4D9NA

Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with d-serine
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
390
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVNVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Diaminopropionate ammonia-lyase
total genus 138
structure length 390
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9nA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9nA01
1A5AB 1A5BB 3PC4A 4D8WA 3IQIX 4AECA 1TZJA 1VE1A 4D9BA 1TTQB 5DW0A 3IQHX 5J5VA 2Q3BA 3R0ZA 5CVCA 4ZU6X 4D9CA 5B1HA 5JISA 3ZEIA 4LMAA 2CLFB 2EFYA 4L28A 1V8ZA 4NU8X 5D86A 5HBGA 4D9EA 4D9MA 2BHSA 1VB3A 4OREX 4IL5A 3VSAA 4L0DA 5I7WA 2GN0A 5CGQB 5DBEX 3X44A 1QOPB 1OASA 3SS7X 1KFCB 1J0CA 1M54A 5BW6B 1E5XA 1TZ2A 3PC2A 1PWEA 1F2DA 5IXJA 2GN1A 3DWIA 1TYZA 4NEGA 4D9FA 2DH6A 4OFXA 2CLEB 1WKVA 5B36A 3DWGA 2JC3A 3HMKA 1TZKA 1D6SA 3PR2B 2TRSB 5DW3A 1V71A 4D99A 1FUYB 1K8YB 5B1IA 1CX9B 1WTCA 1C9DB 4HO1X 1KFBB 1BKSB 1X1QA 3IQGX 1K7EB 2TSYB 1UINA 5EY5B 4D9IA 2CLOB 3SS9X 2J9XB 2RHGB 3VBEA 4JBLA 4D9GA 1J0EA 1K7XB 1O58A 1P5JA 3AEYA 4D8TA 1K8ZB 1PWHA 2ISQA 4LI3X 4WX2B 1KFJB 1KL7A 1KFKB 2Q3CA 4D97A 2ZSJA 3R0XA 2Q3DA 5DBHX 2CLMB 1TDJA 1QOQB 1RQXA 1CW2B 2CLHB 4Y6GB 3PC3A 1Z7YA 1A5SB 1WBJB 2CLLB 2EGUA 3VSDA 5T6MA 5B55A 1FCJA 4I1YA 3CEPB 4D9KA 5I7HA 5C3UA 4HT3B 5JJCA 1Z7WA 4PCUA 4ZU1X 4HN4B 4XUGB 2J9YB 1C8VB 4KKXB 5KZMB 3BM5A 2GN2A 3L6CA 1WDWB 3VSCA 3X43A 2C2GA 4JBNA 5B53A 5D85A 2O2EA 4D9NA 2ECQA 2TYSB 5D84A 2PQMA 4D8UA 4HPXB 5I7RA 5I6DA 5DVZA 1KFEB 3RR2A 1K8XB 1J0BA 3IAUA 1V7CA 2CLKB 3TBHA 2RH9B 5E0KB 1Y7LA 2D1FA 4ZQCB 2ECOA 4F4FA 2CLIB 3FCAA 4L27A 1TJPB 2ZR8A 1UBSB 3VC3A 3V7NA 3L6BA 3FGPA 4HPJB 3T4PA 1VE5A 5I7OA 5IWCA 4L3VA 2RKBA 5KINB 3L6RA 5B3AA 4COOA 1JBQA 1A50B 1UIMA 4QYSA 5I7AA 3AEXA 4H27A 2V03A 1BEUB 1J0AA 2BHTA 3DKIA 1K7FB 2J9ZB 2WSYB 1K3UB 4AIRA 1TTPB 1C29B 1J0DA 4D96A 1TZMA 5D87A 3SPXA 2O2JA 2C2BA 2ZPUA 4LMBA 5IW8A 2DH5A 4D92A 5J43A
chains in the Genus database with same CATH superfamily
1P2TA 5JZVA 4ZPXA 1ADCA 3GJ0A 3KKMA 3NOXA 4JWTA 1RM3A 4DQDA 5HXAA 4TVKA 1O6BA 3SICE 3T52A 1H8EA 1RHMA 4GR9A 1XCGB 4HDMA 2DFPA 4ZZIA 3EAFA 4DLAA 3KC2A 3ME5A 3M83A 1UFQA 5HRUA 4PANA 4A2QA 2BFFB 2CCKA 1KOLA 3WL6A 1WLSA 3L8FA 3AVUA 4NBTA 3T94A 4RAOA 4IZ6A 1UBFA 3K96A 3I53A 1A9ZA 4RL4A 3OLCX 4DSZA 3O90A 2P0AA 1RWWA 1ZIYA 1U2DA 2IPLA 3D3WA 3PLAE 3UH0A 3G7SA 1QH8A 3ACCA 3VYSB 5ARBA 2ZUEA 2QRMA 1ZNQO 3HI6A 1WZNA 2H65A 1S8NA 1ODFA 3T95A 2IZ1A 2ZYIA 4K26A 4NMMA 4YDRA 4BO4A 1TYZA 2W0SA 2PX2A 2XRFA 3DONA 1ESZA 2FRXA 5LLSA 2OAQ1 2A5DA 3UT6A 4KR2A 4RHCA 1Z0KA 1GYPA 1H0SA 4MUEA 4RTLA 1SKQA 3C8ZA 1KI8A 1CQXA 2CLSA 4OB7A 4PYKA 3TQCA 4B34A 2MYPA 2ORIA 5HWSA 4XWWA 3AB3A 4UTRA 2WB2A 1O94A 2I4OA 5DJ5A 1LSOA 3MZ0A 5EKTA 1YQGA 4R51A 5E6RB 5C1OA 1LJUA 4RZIA 4ARZA 1XTVA 4ZQGA 1Q19A 3G2MA 1GPJA 2J85A 1J9GA 2Q3JA 3FCEA 3FVVA 2NNWB 5KCMA 3CLSC 4PHGA 3EGDB 5CBPA 1ZH0A 1ESEA 1NL3A 3BHIA 3MN1A 3FJYA 1WOYA 2XZDA 1MJ5A 1VHDA 1LDEA 3PTLA 3UB2A 2JKVA 4WX2B 3FDIA 4ZPJA 3UV7A 2G83A 2A1TR 1XB2A 4R1SA 5JWOA 4L9AA 5HKLA 1Q7EA 1GLGA 3MT7A 1NRJB 4RXTA 5L6LB 2P65A 4MCJA 5A7GA 4B7ZA 2ZS9A 3D3EA 4R83A 1EFRD 1G20E 3DDOA 5EKDA 1I7NA 2VYND 2C96A 3PPVA 4XLLA 5FX2A 5F2NA 2RB5A 4ZI5A 4EKIA 2C2KA 3A9UA 4Q93A 4FFNA 3LD9A 2VDKB 3BM5A 1OJ7A 1UZNA 5AW9A 2G9NA 3KB2A 4RENA 4D8YA 2W42A 2O8DA 2BMFA 4CTNA 1GDTA 3D6UA 1LFDB 3R3SA 3W79A 5K5EA 4NAVA 5CDFE 3WWOA 1EWTA 1E2LA 1E3JA 1H42A 1R8SA 1KQPA 3FM9A 4MRRA 2PO7A 4N9WA 1XVAA 2D2FA 1DV1A 3RTBA 1RT9A 3K0CA 1OREA 4QASA 5EGNA 4DXDA 1N5MA 2RH9B 2N42A 4OSEA 1K27A 5DBFA 5SZKB 4DNQA 1R5OA 4JC4A 5KJCA 3VC3A 2I4TA 1GUYA 2EBWA 3P9ZA 2J3JA 3GJ6A 4Q7JB 4U2CA 1VE5A 1AG9A 3E3AA 3GRVA 4XSVA 5I7OA 4EENA 2HLNA 3QLUC 5FLXA 2XMQA 1WCIA 4ENSA 2QRPA 3QKSA 2BSQA 4TXJA 5IULC 3R6WA 2F9FA 4QG7A 4XIGS 1NHGA 1KZ9A 2I5PO 2CUKA 2XSZD 4YLGA 4G5RA 1H9CA 2C4TA 4CKBA 3OQ6A 4Z9FA 1C3VA 5KWEA 4LQLA 3TTVA 3I92A 1RS0A 3ZIAD 4ZZ3A 2QMYA 1SCUB 4LVCA 1H66A 5LQRA 4MOWA 4BLQA 4EMTA 4D0RA 3QKTA 5HQTA 4XQ0A 4DUGD 3WC4A 3SYKA 3ZYCA 4PE5B 5CVCA 2YOGA 3AZOA 2CXOA 5KTMA 4IY1A 4RZ2A 3KUCA 4JL5A 4OJYA 1N2BA 1KAQA 4PQFA 1X13A 1WB9A 2ASEA 4JZKA 4MHSA 3UAZA 4MUIA 4PNZA 3WLMA 1VRCA 4K5QA 4CMGA 3RYCA 2QUHA 3TOZA 3VAZA 5CDSA 1E92A 1DC6A 1JALA 1ZDMA 1Y5LA 1TVKB 2POQX 1YB4A 3U60B 4OHZA 3GJ7A 3HGMA 5DYGA 7YASA 4OIMA 1P5RA 1YAJA 3IP3A 2RHDA 4HLDA 1WKVA 4MQBA 1DAEA 4OO3A 3TIVA 2R7MA 3FVWA 3ZLUA 5AVSA 1L7AA 2WA2A 3C3DA 4H77A 3RIEA 3NETA 4C88A 4MNTA 5LB2A 3B5EA 3MTGA 1THTA 3NMUF 2H1HA 1DEXA 4NBKA 5AQ1A 3OOHA 5KSZA 1JDUA 1Q2UA 1QGAA 1DT3A 5HX7A 4AZ0A 3NHBA 3FYUB 1VIDA 2D0DA 3FR8A 2C98A 2XKBA 4JVSB 7REQB 3RRYA 1C30A 3LRPA 4OU5A 5C81A 4R54A 1RCTE 3SIRA 4J1TA 3C3XA 4LXQA 1GAEO 2DFTA 3M6MD 4K9NA 4EUEA 3T9EA 3A1VA 3CX8A 3AC0A 3GAFA 5LA6A 1GT91 2K4MA 4Y9UA 3B82A 1ENOA 3NYWA 5BUSA 1PGOA 1JSRA 1ZK2A 3CUTA 5G02A 4EW6A 3EXHC 3ZU4A 1V8DA 2A0WA 1R37A 2YJ6A 3IVMA 5BOSA 3DZGA 1ZICA 4ILKA 4XUGB 1ZY2A 5EIHA 4WZAE 4DIDA 3RKRA 2B98A 4UEJA 4G2NA 2P1ZA 3HYTA 1HRDA 3TLEA 5JSYA 5F7OA 3T4UA 5K05A 3ZLJA 3JZAA 4XTRA 5ITZB 