPXA 4OK6A 4BMVA 4FB5A 5KO2A 1TNDA 2Z2IA 3SDSA 4J6FA 3T1NA 2ZRCA 4M1KA 3GLIA 3OIVA 4HEHA 1ESZA 5ALIA 1BYIA 2JNWA 4D0NA 3VNUA 4JI8B 2WSMA 2VHUA 2X19A 3O9MA 2G9VA 5B4UA 1JEQB 3IALA 1US8B 1KXJA 1LX7A 3G89A 2CJPA 3CNQS 3IE0A 4RA9B 3NBFA 1U1EA 2WOOA 1AUQA 2C3PA 1XWFA 2Z3VA 5EMHA 5HE8A 1KDZA 5I01A 1BW9A 2G0TA 2QR2A 5LR6A 2CC2A 3EZ2A 1EP1B 1KHHA 3AF4A 1ZN2A 4BLVA 2J0VA 4DL9A 1ZJWA 5KI6A 4OXIA 2H7XA 3MS2A 2RIRA 3AJAA 3KYBA 1B43A 1JHOA 4PGHA 5IAJA 3RFTA 3ZLVA 4A8JC 1BVHA 1ZIYA 2Z2ZA 5TMDA 2C2YA 1AKWA 4N5NA 1U3DA 1AS0A 4EITA 3N5CA 1OH8A 5I4KA 1MX5A 4Q5IA 3EEOA 1IEVA 1RC8A 1QUFA 2CLLB 1QG0A 4OKSA 1RZUA 2V6BA 3IPXA 4C87A 5A1TA 2L19A 3IP5A 1VB3A 3O1JC 1S4QA 3O92A 3FOFC 2X8JA 5L3RA 2R47A 2VJCA 3LUDA 4IDHA 4CIAA 4N7BA 1C80A 1WSDA 1G9TA 3KEFA 3EGIA 2KS6A 4L9AA 4D79A 4TYYA 1D7AA 1JKJB 1G8AA 1Y9ZA 4LV8B 3TOVA 4OHBA 4D42A 2Z8ZA 2IP2A 2JHPA 2JLYA 3U4QB 1E2BA 1MCZA 5BW4A 1KHTA 2VK2A 2WTUA 5KQRA 2OEPA 5A5DA 5HZHA 3ADKA 3DFUA 4JLMA 4CIDA 1P1BA 2PVPA 3IELA 4R83A 1AUVA 4XD7A 4YBRA 5IASA 3MMPA 4U2DA 3IQEA 2W11A 3FOZA 1I8TA 2QGNA 3TRIA 1OBFO 4LQCA 1MG0A 1SEPA 3HRIA 1V25A 3K0HA 2JB9A 3PNYA 4HN2A 1MH9A 1TAGA 2RHLA 4N6NA 4B74A 4DCPA 3KHKA 2DBRA 4EUKA 1J42A 1N1GA 3QUAA 4Q7EA 3NHSA 3ITDA 3RIXA 3IDOA 5F9FA 2FRDC 1CUZA 1FDVA 4WY5A 1AK9A 1VHDA 3M49A 5G2OA 1NAHA 2IEGA 2C2XA 3MOSA 1DTEA 1D0IA 4YCMA 2C2HA 4KQ9A 4QBGB 3MGCA 3MMSA 3OJCA 4FINA 2ISQA 4ASUA 3OTQA 1UM9A 3V6MA 3ZVRA 3ZZNA 1I51A 3OZGA 2QI9C 4I9UA 5EP2A 3Q8LA 1XVVA 4PCUA 4MCAA 3B6EA 4L16A 3Q85A 1PJBA 4PYIA 3FVQA 1GEEA 4ZEVA 3EDCA 4ND5A 1ZR4A 3EVAA 2G9NA 1ZM2A 3S29A 4AKTA 1K7EB 4MKZA 4BNTA 4D99A 5EJ9A 3F8SA 4NFHA 4P36A 2UVPB 1Y6FA 3RFVA 5L6MB 1E3WB 4NQRA 4U9IS 3UJCA 3E6AA 3QLTA 1L7PA 4B0OA 3FBGA 1IOLA 3HWX1 2EFEB 3P9RA 1UBNA 4YUAA 5BNTA 4DY4A 1E1RA 2V9ZA 3L6CA 4IXNA 2AZMA 2EXXA 3ZE0B 1XZJA 5ALVA 1EFDN 4YREA 5E3HA 3PTAA 1AXEA 4FMDF 4OMCA 4P84A 4PFJA 1O58A 4GEKA 3UC5A 5B64A 5CDTA 1SKQA 1JSXA 1CHNA 1X13A 4Q4HA 1KJ8A 4LSWA 5EYPA 3T7DA 3UHOA 2QRZA 4RSMA 5CMLA 3DE7X 5EPOA 4ZO9A 3ZBUA 1DQNA 4AKSA 4F8YA 1GZUA 3FSEA 3KZCA 1KWKA 3V4RA 1A82A 1T4CB 3FYTA 2A9JA 1EM8B 4BQQA 5ITSA 2OBFA 2JIPA 4L76A 1QIHA 1LVUA 2X4GA 3LO5A 4BLTA 1HDOA 3NC4A 1JAXA 4XVQA 1GKIA 1UZMA 5E7JA 3ZE9A 3LUHA 1JQKA 4JOCA 4AYWA 4PZ0A 4PHHA 1GN8A 3FPCA 1QCZA 4JQYA 3HXMA 4FGLA 3QXJA 5K3SA 5KTPA 1NKVA 5JBNA 2CMHA 1B00A 2JAUA 4U6SA 1V3UA 1Z34A 3SZUA 5J2TB 1QE3A 2PUWA 4BO1A 2YZ7A 4ILKA 1EFUA 3C1AA 3G13A 3JD0A 1WKBA 3BWXA 3HPQA 2Z2JA 1V45E 3KS9A 5E9WA 4AQDA 4OH7A 3W6UA 1E5LA 4UBNA 3W5CA 1B6TA 2ILTA 2ZJZA 2J1LA 4FFOA 2HIMA 1NYLA 4KRYA 4IRXA 3WDSA 5LZ7A 3U1TA 2FE4A 3I76A 1EA5A 3AKCA 1ODSA 1H22A 3VXKA 4ALNA 3U4MA 2DPMA 1YXMA 1A2OA 3EZLA 4J90A 1SKYB 3WRXC 2WQ6A 1VL2A 2CE2X 4KLCA 5SY6A 1LX6A 3Q2OA 4EEKA 1B6RA 5AXCA 1Q1NA 1XQ1A 2PFGA 4B85A 2F17A 4XX0B 2F3TA 1Y5NA 4URWR 5DTJA 1DV2A 1Z75A 2P6OA 2VZLA 3DZGA 3E53A 2PA3A 4LRWA 4OJQA 2PVSA 4ZAZA 5D00A 4EABA 3NATA 3RU2A 4RELA 1LF0A 4BNDB 4DJFC 4EPYA 1RU3A 3ESCA 1TM7E 4GM4A 4E88A 1C1XA 3E7DA 1RBMA 1FUYB 4Z7JA 3H2IA 1DU4A 1KH1A 3HY6A 1Z6QA 5KNBH 1AXRA 1GFZA 2I4TA 1W6UA 1XZPA 2GBCA 1JN0A 3PZBA 4MR9B 3LVRE 3L6BA 1GN9A 1N2CB 3D6MA 3OF5A 4RZ2A 2E6KA 4MGIR 2FWIA 1U7TA 2F62A 1H0KA 5IEJA 5KVAA 3E3OA 4DA8A 1Q0TA 5DNVA 2E9SA 3L8MA 3QKTA 1BC5A 1SXJC 2QG6A 1NMEA 2QTLA 4HH1A 1U3UA 2PS1A 3S0JA 4X64B 3KQOA 3STVA 4DGSA 1F2DA 4YT8A 1GTG1 4RHUA 5A6VA 5AD1A 4M1QA 1UAGA 3PIIA 3DP7A 5EQTA 2AF3C 3IXLA 4WJZA 3JATB 5EIOA 3TD6A 1G5FA 3TLAA 3X2SA 4AJEA 