4D9NA

Crystal structure of diaminopropionate ammonia lyase from escherichia coli in complex with d-serine
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
396
structure length
390
Chain Sequence
SVFSLKIDIADNKFFNGETSPLFSQSQAKLARQFHQKIAGYRPTPLCALDDLANLFGVKKILVKDESKRFGLNAFMLGGAYAIAQLLCEKYHLDIETLSFEHLKNAIGEKMTFATTTDGNHGRGVAWAAQQLGQNAVIYMPKGSAQERVDAILNLGAECIVTDMNYDDTVRLTMQHAQQHGWEVVQDTAWEGYTKIPTWIMQGYATLADEAVEQMREMGVTPTHVLLQAGVGAMAGGVLGYLVDVYSPQNLHSIIVEPDKADCIYRSGVKGDIVNVTIMAGLACGEPNPLGWEILRNCATQFISCQDSVAALGMRVLGNPYGNDPRIISGESGAVGLGVLAAVHYHPQRQSLMEKLALNKDAVVLVISTEGDTDVKHYREVVWEGKHAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Escherichia coli Diaminopropionate Ammonia-lyase Reveals Mechanism of Enzyme Activation and Catalysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Diaminopropionate ammonia-lyase
total genus 138
structure length 390
sequence length 396
chains with identical sequence B
ec nomenclature ec 4.3.1.15: Diaminopropionate ammonia-lyase.
pdb deposition date 2012-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00291 PALP Pyridoxal-phosphate dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9nA02
3.40.50.1100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4d9nA01
1K3UB 1K7FB 3IQHX 1PWHA 4HN4B 5DBEX 4D9KA 1J0DA 5DW3A 2EGUA 3TBHA 1BKSB 4IL5A 3T4PA 4LMAA 1KFJB 5D85A 3R0ZA 4D9BA 1TTPB 1VB3A 1BEUB 2ZSJA 4D9IA 2JC3A 4JBNA 5B1IA 1FUYB 5J5VA 4LMBA 3L6CA 5CVCA 1WDWB 5KZMB 5JJCA 3VSCA 3SS9X 1WBJB 3CEPB 4L3VA 2CLMB 1F2DA 1E5XA 1KFEB 2CLFB 1CW2B 4ZU1X 1M54A 3V7NA 5CGQB 4OREX 3DKIA 5I7AA 4AIRA 2ECQA 1KFCB 5DW0A 2PQMA 1K8XB 4NU8X 1WKVA 3IAUA 4D96A 5B53A 1KFKB 5D87A 1Z7WA 2RKBA 5IXJA 1TZJA 5IW8A 1WTCA 3AEXA 3VBEA 1X1QA 4WX2B 1C8VB 3DWGA 3VC3A 1Z7YA 2ECOA 2ZR8A 2DH6A 4HPJB 1V8ZA 4QYSA 1C9DB 2WSYB 2GN2A 4D8UA 1OASA 2GN0A 1P5JA 3HMKA 2O2EA 1TDJA 3ZEIA 1C29B 1TZMA 1A50B 1A5AB 1UBSB 3L6BA 3VSDA 4D9MA 4ZU6X 1J0CA 1J0BA 2C2BA 1TZ2A 5D86A 4D92A 1FCJA 1CX9B 1VE1A 5I7OA 2CLIB 2Q3CA 2J9ZB 1KL7A 2BHSA 4LI3X 4HT3B 4HPXB 5B3AA 2V03A 1TTQB 3AEYA 2GN1A 1K8YB 3PR2B 5I6DA 2EFYA 2RH9B 5KINB 1J0EA 1TJPB 3BM5A 4JBLA 3SS7X 1V7CA 3PC2A 4COOA 4D9FA 1QOQB 5DBHX 1A5SB 5I7RA 2O2JA 