1WULS 2VXOA 3I73A 5CB4B 1KGSA 2DG2A 3KU4A 4CM8B 3QLUA 3DW3X 4QNRA 4UQPA 4L8YA 4JUFA 2RHMA 2Y1FA 3OTGA 3GFSA 1OTYA 4Z3OA 1QZXA 5BSKA 2ZYUX 2QIPA 2ZB3A 1NF3A 4QZVA 4GECA 3LPMA 4AQDA 3ON5A 4L6CA 3A26A 5DRTA 1RXWA 3DE4X 3AUXA 2H2FA 1AQYA 1UBHS 3ZTWA 2J4FA 2BZGA 1U2SA 1X14A 1IPEA 2IZ7A 1QVVA 3P9YA 4O4JF 1W75A 5LNK6 2C95A 4KE9A 2JLBA 2FW1A 1E2BA 4YCJA 3KFLA 1TZBA 2I1VB 1UKAA 2WJJA 3LT5A 4GVPA 1R4MA 4HTFA 1O3YA 3NTXA 3MG9A 4PO3X 3WMRA 4L73A 4FGZA 2ZWMA 4WBNF 1ZGHA 4RGYA 4FFMA 4AD8A 3C7AA 3BTVA 3K8ZA 4O2LA 1WOMA 1OYOA 2CNOA 3KWLA 4AZVA 2P8JA 4ANFA 4B46A 4C2UA 3H42B 4QGAA 4KFUA 1SHKA 1AK1A 1EAMA 3AY7A 5GJCA 5K6RA 1DC4A 4YCBA 1OA0A 1ISJA 1DMSA 3P4YA 1I4OA 2HN9A 1DELA 4PS0A 4QU0A 3T1HB 3RB8A 2HBRA 2VJMA 3PNQA 3VR6A 5JWRA 2CLFB 3PFGA 5HIMA 1NJSA 2R6AA 3BBLA 4KX3A 3IIKA 3WZLA 2WJ6A 3KOWA 3CS3A 1O0BA 2JGRA 1FDWA 3AIOA 1WZ2A 1FFHA 2V5AA 3FA2A 5AKKA 1CJTC 4F6CA 2BH2A 4JCOA 3DZIA 1NW3A 3VBCA 1E5XA 2IYWA 3KT3A 3ZBQA 3DOCA 4CLDA 4ONEA 4ZVPA 4A2CA 3ELBA 4NV1A 1WM1A 4ZCPA 2AK3A 4LWQA 1E7MA 3CO5A 3SAJA 2OAP1 3EEQA 4KAJA 3X1MA 5A5FA 3UOAB 2BFFA 1USKA 1TKAA 5IAJA 1L0BA 2ABWA 3FPBA 1G1AA 1VFNA 7GPBA 1KEKA 4C87A 5YASA 1U0GA 2QW1A 1EXMA 4PTZA 5K7SA 3TI7A 3P26A 3EFOB 3V7YA 2ZQZA 2H5LA 4QDKA 4XWAA 5LCXA 4YRNA 3NANA 3D8HA 4S1NA 5EE9A 1G98A 4OI4A 2H07A 4PR0A 5BRNA 3OFJA 1DDIA 1KP2A 2XDYA 2YY7A 3A0UA 4RIEA 4D9GA 2QY9A 5CNJA 2XCQA 1RWVA 1UXKA 1TGYA 3WRYA 4UU8A 1QH9A 2B83A 1YQQA 2QIOA 3RVLA 5B7NA 1FX0A 1KDRA 3GLIE 2GVNA 4BLVA 3K70C 1MH9A 1RYYA 4G0YA 5LMCA 1DZIA 3N2EA 2WYVA 1RKXA 3EMDA 3L7KA 3KTAB 2H5EA 4F2HA 3ETGA 4PGGA 1ATIA 2CLLB 4KR6A 1YJXA 3R0QA 5EVCA 1YULA 1CYDA 1KJWA 3R44A 3PNSA 1X1SA 3N1UA 4XIYA 1U1GA 3I9OA 1M3SA 4FONA 4EY5A 5C4IA 3FZYA 4JY7A 5GIOE 5LMUB 2I4LA 3P0IA 4K87A 4YC7A 1MB0A 1Y1TA 2HDHA 1O0CA 4X3OA 2EW1A 2O3SA 2PXCA 2YJTD 1M2NA 2ZJ0A 3GUUA 3OX4A 2J6CA 5G4LA 4N0PA 2BEUA 1G55A 2JLZA 1PV4A 3C3YA 4G1EB 2P7IA 2CL6X 1RADA 3I9NA 4KXWA 3HU5A 3TB6A 2WYWA 2F4VB 1FY2A 3H1BA 5DKFA 1HNWB 2BZ1A 2WINI 2BKEA 1SKUA 1ZI9A 3CA8A 1JNXX 3GRFA 5BQ3A 1TM3E 5ULLA 2Z9CA 4F6LA 2XGSA 2JD0A 3YASA 1I7DA 3HDHA 3GPIA 1DOHA 2YNMD 2OZVA 5J2UA 1H2WA 4B3MB 2QZPA 5J1SB 2DHEA 1ECPA 3I8XA 5A1JA 2V7TA 3OU6A 1E1RA 5I7AA 4CLOA 2F8LA 1RLOA 4N3CA 1ZD4A 3UXHA 4FYMA 5A71A 1VCIA 4ED9A 3IR5A 3KJGA 2E1PA 4E1AA 4ZVSA 2EGHA 3RG2A 2CYBA 2Z3WA 3LS2A 3QPCA 3L0CA 4K6CA 1Q57A 2OWDA 1RQNA 4EHAA 1GQRA 2H54A 5IBQA 5BN3A 5H80A 2CVQA 4BV8A 5MDHA 4PX3A 4EKDA 2R751 4WCDA 1U4SA 2O1WA 4UKDA 1D2NA 1MPXA 2NYVA 4WN9A 1WABA 4D9BA 1G7RA 1C41A 2P1DA 5J2UF 2AVNA 2PX8A 3DVRX 1QK4A 1M8PA 2VCHA 4ZMBA 2JFWA 2BGLA 2ZAMA 4JJAA 3SN6A 4O4HA 5L3QB 1M5UA 1DBQA 3MCUA 4UZSA 2IVFA 3SI7A 4XR4A 4CCSA 3JQAD 5G3ZA 4BVKA 2YS7A 1AB6A 2A5LA 3G9UA 5G0SA 1YACA 1QLHA 5EXSA 2ZW9A 1C4OA 4CE6A 3STHA 2E7ZA 4WAUA 3C0KA 2XGJA 5K3FB 2W6OA 4KODA 3VU3A 4EPVA 1MEJA 2QD5A 4L0CA 2Z2YA 3HKBA 4MP3A 2RCYA 4CM4B 3WTCA 4QGSA 1H2RS 3B6KA 4JBXA 4V3BA 4UHDA 4G4SO 1R9JA 3OX1A 5G1NA 1GKIA 4KR0A 4DIKA 4XDGA 3L8DA 3GI1A 4HX5A 1M2KA 2Z8YA 3RUPA 4YAKA 1O95C 4W5RA 2P6OA 2WWWA 4B4UA 3B6EA 4HMOA 2W4IA 4FMDF 1MLDA 4LOHA 1FYEA 5DT2A 1XJ5A 3I83A 4RKYA 2PJDA 4TMYA 4LMRA 1CIPA 4WBSA 5EWLA 1Z08A 3FJOA 3W6PA 4J43A 5DNEA 1QNFA 3R9XA 2O5EA 5JIBA 1B6TA 3B6JA 3L43A 4URZR 2PSHA 5ALPA 4WEOA 3ITDA 3THWB 1K8ZB 4TLDA 3HZOA 3TECE 3FB1A 1PGPA 4QEZA 3U09A 2BZSA 2NG1A 1X8JA 3D7KA 4RSMA 4AZTA 5FYQA 2YR0A 4MZXA 3UYKA 1UQUA 4GPBA 1GPMA 3A06A 3HCAA 3QPWA 4M38A 3HADA 2ZJ3A 4MQLA 4B9EA 1TCVA 4D0LB 1M34E 3VX3A 3EIFA 1I0IA 2JLAA 4MQEA 5KIAA 4DR1B 3MGBA 2QN8A 5ALJA 3LC1O 3H86A 1V4NA 2NTVA 1CVRA 2BRUA 1CP3A 1JYSA 5EXTA 2VDWB 4LXYA 3T0FA 4DSNA 4DDWA 2F43A 1ZD2P 3DVLA 5C35A 5AXCA 1XROA 1NDUA 3ESBA 3NZEA 1E2IA 1N78A 2GXUA 3GJ3A 1OLUA 4BGUA 5BPHA 4HATA 5JOQA 3HRKA 5JARA 2FPMA 4DQLA 1NOJA 1G21B 1RFGE 3N6XA 4MW9A 3Q0TA 3UW1A 4B40A 3ZV7A 1T10A 1NI3A 2ZUSA 3IT2A 4M0FA 5CFOA 3IMEA 2Q9AA 2AG6A 1M6WA 5IDXA 1RXVA 4FXPA 4MJ3A 5JS8A 2NSLA 3E05A 5FEMA 5C31A 4D3FA 1AF7A 4ZVKA 1OGIA 3GRKA 3O8RA 4XAQA 5JAMA 4BKMA 5FH9A 1E1LA 3R41A 1JQ5A 2PMBA 3Q88A 5TGZA 1OFUX 4ZU3A 4LGVA 4JX9A 1BMDA 1WF3A 1STOA 1Q0ZA 2NO0A 2PT9A 2ZBVA 3L06A 3ESRA 3WIOA 4KDCA 5FFFA 4D96A 1RKBA 1HT3A 3I1JA 2WHRA 1IWOA 1N8SA 4KXXA 2PL5A 4HNRA 4QU8A 4BZWA 4BKUA 3F3KA 4OLFA 4B8WA 5HKBA 1RAEA 3UQYS 3WWEA 3IDQA 1AHPA 1XJWA 5E4YA 1J0XO 1WSWA 3DHEA 3TJMA 3C45A 3NB0A 5HIAA 2J3DA 3KOXA 1GXSA 1MJHA 4NJEA 4V0RA 3WBKA 5LQJA 4CEJA 1G4AE 1H4QA 2IOHA 3HMQA 2OGWA 3BRSA 1VI2A 2YZ2A 1WDKA 4I2NA 4LK2A 2C0PA 5FB3A 2KSQA 1COWA 3MWJA 5JISA 3BD8A 2C2WA 3ZU3A 5ED0A 3RRXA 5KTPA 3QLTA 1KY4A 3CKKA 3GIDA 4EF4A 3PXAA 1REQA 4F6RB 4ZD6A 2XNKA 4WTOA 3SVZA 1E1CB 3A05A 2G9QA 3EMKA 3KSMA 4LRYA 2L0XA 4TLAA 5CFRA 2RBGA 1A9TA 3OE1A 3EC2A 4PSDA 5SY4A 3NKFA 1XU4A 3G6KA 2HMAA 2BHNA 2MYUA 1N2CE 3PQ5A 1K0FA 3TYXA 4BVGA 3K3PA 5HR5A 2JPDA 2ZZNA 3LQ2A 4N5NA 3ZZNA 1SIUA 4JP1A 4HAUA 3QX9A 3GB9A 1PNQA 1WXEA 1DAHA 1V5WA 2BGWA 3FLAA 4NOKA 2C1XA 1PVOA 4BFUA 1I0ZA 3B6ZA 4EDFA 1Z5OA 1BN7A 4X45A 3UK1A 2PD4A 2WHYA 5I8WA 2VPTA 4P86A 4NE7A 2BONA 3FUWA 4HV4A 4TN5A 4ZIRB 1IONA 1VE3A 4ML3A 