2R8YA 1E7WA 3OFVA 1DQPA 1WMEA 4GVLA 4RF3A 5A05A 4B4WA 4C14A 4I9HA 4KYUA 1TQ2A 3VZRA 1N9GA 4RK0A 3WO0A 4CDMA 4EJFA 2HWXA 3OEEA 3VAZA 1F2UA 2WF7A 3DE6X 2IQIA 2FQWA 3I23A 5HGJA 2PYIA 3CG4A 1TGVA 4XSVA 2EW2A 1UT5A 4N0EA 4KTVE 1PS0A 1NF2A 2EATA 1YZHA 3MS7A 3D3WA 3U3RA 4UNRA 1LBTA 1O7JA 5LYJA 1PI3A 1SM4A 4F5WA 4DIKA 3CH5A 1M72A 3KU4A 4S0ZA 2OORC 3VKUA 4BEVA 3Q5GA 3WK8A 4RULA 2FWRA 4R41A 2PX5A 3O4HA 4NY1A 3SZGA 3DF9A 3ZWQA 3QOFA 1NN0A 1SZJG 3RTBA 1C50A 1QMPA 1E6MA 2BONA 1M2JA 2FPKA 3O2SB 4G0ZA 1V7PC 4JMPA 1ZUIA 2ZAIA 3Q98A 1G41A 3EOAI 1Q7BA 4PC1A 1H4SA 2C4NA 2REOA 2C0PA 1JIJA 1BDHA 3MTBA 4YROA 4B2YA 2OBYA 3QUQA 4KHPB 5I7SA 3C43A 2QD3A 5F4BA 2AQIA 4IO0A 4LGCA 5DO9A 4FDLA 1QONA 3WWYA 1CUWA 4L28A 2IEAA 5DM4A 4Z6KA 5A06A 2WHYA 3KYDB 4QEZA 1H2RS 4JLUA 1RAFA 4R8SA 5ESDA 1Q1QA 3V2HA 3ZY6A 4JY7A 3T0IA 3LLSA 4JC5A 4BE4A 3A6GA 4MVJP 3ROTA 3T1VA 2HADA 3DMRA 2ZATA 3DEKA 3PUYA 3O3CA 2CHEA 5EHZA 2NN3C 3BMQA 3TXAA 4D4JA 5LYJB 4H7EA 3RTEA 1DQZA 1UZAA 1I13A 2JJ8A 2B92A 3CR8A 3IKLA 1DKRA 1L5HB 1XJCA 4N82A 2P3OA 3ZH9B 4DWJA 2GM5A 4IUDS 2RHRA 4E5VA 4CKZA 1PUJA 1FJHA 3IJPA 2QL6A 5F98A 1NJ8A 2F9MA 3DW3X 1UZUA 1S01A 2YWCA 1ITZA 3GXOA 1SKMA 2XT6A 4DBZA 3J7AC 4AS3A 1ILEA 2EFJA 3TZBA 1VSQA 1CX9B 3KZ1E 1P4SA 1Z4IA 4YEDA 1YJCA 1XDBA 4PW0A 3HQ4O 3AILA 3TMKA 1Q7CA 2JVJA 3VVCA 5B7GA 1ESDA 2VXBA 4G2NA 1AT1A 1M2EA 2HQOA 1MIHA 1QTNA 5JSKA 2OQRA 1MABA 1XD2A 3RT9A 4UQOA 2GXSA 2FCAA 1RLMA 5KJCA 1MQAA 1X77A 2IXAA 3BMQB 3BWDD 3VDMA 4GR4A 1P74A 1SZCA 3UMVA 1QAQA 2OP0A 2VRBA 3DGEC 2HWWA 4HQKA 2A1UB 4RDHA 4CM9A 3VPAA 3LTNC 2MJLA 4HVAA 1W36D 1GKLA 3U6BA 2DC1A 3P20A 3CEAA 3DEYX 4CQLB 1IVSA 4WN9B 2XB8A 1T1GA 1T3HA 1KC3A 4PC7A 5MGNA 3U44A 4K9OA 4AF7A 1QH9A 2W93A 1RW4A 5EJ2A 3SCZA 3RK1A 4UNSA 1EFHA 1ZI8A 3ES9A 4Q4JB 1MMFB 5DASA 4E7OA 4I1PA 5AW5A 1NN5A 1S2OA 1AOXA 1ZH6A 2WSSA 1LPMA 1E4YA 1V3VA 2IODA 3DEAA 1DRJA 1OI2A 5A3QA 1QP8A 5AOCA 1HL7A 2ZVPX 5L7WA 5ICFA 3RSSA 1BWSA 1K8XB 1L8OA 2JIOA 1J0DA 4GI5A 2JFGA 3R09A 4RD0A 4F7DA 4BUCA 4UM5A 3HBLA 4J16A 3OIWA 4AAYA 1VSTA 4IH1A 4INPA 1VOTA 4IIJB 5A5GA 5E3JA 2GZSA 4AK9A 3QJ5A 4KK3A 4EKGA 3K71B 4QFDA 1WB6A 1EZ4A 4DRZA 4V38A 1XCPA 2Q7DA 2GILA 4DOMA 1QIFA 2GF9A 5H8WA 2TS1A 1HEUA 4L57A 3R7DA 4CQMB 3I53A 4GT1A 4RF4A 4IX9A 3BCHA 3EFOA 4LKOA 2BM0A 1N6KA 2Y3IA 2DHEA 1M2GA 2PO7A 2ZSKA 4RK1A 1U81A 3MLEA 2D4HA 3T7IA 3MT9A 3BRWA 5H80A 1U2ZA 2R2GA 3A1CA 3GBVA 1HFKA 5COQA 2R48A 4KRGA 5EP1A 1T9CA 2FOXA 2P5SA 5H9VA 5I51A 2VZ8A 4RPHA 1YAHA 5E9QA 4X61A 1RLJA 3EZFA 2UUBB 4TL6A 3NQ41 4O08A 3PLAE 1GKKA 5ALLA 4GUAA 3CNNA 4RBNA 4PLCA 3SX4A 4LF8B 3K2IA 2GBLC 2GCPA 2WB4A 1EJ2A 4PGGA 3U3OA 3JRXA 2NXCA 5JE8A 4FEEA 1ZD9A 5TC4A 1LS6A 3ZDRA 1CPYA 2IZ5A 4MJLA 5TQ0B 2IKSA 4FYMA 2VDVE 1G3MA 3ZZUA 2OGWA 3PNMA 5FA6A 4U7DA 4LJLA 1BHQ1 3UJBA 2I4LA 3NDBB 3NEAA 5KOIA 2IX9A 1NPYA 1W4RA 1YZGA 3MFQA 4LQ4A 4EB0A 4HGOA 2F90A 1EUDA 2WVHA 4BKUA 1AN9A 5K8UA 4DR6B 3MHPA 1JT9A 1MRNA 4QPCA 1WD7A 4F4FA 2HXGA 1JEOA 4NYJR 4A4DA 3T7SA 4O29A 4CLHA 3OIDA 4QM6A 4D43A 1O87A 1CG6A 2C7RA 5B1IA 3Q8WA 3FTDA 4MP8A 4BAUA 3ML1A 5HZKA 2B3TA 3U62A 2AG0A 2XUJA 4IFEA 1FDTA 2NZUG 2DP4E 2QRGA 3G0OA 4CMKA 3QUCA 4IOJA 3GFGA 4EMUA 1P3DA 1XV5A 4MA4A 3N6XA 3HR8A 1CULC 4JI7B 3X1JA 1ZGJA 2IITA 2O2HA 4WINA 5C81A 4YN3A 1Q7EA 3HJGA 3QA3E 4O5AA 1OBCA 2BFMA 4M8SA 2Q0SA 3ITNA 3MG9A 4KXLA 4MV6A 2R44A 5KJ1A 1Q1EA 2AX4A 2J4CA 2V9PA 2P1RA 3O5AA 2HMUA 4H6XA 5BR4A 1I7LA 2D74A 4GS5A 4PYJA 4RIEA 5HTOA 4UHCA 1E61A 1KVRA 2BTOA 2C4MA 