5I7WA 1K7XB 2C2GA 5JISA 4KKXB 5D84A 4D9EA 4L27A 4D9NA 3IQIX 4D8WA 4NEGA 5BW6B 4AECA 4D8TA 4F4FA 1QOPB 4L28A 2CLEB 3FGPA 1UIMA 4I1YA 1TZKA 3SPXA 2Q3DA 2BHTA 1RQXA 5B1HA 3R0XA 4OFXA 5HBGA 3RR2A 4Y6GB 3VSAA 5T6MA 2ZPUA 3PC4A 3FCAA 3X43A 1JBQA 2CLOB 2CLLB 4D9GA 1O58A 2TRSB 1K8ZB 5B55A 3IQGX 1A5BB 5J43A 1TYZA 2DH5A 5I7HA 1Y7LA 1D6SA 2D1FA 5C3UA 2TSYB 5EY5B 5DVZA 1J0AA 2CLHB 2CLKB 3DWIA 5E0KB 4PCUA 5B36A 1K7EB 1PWEA 3X44A 2RHGB 5IWCA 3PC3A 4L0DA 4HO1X 4D99A 2J9XB 4XUGB 1UINA 4D97A 2J9YB 4ZQCB 2Q3BA 1VE5A 2TYSB 2ISQA 3L6RA 1KFBB 4H27A 4D9CA 1V71A
chains in the Genus database with same CATH superfamily
1OLSA 1PDVA 4LYYA 4TN1A 1P45A 3QBVA 4YRMA 3DKVA 2FWNA 2XITA 5DBFA 3NJRA 1NXWA 1DIAA 1YVUA 1XTKA 2YRFA 3A32A 3ZK7A 3OZDA 2ZJ0A 1DFIA 3KAQA 4XE5A 5EJ9A 1VJCA 4MVJF 2YFYA 4P4UA 4YNBA 1L4KA 5F5LA 4I5FA 1LX6A 2NLOA 1IOVA 1VB3A 2WQZA 4LKRA 4L72A 2D2XA 4OBXA 3VPFA 4PHCA 5TXGA 2VYQA 1WUIS 2B36A 1R64A 4L7VA 3UB4A 2GOYA 2P2GA 4PIPA 4AWBA 4ZA2A 4BMVA 5AVKA 5ALLA 3D6UA 4RBNA 2FZEA 3IAS1 3ND9A 4BQOA 1T2UA 4FD2A 4R8LA 2XKKA 1X1BA 3QUAA 3RASA 3ONDA 1CFJA 2NNLD 1VFNA 2NT3A 3BMCB 3KYJB 4D0SA 3BB4A 3I6ZA 3K70B 4JC0A 3N39C 4DFDA 1MV5A 2IXAA 1Q0SA 1GPNA 1Q5PA 4JA2A 3D8UA 1ZZEA 3WK5A 3RADC 3SXPA 2A67A 1RE1A 4QBIA 2BMEA 3ADPA 2X13A 1XKLA 3KAKA 4IJMA 4IO0A 1SQSA 3RUFA 3OMLA 4QG7A 1W4BA 3U26A 5CFNA 3FX2A 2UUBB 1QFMA 4NONA 3RTBA 2PRKA 1ULSA 2PUVA 4L3WA 3TOSA 4RHFA 1ZHFA 3KWFA 3RHZA 4RHXA 2PMKA 4G1EB 2IHUA 5LVAA 1XK7A 3M1IA 2R1TA 1NE2A 2B3TA 2W43A 3SNHA 4RGVA 4FNOA 3KKPA 1ADGA 1QYIA 2ZI6A 1AGPA 1QHSA 3C6YA 3MMPA 1KJIA 3AG6A 4I1SA 5HILA 1HI9A 3OLXA 4QUDA 4XD7D 3R7FA 1EM8A 1SKUA 5JDIA 3MM4A 4LGVA 4ZVLA 421PA 1RWNA 5HTOA 3L49A 1QYDA 1T6YA 2QAGC 3MGAA 5EYPB 2ZZNA 3VC1A 2I0FA 3RIEA 1QJ4A 4TL6A 2CNKA 2WWFA 3DDOA 5IC6A 3T5CA 1OYYA 2EF0A 2FJ0A 2JLCA 4EG0A 2RK6A 2G6TA 4FEGA 2GKOA 4BZWA 3M4NA 4DZZA 3Q41A 4YLYA 1OU4A 7AT1A 1DGQA 1CVRA 4MUHA 2FFBA 3FGPA 1VMKA 3KTFA 3VYVA 3KFXA 1V48A 2B8JA 2QHXA 4NOMA 3PBKA 3SEFA 1Z0KA 5EPUA 3WKDA 4EBBA 2O2HA 4UXHA 5K3FB 4DCUA 3F2VA 2P7HA 1MT0A 3VAYA 1GFIA 1TCCA 1P7VA 2P6OA 1NR5A 1JIQA 1TUEA 4MS3B 1N2SA 3OIWA 5FLXA 1NWCA 3JAMA 3CXUA 4QYWA 1W44A 3BFVA 3T3PB 2JJMA 1V7ZA 2KHZA 1XZHA 4RD1A 3FCEA 4F2PA 