2WKRA 3SHFA 1DL5A 2ZE6A 1UOPA 3I34X 2XMBA 3LHDA 2IOYA 3PCRB 3ZDXB 3SG0A 1N77A 2J0UB 1A9XB 2IYZA 3LLSA 4DPKA 2I22A 4MUMA 1WXDA 2GJ9A 1ISMA 3N2ZB 4DMGA 1AN0A 2PL9A 4EYKA 2ZXEA 1FUIA 4BMYA 3OT1A 4KK4A 1GNVA 3ONVA 1I6LA 1U3DA 3LK7A 2QDXA 3IAAA 4UUPA 1BXGA 4WXPA 5EIBD 3GVIA 3PG5A 3VQTA 4DCVA 1KQNA 4DIMA 1TKCA 1E9SA 4W1PA 3OX2A 1L7PA 4QSHA 2HJVA 3E8MA 1JU9A 3Q0EA 4J4BA 2XTMA 3HA7A 2GB4A 3GBPA 4X61A 1TRHA 1YZLA 3G59A 4PPFA 1O54A 1BMQA 3RT7A 1XPUA 4PFSA 3QWFA 3OMXA 1Z0AA 2XLBA 3F0TA 5HA5A 1DC8A 3TR6A 1XWFA 3VC1A 4DIOA 1G5QA 3P9CA 1TFUA 1YONA 3GQBB 2VBGA 3QE2A 4MB2A 3U1TA 1V39A 3ZDRA 5KYXB 4N7MA 3DVAB 1MT0A 4OU4A 2JJ2A 2WJZB 2HRZA 1XMIA 2XUQA 4DWVA 1R16A 5JROA 2OILA 3V8NA 1MO5A 2PMCA 3ZDDA 1Y3IA 2J9GA 4FD2A 3ANLA 4HUJA 4XRGA 2O2HA 5FOQA 4LFBB 3ZHSA 4AKHA 3LCVB 2OECA 1WUIS 2GETA 4TKVA 2W83A 1MAUA 4IGFA 5IP5A 1JDBC 5A6SA 3P9XA 3HS3A 4DR3B 2E3JA 3PQFA 3KD3A 2PLWA 4K2AA 3PGVA 3FCSB 5KINB 2HHHB 3ZY3A 1UBNA 1O1YA 5KHLB 2JAUA 2WPNA 1ELOA 1THZA 2PUHA 4FI3C 1TB4A 4KQ1A 4PZPA 3Q8KA 3CNNA 1OLXA 2XTAA 3TG8A 4JGIA 4YYEA 5IM4A 2BM9A 2G06A 2WNIA 4F0JA 2A35A 2JLUA 3OFSA 4RK6A 1FVHA 4G4GA 1JG7A 1JXMA 4QVKA 2PGXA 5BWLA 4BVAA 3FNRA 4NPHA 1OXTA 4TLEA 1HFWA 4AWXA 3RADC 2RK6A 4KH0A 3BGDA 2PH7A 2XMRA 4O4HB 4DJFC 1FOEB 2Y1EA 4P53A 2B4YA 4C22A 1WZCA 2GBPA 2ORED 5DM4A 2DB3A 1TI7A 4QO7A 1BFUA 2QL9A 1A8UA 3ZJUA 4XX0A 1MH1A 1WHTB 1D2HA 4YQEA 3NONA 1GZ5A 3ICCA 3VR6H 1XSEA 4K9PA 4AN1A 1F51E 1JIVA 2PTGA 4TZ6A 1ADGA 5C53B 1JZTA 4ZOLF 5G4KA 2C9BA 4UXIA 1EVLA 3HY3A 1CS0A 2WMOB 1I2CA 4BMSA 1ENZA 1V5FA 2XOXA 3HB9A 3JU3A 4BJHB 3ZPXA 3D8TA 4OMDA 4R1UA 3QENA 4D8XA 2W6QA 3L0ZA 2ZS7A 5LD2B 1NZJA 3CF6R 1CY6A 4NQRA 1MFZA 1ZOLA 3GMIA 2OFOA 4OD0A 1DXHA 1Y0BA 4BAUA 3U61B 2R68A 3PT9A 1NW7A 4BO3A 4E7OA 3ABQB 3C3CA 2UDPA 4B3XA 3KE8A 3EASA 1JQ3A 4I8DA 3DBLA 3KT8A 1V71A 5ECDA 2FFJA 5BQPA 4W5WA 1QHFA 2YWCA 3E4DA 4UAJA 5HUJA 3E23A 2BGJA 2P5SA 4CKZA 2O54A 2OBYA 4ZOLA 1T15A 3FNHA 4JLVA 6ABPA 1F48A 1QFZA 1ZIOA 4ZTBA 1YJ5A 4X95A 3K5HA 1IM2A 3W04A 3NM4A 1RIIA 3G1UA 3HDVA 4UNPA 3O4GA 3UJBA 1HLFA 3WBBA 4L4UA 3PWTA 3HLYA 1Z7BA 4KGXA 4CQLA 4JJGA 5J4VA 1S3GA 2GYUA 4PGMA 2RAPA 3UF0A 4BMXA 2WUWE 3DEFA 3LHKA 5F1OA 1G59A 4ZOLB 3WIBA 5LZ8A 4AJHA 2BTOA 4ENPA 4OHOA 3VVLA 3ZKWB 3ZS9A 3PKJA 4I5DA 5C0OE 3AWIA 4MI3A 2X14A 3KUDA 1PZHA 3GDGA 5JCOA 1ZOOA 4FNMA 4P83A 2BBTA 2ZWAA 5KCZA 1MDBA 1G18A 1OV6A 2G0AA 2VI5A 2XVYA 2YRFA 2YY5A 1J97A 3LLMA 4WZBB 5KTRA 3D4PA 3AUYA 1L5NA 2EATA 1AQIA 5EKSA 4D4JA 4EJMA 1UXIA 1W36D 1H93A 1IXYA 3TTTA 2O8BB 5FNZA 3UCEA 2H9YA 1TZCA 4FOSA 2AG0A 1K8XB 3BCUA 1LDMA 5IDWA 1TPZA 1NV8A 2Z95A 4U6QA 5A5VA 4HB2A 2Q27A 4NCHA 3EPRA 3LGAA 3KD2A 3FOFC 3JSXA 3O38A 1VZ3A 4MDFA 2WU1A 1Y4UA 3T7KA 3AR4A 3CB4A 3Q10A 2C00A 1XPJA 4J16A 4OQEA 1FP4B 3ZH9B 3WWZA 3RE1A 2ZE8A 3OF2A 5C8DA 2QW0X 5MFZA 2C7GA 2WTUA 1CTQA 2JIZD 4HYEA 5HGJA 5AVOA 1JSLA 2I0FA 1NR5A 3QU9A 3OQ1A 3T7EA 1XDGA 2RHOA 5KOYA 1ZNZA 1DCKA 1W36C 1TCUA 3W1WA 4EVSA 3GUCA 3M49A 3U6BA 3KXDA 4D0NA 3EEIA 1S9DA 4CLRA 2D5CA 3EDRA 1Q7GA 3IR7A 3HUFA 4TQ9A 4HKTA 3HB1A 1Z37A 3ITEA 4IEFB 1GVNB 2OB2A 4RD1A 3RROA 4MDEA 2IZ5A 4EHLA 1XEWX 3VTAA 4BUJA 1KAEA 1N7GA 4N7RA 2YJ3A 5G2OA 1T6YA 1NF2A 1ZIPA 3IVGA 1B0ZA 1IUPA 2VRBA 5BXYA 1UJNA 2GZDA 1WHSB 4PFJA 1ZXXA 5G41A 3AI3A 5EQTA 3V9PA 3VR4D 3KE9A 2D62A 4EFKA 2NUAB 4QIHA 3WGUA 2J9RA 2ZWPA 1XZCA 1PNRA 4MS4A 4RVCA 4K9QA 3P2EA 4H1VA 3AWDA 2D4HA 5HRAA 3IDAA 1MOQA 1OWMA 4YV1A 1FMCA 5CNKA 1U63A 4ARIA 3F6BX 3BTSA 3K1AA 3B3QA 5EKUA 2Z6UA 1SVLA 4Q9LA 3BWYA 4B6EA 1AY0A 2AWNA 3QGMA 3EZ7A 4E15A 3WIVA 1A69A 2I3BA 3QNUA 2VHZA 1FJHA 4FR0A 4RQBA 4Z3DA 5TSDA 3LKVA 2P4HX 3N3AC 4BNDB 1Y9DA 1UK9A 1TIPA 3M6UA 3CC8A 4MZDA 1OYVA 1WTCA 3UUEA 5DM0A 4WADA 4MRVA 3HJUA 1EK2A 2FCRA 3ZCUA 1JHZA 3AM4A 3KAQA 2N1MA 1NJGA 4PWYA 3LUKA 2NO1A 8ABPA 1FRVA 2OO3A 2X4IA 2QX9A 3ICEA 1H2FA 4PBRA 3R7WA 3ST7A 2YBDA 1ZGGA 4XGNA 1TUBA 2V45A 4DIUA 2R8PA 2QP4A 1NW5A 4DCPA 2GKOA 5FD8A 1CPYA 3L8HA 5B2FA 5HKKA 3IRVA 2C04A 2M6RA 3N8GA 4MYTA 3EISA 4GC5A 5CDYA 1HYEA 4ISBA 3M4NA 4W9RA 5ESWA 4A6EA 1FCJA 5JJCA 2W6MA 1IQRA 2CHUA 4FGUA 1QH0A 4R8VA 2RDMA 1AUXA 1AH2A 5I9TA 3I12A 3P9SA 2DEUA 4XJTA 4B2LA 4IZHA 2A4MA 3QLJA 3PUZA 1PNOA 4YPFA 3P0HA 3MWLA 4RVNA 3JQGB 4ALKA 4BWFB 2VYNA 5CBKA 3KQSA 3LO8A 2E5LB 1O9BA 4E2ZA 4R40A 1JI0A 4NHOA 4QHYA 1GTJ1 1VA4A 1KE1A 1QGUB 1FA9A 4MPJA 1FLNA 4JBHA 3IJRA 4LWOA 3D59A 4QU5A 2Z6AA 3MRXA 5DIFA 4CMIA 1M66A 1B8OA 1AKTA 1L5QA 3Q7PA 1AC5A 2VT3A 4Q12A 4ZXFA 1CUEA 3CZ5A 3B1YA 1QDEA 1M1YB 4FSDA 1MB9A 1NVDA 3S2SA 3V7NA 2EBFX 2H3EA 3F4BA 2NYUA 2ZDHA 5EJMA 1ECCA 5FBQB 1L4LA 2YWHA 2PAFA 2R6JA 4ZQFA 4EAQA 4MS1B 5IWAB 4AO8A 3IAS6 4P7KA 1HDOA 2OGSA 1ZSVA 4GPD1 3ZCSA 4CM3A 5AW0A 3BEOA 2Q28A 2XF8A 1KMIY 2Q5EA 4OAQA 4EY3A 3LP5A 3EY9A 2FK8A 3F96A 3FOBA 1SCQA 3G9XA 4UUOA 2OFFA 4QGFA 2E6KA 3TFQA 4BY9E 4GKBA 4Y2PA 1NI4B 2DQYA 3MXTA 1LVGA 1BE6A 1F2TA 1KYTA 1A5AB 5DBGA 2EC5A 5TS2A 3GCDA 5F73A 1IZYA 4J4HA 4QRIA 4W82A 4CEIA 2Z2JA 1XMOB 3O31A 5K8LA 1E9BA 3HU3A 1L7MA 2OP0A 2GEUA 4P81A 4PWZA 1L8XA 2DPLA 3CGWA 3S4YA 1W0KA 2R6ZA 4KR3A 1ZUNB 1PSZA 1VPWA 3FZEA 