1Y80A 2A67A 1W36C 2OA0A 1XTQA 3S7TA 4YV1A 1K9SA 1AE1A 4NYIQ 5IXYA 4J0HA 2VJPA 3F4KA 1OKKD 2ZT8A 3LBHA 4IO1A 4KV9A 2VDPB 4KQKA 4AMZA 2E48A 4TKUA 4JC0A 3WGUA 1GPKA 4WOPA 1I10A 3B53X 4G3XA 1QC5B 1J6UA 3EULA 3RGWS 4H08A 4YVFA 2C8JA 4DUYB 1WCIA 4LNAA 1C7JA 3I6MA 5FLYA 2WPDD 5GVSA 5JO0A 4NZZA 3GGSA 2JH8A 1E5VA 3GLGA 1BCSA 5JCOC 3DOIA 2COKA 3ABQB 4LDJA 3ZQ6A 3VTKA 4TMYA 2RIPA 3GUYA 1KTIA 3D59A 3SQNA 3PI7A 1O96A 2PL1A 4LRUA 3GHYA 3UGQA 2A7XA 3IVAA 4UXJA 5JZMA 2DOKA 2QGZA 3AM5A 2BFCB 1DELA 1NXSA 1Q50A 2OO7A 2BGRA 5G02A 4DPLA 3WP0A 5LP6A 3DMHA 2AXQA 5CB8A 4Q9JA 5AUOB 2OXRA 2XT9A 1JFTA 1BU5A 5LD2B 5J4VA 4IDQA 5I9BA 3HR4A 4U7HA 2ODEA 2VF5X 1GFSA 5KKCA 4CU2A 3LXRA 5JMTA 4MQUA 4ABTA 3VYTB 1Q0LA 2J9FB 3D8RA 3VH2A 1KIMA 5HRUA 4QQ8A 1VMEA 4OREX 5DJ5A 2EV9A 2CXRA 1KJIA 3BC1A 1X7ZB 1LZLA 3IOYA 1OX4A 3W9YA 1U2GA 1U5BB 1KIFA 4QXPA 4QARA 1M8FA 1L5WA 4YLGA 3P9YA 3VDNB 4B2PA 3VJMA 4XUCA 2B0JA 4BZZA 4DLZA 1JG4A 1O95C 1OV6A 3OEED 2XKJE 2WFZA 4QOGA 5FBWB 4QT4A 2SCUA 3AI3A 5C46F 1DJOA 1GUDA 1HWYA 1KI6A 2FQYA 4R2XA 1P75A 3VSDA 2I78A 3VPDA 4XARA 1H5QA 5AK5A 2GUGA 3H9UA 2JRCA 5CHYA 5L4LA 1RJEA 4JN6B 4HTFA 4RMJA 3W2IA 1KPHA 3D6JA 4WSOA 4ZTZB 1GEGA 2WZCA 3SBOA 2FJ0A 2WWHA 2L42A 2W2VA 4JU9A 4ZXFA 5K9ZA 2FPSA 5K0EA 1E0JA 4RY2A 3NFRA 4RSGA 2IPNA 3BB4A 2GNAA 4E07A 3H4TA 5IPFA 3HSKA 2E18A 2JGFA 3PWTA 4AL4A 1ZGBA 3BE4A 1UOOA 2W7TA 3MFYA 1WEKA 2Z2YA 2AUTA 4LZWA 2K7FA 1NJGA 2FFHA 2FN3A 3JALA 4TKVB 4AJLA 2BIFA 4C21A 4L4UA 5BN3B 4HMQA 3RS3A 3UGTA 2IE8A 2VYCA 4RA9A 1QS0B 3KNZA 2GYUA 3URMA 4AFNA 4LJYA 1IZYA 3KRTA 2ZQ5A 1PBTA 2ZTVA 4UUAA 5BVHB 1O4VA 1Q2XA 3NOOA 3QEKA 2Y8EA 3ODPA 3NWBA 4W8HA 3W2HA 5CFZA 4FGJA 2H6EA 1NXXA 3OSZA 3SHFA 1QHIA 3VSBA 1XN1A 3CTMA 3N5KA 4LXGA 4ZVOA 4BGEA 3KL2A 1B8NA 1Q6ZA 2RG1A 4IGEA 3N74A 2IEIA 4PC6A 4B48A 1HORA 2YFKA 3RHTA 3ROZA 3TH5A 1Q44A 4DC9A 2O8BA 1G1AA 2IV7A 2VZ0A 3IS3A 4AXBA 1XTUA 3K4PA 2ENWA 2P27A 1UZNA 1IZZA 3FGNA 4CGZA 1ZXXA 1EEHA 3GVPA 3HBNA 4HDKA 3I39X 4NL4H 2O06A 3KQTA 4OY3A 4RSRA 2LUOA 2C0CA 1WKCA 4GLJA 4TVBA 5DI3B 3ZW9A 1GCAA 2AB0A 2WHXA 4RVSA 3P2OA 4ZA2A 2CV1A 4OXKA 3OFJA 3GJ7A 5KX5F 3UAZA 3R5JA 1Z13A 1JWLA 2O8DA 3AY7A 4ZAYA 4PE5B 3UT5B 3AHCA 2DWQA 3EIEA 4M76B 1GVNB 2PAFA 4BX9A 3MJCA 1MU0A 2J31A 1V1RA 1F17A 2XSZD 4UCXA 4WFQA 3LGAA 2Y1GA 3DMNA 5DTQA 1Q1AA 5EE5B 4RDIA 4QOFA 5K3DA 3B82A 1U2TA 4ZYVA 2VQ6A 3MAAC 5HE9A 5L51A 13PKA 5E7IA 3I0NA 4UTOA 4P83A 2O8BB 3BGIA 2D7JA 1X70A 5EKUA 1D6JA 1KP3A 2Z9DA 3DLBA 1SC6A 1V37A 4YCAA 1KL7A 4R8MA 5JYEA 2WWYA 1HRDA 1MTZA 1GAWA 2R2AA 3WR5A 2FX2A 4Z0TA 1WXEA 1YZQA 3OX3A 3GT3A 3VNBA 5AJYA 3RG2A 3TQFA 4BO5A 3LHFA 3FYDA 1X1BA 5T6BA 1DIRA 3IUPA 1GG2A 1H2WA 3U26A 4B81A 2RCNA 1T5OA 3OX1A 4IDCA 2HLDA 3KCQA 1ADYA 4NONA 1PS9A 4OGKA 1TIPA 2ZVQX 2WW8A 3GWZA 3TLJA 3KB1A 3O3OB 2C5FA 3KCNA 3PQCA 3TTXA 3ZDEA 1OBOA 1VI6A 3RSHA 3FVWA 5H3LA 4YJ3F 3VU3A 3W5SA 3PGA1 1ZIPA 5HUQA 2GKSA 4TMKA 2W71A 2OO3A 3FG9A 1DC3A 1NURA 1F12A 1PYDA 1U2SA 3HZOA 5DMHA 4D0LB 3ECAA 1BMDA 5KTMA 2VTBA 4PWYA 3MT7A 4DMFA 3ORQA 4NABA 3TFQA 3T3GA 3MD9A 1R8SA 3H11B 2XYQA 4CGYA 1FDUA 4EMSA 5K4HA 4JI1B 3CNLA 4UREA 2GJAA 3SJZA 3WICA 1IY0A 3FHOA 1M3SA 2CUNA 2CHUA 3PUIA 5HIJA 3KJZA 3L07A 4P0QB 4OIMA 2NYVA 4JVLA 3UXMA 1Q3HA 3FZYA 2IYWA 1HYEA 2WIAA 2QDKA 3HFRA 4K1LA 4Q9HA 4JA0A 2GLXA 5FB3A 4IYJA 1DT3A 4OQLA 3TEJA 4YCBA 1F5NA 1PQYA 1ZCAA 2BDEA 1G17A 2BKAA 4WASA 5KQPA 1J7JA 2QNRA 4QUJA 2DF8A 3ZC3A 4A82A 4CG2A 5BOSB 3V97A 1J5PA 2QD5A 1XYVA 3MCTA 3P9IA 4LBWA 3JYPA 