1NBAA 1LU9A 1ZVMA 1L4YA 2QP4A 1ZOSA 1QBGA 2QTTA 1NUQA 4GPBA 1JQAA 5TQ2A 1Z75A 3M5PA 3TLEA 3IMGA 4FYKA 4DQ0A 5CM8B 3ZJYA 2D2IA 2PZFA 2VJCA 2BFBB 5EP3A 4Z54A 1T29A 1W85B 3PDCA 4BO7A 3M9WA 4KSYA 4DAOA 1H2EA 4D4MA 1IRXA 5F12A 1GLGA 1A5ZA 1T8PA 2MOKA 5FWDA 2WPDA 1OXBB 1D6JA 1VLLA 3ELDA 2HLHA 1Z5NA 2MU1A 4KLAA 2IHTA 1K5GA 2EX0A 3R2JA 1CQXA 1G18A 5HUQA 4PLYA 4MV6A 1N8TA 2VP2A 3DD1A 2BKXA 1XDSA 2HAEA 1KPGA 1SEPA 3ZWQA 3EY4A 2II6A 3MJSA 4MVYA 2R6CA 1J6UA 4HLNA 1FQWA 3AF4A 2PXXA 3Q5GA 3LDFA 2HM7A 1M8GA 3D81A 5F77A 3ZS9A 1EXNA 3N3AC 4JWTA 5BR8B 2UYCA 2NV0A 2CKMA 1Z18A 3UCFA 2QMQA 3ZCXA 1PGJA 2PZBA 4B2IA 3SC4A 1GFWA 1YCDA 2GF9A 4YMWA 5KOHA 1XXLA 5BSEA 4NPCA 2O2DA 3ROPA 1XRLA 4FNGA 3SJBA 2ODWA 3JQCA 2D62A 3GLIA 1RYHA 5ABPA 3GOHA 4I14A 1YL6A 5I47A 3C85A 4QQ8A 1XJCA 3GRFA 1OILA 4IGAA 4IS2A 2MYTA 2VJAA 1RE0A 1TQ6A 4R7TA 2Z2IA 5CH8A 5T8KA 3U31A 5A1TA 1U8TA 1RM4A 2HJHA 2VDMB 3UC9A 3WGYA 2JDIA 1EFVB 4AL4A 1OASA 2VQDA 2AFRA 1UR5A 3OM1A 5F2NA 3AUSA 2JD1A 2QBYA 4LZLA 1RAFA 4RGYA 1QUFA 3AUJB 1JA1A 5HCNA 1GPJA 2H2FA 2X9LA 4IQGA 1CQIB 5DRTA 1W0CA 1BHO1 2X8BA 4G2NA 2CEAA 3NZEA 3BMOA 3MRVA 1AGNA 3PJFA 4JVOA 1Y9JA 3FRJA 3QPDA 3MLAA 3V1LA 2QAGB 3DZFA 2F59A 2JGRA 2RGYA 2WJJA 5KYVA 1XZLA 3RTGA 4AQDA 1HNXB 1YTLA 4H1UA 1YQ9A 5HZHA 1XTVA 2X41A 2VCEA 3EOBI 1O94A 1QOQB 2ZS9A 2A0WA 3I9FA 3G9QA 2VP4A 5G4LA 1SCDA 4N8SA 5IAKA 3VVLA 4DF3A 4EJMA 5ALNA 1T91A 3VNSA 5ESXA 1TJYA 1S4QA 3CPJB 4LDNA 4NNPA 4QQFA 1SN7A 2X4IA 3P9IA 2CD9A 4M8IA 3Q4GA 1F4LA 4Q7JB 1L4UA 3T6KA 3ZV6A 2IY9A 1ZDMA 2L17A 4FIDA 3VRHA 2AJDA 3QBJA 4DSTA 1LLFA 1E6EA 5LOVB 4DSAA 1M2VB 5C0OE 4C08A 5JBNA 1U9YA 2BIFA 2UXDB 2W6CX 2BWJA 3GJRA 3UH0A 3NUQA 1AC5A 1GILA 1M2OB 2JCXA 4CMHA 4KXWA 4JR1A 5EJGA 1X1SA 5SY6A 3GP3A 2R6DA 5K8UA 3KQUA 1DCKA 4RX1A 2Q3JA 4B45A 4KXFB 3BSYA 3FUVA 3CURA 4GLOA 4RA6B 2BYTA 5EMJA 3AVWA 1ACLA 3FB1A 4KYVA 3ZU4A 3Q7EA 1XDBA 2UAGA 2X77A 4HYEA 5BN4A 3PC3A 4UJ5A 5IKOA 2NO4A 1T9KA 2D54A 3EYAA 4D6YA 5J40A 2RI1A 1J21A 3BKXA 1II0A 3DCNA 2HZBA 3GWZA 4TLEA 5L6MB 4Q93A 1HE8B 1SOMA 5CXSA 1E2NA 1UMCB 2VDRB 4Y2VA 2NU8A 2GEUA 3FZGA 3Q7PA 4M3NA 2GAOA 2C1XA 4AQ7A 1U0JA 3G85A 4RVOA 2GZ2A 3D3KA 2WSIA 3L82B 1R0RE 4RE5A 2D1YA 1W49A 3K8OE 4GC5A 1UJ5A 4D5EA 3PQ6A 