4FMBB 2QZ9A 3HJHA 4L5YA 1W5TA 3KK0A 3MFYA 1H23A 4CL3A 2GBFA 2PL1A 3N2GB 1PSDA 4A03A 5IHPA 3BWMA 3ABRB 5AMXA 1EYZA 1KPHA 2D1TA 3DZFA 1PKXA 3M70A 4TYPA 4CCYB 5KTSA 1YI1A 4JK3A 4ACBA 4GPTA 3WKBA 2FSSA 3GUVA 4P4NA 1MZVA 3ACBA 3SC2B 1RJWA 1QHYA 2O7RA 4FGWA 4PG4A 5E6SA 1Z6AA 2PZLA 3C3AA 3K8OE 2QD3A 1KO4A 1ACLA 5B3JA 2DH6A 2H1LA 2HU5A 4A0QA 4EQZA 2O14A 1HMPA 4KG7A 1CHNA 3H9UA 4KXNA 3QIVA 3AKZA 4P0TA 1T5IA 3HHEA 4OH1A 4MWOA 2WIFA 2MYTA 1C7QA 2N1BA 1I30A 3KPUA 4XUDA 3C6BA 4KOEC 3ZI4A 5HKOA 1M8JA 4FMDB 4UVIA 2QYTA 4WI1A 2C4NA 3ZLTA 4WJZA 1E7SA 1UP7A 2Y93A 1EAYA 1W5SA 4OJTA 2ZBQA 4LE1A 1SKYB 2WSSA 3QWBA 4QGBA 1VMAA 3BDVA 2GCOB 3ZEAA 3EGIA 3KP1A 3RC1A 4BE7B 3G5MA 4R1TA 3ZD9A 4D4LA 3ONDA 4UHHA 1UMCA 4OJQA 4F3YA 2BH9A 3OTWA 5LIPA 4CTMA 2NO4A 4R5HA 3PYLA 2IA5A 4TLMB 4RJTA 4A1FA 5FP0A 3WGJA 3R9XB 1C50A 1G8PA 1XRMA 2DCMA 2GEBA 3BIOA 3AT1A 3VPGA 3RC7A 2Q3DA 1RC8A 3A10A 1JUDA 1CUBA 3HL4A 4YH1A 4D0SA 4LCBA 5GJBA 2VP9A 2OY0A 1SULA 4GM4A 4I1YA 1DQYA 3ZCVA 2Z09A 4BNTA 1U28A 1NVTA 2I3DA 4G0WA 1EJBA 2TMYA 2P2YA 2VP0A 2DHRA 3AO0B 2BKVA 1AKQA 1UPTA 2V7VA 4EJSB 4WVLA 2DBVO 1RQ7A 2OG2A 2CB9A 2ISSD 4UREA 1ADJA 2PKWA 1QV6A 2IXFA 3ILVA 3RJZA 4DCSA 3EUWA 2F3RA 4Y1GA 2BGRA 3VGPA 4ENTA 1QGZA 2F43B 3WP1B 3GJQA 2DHCA 2GWRA 1PF7E 1PLKA 1BH6A 1WJGA 1D7OA 1ICEA 2W8BB 3GCZA 1N5OX 2BWJA 2RHCA 2GDZA 2Z58A 4GRIA 5E0KB 4N48A 5LL6P 1NUPA 3L04A 1OBVA 1VBMA 2WKWA 3M6FA 3E9DA 4QOHA 1XMJA 1IZ9A 3EGVA 1REQB 4QOIA 9LDTA 5K09A 1R8QA 1BXRB 1DG3A 1G20A 2JRCA 2R8EA 3CRNA 4RY9A 2BBSA 3S99A 1IM8A 4K88A 5SICE 1W9MA 3S81A 1UIMA 3ETNA 3DE3X 5D3ZA 1Z6XA 5DF1A 5J63A 4P5DA 2NU8B 1M1XB 3ICQB 2WZCA 2Q5JA 1Q0TA 2IW3A 2J30A 2G80A 4FDVA 3NIGB 5LN1A 1HBJA 1Z68A 4D6PA 1IDOA 4FJ2A 4MGEA 4P38A 3VNQA 3W5HA 3WJ7A 4DGQA 5KU7A 2H0AA 4XD7D 2G7MC 3RUIA 3U4MA 1EGHA 4CCYA 1CUIA 1TPYA 1Y5MA 1SUIA 2IEIA 1AUPA 1E1MA 4YO7A 1LV8A 3QFSA 1YIAA 1GRNA 1DT5A 1TQHA 1XZQA 2GS9A 2OK8A 1IOLA 3N6RA 3R8XA 3WYAA 2BFMA 3EIHA 3SCZA 4L7VA 4NABA 4U2KA 3UJ9A 1UADA 4MQFA 5KOIA 1N4AA 5F2EA 2Z56A 5CHEA 4KPGA 3ELUA 1TVMA 1X87A 2QRLA 3OZEA 4LX8A 1L8LA 4AY6A 4YQFA 4MV6A 4TTQA 1N92A 1M76A 2PMKA 3DE0X 3M34A 3O2NA 4AYXA 2YZGA 4DBVO 2ZRAA 3PTAA 3KLBA 3HWX1 1BEEA 3BMNA 3RODA 5CA0A 3TZBA 4CRWB 1UJBA 4BQIA 3KALA 1SBIA 2B6NA 3FWZA 1DAPA 2O2DA 2DVMA 1GG8A 3DKVA 4D3DA 5AQEA 2I4MA 1JPUA 4O3FA 4ZAFA 1HY3A 3Q7IA 4BBPA 1E8NA 9ABPA 1SO8A 3I30X 3NH9A 5T8KA 4R8KA 3T1VA 2HK7A 5EXXA 2JFQA 2EARA 3KDAA 4EUFA 1S3SA 3NBUA 4RHYA 1C0KA 4C43A 2NU7B 2EERA 1J5PA 2IW1A 1BDMA 4EUSA 2VTEA 3F73A 2BMJA 1VI5A 1IDN1 4S24A 4CMIB 3VPBA 4IVQA 2GYYA 2IDJA 2AMFA 2QM3A 4FZ5A 4DAEA 2JLYA 3MWEB 2FRVA 2BELA 3MLAA 4OMCA 1DP4A 1U9IC 4RH3A 1MC1A 3DDUA 2I9PA 1PX0A 1NYTA 3C7KA 4ZYYA 2GPJA 3GCXA 2SICE 5KAPA 2NU7A 3MOSA 2B0CA 2W2LA 5FPHA 1E62A 1L1FA 1AKUA 1P0IA 1Z7YA 2NLOA 2W6IA 3LLVA 1UFOA 4J91A 1P0MA 5CURA 3MQ4A 4OATA 4OI2A 3KZXA 5DIZA 1XTSA 2VQFB 1KJYA 1PR9A 1A98A 3PGJA 1E5LA 2WV7A 3VPCA 3OA2A 1UEXC 4P4SB 1O5IA 3M89A 3OG9A 3O5AA 3NHAA 1ZK0A 3G2NA 3L18A 4E1BA 4E5KA 2X7HA 4R9UC 3U40A 4FOPA 4ARSA 2KM1A 1MEEA 2P5YA 1BW9B 2W0MA 3QW2A 1MO3A 5JSZB 1E63A 4V0SA 5AI0A 1GVHA 1Z33A 5KOHA 1UXHA 4C05A 3GLSA 4A8TA 4X00A 3BH7A 4Q05A 1N36B 4TGLA 3GOQA 2K2WA 4LCEA 3GWGA 1QPZA 1FP4A 2YWRA 2CBXA 2DTEA 4RIGA 3HB4X 3ZHYA 1ZQ9A 3M1AA 1Y6FA 4PNEA 1PK9A 3PGLA 3QPAA 1UQRA 4FCWA 3UC5A 5MF6A 3RAFC 1Q0SA 5AJXA 1H1TA 5GZ3A 3F90A 3RIYA 2VUHB 5DTJA 1QQBA 3QVOA 2LVBA 3H8WA 4G86A 4N5LA 1RQLA 5KYUA 2VQEB 5DHPA 4ZOEA 2Q4EA 1F60A 4JXKA 3F9RA 3H2ZA 5DLEA 4DDKA 1QB7A 3ELYA 4RMIA 1H2HA 1DUSA 1TKBA 3AP2A 5IMBA 3BEDA 3C8MA 3NRJA 3VU0A 1Z56C 3KO8A 3QKWA 5FFNA 4BFCA 3N8IA 5BV0A 4FBLA 1AMNA 4GD3Q 1DSSG 2JIQA 4BCCA 1IY8A 1NXSA 4EK9A 4UW9A 3KQOA 4XVUA 3GRYA 4NFYA 1Y7TA 4WXMA 3KHSA 3KAJA 4Z5XA 5K3CA 2V97A 1FP1D 4FUTA 5EMNA 1P31A 1J25A 3RVQA 3NHYA 2GAJA 3FTCA 2H4JA 2JBAB 1DIGA 1U80A 2VHWA 3N58A 3P9NA 3N7TA 2P27A 4US2R 3INNA 3PR1A 1VDZA 3SEAA 1U8CB 1I3MA 4LF5B 1NQXA 2RCNA 3U4AA 4PC2A 2D00A 2F1HA 3IJPA 3IPCA 1IU9A 2G8NA 1CB7A 3GFTA 4M49A 3GX1A 5DT9A 5IJAA 4Q82A 4Z49A 4GX2A 5GOTA 5J4YA 1WMSA 4DA4A 2C9ZA 4J1SA 2Z4TA 3T9CA 1TLLA 4XPIB 1QP0A 3LHSA 2YVLA 5F76A 3QBTA 4LWPA 2IITA 2QZ4A 1MRSA 3EGCA 2G25A 3K0AB 3GNLA 3LUAA 1TAGA 2YV3A 2A0YA 3PFNA 5K51A 4RA9A 4RTJA 4G9EA 2F1RA 3EHEA 3B7GA 4OXKA 4A7PA 1C3OA 3KDPA 3PNYA 3P7MA 721PA 2AJ8A 2YNMA 4Z1MA 3KOYA 5BNZA 3QMPA 6ADHA 1AQLA 4E5SA 2PJRA 1Z63A 4PFQA 5D3KA 1QYVA 2XCUA 2I2AA 2YC2C 5EUCA 1FSGA 1I14A 4KVFA 1T8SA 4EYGA 3JASA 3OWXA 3SQLA 1T9AA 4GVXA 4C06A 5KOJA 1V5GA 5IG2A 1DC7A 1ZJJA 5JD6A 2V1UA 1FXSA 4I14A 1DEOA 5KNDD 3FYUA 5EP3A 4J76A 1VXRA 2R1TA 3G8DA 3VKFA 2O8DB 3HB5X 2PCJA 4PS1A 3DP7A 1DHRA 1E9FA 2NT4A 1NFRA 1URPA 2F7SA 2Y1GA 5E2IA 3USES 2R6R1 3S8EA 4JOBA 3U4QA 2XUJA 4UNSA 2JIRA 3MS4A 5ALHA 3WB1A 3ZE8A 3WOHA 1R4NA 2AN9A 3D1JA 3AM3A 1QU2A 1Y8QA 1SOVA 1XCLA 1VMEA 1W35A 1WXWA 1QZUA 3RARA 2O2EA 2ZRGA 4G8JA 4CUJA 2A9RA 3SC4A 2OG1A 3W5CA 2NWQA 4PEVA 4EY8A 4G8BA 2QZSA 4RAQA 4XR9A 1VP9A 4GEKA 2CF6A 3A11A 2CMGA 2IYTA 1AA6A 4FWIB 4K6OA 1EDDA 2HU2A 2OQRA 3LOPA 4J49A 5E3HA 3U0VA 