1DKMA 1GCOA 2UZ3A 3HTXA 1VHWA 2J3HA 4DUZB 5A5VA 3ELUA 3L0YA 3K8ZA 1FFDA 4J4HA 2JFXA 3K05A 4UUOA 1N2HA 1R6TA 4CEIA 1RI5A 3PQ5A 1QIEA 2N1BA 1ISRA 4LN1A 3Q9SA 3A0UA 1MJGM 4MS1B 2YCBA 2JDID 1FS6A 4OQNA 2I7CA 1W0KD 1GU1A 2FKAA 4MRAA 3NYRA 2RBEA 2C4WA 2AKAB 2HYDA 3SZLA 3B8HA 5EWJB 1WULS 3U3XA 1Z8NA 3I42A 4UVDA 2UKDA 1HDXA 4MRMB 4HMOA 3L5KA 1E7SA 5EXXA 1A5TA 3F96A 3O4VA 1E3WA 1ZCFA 3SC6A 5JALA 1WTAA 1XMSA 2BMVA 2FZVA 1LI7A 1F14A 1TT7A 1SVWA 4XCVA 2O7RA 1T2EA 2AS0A 2G71A 5CEEA 3I5XA 4FX2A 3THRA 4MWSA 5CH5A 4OH1A 2REQA 2ZRNA 3PE4A 3GOHA 1V5GA 2QQ0A 2ZZKA 3GN2A 4CV1A 3EDOA 4FCWA 4M6WA 2XTZA 3OQPA 3LP5A 3OZIA 1E32A 3RS8A 3WWOA 1LBQA 3IQZA 3NHZA 5L8VA 4H15A 3U81A 5AI4A 2B69A 3DA8A 3PQ3A 3L7DA 5F2KA 4B75A 2ZS9A 4WKCA 5BQXA 1D2RA 1D1PA 1ZAKA 1UCFA 2NUPA 1PZNA 1N1MA 2XUZA 3MTGA 1UAYA 3TWOA 3UNXA 5JYCA 4RQAA 4V2UA 2CXSA 2RFLA 2XD9A 4RJIA 4HOYA 4G6ZA 3D8BA 2ZM5A 1YSCA 1K27A 4RLSA 3DV2A 4OJMX 5EWMA 3KPWA 3U7HB 2ZB8A 1ISJA 2OCLA 1MIOA 2AD1A 5BSGA 3AESB 5IFLA 3BXXA 4I8DA 3WMGA 2XECA 5KYTA 3L0BA 2JFZA 3ZXSA 3QY0A 2UAGA 4MV4A 1GUAA 1XQWA 2C2BA 1G1MA 1YDWA 2W6OA 3AHIA 3LS2A 3QQPA 4UAUA 4UUBA 2WI8A 5A9SB 1IN4A 1Q15A 5KC8A 4AI6A 3FUVA 5U4QA 3IEVA 1N8KA 1SIOA 2DG2A 4CKWB 1YVUA 4PZUA 4UDOA 3GDWA 1KS9A 2JFVA 3L4EA 1MC4A 4X1OA 4E6PA 1TU4A 3BD6A 4QUDA 4A15A 2WYOA 1LC3A 4POAA 2A6PA 2E1RA 2FFQA 2JDIA 2VDNB 1AKUA 2VA9A 1NVVQ 3LLCA 4QYXA 3SKYA 3RSQA 4K8OA 1XZKA 3TJZA 2P65A 1AA9A 3UJHA 1M76A 2XMCA 3LCRA 5HHTA 2DUNA 4QFMA 5JJ5A 3QLEA 3AHDA 4YCNA 4YHBA 1P91A 4ZVLA 4B4DA 1QV6A 4IR7A 4DF3A 4L4SA 2GWHA 2IH2A 1TA9A 2I62A 1G2IA 4ADSG 5ULLA 4K3VA 1MO3A 1C4WA 3M5CA 2BF7A 1TZ2A 2NUAA 3A7EA 3MJ4A 2PSSA 5CVCA 3A1EA 4J29A 4X8HA 5AKJA 4GU5A 1NG1A 1E2HA 4FFMA 5H1YA 3EHDA 2IHBA 4C89A 1RWKA 3KYIB 3QBTA 2B4TO 3DL2A 4TT3D 4PZCA 3A1SA 2PRIA 4TYQA 5IF3A 2GYWA 4ZT7A 4H31A 4J0DA 4BVJA 1SU4A 3ER6A 1J56A 1JI3A 2XIJA 4BWFB 4D25A 3QG5A 3UB4A 4GC9A 1PKEA 4RORA 1WV1A 5ER9A 4F2GA 5AM4A 1IWBB 4N8SA 4A5SA 4ZP1A 4BMDA 4ZO7A 4X63A 5JH7B 2V7GA 2WJIA 2NZWA 3ADPA 1UWCA 4QRDA 2G09A 1JHXA 4YALA 5IKEA 2A1TS 3C15C 4FFBB 3RHFA 3GQBB 1Z7BA 4ZEMA 4I5FA 2F00A 2ICAA 1P7WA 2B9EA 4DR3B 2AFHA 1RXIA 4PZYA 2ZS8A 1GFWA 5DM2A 1XZNA 3LDAA 1RE0A 3EXEB 3WGYA 1KOLA 2HO5A 1P72A 2FEAA 3PEFA 5BSMA 2JVIA 4MEBA 2QN1A 3GLHE 3R3ZA 3VDQA 1YBMA 2B37A 4M46A 1EX1A 1USKA 1YB7A 2XCOA 1ZM4A 1R5OA 4WBNA 4C7MA 1DOAA 2HI0A 4E46A 4NCKA 1ZNWA 3O1HB 3K5WA 3P27A 4KMMA 4B40A 8ATCA 5I7HA 3KQMA 2OBLA 2PNFA 4B3MB 3G02A 4IRMA 4GH5A 4MPTA 5K3CA 1C3VA 3FPGA 3LH5A 3W5AA 4LY6A 4GZMA 4MWTA 4P4UA 1OZFA 1E9EA 1G59A 1I1QB 2R9VA 3JAWB 3HFSA 5CTJA 1JILA 2EHDA 3VU9B 2Q21A 3E7WA 4PXYA 2XI4A 5LXTB 3OHSX 5B6IA 2YVUA 2P6MA 2JRLA 1S3SA 2GJ4A 3I2JA 2FRDA 3U19A 4R81A 4C4ZA 4MEAA 3V4LA 2GQ0A 2LCQA 4F72A 1W49A 5BO5A 3NHKA 5DI9A 4OYRA 4OHCA 1GNPA 3LFTA 3WIVA 1R5JA 3U9TA 1ZMXA 4ALIA 2C5BA 4AS1A 1VTKA 3C7KA 3E27A 4J0KA 1EM8A 1XTVA 3ADOA 3IMCA 5ERXA 1R27A 5FFMA 1L7XA 3H7AA 1M8PA 1EEXB 3K94A 3GLFB 4ZAXA 1EX6A 3EWSA 3GT0A 3IJEB 4RAQA 3SOZA 1L3CA 1Z45A 4OL9A 2HA3A 2PFKA 2ZJ0A 2G83A 1QH1B 2ZSIA 5EWLA 4A2WA 4MUBA 4BMPB 4CMJA 4XGIA 5FP0A 2Q99A 4BAZA 2QLBA 3P96A 1AC5A 1Z29A 2MSWA 2JATA 3VSCA 2LV8A 2FZ5A 5BV7A 4RETA 4WVFA 1NNEA 1R8JA 4L1KA 4DILA 3ED5A 1TF2A 1UFRA 3QYFA 4ECAA 4IXWA 3ZHRA 3PUHA 3H19A 3L8CA 1JLRA 4RH1A 1ZJ6A 1TJNA 3TZHA 2BMWA 3WSVA 5KYXB 1SZDA 2MWMA 4Y3UA 1BD3A 1KYZA 5AQ1A 1WVIA 1HOXA 2A0UA 1I0ZA 1GADO 4ERNA 3GFOA 4G0NA 2OESA 4QT0A 5FNVA 3NNDA 1O97C 4B46A 3P7MA 