5LXTA 1PX2A 3TKYA 1W9HA 4S1VA 1G19A 1CUXA 4M8SA 5J5VA 2GNPA 5KJCA 3IQZA 1TFRA 4I4NA 2JLWA 1IUPA 1DDGA 2QR2A 1PZFA 3QW4B 1UKEA 1JHRA 3TUJC 1AK1A 2HYIC 1T2DA 3ZHVA 2CXQA 5JQGB 2ORYA 4JLMA 1ORVA 1DJQA 4NEQA 3ED5A 1M54A 3IMKA 4NBUA 3OQMA 3SDZA 4X1YB 1ECJA 4P1ZA 1ZSVA 5KTKA 3D6VA 1M5RA 5F78A 1EVYA 2GGSA 1E2UA 2NTYC 2YMQA 3GA5A 3STWA 2VWQA 3V1UA 1ISFA 3CQ9A 3L8EA 3F49S 4QHSA 2OC4A 4QUIA 5EMNA 2QT0A 1B0UA 3FWZA 1A8QA 5BWCA 5JASA 2VT3A 2WG1A 4F4HA 3HYSA 1MABB 3K0KA 1NXVA 4GMDA 1F8UA 5TMEA 3SYLA 1AUOA 1YJXA 4AUNA 4CMEA 1XTPA 3UVEA 1NNI1 1PQYA 2FUCA 3CCBA 4FFPA 4FFRA 2YN4A 2UZ4A 2IEAA 4BNFA 2RAPA 2GH1A 4XAQA 3EMVA 1KIFA 4EELA 2EKZA 2FHPA 4LHXA 5ARBA 5KYNA 2PCJA 3AR4A 4ZEXA 1ZVKA 2XUPA 5J59A 5JS8A 1QCYA 1ADCA 1Z0SA 2FPXA 2I3GA 3IIKA 3KO8A 4U7GA 2H5JA 4D9MA 1Q21A 3J7TA 3NASA 4URZR 2FF7A 1I7DA 1UXGA 2GAFA 5EE5B 4KODA 2KB0A 3OPYA 4N01A 3RIXA 2M6RA 2WIBA 3RWMB 4MUGA 5GVSA 4KK3A 3U60B 1KORA 4WKPA 1SWVA 4GOJA 4L5AA 3HBFA 1JALA 2Q8QA 2L82A 5IKXA 3R9WA 5A9SB 4Y6PA 2D8AA 1J0EA 2BZ0A 3EXAA 1OIVA 4JUAA 4RDXA 2P11A 4COOA 2MYPA 3L06A 4J43A 4Z9AA 4M9SA 1RPNA 5LQCA 2ZGVA 3JQEA 1XIVA 4FYPA 3LHIA 5FWXB 3I32A 2XMGA 2X6TA 1XNRB 2GX6A 3DZBA 3LUDA 1GD1O 5B4UA 1N5JA 1QOPB 1U7OA 1ECBA 5CJ2A 2EWWA 3G0OA 1LFAA 1H66A 1L7QA 5T57A 2QE7A 3E3AA 3GGSA 3TVYA 1O96A 2FFHA 4HQOA 3GEPA 1L5HA 3DOOA 3LBNA 3QXGA 2ZWIA 4BGEA 1E0AA 1R4MB 3D7NA 3DA8A 3B3AA 4FHZA 3MN1A 3ZGNA 1K88A 1M0WA 4LZPA 3W2EA 1FTQA 3O0TA 2DH5A 5AW6A 5JAMA 4ZCSA 1ZWLA 2RHTA 1XZDA 3UGJA 3CZPA 3KB8A 4QQNA 2J0UB 2OV2A 2F1JA 1H94A 5CA0A 3CN9A 1EDOA 1I2MA 4GBMA 4QBFA 1M2GA 4MVWA 1KR5A 4PONA 1S3FA 5ITWA 2P2CA 3LI2A 4BQPA 5KJ1A 4KPEC 3LMKA 3QP9A 1DMRA 1CJBA 4LYGA 3E22A 2W93A 4GX0A 3IT1A 1ZNQO 1NW9B 4PQGA 3D2AA 3JQ7B 2BGIA 4J7XA 4HSEA 1V5FA 2ACWA 4JHXA 1BRTA 1A4RA 1X1TA 1OV4A 3NWBA 3OQHA 3KQWA 1PBNA 5CIYA 2P6RA 3LSYA 3V1YA 4X90A 4FCWA 4FPXA 2PNFA 1YZLA 4J6EA 1NI5A 3HI6A 5KYXA 4RZIA 3UJ8A 3L7LA 5T7BA 5HRUA 2UZ0A 4HHEA 1MTZA 4U2BA 2JA2A 3DM9B 2Y1FA 3L0IB 3M33A 3OOJA 3TXYA 1RBZA 1DKPA 1QHYA 1G6HA 1N0VC 5TPWB 4NI5A 3PWTA 4DLXA 1AZLA 3V6MA 3KXPA 5A05A 3VO8A 2P4UA 3IEXA 1LBTA 5EWMA 2IH4A 1GRNA 2ZUFA 4XOIA 1Y3FE 1NOKA 5FI3A 1QU2A 4FGJA 1YZTA 1D2MA 2V98A 2XUQA 1AXRA 3NTLA 