4F56A 3CG4A 2XRYA 3WMWA 2WDPA 3JAWA 5A6SB 3E15A 2YIMA 3HCWA 4XVRA 4CPDA 2IL1A 4R8MA 2ZM5A 3UEOA 4LC1A 3HN7A 2WF6A 5H5JA 1WNFA 3D6VA 1JLLB 1LBQA 1P9LA 2PUVA 3FPJA 5JMPA 4V0QA 2REXB 2WRZA 1SEVA 4MLDA 2XYGA 4EELA 2XTNA 1PQ4A 1XDSA 4BMOB 1JV2B 5ECGC 3AUSA 3MF4A 4LBZA 5HFAA 4J0CA 3GU3A 1HOTA 3B9PA 4RVFA 1J33A 1VDMA 1LEHA 3FNGA 4YRKA 4I1PA 1IM5A 5ALKA 5TX7A 2CZGA 4Q4CA 2J6BA 1QTRA 1XKLA 3KLNA 1LNSA 3DFKA 4XYEA 1M0TA 3ANMA 1IBSA 3I23A 3FCCA 1GUDA 2ZBFA 1PFVA 1Z4LA 3BF7A 3JYHA 4P3NA 2P4EA 2B5WA 2AS0A 4UNNA 4DNXA 3LPNA 3GA5A 3N0WA 5IUJC 1ZM7A 4ZCMA 3ORYA 4TWRA 3RFTA 4NBNA 3BXEA 1QHGA 2ASVA 4H9GA 2NUPA 3LQKA 1AQ6A 1QR2A 5AVJA 1U1DA 1QCCA 4MV8A 5LZ2A 4RBNA 1YCHA 1C81A 1V43A 1N2CB 1WBBA 4R0NA 2VHJA 4AMZA 4DG8A 3C70A 2GF9A 4DOMA 4U00A 3L7CA 3MJHA 1GP2A 1HDEA 2QMEA 1L7OA 3EXEA 1DIOB 4KGDA 5CGQB 5AKZA 3BXHA 4QQFA 4ZGBA 2P9FA 5I5GA 5FA8A 1D09A 5FOWA 5AKJA 4R0MA 1FYDA 3GNTA 2OCAA 2O3UA 3P2OA 1NP6A 1A8SA 2VJQA 3PHLA 4KBYA 4Q9DA 1UAYA 3VPFA 3PUHA 1TMYA 1XI2A 2MSDB 5M04A 1D1PA 1SBNE 1ZP6A 1WPXA 1WQ4A 3LP6A 3NGMA 3TS1A 3MRTA 3V97A 4C07A 1FTGA 1ZQ1A 3KQVA 3WV4A 1LBSA 4UVGA 1P1JA 2PUTA 3NBZC 1CJBA 5EQDA 1J00A 1SU6A 1FPQA 2WVHA 4G41A 1E1QD 3SHVA 3T5BA 2IWRA 2XRZA 4LXUA 3H04A 3G88A 4Z0NA 4IDHA 1CY1A 2XHZA 4EF5A 4N5IX 3CW2A 3F67A 4BECA 3B1WA 1SRRA 1XD2A 4MTCA 3N28A 1BJKA 5JBNA 2LDXA 1ZJ5A 1Z0ZA 3V46A 3EB9A 2FXIA 4EECA 4ZYTA 1XBTA 1GG5A 2SNIE 3H87A 3GEHA 4RPJA 2BFPA 3F7OA 1I01A 1U3WA 1I2DA 2FJUA 4TYQA 5AHKA 3WJ2A 1BXZA 1GCAA 2FE4A 4DJEC 5KZMB 5F23A 3IKVA 4AUNA 2AIRA 3FHTA 4KFSA 3DXYA 4X84A 5CA1F 1PJQA 3HR4A 5HOEA 4RF5A 1YZFA 2AN4A 3GZNB 1FTYA 1IPFA 1JHRA 1LKZA 3K1AB 3P27A 2G17A 4O8CA 1X8KA 2EFJA 4N6GA 4OYRA 1GPAA 1ZJ4A 3WYGA 1AQNA 2VZEA 2VHQA 3P45A 1K7SN 5E7QA 2FWAA 4MQ5A 2EWWA 4LSZA 1NXQA 4B7XA 3T15A 2YIJA 4TQAA 2C7OA 3AKCA 5CPBA 4F86A 3I45A 3LNCA 1UFVA 2PZ8A 3OLQA 1UBSB 1G6KA 1TK9A 1ZRHA 4RFVA 4TT3A 3ZDQA 4M1ZA 1XZFA 4KTTE 3W2IA 3FAKA 2FQWA 2NVUA 4OUDB 5CMLA 3HZRA 2UUOA 4Z7QB 3CX7A 3UY4A 1GZSA 4GPEA 1P4HA 4JEMA 4XWGA 3M5DA 2XECA 1QLWA 4HAYA 1P2FA 3Q7RA 5TVGA 2YJZA 4MW6A 1X1EA 3V8EA 5ERYA 1SIWA 2WWIA 2FA9A 2R7AA 4DA6A 1CDZA 5JTTA 4XM0A 2ZK7A 4H7PA 3TEJA 3I8OA 2R2AA 4LEIA 2AVDA 1WBDA 3FW1A 2QYOA 4BNIA 1PT7A 3AETA 2HPZA 1OTHA 1UT8A 1UXJA 3L40A 4TMXA 1NX6A 4JODA 3KHUA 1PFGA 3HP4A 1VL2A 1P72A 1Q7CA 3DPIA 3LY8A 1GTL1 2E4VA 1UJ4A 4WCFC 1WQ3A 2EG5A 4FR2A 3SZUA 4UNRA 4Z4CA 3C4JA 5J2TB 2O7QA 3QSYA 1V25A 2B82A 3COPA 4MUNA 2VHTA 1D4AA 5SYAA 2JIPA 1EEXB 4M8KA 2WF9A 1EA7A 1Z13A 4M46A 3INRA 1OPXA 2D1YA 2P6MA 3SOZA 2QM8A 1XR3A 2F59A 3MOGA 5HQ3B 3OFVA 3R3XA 3PTZA 4D5GA 3DOEA 1DO0A 1O03A 1LQ2A 1H1DA 3NUZA 1T8PA 1QIFA 5SY9A 2XVXA 2A3RA 3PLNA 4QQ8A 1KMHA 1FNNA 1N9GB 1SAYA 3E9MA 3ISJA 4OH7A 1TIBA 4WUTA 2BISA 4QOGA 3QQ5A 1FU8A 1Y3AA 3M7IA 4CDMA 5TMDA 4J3NA 4CI9A 3PFKA 4MR9B 3O8NA 1P2DA 4RVOA 1U81A 4M55A 4XYGA 2BUBA 5HUHA 3AVWA 3C8HA 3ANYB 1L2TA 5JAHA 3LF1A 2GCIA 4RULA 2WT8A 4KQWA 3R7DA 4EF6A 3MJEA 4HDOB 3ZHCA 3A9TA 3BSSA 2MSLA 3QU4A 1HYBA 5IVDA 4KLAA 2I2XB 3RVNA 3NVKI 2J9FB 2IZOA 1U0RA 2QQ5A 1TC2A 4Y2UA 2YIVX 1KFJB 5FTJA 4X1IB 3TM4A 1Y3HA 2QVGA 1NM5A 1OYYA 1V6SA 4RM2A 1XFDA 1A97A 4E13A 3DL0A 1QPBA 2H1VA 1DUVG 1I13A 1U9YA 2AC7A 3DOFA 3DTNA 1SZPA 4RKRA 4NPCA 5K6TA 4Q7EA 2WKPA 4I5IA 4ID3A 4O4LA 4E2YA 5IK2D 4NXMB 1B00A 2DZDA 4L51A 1U2QA 4JT9A 3BXZA 1MA0A 3PGXA 2WJPA 4QAQA 1SQSA 2JFGA 4YRZA 1QRSA 3GY0A 4J29A 3WGZA 4RFSB 1JG1A 2NXWA 4IJUA 2B3DA 4TM7A 1XXLA 4L9SA 2O8EA 1I7LA 3UKJA 2ZYVX 1X7XB 3LCCA 3W3AH 4OOEA 3ZDBA 2EDAA 2FN4A 2XPCA 3MINA 4DKJA 1XKQA 3IAUA 2VKTA 4I50A 2RBEA 1LBHA 5LYYA 5JNWA 3THWA 4E1VA 3TBHA 4NCAA 1QH8B 4PCVA 4AJ4A 3HBNA 5AVRA 1HZJA 4TMTA 4MS4B 4XUEA 2PYDA 3AJ8A 1S7GA 2BW0A 2FYTA 4J9UE 5T4HA 1NLZA 4WFIA 5HCUA 3WO0A 4AYWA 5JS6A 4IQFA 2QSYA 1ZBQA 2FMXA 4IDDA 4RSHA 4UBMA 2JH9A 1ULTA 3TKLA 2RKOA 3Q7SA 5EERA 1Z25A 2WD9A 4XQEA 2QMOA 4OLHA 3MFQA 3F98A 2JJ1A 3CVUA 1LRKA 4QVIA 5C5EA 1EP9A 1SVKA 4H7HA 2O8CA 3D1LA 2X0NA 4MJ7A 1T8UA 3HFSA 5CUQA 4EKGA 2I67A 2W6NA 5DRYA 2DAPA 3BX1A 2HK6A 3OE4A 2JFBA 1GILA 2B69A 3TTWA 4B84A 4EB6A 4CKCB 2CFOA 2COEA 4QKQA 3RDPA 3E35A 1ETHA 2R8BA 1SA0A 5B37A 4BVFA 3UMCA 5CCEA 3VNVA 3VHLB 3HCOA 2WTEA 1TA9A 2OCYC 2ACVA 2EKZA 3MT0A 4NH0A 4Q0MA 1QE3A 2WT9A 4P4SA 4CN9A 4DT1B 1DDOA 3SSOA 2XXJA 4O29A 1B2RA 1N1MA 2FMUA 4MCIA 5IJXA 1JIIA 2B9VA 4GP9A 1JHYA 3MGGA 4BAZA 1E60A 3KEQA 4YP5A 1IZ7A 1PDWA 1Z5UA 2CMHA 1RRKA 2M1XA 2IBMA 1XX6A 1VG8A 3T41A 3L2OB 3AERB 3T5MA 3IAM1 3RHFA 5I48A 2HPAA 4R6XA 4QYIB 4KQJA 1JG3A 2QLJA 2RC6A 4EG3A 5BR1A 1UJCA 1GDDA 3DAGA 1HQCA 2R97A 3EQZA 1IZ8A 4HF7A 3T4XA 3BZWA 3NP9A 3LQ4A 2HIGA 3S0JA 3V4SA 4WUVA 1EFCA 5E4TA 4RM3A 4YUAA 1Y8RB 1BA2A 4QUDA 1XQYA 1H2XA 4RFSA 2V0GA 2GA8A 1NASA 3A6GA 3CLHA 3UWPA 3ZUGA 2RIPA 2GASA 3OM1A 4M1EA 3RQSA 1OOEA 1KP3A 4XB2A 4C20A 5HKAA 4A0RA 3PXEA 3H9CA 3WYNA 4TSKA 3L4EA 4XJVA 4DBZA 1IJBA 2X9GA 2E6UX 2X5OA 4C5BA 1FZQA 1G6OA 1L5VA 1Z2DA 1AURA 3KT0A 3PFWO 2VNJA 4GQIA 5DFAA 1RD4A 1Q0RA 2R96A 3W9SA 2B8JA 3TL2A 3ESZA 2WWRA 2Z9BA 2FFQA 2H48A 3SF8B 3ZLBA 4UUMA 3OHSX 2NZYA 5K3EA 3WL3A 1QSGA 1GG9A 