3N7TA 4RJKA 5ILGA 3AUAA 5IBRA 1T15A 3HMQA 1DIOB 5F73A 5HUHA 3BWMA 2HREA 4C7KA 5LDGA 1BAPA 3GRCA 1E2QA 4BVGA 1NSFA 3EPKA 1P7CA 4U0KA 2Q49A 4FBMA 1QRAA 2QNIA 1U3FA 3MOIA 4Q9NA 4D56A 4DSTA 4MR7B 1DBIA 1ECBA 1E79D 2HA5A 3SYLA 1EFAA 4LBZA 5HW0A 2QU7A 3LNCA 3CPSA 1WVMA 1QJCA 4ZRDA 4M4SA 5K51A 1WW3A 2SKCA 5FOQA 4OUKX 3PXBA 1MJGA 3ZCQA 1CUJA 3OAAA 5JWRA 5BN5B 5AFSA 3ETHA 4R1SA 4TMZA 2DY0A 2XF8A 5AVKA 2VH5R 2WE8A 3AXSA 2H08A 1FQKA 4O4HB 1K63A 4DMKA 1LDBA 5F1OA 3ZD7A 2MU1A 1XO1A 5TMPA 3M1YA 4BLRA 2JJMA 2NU8A 4AZ0A 3MN1A 4CF5A 5CVTA 2D0DA 1T9GR 2DT8A 1U0SY 4V1CI 1E1DA 2XYRA 4TVOA 4MI9A 5GZ6A 3L8DA 1D1TA 4EO9A 2EEPA 1OBHA 1U8ZA 5D7NA 5G53C 2BOVA 2PZKA 4F2DA 1L5RA 5GJBA 1X1DA 2GNOA 1TU0A 3LX8A 4YNBA 1O5TA 4BPRA 2WJAA 5HS4A 5CLJA 1BCRA 1RACA 2MSKA 3CLRD 3Q7SA 4AY3A 4BMCA 1ZOSA 1KI3A 1RWNA 1H5UA 4IOLA 3SNHA 3QVLA 1ARZA 2AZDA 1PR6A 2I33A 3R6TA 4GP6A 4X7PA 2HTEA 1UANA 1K3FA 4NICA 4AZSA 4OQYA 4E12A 1AKNA 3WGZA 3O84A 4XWOA 5DLPA 1TZBA 4Z4GA 1A4UA 1RLIA 2P4EA 3CFYA 3DVQX 1RJ9A 2IHKA 3NHLA 3PHCA 1JDNA 2BAGA 3FM9A 2AI1A 3KM0A 4IIBA 4QUAA 3SSMA 3KOYA 4KN6A 3A9UA 1PU2A 3HU2A 4WKNA 1Y7IA 2R96A 4KITB 2IH5A 2VF7A 3PVCA 2OE2A 2HF7A 1T1EA 2JIDA 3EOZA 3EXIA 1KO7A 1EKXA 1UPUA 3HWRA 3PIRA 3OETA 1OWNA 2IRWA 2ZFUA 1D2AA 3E0QA 3F5FA 5LMUB 3TTSA 1TAUA 2DUUA 1UPTA 1V8DA 3DTYA 3LXUX 3P4YA 4BP1A 1UBHS 2YV2A 3GEHA 2A0XA 5SV2A 5JSUA 1CKEA 2H11A 5BOVA 2ZYIA 3PDIA 3S1AA 2UZ1B 1N1EA 4LOHA 4S04A 1SIBE 3B48A 4MDFA 1FCJA 1P29A 1TYCA 4QFBA 1TADA 5EKTA 3WGTA 2GBPA 3EX7C 2FR1A 3K73O 3IB3A 3NNNA 3PPVA 1V11B 1Y8CA 1ZD2P 2XWSA 4IRUB 4PGMA 2CDAA 2IGTA 3CJTA 4QXOA 1L7RA 4A26A 1LRJA 1Z16A 3H5IA 1JR3E 5B2ZA 4DV0B 1YA6A 5F3DA 3PXDA 5SZJA 3KXLA 2I4IA 3VTFA 3C3PA 1Z2NX 2EZ4A 3STWA 4AF8A 3NOXA 2EJUA 3GGDA 3IE2A 4QATA 3R5KA 4Q01A 5I5EA 2WU0A 2QLJA 4G07A 5FOWA 1DHRA 4PC2A 4JC8A 4PG7A 4QNNA 5JTTA 2P77A 2UUAB 2B2CA 4MNTA 1JP7A 1OQAA 4XGRA 3SQMA 2NVUB 3W4KA 4PBSA 1TRHA 4W82A 5GONF 1KYVA 1F6WA 3DHNA 4Q47A 3EVEA 2LVBA 3VPXA 2XPCA 4LVUA 3RC7A 4KGXA 5G0UA 1YR1A 4FN4A 4BNWA 2HRDA 2J9YB 4Q9AA 3EFHA 4FK8A 3P9XA 5LB2A 2JA2A 3ZBTA 4DXHA 3OEYA 1RAGA 1SBTA 2OD9A 5TPWA 4PG6A 1DRKA 3RABA 3AHGA 4ETIA 1L5ZA 1RMYA 2FPIA 2Z5GA 4G63A 4GBGA 1YHZA 3T9CA 2V7TA 4OIFA 2LTAA 5E7MA 4ANFA 1WO8A 2CV0A 3UK2A 3CKLA 1NL3A 2H18A 1VRCA 4JOBA 4UVIA 1DFHA 5B3KA 4DNOA 1USVA 2ZIUB 4EY5A 1T8WA 3P1JA 3D8HA 2HHCA 3KZKA 3OBBA 1Y6JA 4MW7A 3VHXB 1M83A 1AKVA 1UKVY 1ECCA 1DCMA 5ALMA 5DPMA 3OLWA 3RUIA 3NHBA 1DPFA 3R6GA 3TZQA 2GEUA 1M9NA 7REQA 1QHHA 3FDZB 3LK7A 3OY7A 4IHJB 2GBLA 3WFZA 1H2ZA 1SUFA 1VBNA 3LOPA 3SSNA 3TW0A 4ARZB 1G5QA 1KO4A 1CY8A 2RBGA 4ZO4A 5TQ2A 1MD9A 1UAAA 1XP8A 2G67A 3I01M 4HLUC 3T94A 3BRCA 3N87A 3AFGA 1SG0A 2XNSA 2XWBF 3QE2A 1Z6XA 2GZ3A 1SPXA 2XCIA 3ZV6A 3SJUA 4FW9A 1DI0A 1TLFA 4CPDA 3K70C 3SBXA 3RF7A 1KEEB 3H9EO 1TZKA 4JODA 2FXIA 1QHSA 1GDTA 2IYEA 4EG1A 3V48A 1W8IA 3STXA 1COZA 3F1LA 3P2YA 1K7XB 4R7ZA 4ZQFA 3RI3A 3V5NA 3ZHXA 4BPBA 3O8CA 4IIYA 3T4UA 4EBFA 2IYLD 3TOXA 4ZCIA 4NULA 3VSEA 1J8QA 2MSLA 1VCHA 4WRRA 4AZWA 5LNK1 4L5JA 2VTKA 4EJ6A 1PX2A 1PNOA 2QJOA 1CLEA 2ZBQA 2OYRA 3ZU5A 3IP3A 4LZAA 1Z82A 2CXPA 5KB3A 2OFFA 3SC3A 1EHCA 2G9RA 1BW9B 1UR5A 4B8YA 3LBIA 3U4CA 1VLVA 5CDHA 5AKYA 3GARA 421PA 4DCOA 1WZ2A 5L45A 3ZJ4A 3IPLA 2CHQA 1WUJS 1GGMA 5E6RA 2W2XA 3DE0X 3I05A 1QLWA 2QR3A 5A3JA 1QANA 4BN0A 3M83A 1O96B 3EGEA 3KJQA 3NGMA 4B1FA 3FPKA 4MCHA 1A04A 2P9GA 2A9OA 3IVXA 3MW8A 3AHFA 4EI7A 1QFMA 2CLSA 3INRA 4YMGA 5JADA 5LP6B 3F74A 4QTYA 