4LI0A 2ZJ6A 2ZYVX 5AM5A 2Z57A 3YASA 4ETWA 3T1QA 1GZVA 4PLGA 2H4WA 3AEXA 4DRYA 1QS0B 3IPYA 1SCKA 1SIWA 4DDTA 1TIKA 4CL2A 1P4HA 3GEIA 4FZJA 4I99A 2QV7A 5KQPA 2DBYA 4RKEA 5GTDA 1IC6A 1F6DA 1T8SA 2VYVD 5HEKA 3FRIA 3Q1LA 4LVNA 1DBIA 4JYBA 3WL4A 4BYGA 5A2QA 4AG5A 1FSGA 3PRYA 5L9AA 3OOHA 3SZMA 3A6PC 5K45A 3QLUC 2PPVA 5B58T 1MXHA 3A6KA 3L0YA 1QXSA 5EKXA 3ZDRA 1SNYA 1FSPA 7YASA 4PC1A 2E37A 4FDTA 1EFPB 3QU2A 4HGYA 5G0VA 5FPPA 4M9CA 1ADBA 2O8FA 4RV9A 1IZ8A 3PG5A 4C0JA 4C4TA 1YACA 3Q11A 4WE3A 4JB8A 1AOXA 1JIKA 3MTAA 4IQFA 5FLKA 3R5TA 5I01A 3FYTA 2JGMA 4R05A 4CNBA 1YZYA 1OVGA 2WZDA 1JSZA 1ZU4A 4GVPA 4LYDA 3F5SA 1YMQA 4DRZA 4ZVRA 1T2NA 3HB9A 3PX7A 1FB5A 1IBSA 1PUJA 3Q3VA 1NNUA 5CA1A 4W99A 4YPVA 2F1HA 2IQ5A 4KQWA 3RTEA 5DGHA 1H05A 1BJTA 2W6OA 5JU6A 1OB2A 1TEHA 1RQRA 2ZYRA 2I7TA 4YFVA 1JDJA 1XV5A 4QJ3A 5KVVA 2G88A 4RTKA 3AM5A 2MTBA 5BT9A 4KJXA 1E3LA 2YDYA 1QGUA 2D1RA 1TD9A 1VL2A 3SIPA 5JNTA 2NU9A 4LTNA 5CMLA 3KDSE 4XWTA 5ALOA 1JU9A 1KSFX 4J16A 1Y8RA 4IVRA 1VG1A 4CQMD 2PUAA 1BHQ1 3BRWA 2E5FA 4MA4A 4MUNA 4IMRA 3DEAA 4TUYB 1WUTA 1YB7A 2BKLA 2DYKA 3ZD9A 2O5CA 2YZ7A 1D5WA 4DIMA 1U0OC 3VNBA 2YMMA 1ODLA 3WWEA 2C0QA 4B6SA 5LFAA 3AVYA 5SZJA 3AXTA 2C57A 1EESA 4PWZA 4TWJA 2V9CA 4GPIB 1JSRA 3WB1A 5COBA 3EGDA 1X7HA 1FBTA 3PC8C 4CQLB 2RKWA 4Q4AB 4C6RA 1RYMA 2OD2A 3VU9A 5MF6A 1I33A 2BGRA 2DRIA 4OYRA 4QPJC 5JCOC 2ZSIA 3NT5A 1QQAA 4BMNA 3MB5A 4RXUA 4WGGA 4QGGA 3RUEA 1R0BA 4QDXA 1OC2A 1AQYA 3BT7A 1P1HA 1KYYA 2QD1A 3GJ7A 2Y1OA 4ZAVA 1CC1S 4HJXA 2IITA 3EASA 1YDGA 4RHUA 2G3YA 1FRZA 3GUHA 3N75A 2DCMA 3W1EA 5C2JB 3JZIA 3U7GA 3WO0A 3BCHA 3I9KA 4V2IA 4HEQA 3KU4A 3G82C 3CFYA 1XO1A 1XAGA 3PI7A 2Z9CA 1PRYA 3QMPA 4H7IA 4JYMA 1E9VA 3GUUA 3KEQA 3TLGA 4DQXA 4QFDA 2FZGA 3WLSA 1ODTC 1EGVB 1XZJA 3RBAA 4AZ3B 2BFOA 2MHCA 2XHEA 2X2EA 5AIAA 4EO4A 1TMGE 1W93A 1RCFA 3CVWA 3QV2A 2X6RA 1IQUA 1CZUA 3ZE0B 1GNTA 1YA6A 2EF1A 5AHWA 4PX3A 4RK5A 4XB1A 4U7FA 4LOKA 3HB7A 4RMGA 3DBIA 4YCLA 2CE7A 1H5UA 3O8QA 3ZQ4A 1OAAA 1P8AA 4TSFD 4WKCA 2WLTA 1LTHR 1FSZA 3MT7A 4OQPA 3FNRA 2XD4A 4F8JA 1THTA 2GK4A 3SSAA 4HNSA 2FMKA 1B26A 4ZRMA 5EQDA 1CRZA 1YA8A 2DH6A 3BFPA 4LDAA 4RL4A 1GNPA 1U1CA 4AIIA 5I3CA 3Q9SA 2FMXA 4PO8A 4ACAA 1RWWA 3FPHA 3QX8A 4QBGB 8ATCA 2Q5IA 