5L7YA 3V3KA 2BGKA 2ON6A 5HEKA 4BZXA 3DJFA 3N5CA 1AHIA 2PH1A 2VF7A 5FL7D 3AP1A 2YS6A 3GRRA 4H16A 5DBHX 3U1BA 1A96A 1UP4A 2TMGA 1ZN7A 3EVTA 4RA6B 3WK7A 4F38A 1X80B 3DLBA 1E2GA 1P5ZB 1R10A 3EE6A 3LVBA 3ZBPA 1T0HB 3W6UA 4ZVOA 2ZRCA 4GKKB 2HEIA 4NTZA 4GIBA 4Y30A 4BMZA 3JVUA 1OFIA 1S4MA 2OHIA 1ZLYA 1YS9A 4BO9A 2AHOA 5JJ5A 3UWDA 4Z2YA 1VE9A 3VVBA 2Z1DA 1GZHB 4KIWA 4J0HA 1FXWA 2PGOA 4ENRA 1RHJA 1DO8A 1WV1A 5EL0A 1TUIA 2NZVG 2G36A 3LJKA 1L9XA 4MKIA 4QELA 1VG9B 3RTDA 1RFLA 1SHZA 2EL9A 4FJ0A 1KZGB 3TK1A 1NNEA 1ZYUA 1IMOA 3ND6A 5TF4A 4CG3A 3N76A 5ECWA 3NFRA 2I55A 5KMGA 1NTRA 1P17A 1TIKA 1N2OA 3FCXA 3MYYA 4PSAA 1SCDA 1AKVA 1S96A 2H2HA 2HIAA 3G9TA 3KYDB 5JQWA 1XZMA 4ESOA 1YZVA 4YEDA 3F2VA 1FFDA 1M6VA 5EIWA 4EYEA 1PTJA 3SZGA 3Q5EA 3N75A 3ZW7A 3EG9B 4PF1A 4BJ1A 1OH8A 1LI4A 3I0NA 3KBBA 2YWJA 2WD7A 4DKXA 4Z9YA 3P0RA 4YUZA 1A27A 2O2JA 1DFGA 1ZZEA 2VA8A 4JOSA 2ZXUA 3E27A 4K81B 5CVVA 4D92A 1QE0A 4I9UA 2RE8A 3H2HA 1KTIA 3FPCA 4TVBA 3GLHE 1L4MA 3HACA 3W2GA 3O8OA 1E96A 3U3RA 5KNCH 3ET5A 3HV0A 2C4WA 4HVAA 2OC4A 1GN8A 1OGJA 1TJ3A 1IAVA 1WUKS 2KBFA 2IXBA 4GSLA 4PNHA 1UUFA 4WNCA 1BVHA 1R0BA 1ENPA 3CRW1 3I62A 1HT0A 4NF2A 3K73O 4WLFA 1L5WA 3BE4A 3CH5A 1KJIA 4I3HA 2QN7A 3HM9A 1CZNA 3IR6A 3WMFA 2B1IA 3SX2A 3DTVD 3RWMB 4BX0A 2AN1A 4D9EA 4R4JA 3MYRA 2AYZA 3MJTA 1VB3A 3TX2A 1T9GR 1MOPA 1QCDA 3DMHA 5FLEX 4FB4A 1COZA 4CKWA 3OZCA 4I1SA 1NDHA 1QUEA 3FMVA 3FFAA 1C7FA 3NIWA 3R9KA 3STYA 5DNWA 1BWQA 3B3FA 3TLMA 2VAWA 6CHYA 2G82A 2ZIFA 4QO8A 2AFHB 2G4CA 3SZLA 2WYIA 2B1QA 3BMXA 3D2AA 4BCBA 1C1DA 4EG7A 5KYXA 4XCQA 3TH5A 3ENWA 4ZVLA 4TUYF 1PEDA 2EF1A 3PJFA 4K1LA 4RPCA 1YJ8A 3WZ2A 2I1LA 4NOLA 5CM2Z 1T2NA 3GR6A 1GLVA 2NOAA 4M0UA 3UJ6A 2ZAOA 3TSYA 4CU2A 1PBNA 3G2JA 4C03A 2G77B 8GPBA 4DV1B 1S5PA 2REOA 5AW3A 4U9UA 4UBNA 4JQCA 4NE2A 2FY8A 1Z4IA 3NWPA 3UAYA 3QELB 4DJJA 1P7WA 4FDUA 3O4IA 3RYIB 1M0SA 3M6AA 1YJCA 1LTHR 2OWEA 3QYAA 1YRBA 2PMFA 4BNGA 2HK8A 1G2OA 1QVZA 4FHZA 2Q3CA 4HNAB 3M1IA 4ID9A 4G4IA 4BO7A 4HDQB 2HWWA 3UPDA 1CBUA 3HHPA 4O4IA 3F4LA 5DYIA 1A5SB 1BNCA 3VKGA 3PWKA 4LRSB 1M9NA 4EY7A 2WVJA 2A4KA 5JQGF 4YDQA 2WTXA 3C43A 4RIFA 4ARUA 4KKXB 2OMKA 3SVTA 4LNUA 2X8AA 1SELA 1V8BA 3E3LA 3D8BA 3DOUA 2CT8A 1T6NA 1W44A 1DG1G 1JLKA 1QTIA 1YOVB 1N2JA 1NIPA 1BD3A 2SECE 3K72B 3NR2A 5D85A 5DB4A 5A6VA 4C7OA 1EBBA 3ANSA 4UATA 1GCOA 4AF8A 1X77A 1D2EA 3CVOA 1WCIB 1X86B 4HDKA 5L4NA 1IAQA 3WRVA 2DFVA 1C14A 3CLKA 4GKJB 4Y7CA 3EEFA 2EW8A 3AESA 1I5RA 3L1JA 3SFTA 2UXCB 2C07A 3H5VA 1HEUA 1NXXA 1EQAA 1Z2CA 1F3OA 2JBAA 3DHVA 3G68A 3PL1A 1K08A 3SYLA 4F4FA 1PFKA 4UQLA 4N3NA 3F2IA 3TL3A 3TLAA 2GN4A 2MYNA 2C5GA 3RSCA 4A0SA 3DCNA 2ATXA 1H4VB 1I6KA 2P90A 3FOAA 3KQYA 4Z7JA 4YRMA 3PEFA 3LY5A 4LJYA 1E9EA 1F4LA 2A9FA 4RJJA 1NBWB 2R6DA 2GVDC 5AXDA 1LB1B 4YFVA 1GDHA 1XLTC 2Q5OA 4UM5A 5KDDA 1QYCA 2ZKLA 5ITVA 3MWFA 1U7PA 4Q4DA 4Q7LA 2DFDA 4Z9XA 2YVQA 3WLLA 2CXNA 3CPJB 4CKWB 1TJNA 2GEVA 1TD9A 4QOSA 521PA 3IALA 1ZM3A 1NE7A 1OFGA 4WA8A 1A1VA 4FMPA 1YZKA 3PPWA 3HLKA 4LVUA 4MYUA 5LQKA 1I94B 5B1HA 2WTBA 4MO2A 1XVTA 3HQ4O 2R47A 4RDHA 4Y1FA 3FF4A 5CFLA 4QVGA 5CT5A 1DPFA 3G1TA 3UHAA 1N34B 2V58A 2GCPA 3E2PA 2IHBA 2YMPA 3C74A 2WG1A 3SYNA 1E99A 4HZGA 4EIWA 3KJQA 1A9QA 1R0KA 1SOUA 3H5RA 1L4NA 3PR3A 3E82A 4R1OA 4F7WA 4E30A 2IGTA 1U3VA 3F78A 5IXSA 5GINE 2D1SA 1UBRS 4PXSA 2JI7A 3NEYA 6LDHA 3OU2A 1HTWA 1KKLA 2AF4C 2CLEB 2X9QA 3OPYI 3D5EA 4G36A 1XVLA 4H3SA 1W96A 1F38A 2AFIE 3K9CA 3R23A 3JPYA 3PR2B 1E3SA 3KIPA 2VDWA 4B83A 4KUEA 3GH1A 1UQTA 4GWGA 5ALQA 3OQPA 5LMNB 3O82A 4IS3A 3UENA 2JGKA 3T54A 1H5QA 1K0UA 3K15A 3OQVA 4F71A 1ABBA 3FDZB 3V4OA 4DWJA 1CUZA 4XQ9A 4N0QA 2QVLA 3WXMA 1UKYA 1XTPA 3DAFA 1OI2A 1XVVA 2G6BA 4ZQBA 3L1IA 1GZDA 2HEGA 2ZUDA 2IP4A 2IQIA 2C97A 3JALA 3JQBC 3PT5A 4RCYA 5DI3A 3PC8A 4EPWA 2H7XA 4IVRA 4NAUA 2Q5HA 1X8XA 5BN5A 4L9WA 2UVQA 4IRXA 3VH1A 1Z3IX 5IH3A 1HG0A 4K9MA 2NAPA 1QB8A 1IOVA 3W8FA 4C6HA 4NU6A 4N47A 4AWAA 1FFEA 2IYQA 3LHFA 3G2PA 4RVUA 5D6NA 5H0IA 2RIRA 3BMQB 3L8GA 3R3VA 4W8HA 2FSPA 1NVEA 2HFJA 2Y68A 3LT0A 1JW9B 3CV3A 4JI6B 1K5GA 3R7AA 3WGVA 4CQLB 1A3CA 1DPGA 2AXEA 2P9BA 3THRA 1HNXB 5DVZA 1GUAA 3MWGA 4CV3A 1XEAA 3ORFA 4J2TA 5DHQA 3WGKA 3KZKA 4ZC1A 4ARVA 1QRAA 4MQUA 2D5BA 3HKEA 4NZZA 4WFJA 4BRUA 4ZI2A 4XM1A 3OZBA 3QVLA 2BRUC 2ECOA 1U6KA 1P1CA 2ZJ2A 4LDQA 2FVYA 2CJPA 2QRGA 2N3ZA 1A9YA 4OCZA 5JU6A 3RVPA 2UKDA 1L7VC 3LL4A 2H52A 3FHOA 1R7RA 2Y05A 4G56A 1JKMA 4ND3A 2EWVA 5DXAA 5ELXA 2FDCA 3Q3CA 2D06A 1MABA 3CLRC 4UM8B 2JI9A 3K4PA 2NO7A 1ZESA 4TV9F 3UJAA 2Y1CA 1FW6A 1W1WA 4LZOA 1EB8A 3AGQA 1EG7A 4EHBA 2EIHA 1QK3A 2J7PD 3UATA 2O8BA 4LYDA 2J9ZB 2GZSA 4YMSA 4GRDA 3E22A 4WERA 2N75A 3LUFA 1DKLA 3F74A 3II6X 4OHVA 3VYUB 4AFNA 2QK4A 5IANA 2AEMA 2XMSA 1A2BA 5IUNC 2UZAA 2AUMA 3CG0A 2ZBPA 1E3WA 1GITA 2O52A 4J2HA 4ENWA 3K32A 3AERA 5ALOA 1X38A 1W0JA 1WCYA 4ENVA 1KJ9A 1J06A 5H82A 3UT0A 1XQ6A 4DWWA 3VHXA 4O59O 2P9HA 1TFRA 2HUPA 1DXQA 2ZCUA 3IQHX 3O94A 1NQUA 3O3OB 3UMFA 4RVSA 2HZ7A 1PAUA 4GT1A 2HYDA 1PLLA 4OBWA 4GDFA 2FHSA 4TWBA 3RHTA 3TSWA 4BO8A 5K0TA 1K86A 3WOVA 4QREA 1U2GA 3C7TA 4JI1B 3EZ6A 1UZAA 5FBRB 4JVOA 4QC2A 