1DNPA 1IXRC 1ST2A 5SZKB 1DBQA 3DDNA 2ZYTX 2C9MA 3M6LA 2EP5A 1AJEA 1T8RA 4CQNA 4PS1A 4JMLA 4QHYA 4OUDA 3STHA 5DNWA 1UEXC 3I9LA 5BORA 1FNNA 3N6VA 2XVYA 3W9BA 2JGJA 4MIOA 1GPWB 3D7SA 4BEJA 2I4RA 2BT4A 3IT1A 4HRYA 2FMUA 3L04A 1GXSA 1V9SA 4FUTA 1QDLB 1UJCA 1DBSA 5T67A 3T9DA 4EEXA 1YQQA 2B20A 1T1RA 1N33B 3H87A 5HILA 1AKMA 2JHCA 2VPTA 3K53A 2GAIA 4PXSA 1JDBC 4DNQA 3ZQUA 5GIOE 1JKFA 2CLCX 2FZLA 3HRHA 2V3WA 1Y6GA 4BJ5A 3L7OA 1ORVA 4RW0A 4BRZA 3LBNA 3ZTTA 3AFOA 2IDMA 4L8YA 1MEEA 4YI3A 4DM4A 3KAQA 3R9XB 1P4GA 1SO8A 2J07A 4DWVA 1YI1A 2I2CA 2NT4A 1D03A 2P9ZA 3OH8A 2CVOA 2JI8A 5FRDA 1YB5A 4Z4EA 4ESOA 2VWGA 4DY6A 2EF1A 5CFRA 1AKQA 1SVKA 2BFFA 4F97A 4EP1A 4MS3B 4F60A 2FPOA 1JFLA 5A4AA 4UJ5A 4GD3Q 4KR2A 4AUNA 5LLTA 5A0VA 3G2LA 3PJGA 3VC7A 4FLMA 2ZG6A 4QYIA 3GVHA 3KR1A 5K8JB 3KQUA 3LZCA 4MOWA 1T9GS 1V4NA 3DBVO 2KMLA 3GGOA 3OFND 5H59A 2YRXA 3R3UA 3FZGA 2CNDA 3PC2A 3V1YA 3IEXA 4HGYA 5HRAA 1FDSA 2HX1A 5I7RA 2GPAA 5LMZA 2ALJA 1U9YA 2VP5A 1GNRA 3KPJA 1M75A 5LDHA 2E1PA 1TZMA 1SVIA 2LIPA 4X8MA 4BNNA 4BMSA 2VHQA 4M9SA 2Z5FA 1NPDA 4MQEA 3RSLA 4LK3A 4DSAA 3K6SA 1GLNA 5AJUA 2XQJA 2GRUA 5C7YA 2RHBA 2P2YA 1H1DA 1I4EB 3PQFA 3QE0A 5AR1A 3RANA 4EUNA 2JI7A 2ZU6A 3IILA 4IEFB 3B3FA 1ADFA 1M10A 5L7YA 2QLFA 3JZAA 3UMFA 5E0OA 3HZZA 5JS2A 2XYVA 5LZ9A 1CW2B 1KYXA 2Y0EA 3AV3A 4GGPA 4LPSA 2RGWA 4ML3A 4CV3A 2UYCA 1W7AA 3CLUC 2ATVA 1H66A 3GLHB 4AC9A 5AHRA 1COWD 2UUOA 1RWVA 2JAPA 4HP8A 3KJHA 1INLA 5PGMA 4JLKA 1HDCA 4RY0A 3KAPA 4LJ7A 4ZJPA 1GG8A 1ZNQO 4FFDA 3WSWA 1OE0A 1DLJA 3BZUA 4IH9A 1T4DA 2ZPUA 4HGZA 4KL8S 1FDOA 4W7HA 5JZSA 2IXDA 3VYVA 1S8NA 1HE1C 1IY8A 4Q9KA 3GJTA 5BSTA 5B7PA 3NHUA 4F3NA 1X8JA 2JA1A 3M89A 3IAS1 1TVCA 5JXWA 3M5DA 4XDGA 4LHYA 2J9FA 4YDHB 2BFDB 3O0DA 3EZ7A 4BMXA 1IDN1 4G8DA 3OIUA 5K99A 3PUVA 1J20A 1O03A 1T3ZA 4LXHA 5D85A 1GPYA 5AI8A 3GLGE 4XGKA 1YHYA 1XTZA 4K9NA 4PYNA 2YY6A 1M54A 3V1MA 4ETWA 2YDYA 4QYWA 3AM3A 3VKFA 4C0HA 1X6VA 3NBUA 3HCPA 3H3XA 4YLYA 3WL6A 3RPEA 2W70A 2CCGA 2IL1A 3IUMA 1FUKA 3GLHA 3QOYA 4RE5A 4Z3DA 4JQOA 5T6MA 2VXCA 3TLXA 5ES4B 3BSWA 3R0XA 1VHQA 2JFFA 4LF7B 3WX0A 1TCAA 5BQ3A 3I73A 4UD2A 1VRVA 1FQOA 2QPOA 3R3HA 3WGQA 5EIXA 3DZ8A 3LHSA 2RMKA 3EHEA 5EJ6A 2D7CA 3TLGA 1RJDA 4BEWA 5BN4A 5F1KA 3FTNA 3RUPA 1P62B 5ICMA 1GYPA 1GHTA 4XWTA 2EQ5A 3DW1X 4US1R 4BLQA 1BXGB 2HJRA 3IBSA 2FH5B 1JECA 1GITA 2P2ZA 3UA4A 2KBEA 1Y89A 4DIDA 5C7OO 1Z4KA 2F1JA 1NF9A 4TGLA 2P9FA 4X5OA 3S2GA 5FOTA 1EDDA 5U4XA 3RVQA 1KVTA 1VIMA 2QX7A 2HHLA 5HF5A 5IYZA 4GE3A 4J1NA 3U56A 5TGDA 3RLFA 4EGAA 2WKWA 4LE0A 4EELA 4MI1A 3ZLBA 5JHHB 3T9BA 3HWWA 1OXXK 1UP7A 1DEXA 4DNPA 2A1TR 4CWAA 2CLMB 3EWAA 3FHJA 4QASA 5HRCA 1TDJA 2RH4A 2ZUDA 1L4EA 3A9SA 4GEGA 1J70A 1NGSA 2DKOA 3A3YA 4YLEA 3QVJA 3U3KA 4DV5B 2A9PA 2IUYA 3THOA 1NVXQ 4G36A 1VLQA 3UGJA 1REQB 1XEXB 4HUJA 2Q6IA 3KUUA 2MT9A 3OE1A 4NYMQ 1YF3A 4BFWA 4IJVA 4YXFA 4KXXA 2G8LA 2YHSA 5DTIA 2HW8A 4DCGA 2Q50A 1VMKA 2VHZA 3AW8A 3H16A 4ARAA 4KYIB 2C8LA 3A10A 2JGAA 2WWTA 3SJAA 3ICCA 5HXAA 1V95A 4ZOLB 4G5RA 4HQ0A 3H65A 4KE6A 4AKIA 4IQGA 1NXQA 5HSGA 3RIEA 4EYKA 1F6DA 4OFWA 1N0HA 4JB2A 1RAAA 6ADHA 4KFCA 4ID9A 1W1WA 2C1ZA 4GF5A 4J2HA 3HO8A 4MUMA 2NZ8A 2D2FA 3DE3X 1U0NA 2VK8A 3GPBA 1UWVA 3CLTD 4KGZA 5C8ZA 1UFQA 2AVDA 1K89A 1EVYA 3IBCA 2BBWA 2D4AA 2GCOB 2PMEA 3IMKA 2GO1A 4L8LA 4IDAA 1TMKA 2GD1O 2IPXA 2J3JA 4WKOA 4JI6B 3TIIA 4U2KA 4F04A 2BHSA 1E9CA 4BU0A 4LWOA 4DREA 2CW5A 3E48A 2V3VA 5CYOA 3PXGA 1B2LA 3F3YA 1SVOA 1CVRA 2WE7A 3HXTA 3QFHA 4AM8A 3SHQA 1W87A 