1MQSA 2JIRA 3TGWA 3M3HA 2PSDA 1OWMA 1UPCA 3ZUPA 3GDHA 2YFQA 5HF9A 1DUSA 3EMBA 5CM9C 1R0KA 2P9QA 1JDPA 3AO0B 1TQ8A 1SIUA 3D0OA 3N7TA 5FORA 1TTTA 3GAMA 1KEKA 4B3MB 1O6FA 2C1ZA 3EIXA 3A6LA 1GYQA 4OGKA 4IH4A 4Q9JA 2LBPA 3F9RA 4NV0A 1TW2A 1HZZA 3GBPA 3H19A 1EUCB 4JKIA 3WZLA 5AJXA 3AVVA 4X3PA 1GGEA 2W5UA 4D56A 3PFKA 5HQ3B 3UUEA 1A04A 2YXEA 2H0RA 3FUWA 2FSSA 4G36A 5AJZA 3O75A 1UM9B 5JY6A 2HV8A 1JKIA 2F2TA 5CDFE 3AUKA 1E98A 2YXNA 4UBOA 4MW4A 2IZ5A 4R01A 4B81A 1KDRA 4ZJUA 4JLUA 1QTIA 4QIHA 3AFOA 3RUIA 3MJVA 3EMDA 4FFVA 4I4TF 4DR7B 2F8MA 2XY4A 2VBIA 5D3KA 2YJ4A 3VPAA 5IMSA 4KPFC 3DEIA 4E51A 2EERA 1YZKA 2ZSAA 2DT5A 1RIFA 4Q3LA 2HW8A 3U4AA 2I4NA 1KY4A 3R9KA 5LDGA 2CVHA 2B69A 5AWFC 1H2HA 1XZ8A 1JAXA 2HSZA 1NA5A 1M0TA 2GF2A 1OXSC 2IJGX 2Q45A 2NAFA 3IAEA 5L95A 3ONFA 2C4WA 3A27A 3O2NA 5U9CA 4LWOA 4HATA 1ETUA 1A8HA 5J1SB 3KYCA 1WV1A 3QYPA 4PAMA 1YBAA 1ZGBA 2VPWA 4QRHA 1SOUA 2QTBA 3I3SR 4F4JA 5L7WA 5IN4A 1RS0A 3ML1A 2RAUA 4K6FA 3BMNA 4HVAA 1SELA 2HO5A 4OQEA 4QYIA 3R7LA 4CG1A 5FBHA 2QNBA 1PNVA 1ZH0A 4KUEA 5J9FA 3ETNA 3RK0A 1SUAA 2ON6A 4RS4A 4B6QA 4KHPB 2RCNA 1E77A 5EIOA 3MUNA 4UPEA 3AB8A 3S5UA 2OHVA 4BBPA 3OTGA 3RYIA 2AKYA 2C88A 3BVPA 1XKXA 5HIIA 3V3TA 4X60A 2O8CA 3MB8A 2QROA 1KYXA 4ZOAA 5KQMA 5B5SA 4DJ5X 2VDPB 2R79A 1O6BA 5DX8A 3IB3A 3A25A 3I0MA 1Z0JA 3B52X 3QXSA 4KQKA 4KHZA 1E18A 5BR7A 4KREA 4BL5A 1G20A 4BV9A 3BFKA 5A4KA 3R74A 1U8AA 1LLDA 1LBSA 3M3DA 3HPRA 3ET5A 5ER6A 1QP7A 1T34A 1F17A 2C7GA 2IS6A 4XYGA 1P4GA 5KDLA 4PRKA 2Z43A 4JLJA 5CLHA 3S40A 3QX3A 1OV6A 1O2DA 2B3DA 4KE7A 1XMQB 4EF6A 4E15A 1WL8A 2P67A 4XQEA 2CLFB 1FPQA 1NQTA 3FUUA 4GAEA 1T9AA 2Y0BA 4G84A 4BTLA 4C4AA 4AKHA 1WMDA 4F9EA 4NXNB 2HNKA 3OIDA 5LXTB 1T36A 4QXAA 3FUCA 4FFMA 2BDEA 4HX2A 1I5EA 2ZAMA 5CK5A 5DP2A 1D2AA 1H1TA 3K7EA 2ERXA 1Y4ZA 1K8QA 2LIPA 4OB6A 1G3RA 3CF4G 1R8YA 5TSDA 2APJA 2K87A 1E9BA 3OETA 3FI9A 4JVMA 4Y1RA 4EFKA 2ZR8A 5ENDA 4YONB 3HU5A 5B57C 2OCIA 2VJOA 2Z3WA 4MW9A 4B09A 3FPEA 1CUUA 1NUPA 1VXRA 3OCZA 4RSMA 1IIBA 4WZAE 4B75A 1P5JA 4EHKA 4EJ0A 4KSCA 4OHFA 2QD3A 1MIOA 4BMOB 2O0MA 2WD8A 4NU6A 1DT3A 4C2BA 1BHSA 3TOCA 5DB4A 5DGTA 2VJMB 5AVTA 1MV8A 4BP8A 4F3NA 1A9QA 3G68A 2B7LA 3IB6A 3IILA 2OCDA 5SZHB 4FE3A 5EGNA 1CQIA 1W85A 5EWJA 