4BP3A 3JQRA 4BMPB 3O93A 3IMKA 2Y67A 3QVKA 1SXQA 2A2ZA 3CEHA 3G2OA 3M4JA 1KDTA 4CLRB 1SN7A 3SLKA 3FYSA 2PVCA 1EFLA 1E0AA 2R1ZA 1YD7A 2Z43A 2P91A 2WYOA 2ZJOA 2HNKA 3CURA 1NNLA 3IEKA 4OFZA 5JZBA 4F97A 3N39C 3JX9A 3IUEA 2YMQA 4MVJM 4Q47A 1XZDA 3T5TA 4F9TA 3M2PA 4FWTA 5JLJA 3KR2A 2RI0A 1P2SA 4N8EA 3CRQA 2VHYA 3HL0A 2WE7A 1VGVA 1G60A 2AE2A 2X2PA 3ID6C 3LE8A 4OGFA 1W2HA 1A04A 1VB5A 2PAAA 4OJMX 5ISMA 4JYZA 3AZPA 3BPSA 4Z9AA 3ROFA 3S2YA 4YRJA 5EWMA 3GARA 1KPGA 1JZSA 4UEOA 4WLNA 4UFNA 1VBKA 1SOAA 2C92A 3TTYA 3KTDA 4IDNA 4X1KB 3W9BA 2P30A 3OZAA 4G5FA 4P08A 5AVUA 3AEUB 3B70A 3ZHXA 1GTVA 2GNAA 2W43A 1RBMA 4UULA 1X1BA 3PQEA 2CFIA 1ADBA 1ZD5A 3O3CA 2PGNA 4G0NA 5CDUA 7REQA 2C9YA 1PGNA 1E1KA 4OFWA 3BIJA 3M9WA 3SQOA 3TLGA 2GLXA 1QK5A 4D97A 3EF3A 3W5SA 4HFJA 1PG0A 5DSZA 3LP8A 1QO0D 1R9GA 2Q6KA 1UR5A 1V3QE 2Y1OA 4JLDA 3H75A 1YS2X 5AW2A 1Z0IA 1IK4A 3LC0A 3ADBA 1W76A 5AI6A 5LBTA 2Z2ZA 2BCJQ 2YINC 3MJDA 3V42A 1NN5A 1IUOA 1XZJA 3VA7A 4EO4A 1N6LA 3GP8A 3CIFA 1DCMA 1K98A 3TJZA 3OLXA 3HC7A 3O8BA 2HDOA 1QS0B 4G5YA 3B48A 1JJIA 1BE0A 2VYFA 2OK7A 3DPSA 3IUYA 2W8ZA 1RTTA 4M1SA 1A0OA 4MRSA 3K9GA 2AW5A 2BM8A 3A1WA 3P4UA 3CE6A 4KW7A 3SJUA 5JMTA 2WYHA 4LYGA 1KO1A 1QONA 1SK8A 2I3AA 2ZYGA 4OM7A 1X7HA 1T4CA 4U3JB 3ZXXA 1PW5A 1GGEA 3EEBA 1WKCA 2Y27A 4OL0A 1ETUA 3S28A 2ORWA 3UAGA 4DW8A 1YE3A 3IOMA 5H3HA 3TZEA 2GCGA 3WGTA 4BLOA 3EXHA 4MHTA 3D4BA 3IXMA 1MPTA 3OZTA 3K94A 1M8FA 4RKQA 4DUPA 5K8VA 1T2VA 3UMYA 2RMKA 4PX9A 5LFAA 2IKQA 3WS7A 1ODJA 1IUKA 4UAGA 5LYJF 1HDCA 1RE0A 4P7GA 4EAAA 1N0VC 1WXGA 1GPH1 2IEAA 3SFVA 1HH4A 1R6DA 2OZEA 4Q3LA 4FS3A 3KQUA 2GFIA 1HWYA 3BMOB 2EKQA 4PQEA 4BKRA 3FSGD 1JG2A 1NQOA 3D2LA 1N3LA 1V35A 2GAFA 1ABEA 2PZBA 3I05A 1NXOA 1R8JA 4UCQA 3OQNA 4OKNA 1TF5A 1BXGB 1NSTA 2YWEA 3MGKA 5BMVF 3R0ZA 3BCSA 4ZN6A 2DQKA 4QHSA 4F91B 3QITA 1E2HA 4IIDA 1UMDB 1QJCA 5HS6A 5HTOA 3FWPA 1RYDA 3FRHA 5HBGA 3LWNA 5KAMA 4DM4A 4NBVA 5ES4B 1A9XA 3QX7A 2FW9A 2ONCA 1KSHA 3HRIA 4J0EA 3O4VA 1H94A 1OSNA 2CUNA 2X2FA 3QYFA 2OOKA 2ZOSA 3CUWA 4MITA 3BE6A 4BKPA 5CG2A 3EZ9A 3C8DA 3L0SA 4WH0A 4QARA 5BSTA 3S1SA 2G63A 4RMGA 3RHZA 2WFLA 2FF7A 9MHTA 4NEHB 4RJIA 2FLWA 3J81k 3LGXA 3G5TA 4X7MA 1X9IA 2CWDA 3C1TA 3QUSA 3NWEA 3OVMA 5BOVA 1QFSA 2V7XA 3SC3A 2H11A 2ZI4A 1E7YA 4CMHA 2BD0A 3UW3A 4A8PA 4Y2QA 5TR9A 1XTBA 1T1IA 4JP3A 2H1SA 4GR4A 3MT9A 4HNUA 1ECLA 2HC9A 3L07A 2FWBA 2EFGA 1PWYE 3DV2A 3OKCA 3QMMA 5L40A 5CGZA 2AB0A 4JJEA 5JO0A 1H8ED 1H85A 1PUXA 1Y82A 5FCDA 1A7AA 4PZYA 3KSAC 1UC4B 1Q21A 4QXQA 4MQMA 4URWR 3NOOA 3K2BA 3P5SA 1N2XA 3LDHA 3PJGA 4WOPA 4EHJA 1JIKA 4KGVA 2FQXA 2BZ0A 5GAJA 1Z4MA 1E1NA 3IHTA 3KYDA 4NAHA 4YPVA 1G17A 1IQ0A 1ZOPA 3NVDA 4YX9A 1IZ0A 1JLSA 1HZZA 3D8SA 3EVEA 3IS3A 3ZBTA 1GXSB 2DECA 4CMCA 1YMUA 3HJFA 1N2CA 3HPRA 2AR7A 1N2EA 1VGQA 3TLXA 4YMHA 3LPLA 4L6AA 5BNIA 3RU2A 3IEUA 1KO5A 1VLQA 1UM9A 3WAKA 1IZZA 2GGSA 3PDCA 1GL3A 2W8BA 4XEUA 1I4LD 5I7EA 3HYCA 4PHTA 2OXFA 4B8YA 2M6LA 5I6DA 1UDWA 3LXXA 1T0UA 1YBVA 1EUCA 1G1MA 5IT9A 4OP3A 4G1CA 4Z4GA 2WG0A 2QRKA 3C24A 3WICA 4QEDA 2GZ3A 3DAPA 1OBHA 4KWEA 5A4KA 4G37A 2OPHA 2NZUG 1VLHA 1GU0A 3GPBA 1PL6A 4QUHA 4XX1A 3MBKA 2XT9A 4LDNA 3TTSA 1SXHA 2X2OA 2B5OA 2ZT7A 1L8AA 1KOGA 1P5FA 3A1UA 4NJMA 3FIUA 3SBXA 5D00A 4AF7A 1Q84A 2ID9A 4TZ0A 1HK7A 3EOZA 3QU7A 3I37X 3OEEA 3MTEA 3WA6A 3VYWA 3P2MA 1ZVJA 1XTJA 4YUVA 1CUJA 3L93A 4B6SA 2WSYB 3QBDA 5I47A 1EFRA 1R9NA 2P8SA 4IJKA 4YWJA 2RGXA 4GZ5A 2J87A 2PUCA 3IURA 5DGDA 3ZC3A 4LCJA 2PBLA 3M1LA 1P7VA 1PW7A 2YQ4A 3QI7A 4NLLA 5BUCA 1IN1A 4PC3A 1GO2A 3K9HA 1G4HA 1RVDA 1JQAA 3EXEB 3EWSA 3LC7O 3LXRA 5KVAA 2F8TA 1E6KA 1Y4DE 2VHCA 3C2QA 5TJ9A 1SHTX 1VHWA 4M3NA 4MEAA 4E11A 3GVPA 2WM2A 3EF0A 2CXHA 3QKSB 4Y2TA 4KBGA 3B7PA 3TINA 3L4KA 2FP3A 3FTNA 4YQYA 2QNRA 1Q92A 3I9FA 5AI4A 1W1IA 2DU8A 4QEKA 1Y89A 2DM6A 5D5HA 4AJJA 1JEEA 5HVNA 5U1PA 3HY4A 3QKUA 1EHIA 1WVIA 2IPMA 1L3BA 4LY9A 4WY8A 4IFEA 1WY5A 1A8IA 3SBOA 3KQKA 3AIKA 1W4LA 3QXSA 2RHJA 3OF3A 2ODBA 5AK6A 3CNBA 1ZU4A 1X7DA 2LNDA 4JBWA 5B6JA 5FWXB 4MUYA 5JFOA 3CF0A 2WWXA 1S4QA 4JU9A 2WMDA 4FBGA 4G0XA 1YBHA 4X6XA 3QUQA 3O2JA 4ZT3A 3UNXA 2FZVA 4Z4EA 2VQ6A 3K7EA 3WQHA 4J0IA 2B37A 2H1FA 2IE0A 4OQQA 2AYXA 2VUIB 4ND5A 1ORRA 4P35A 3RU9A 3IQWA 1L8QA 1SBCA 1U4NA 1X7GA 2UZIR 4FPXA 5ES3A 1WX1A 3KOUA 5B7QA 2CV0A 3CNQS 3MCWA 1PNVA 1KERA 5FPSA 4D45A 3T5CA 1M2EA 4HL6A 3FUUA 1UJ5A 3ZTYA 4YLYA 4YJ2B 1T3SA 3LBHA 1N6NA 3U9TA 2DHDA 4BS9A 5ALRA 3GLVA 3TOSA 5EIEA 1V1RB 2QVBA 4B3SB 1J0EA 4B82A 4PC1A 5CJJA 1J56A 2DQSA 3R4CA 3G17A 2GHTA 3OEED 4LHXA 1FMTA 5DDIP 3KQPA 2NSDA 5C5CA 5IUKC 5IFKA 1V37A 4AZSA 4Q39A 2GZMA 5DGTA 4YMGA 1GSAA 1QHEA 4M86A 4EA7A 1TUBB 3OQIB 5D3MA 1PEAA 2QAGC 4ZZ0A 4ZCRA 1YHNA 1JHDA 2FV8A 3HDGA 3O8DA 1M6VB 1GGMA 3QEAZ 3A58B 1PWZA 4S2EA 3RYHB 4CTKA 3H18A 1Y7IA 1YSCA 3VSDA 4C0WA 4GP6A 1F0PA 6REQB 3IP8A 3I2GA 5FO1A 2QHXA 1WETA 3NLLA 3WRYC 1BHJA 4L4YA 4BMNA 4F92B 5KVQA 3EBPA 1DEAA 3KR1A 3KPVA 3M4ZA 4QBFA 2H08A 4IWNA 4ES6A 3R8FA 5B7PA 1XTTA 2AFHE 2O2GA 4KLNA 3CWQA 4DV3B 1ZOSA 2XD9A 3ETLA 1T13A 4L5BA 4OQFA 3IIMA 4UNIA 5JPDA 1YFLA 5HK9A 1UKCA 1ZK3A 4XB6B 1CS0B 1W581 