2H3HA 2HCRA 1L7BA 2E4ZA 2WSIA 3OIFA 2FSVA 5GV8A 5IW8A 2YJNA 3U6KA 4X7MA 3COJA 3QKRA 4LXXA 5EJGA 1P19A 1XNRB 2OO5A 4CIBA 4O4IF 1OHHA 2C9ZA 4FFLA 4GPAA 2DB3A 4HQ6A 2E49A 4KHZA 1ND6A 3PQ2A 5EPEA 1MG5A 3PWKA 2AMFA 2J9GA 1ZL2A 1E9AA 1H6DA 1EDEA 2FN7A 4HZIA 4J03A 3KDPA 2D3TA 1E9VA 1TTTA 1AN0A 1S2GA 1CFJA 1NMXA 3IP7A 4FP9A 1CETA 1WSWA 4JU8A 4EYOA 3GHHA 3T0FA 1J07A 2WG0A 2ZWOA 3O6VA 4I99A 4NHOA 1SC3A 1FX0B 4ATNA 1E58A 1F6BA 3QJGA 4E3WA 1HC7A 3I2YX 1EWVA 3EZ6A 1J25A 3SXJA 3IA2A 2LXNA 1QIKA 1SCNE 1KKLA 2VDLB 1SUEA 1RM0A 1G7SA 5ILOA 5G0TA 2QM7A 1LLCA 1U1FA 3FI9A 2G07A 2ESRA 2OAGA 2IOHA 2ZQYA 3RHSA 4DDUA 3UQZA 1MO6A 1QPZA 2WLTA 1E5XA 1UODA 2GN1A 4BL5A 4JFAA 2GAOA 2UVDA 1YFKA 1Y3IA 3PF8A 4UDYX 1N5IA 2G76A 2B9VA 3BILA 1CR2A 1XU7A 1H2HA 4H16A 1SY7A 2ASEA 1DRUA 2PZ8A 2VDRB 3GZ4A 3OPYI 1XRSB 1DBVO 1W88B 3BEOA 4UUPA 3IAAA 1DQSA 2R8OA 3NO4A 4TQGA 3HG7A 4CLRA 2DHDA 4KZPA 2X7JA 3H2JA 3QP9A 4AWBA 3ACCA 1KE2A 4ZDIA 2BI4A 4KR0A 4EB6A 2DPGA 5K0BA 2XEXA 3A36A 3JQFA 3H97A 2X86A 3WWCA 4YAJA 1SCIA 2QD4A 3KL4A 3E2MA 4HDCA 3KELA 3PE6A 4KPUB 5JS1A 1HX7A 4YH1A 2G1JA 1XR3A 1NVVR 1VKNA 2I0FA 2ODTX 2V65A 2XYGA 1CD5A 3AF1A 2Z4TA 1XTPA 2X7HA 5DGTA 2XNDA 1Y48E 1RS0A 5FOSA 1IN8A 1Z4MA 4WLNA 4XI9A 4J49A 4EB8A 4UEKA 3SJCA 4G0PA 4HAVA 4NXNB 4ZAGA 4IFBA 4Y0VA 1RKXA 1W4ZA 4URHA 1CUYA 3DL0A 4BFZA 1TQ6A 5EXPA 2APJA 1Y8QA 3S2ZA 4Y30A 2OB1A 4I3HA 4Q15A 2R6CA 4YFYA 4N8EA 1JFSA 2V5AA 3R2JA 1WA5A 5K3BA 3GR6A 4ER0A 2Z6QA 1NUTA 4K05A 5EXDA 2X2OA 4OL0A 2DBVO 3TKYA 3QHQA 3WOHA 1G9SA 1C7RA 1YI0A 3DXXA 4NF2A 3T3IA 3UB3A 3ZY5A 3K1ZA 2AUNA 3R5TA 1RPTA 4R1MA 3FMVA 1NOIA 3TSWA 5K0TA 3FPLA 1G9XA 2PRKA 3LUCA 5AHXA 1ZMRA 5CYGA 1PT9A 3CR3C 4NATA 3ZV4A 3OCWA 3AL0C 4J94A 2J33A 4K1XA 1IWPB 5IK2D 1HNWB 1R6VA 2Q6VA 1QYRA 1S3FA 3DONA 1JR3D 2WMYA 3DVLA 4R1OA 5KNCH 2GFHA 4QEDA 3NEYA 3GFBA 3ZDFA 1MX3A 2NZYA 1Z6ZA 2OY0A 3DOFA 1S4MA 1RI3A 4MXDA 3U80A 2A14A 2ADFA 5FDFA 1K68A 4TZ0A 1BKDR 4EB3A 3CF0A 3LU1A 1W5FA 1G8GA 3Q7PA 4RKFA 2OFXA 3SQXA 2FUEA 8OHMA 3KT3A 3G17A 2XB9A 3RS7A 4PS0A 5JAPA 4Z7OB 3QNUA 4V0KA 1ZRNA 3AJ9A 3R0IA 2OOKA 2AG5A 2QRUA 3AESA 3QBVA 4QFCA 3K9GA 1VZ2A 2KQUA 2JFNA 3R6DA 2GYYA 1PT8A 1W6RA 4UAJA 1N32B 4G0UA 1G18A 4K9KA 2RCYA 5EEHA 1KXZA 4CMAA 2CLKB 2Q6OA 5ALWA 3L3BA 4H6WA 4US2R 3I61A 4EHJA 2AEEA 1UJ4A 3OWHA 4GQBA 4MRVA 2RARA 3V2UA 2FF7A 5BNWA 1CUUA 3H2SA 3O7MA 2RHMA 5C1IA 3ZZMA 2V7PA 1AA6A 5AVWA 3U49A 5LQCA 3P0HA 1F8FA 2BGLA 1WXGA 2QTBA 2XGSA 3C3XA 4NC9A 1L0BA 1BWRA 4KRFA 1S2LA 5AXDA 5CA1A 1YQGA 2YHIA 4KO8A 1QQBA 2PXXA 4G01B 4CKCA 5FA8A 4N47A 3OCVA 4OFZA 5DISB 2C78A 3RC8A 1QGDA 4M8LA 2ZVJA 3H8WA 3OMXA 5F5LA 4DLWA 2L17A 1Q0HA 4GHWA 2QE7A 4IVQA 2YJZA 1L8XA 3IAHA 4YA6A 1T35A 1GNLA 1EVEA 2QD2A 1QJ4A 5EGNA 4O1MA 3OOSA 3IUNA 4J9UE 2EJBA 1I0IA 3HBJA 5CIQA 1V7CA 4D9BA 1II9A 2ZXFA 2BCJQ 4OMUA 3KD2A 3DQPA 4ZU3A 1OZGA 2E4WA 2PUTA 4G5QA 2ZOSA 2JJYA 4LXQA 5IRCD 4G26A 4X8OA 4AULA 4GMFA 4UBLA 4H59A 3U37A 2B61A 5LLDA 1IHPA 3V42A 4YCCA 2O0HA 4YO7A 3UCFA 2H07A 4X7BA 2PKRA 3V7YA 2D8AA 5H7XA 4HYQA 3ESRA 1MNQA 5CLHA 1PDVA 4P81A 1QYXA 1E1NA 1JKMA 1O94C 4JQZA 1XELA 2C83A 4BU1A 3GD5A 3Q87B 4G56A 3FOWA 4J2TA 4R2JA 3LBAA 2BEJA 3MXTA 4M89A 5FR2A 3SM9A 3VA7A 1EUYA 2OZPA 1I7PA 2Z3ZA 4LZNA 2NWQA 3IVCA 1HOTA 4PX5A 4U8GA 2F8TA 1C7ZA 1HT3A 1JZTA 5FIUA 1DWPA 3C87A 4RTSA 4BFCA 4LVCA 2O50A 2X6QA 1KEUA 4R9SA 2Q0QA 4BFYA 1S7GA 2PXCA 6NULA 4DR2B 3PD7A 1VCNA 2Q2WA 1PR1A 2PSJA 2NW6A 2BRUA 1OIXA 4IEEA 4DC1A 1RBYA 2ATCA 1ZH2A 1N4DA 3LFHA 