5TB5A 4LOAA 2ZBFA 1PDWA 2RH9B 3RAPR 1TEZA 3UUFA 3WHKA 5CLLA 4F93B 2XTNA 4COKA 1JV2B 4KZPA 3K31A 3BWEA 1V3QE 3D4NA 2IQIA 4M38A 5JTTA 1RLMA 2WE8A 1LJUA 1N6PA 1BE8A 3ADBA 2AXQA 3VZRA 1PS9A 1ZM2A 3JALB 3G0HA 4KYIB 1JIJA 2MJLA 1RQGA 1V6SA 1SEVA 3ENVA 1XTBA 4I9HA 3W2GA 4EUKA 1OZ0A 4CIYA 5LD2B 1E4VA 2QLMA 4D8TA 4U1RA 4JROA 1BC5A 2UU9B 5K3SA 1Q7EA 5KSWB 2DR3A 4G2TA 5K0FA 1H9AA 2F67A 1SD5A 1SVWA 1ZI8A 3LCVB 1ST2A 4KZKA 3ZJTA 3ND8A 4QWWA 1CUWA 2FJUA 4UNQA 1BN6A 2QMYA 3QPUA 1Y42X 4RIGA 3IURA 2RE8A 1KK3A 4K3VA 3OHPA 1P2BA 4FYJA 4Z9YA 4LS3A 1P5RA 2YCLA 4L4XA 2WKSA 3MWGA 4BIIA 5AT1A 4ZMBA 3WRYA 3OA2A 4K8OA 2GYUA 3UFXA 4QPZA 4WINA 3VDRA 4WJLA 2BTQA 2XPCA 1CU1A 2HCFA 4MQEA 1A88A 1GPLA 1AN0A 3KL4A 3DYVA 5JYCA 1Z38A 3ZDQA 4FVTA 3JQ9C 3PX2A 4OJTA 4Y7DA 3CVOA 1A9PA 2PKEA 3P2JA 3QE4A 5B37A 3WG9A 3B36A 2BEWA 1BDIA 2WD7A 3UA3A 4BDTA 4DIBA 3JWJA 4L22A 2OPBA 2P0AA 1GL6A 3W5DA 3HJTA 1LK5A 3UV3A 4R8RA 2I5PO 3B60A 3HB1A 3EAGA 1RJFA 1XSEA 3HUUA 3P9KA 1TYEB 3PC6A 3ZJ4A 1ESZA 4OUDA 4A0FA 4QARA 2HMVA 5JVDA 3I4LA 4MB2A 3MJHA 3AH8A 5A62A 4B7ZA 5K3EA 3ZWNA 5G1NA 3LFUA 5JANA 5MN4A 2P9FA 4OQDA 3A36A 3GRPA 4D74A 1NZDA 4DR5B 3LLCA 2LZ0A 4GWGA 2FZWA 3DV0B 3RVPA 2UUPA 1AQJA 1QGAA 1JG4A 1H4SA 2IYZA 2Q9AA 1WCIB 4L8VA 2P9HA 4K26A 3KSRA 4QDKA 1MENA 4CLRA 4EF4A 3SNKA 5JARA 1JECA 3NBUA 4B8YA 2HSWA 4YQFA 1JPNA 5FBLB 4DLUA 1JQLB 4O1MA 1SO8A 4BNXA 2XIJA 3O4JA 3OZXA 1XDDA 4DUYB 5C81A 2XCOA 1UBOS 1VRCA 2VDNB 8ABPA 4EUHA 2X8JA 2XA2A 2OFWA 2IZZA 2VT2A 5F64A 1GAEO 4LC1A 3W3AD 1RZVA 4ZVVA 4WBNB 2CNWA 3CF0A 2BEVA 4RTLA 4HBGA 2IDZA 4RMIA 5JMOA 2BZSA 2DHCA 2QN8A 2JASA 3ON5A 5EFOA 3FCOA 3G7SA 3P2MA 4NOLA 3FDZA 4K3UA 4OHRA 3RSZA 3MAJA 2Q4OA 1YFKA 2ZBPA 3AT1A 5HFNA 4AY4A 2M9MA 5IJXA 1G17A 1UOOA 4B47A 2QN1A 3AF3A 1TLLA 2GBGA 3PVSA 4U5XA 4YVFA 3P97A 1SBCA 2E55A 2HTFA 4HGPA 4OXRA 1K89A 3LRXA 1NVMB 1O95D 3E7WA 4TMWA 1W4AA 2PRIA 4AO6A 1UL1X 4BVAA 4IDCA 4UUBA 4NP6A 3UQYS 2KMLA 2ZWVA 3E9RA 4YP1A 5F5XA 5D3MA 1PQ4A 1E60A 1G5TA 2P2DA 1Z5OA 1Z4OA 1LDBA 1VYHA 1K6JA 2JFHA 2PYIA 4L15A 1Q7CA 3AJEA 1K5PA 1TQ2A 3HB5X 3JZMA 4TTAA 4ZK2A 1S7CA 2P2NA 5IT4A 3U3XA 4E5PA 3KLBA 4LJKA 3VHXA 2CNLA 2CEKA 1W4RA 2AZMA 3BD8A 4QGFA 4NBRA 4ODIA 2XYHA 5JSFA 2C98A 1MVLA 