4HRXA 1YRLA 3ANTA 4KQ9A 4AJIA 1E64A 3VJRA 5ICCA 2VSFA 3CRRA 3D0RA 1XDDA 3DTTA 3TQRA 4ZEMA 3OM9A 1Q7BA 4NMXB 3VZPA 2WE8A 1AXGA 5LM3A 3EUAA 1W93A 1WHSA 2G28A 1WV0A 4KPFC 1O8CA 1Q77A 1TYDE 1WP4A 2C54A 4FR5A 2H4FA 2TS1A 2FEXA 2FUNB 3C3JA 5C7YA 4IFTA 3QTLA 3O4HA 4L50A 3L1HA 4OXYA 4TM8A 2WMNB 3KX2A 2CBGA 2VJLA 3BD7A 3MCVA 5KJEA 3A6JA 2OAEA 4CIXA 4YJGA 4HJRA 3COZA 4JLKA 1OROA 3FLBA 3KQWA 4R9RA 3A31A 5JSUA 1IN7A 4DWOA 4NV3A 3ZQ6A 4M22A 4ZRDA 3V5NA 2H06A 4HI0E 4R2XA 4HNVA 1WUYA 3PDHA 4F4JA 1FTNA 5A02A 1KYYA 1TZJA 4FYYA 4H59A 4B73A 1QHSA 4PICA 1TTQB 3IIJA 1UK8A 2EWMA 1E94E 2OENG 4PZUA 6PFKA 2IPAB 3DEKA 2ZSHA 3NG1A 4IRUB 4MB0A 3OSUA 3S2UA 2Z6VA 3SBDA 1JHVA 5JI2E 1DLIA 1G0OA 1KGDA 3RJTA 1KK3A 2ZRKA 3AHDA 3W8EA 2GXSA 1I1NA 4KMOA 3OQOA 4YCCA 3NJRA 4X93A 3T1OA 1M2HA 2DYKA 1HDYA 4JUAA 3HCNA 5EQJB 5IVIA 5A9RA 3J7AC 3LWDA 4JZYA 3TKYA 2X9NA 4BB0A 3N74A 2Q4DA 4FHDA 3O8QB 1RWBA 1J7JA 1PD0A 3TQSA 1EFAA 2W58A 2CCJA 2EHDA 2H8KA 2O3TA 2HY7A 1RYFA 2FUG6 3FZQA 4MQ6A 2Z6QA 3K70D 3PVSA 4ITVA 3A1FA 1SC1A 4HAZA 5BSRA 1LNQA 1IEVA 2MTBA 2C03A 2YDYA 4YP7A 4HDCA 5BUZA 4YMTA 5A9SB 2J5BA 4B3JA 4F9GA 4FNAA 5TQVA 1TF2A 2E4XA 3TSAA 1K2VN 3K2QA 2HT6A 4UDOA 2A9QA 3RU7A 2WWVD 1EP1B 5FPKA 1EIWA 4QFBA 1II9A 1SQ5A 2VZ8A 3SMVA 2MSCB 3ADPA 3O03A 4XFDA 2GSDA 4MVJG 3LIPA 4LE2A 4UU0A 2J0UA 5LUBA 1R0CA 3IPXA 1PQPA 1YJQA 2WWYA 1QP8A 3C5HA 3SE0A 4MUJA 4NJMB 2YFKA 1XZEA 4GMFA 4JNCA 3W06A 3H13A 4XJSA 5CYFA 1NVAA 5EOVA 4JBYA 1TGVA 3RUFA 1RI2A 2QU7A 2WM3A 5FUMA 4RZ3A 5DLPA 2ZATA 4HT3B 5F1YA 1PG5A 1O95D 5B7GA 2PCLA 1FDRA 2Q8QA 3VI3B 1QGOA 4JUIA 1I2MA 3DKPA 4NZOA 5M34A 1TTTA 4MS3A 1R2QA 4IUYA 1QYXA 4N3BA 4S0XA 3Q15C 2C7RA 2GHQA 2E87A 4IKOA 4IV8A 2WQ6A 1B6SA 1RJDA 1N9GA 2PQMA 1SBHA 3MIZA 3IBYA 3QXHA 2E89A 4ZEOA 4O0LA 4BVBA 5FPTA 2AI3A 1QX3A 2HQBA 4F84A 1P1KA 1S8AA 2QWXA 1F0KA 5M29A 4FTWA 1FU7A 4Y0AA 4A26A 4XYLA 2IUFA 4UFOA 1VLMA 1ISFA 4IXDA 4F11A 5EIXA 2I54A 2PS0A 3LCMA 3QFTA 3AU9A 1VJ5A 3CVVA 3GFVA 1T6ZA 1BMTA 2CDRA 3DOHA 3R0VA 4JUCA 1IVYA 4J0JA 5HCIA 3NHUA 3WHPA 3BT7A 3SZMA 3R9WA 1TM7E 2FPRA 3AY0A 4NZYA 4R16A 1QP4A 3N2IA 4LDPA 3GUHA 4Q03A 1O6ZA 3N87A 4LE0A 1NPDA 2JBHA 2KB0A 1JKJB 3M4YA 4IJWA 3T61A 3PRKE 4P2BA 4CBVA 4H0NA 1QVRA 2C8KA 3C15C 5FR2A 1OWLA 5CYOA 1GEGA 3I4LA 1BGXT 1S8FA 2BR3A 2PV7A 3UJPA 3OTOB 2W2TA 5E8JA 2HXSA 3IQIX 1XZIA 1FNSA 4E33A 1LXCA 1KIMA 1PHRA 3DWEX 3LVFO 4YJ2A 5ED4A 3CUVA 3HVKA 2BGNA 3KEGA 10MHA 2JGDA 3AR7A 4E5VA 3Q3VA 3AK4A 3KRTA 4LOAA 3VNUA 4OBEA 1RRPA 3D4NA 1H4TA 3OPQA 3B1VA 5FUWA 2CK3D 1JEYB 4WPGA 3W05A 4Q02A 1K3TA 4MWSA 4TKVB 3BAFA 3M1YA 3VAAA 1FFXA 1TVCA 1UEIA 2VPYA 4AKEA 2RAFA 2Z57A 1Z28A 2AX3A 5TMPA 4PSCA 4HN9A 1VHQA 1VKZA 2Z08A 1P80A 1ZH4A 3AHFA 3DAHA 5H3CA 1A2KC 4Y7DA 3NQ41 1G3IA 3ILYA 1YZTA 4HWGA 4C4OA 1UP6A 2QX6A 3ZK8A 5K8UA 1ZLXA 5C8VA 2LGJA 3CRZA 4WVFA 4D6YA 5JCZA 4QODA 1O96A 2GCOA 1FYVA 1R64A 2O7SA 4TMVA 2PLRA 1PJZA 4P92A 2MOKA 1GUBA 3PRJA 3UV3A 3L02A 5DHAA 2KE5A 4MHOA 5IYZF 1TVKA 3IODA 2W9XA 1KI2A 3RSSA 3V2HA 4CWAA 3CH4B 4KHZA 1B3RA 4H7FA 4LF9B 3WNVA 1SFRA 1PT6A 3LF2A 1PWHA 1Z7EA 1B8NA 1BROA 2IXDA 3FSGA 4L4SA 2IEZA 4QWMA 4OQNA 5ALDA 1KPIA 3Q7QA 1QF7A 5EPEA 4BFTA 1HPLA 3FCOA 2C8LA 4LGMA 1NZFA 4PCAA 1QIKA 3HCCA 4UDXX 1WF6A 2BP7B 2JFFA 3IJEB 2JGDB 4C1BA 1SCKA 4P36A 1QOQB 1XCJA 3A27A 4OUDA 3MMXA 4NBRA 4C7MA 1KZ1A 1X8LA 1ZA1A 2VDQB 3GOHA 4L95C 5KWJA 1V1MB 1T4CB 4U3JA 3O8OB 5I5EA 2ZUFA 1XIVA 2QGNA 3D7MA 3PUIA 3M82A 4FX5A 4HN4B 1HX7A 2Z3VA 3B2NA 2BTQA 3IUJA 3MRSA 4OQPA 2PJZA 4JNKA 4X94A 1PS8A 2Y0DA 1IHYA 2OGTA 4QX6A 2ZM6B 4R68A 3EG9A 3CPHA 3FFXA 4PLWA 3SYMA 4DRZA 1JU4A 1P7ZA 3TQFA 4DSOA 4YMVA 5AKYA 4J03A 1B76A 1CR0A 3ZNNA 2I8LA 1VL8A 1BO6A 4E3ZA 4Y1RA 2WZBA 2OUKA 2BFCB 1P73A 3H5TA 4BL5A 1NWHA 5F9MA 3IB6A 1LGYA 2YUTA 3TD9A 4BDSA 4CIVA 3AONB 1A4IA 3IAM6 5FYDA 3WWDA 1XZNA 5K8IA 1WPGA 4IINA 4FI3F 2GT1A 5HIIA 4L78A 2GN9A 2RKBA 1DQRA 4RORA 1CXZA 1G8FA 1UXGA 4COOA 1QC5A 5JECA 1IJEA 1KK2A 3I0MA 3IP6A 1CUFA 1Y6GA 4HP8A 1WPQA 1X1DA 2ECPA 3L7DA 1Q91A 1EINA 1ODCA 4YV2A 1E9VA 1BWSA 3CBQA 4FFPA 2W93A 2J3IA 2RGAA 1UPAA 1X19A 1NOKA 2ECFA 3D81A 1GY8A 2IC5A 5FR1A 2O2CA 3NTRA 2M6KA 3STVA 3B78A 3K53A 4H0CA 3P2YA 4HZIA 3WGQA 2HR1A 4TKUA 4JJIA 2O1XA 1JA9A 2QD2A 3VOAA 2GPNA 3EQ2A 4IRMA 3EAQA 4WOKA 3TEMA 4X97A 4MA0A 3L8EA 5KREA 5K9ZA 2EFYA 2WPDD 3OICA 4MAFA 4PU0A 3NEPX 3ZQUA 3W7VA 2QRHA 2AZMA 4JIMA 1O6CA 2QN6A 3HUUA 2HSJA 3E3OA 4RHFA 4E5PA 4RLFA 2ZR7A 3D6JA 2IYSA 2QUIA 4PX2A 3HA3A 2W2XA 2NSJA 4CLEA 2ZYHA 1YGYA 4BOYA 4NU0A 2PT5A 3TOVA 5ESDA 2A0XA 3RTEA 3L4BC 3AR2A 1YBMA 4HH3C 4KPUB 1KEVA 3C1OA 3T06B 2AQKA 4OHFA 4D42A 1N2HA 5C1PA 2FGKA 3RTAA 2GX6A 2R8RA 2QTAA 3T9FA 1KWKA 3CR3C 1NUQA 4P54A 4AMYA 2X6TA 3NKVA 3M8KA 5FO0A 4ITUA 1Z38A 4HNSA 4K9OA 1U2EA 4TKZA 5EHIA 1K06A 2RAVA 4XFKA 2W2QA 4CV2A 2JS7A 3JWHA 2R1TB 2YHSA 3W2HA 2FDRA 1U1IA 3PWZA 3TOXA 4O2RA 2OQIA 2ZJ6A 3ZG6A 3T3PB 3NHMA 2CJXA 3ZCPA 1V41E 4AN0A 3L9WA 2JI4A 1OIWA 1SUCA 3L8MA 3E1SA 1CY0A 3WWYA 3EFOA 3QNMA 2ZT5A 3PF8A 2V5VA 4IP0A 2VCYA 5IHXA 1L6RA 5JVDA 1Z7WA 3NM6B 3ZWDA 1EDOA 4FSHA 1VBNA 2J0VA 3OD5A 3C3EA 3IBGA