4D98A 2R87A 5JZOA 2PUBA 5DW0A 1TYAE 3PYLA 4YPVA 1YRHA 1L4HA 1YB2A 4RDCA 1DS6A 1Z0AA 3WLAA 5ESWA 3VOTA 4FC7A 4QU9A 3G2QA 4K40A 1QK3A 4DMHA 1BQ4A 1JWAB 1PEAA 4RYDA 1QGUA 4E5NA 1VBFA 4CQLA 2R5WA 4HUQA 4D9MA 2JGNA 3HVHA 5DXAA 1T4BA 2XXJA 4O8CA 3D6HA 1ELOA 1EXDA 1CUGA 1T5HX 5KU7A 4F3CA 2ES4A 3ND8A 1N2XA 5ESXA 1MC5A 4O4IA 1TAHA 3MOGA 3GA5A 1T0UA 3OSUA 4M21A 3W0LB 4TWRA 1SWVA 5IC5A 1LDEA 2C9OA 2Q2QA 3HU5A 4OJNA 2PWPA 2VP6A 2VPZA 2RONA 1T43A 4RZXA 3SAJA 1OBVA 1CIJA 2PKQO 2VP2A 4OLAA 1NVWQ 3D8SA 4QRHA 4BZPA 1EWKA 1U4NA 1VE7A 2GWRA 4IUYA 1DCTA 4NH4A 3UWOA 1H1LB 3W3AD 4F2WA 1BO6A 5HKKA 4LE1A 4PQYA 2K2QB 4BFVA 1A98A 4YV0A 1EQAA 3ZIUA 5FBZA 4JUFA 1N2EA 4GX1A 1J24A 1M33A 2Q1SA 4JX8A 2RDMA 4YJGA 1VPVA 3JQAD 4FSXA 3A2LA 1JVBA 2ZU0C 2OVFA 4JENA 5HJEA 4BGUA 4DIFA 4ZEWA 3LQ4A 3ST7A 3CVUA 1QS0A 3OKAA 4I1VA 4R0MA 3I04A 3GLIE 2CVPA 3VC3A 1VE9A 4MVJM 4UTPA 3W6OA 4Y2RA 1LFDB 1CY7A 5KMGA 5F7ZA 1NUHA 3T7CA 3L40A 5T8KC 1KY3A 1QPGA 3FUCA 2BCEA 1ZVVA 1KPIA 2FWNA 3B1KA 4X1YA 2H7CA 4F38A 4YDRA 2IHYA 2JGIA 1VPTA 3G5TA 4BVLA 1P1CA 2CWWA 1I2ZA 1T5IA 1II0A 4L22A 4NAHA 1NMSA 5ALYA 3WOVA 2UZ1A 4Q3BA 1DDIA 4D1YA 3Q1KA 1OXBB 1AF7A 3L6OO 4GECA 2GSWA 4EFDA 4ZARA 3MBIA 5AVQA 3VJLA 1PDWA 2ZRDA 5T7BA 2BTEA 2PJUA 1WL8A 1OXMA 3HN2A 1B73A 4TL7A 1N5DA 1PGOA 3F90A 1H6CA 1LBSA 1P44A 3DAHA 4AF6A 5E4YA 4EPWA 3U3ZA 4Z4HA 3AKYA 5ALQA 3FYHA 4PM4A 1MHPA 1Q6YA 1D9ZA 4U2CA 4AJ9A 1ORHA 4AJIA 1JWBB 1XRQA 4MLDA 3L7YA 4IXDA 3OZDA 3PXAA 4P53A 3BHNA 2HAEA 3ZUPA 5IH3A 2IF0A 1C8VB 4M83A 3C3YA 2J8ZA 2JGDB 4HBZA 3ABZA 1KZ6A 2E3JA 2PD3A 4P5DA 4V0RA 5CJPA 4A0RA 4IDDA 1A9PA 2W0MA 5CLFA 4DS3A 1KEEA 4ZMSA 2EC5A 1FNDA 4G84A 3G2KA 4B80A 3WLPA 4DA0A 4FW8A 4J0FA 2C5AA 3VAAA 1TGYA 1CR0A 1P4HA 4MINA 4KNWA 4BNUA 5IDXA 1RXSA 3E8XA 4QPJC 2FN8A 3LFUA 4C6TA 1QHFA 4M1SA 3GELA 4Y2YA 2AWNA 2QTWB 4AIRA 1PSDA 1IE3A 3WB0A 4MAMA 4IHQA 1L5KA 4RKRA 2O20A 5EPUA 3SX2A 1DV1A 1LVGA 4I1UA 3AOEC 3MS4A 4LZZA 5CAEB 5TPZD 1ST3A 1COWA 1GZ3A 4P4LA 1T8UA 1FXUA 1H2BA 3VNVA 3DPSA 4UZSA 3ZWVA 4ERXA 5L3QA 2RGCA 4TKUB 3CV3A 3QH4A 2HF9A 3Q8KA 1ICEA 4L2IA 2W8ZA 5EJIA 4B3XA 1MDFA 4CL3A 1Y4SA 2B21A 2IQ5A 3BJMA 4A8HA 2FWAA 3BMOA 3P94A 5ECYA 4EZBA 2QQFA 4R31A 1N8NA 1KAHA 1CYEA 5KDLA 4LNUA 4NJEA 1OC4A 1DOZA 5E4FA 1PZGA 2X8BA 4G5GA 3SQOA 1JPNA 1Y5MA 1MOSA 1ID8A 2Q2VA 4B6JA 3V8QA 5AI5A 4LF6B 1NP3A 3IOEA 1T3TA 3RYIB 4R2WA 1Z2CA 3TNYA 5D51S 2GEJA 2IDJA 4IJ6A 3OM0A 4WX2B 4NKRA 5BQ5A 2HBQA 4AWXA 1WVGA 4G8CA 2JCYA 5D3ZA 1Z2PX 4PG8A 1H6BA 2EQBA 1N25A 1S89A 2O2GA 4LOIA 3KVRA 1QFXA 3KPYA 1G21A 4KACA 4ZAFA 5CDGA 5CT9A 2JCGA 1DRVA 2JFQA 3VX3A 4ZV4A 1AS2A 1Z5UA 1K6JA 3FKJA 4LXTA 1KDVA 1EESA 1KJQA 1GZ7A 1GGKA 2EHJA 2LRHA 1MPXA 1NI4A 1UMBA 1BXRA 2H57A 3A6EA 3BWVA 3IP6A 3PPIA 1YBVA 4KB5A 4MA5A 4B3FX 3UCEA 1JZQA 1H8EA 1EVQA 3GC6A 3LL7A 4M1MA 2QX8A 4PEVA 2H1VA 1RHKA 2XOXA 3NVDA 4KO2S 5DE3A 5DHQA 4OATA 1DIGA 2Q5IA 4HEA1 4CIVA 2CLIB 3GGJA 4Q1DA 1DPGA 4HAXA 1M5UA 1ZNZA 2O52A 4N0QA 4XH9B 4AX4A 2NSYA 4HQOA 4QJ5A 4P80A 4M7WA 4QDUA 3TW6A 1MO2A 3TN7A 5EJ7A 4MVWA 3HCRA 3RJZA 2XUIA 2REXB 2I7VA 3ORYA 4OQDA 1XC7A 2HA0A 4S1PA 3JQ7B 5FBKA 3S4YA 3ZIAA 5KX5A 2XA2A 3Q8MA 2GM9A 3ZGYA 4JI3B 4S2EA 3N2YA 4CFSA 3QBJA 3GLFE 2YR0A 3PG5A 1G8SA 2VTVA 3AEKA 3DVAB 3H7IA 4W1PA 2L2QA 4XUEA 5G3YA 3P2EA 1NV8A 2F1IA 1HM5A 1VCOA 1U3VA 1KEPA 1WDKA 3H84A 5LL6P 2H1RA 4K5QA 2V7WA 3MWFA 3ZLJA 2BHNA 2E89A 1JHZA 3MSCA 4BC0A 5BN1A 2Q46A 1YCHA 2IW3A 1CNMA 1DKUA 1GGJA 1ZISA 2V7QA 2NX2A 1V7QA 4M22A 3B1JA <