1TO6A 4DA6A 2Z2XA 2PWBA 2VPPA 3VSAA 1GPWB 4CI9A 2AJCA 4UM9B 2VRWA 3R23A 2KSQA 1R1DA 3OTQA 3UMVA 5K2OA 3C3KA 2IKQA 1B00A 2TRSB 3K5HA 4DMGA 1X0XA 2WIKA 4LYFA 1LZKA 4UTVA 521PA 2K4MA 3QNWA 4IUYA 4KI7A 1ZHHA 4A36A 3A31A 1J4AA 1X6VA 3D54D 2I22A 3RC1A 4HZIA 3TX2A 2R2AA 1U2RA 5IJ0A 1KK2A 3MCWA 4GMHA 3QWBA 5JIBA 1V9CA 3OOYA 5CD9A 1U5BB 1Z0ZA 3NTUA 4QGHA 3BHIA 4QXQA 3MCTA 4WOKA 5EOVA 2H9IA 4NMHA 4E2XA 2DPLA 5J4HA 1UWCA 1XD9A 1CR1A 4KLRA 1NN1A 4EI9A 4HV4A 2I2CA 4BC0A 1LB1B 3JYQA 1KYTA 3H11B 3IEPA 2RHDA 4PZ0A 4MHTA 2OCLA 5TPZD 1E99A 5KKCA 3DO8A 4OFBA 3VISA 1TOAA 1FYEA 1USIA 1GL7A 4LXIA 2XWQA 4WK2B 3GRCA 4X97A 1YB4A 3GVIA 1VQ1A 1QHIA 4LZWA 1VCHA 2NPOA 3OUTA 3SP1A 3OTIA 3ZDEA 3EXHC 4N0EA 4HVCA 2OECA 2REQA 1E2LA 3WYGA 1T6XA 1TK2A 1TQ4A 3TAHA 5HKKD 2CLMB 3TRKA 1FJXA 5AKZA 4D0GA 2YHUA 5F5NA 3FHTA 4OF4A 2IYXA 2IP1A 4R3WA 2XT9A 4Z1OA 3W3AA 3B5JA 1LWNA 4JMLA 4A26A 2IHNA 1CF2O 1R0WA 2YNMA 4B84A 2FR8C 3V8NA 2WHRA 5B53A 4MUFA 4EVRA 6PFKA 2PH1A 3ESRA 5GAJA 3NS7A 1LPAB 4F3TA 1XZEA 4HNHA 2PJZA 1RHKA 4PTZA 3ZHZA 4MUKA 3I8SA 4E11A 1WTAA 4OHCA 5HK9A 2JCSA 1L5HB 5JO9A 4M0DA 1BKYA 3BXXA 4NY1A 1XEWY 3MJTA 5IDVA 1ZR4A 3ND5A 4MV7A 4RLFA 3DE1X 1ZGJA 4IG9A 5CT8A 4PRZA 4BFVA 1TE2A 2ZFUA 2BSQA 3IPLA 2ZJ5A 4N03A 4F8YA 4LF9B 1DLIA 3OZ7A 4R8VA 4LHSA 2GSDA 5DULA 2XZOA 3K09C 2X5JO 3MGCA 2IDMA 5B2ZA 2QRNA 3Q98A 3RYHA 1VXOA 3BSWA 1T4GA 2HJSA 3HNPA 5HFAA 2F1IA 1NI3A 3G2HA 4WLOA 3RC9A 1Z36A 1FCJA 4CKBB 3SC2B 5LMZA 3THXA 1R3UA 4RZXA 2WHYA 3KUDA 3L8HA 4O0MA 1I3OA 1YI0A 2O2CA 3ZWDA 4NV3A 4HT3B 2RKOA 3PCXA 4K0KB 1QQ5A 3G5MA 3IRUA 4R98A 5J63A 2G9NA 3V7WA 1TJPB 1D9ZA 2VDLB 1GIAA 2V9ZA 5H83A 1JLHA 4KX5A 3AL0C 1J5XA 3AUYA 5J3JA 1ZUNA 3D3JA 3MGGA 1NUSA 3KBBA 4X61A 1Z6GA 3M2TA 1SOAA 2IOQA 2DPYA 5ENZA 2VK2A 4FXOA 1BXRA 2VNHA 2ZJBA 4A73A 1UAGA 3WTCA 2WQ6A 2HF7A 3A1UA 4JGBA 1IHPA 4MWDA 4AECA 2XQVA 4YCNA 5EUQB 1VJ5A 4OKIA 4MRMB 5BP7A 4QUEA 1DJPA 1E3SA 2H1LA 1GXSB 2YJ6A 4CM3A 1SC6A 4MR9A 4YRSA 2WJGA 5IZ4A 4JBGA 5HBGA 4KQEA 4DHEA 1G2IA 4JR0A 3TB6A 3OZSA 1U0BB 3VJMA 4LMPA 5KYTA 1T0JB 3EZ6A 3QJYA 2W2LD 3V2UA 2Q9CA 1DXYA 4M55A 1O5IA 3U3JA 2XH8A 4EMUA 2FGKA 2BHLA 3UAXA 4B33A 5AVYA 3KIPA 2R6ZA 2XGOA 3CRVA 4WXPA 3G8CA 4IIFA 3PJRA 1XRJA 3N9IA 1U9IC 4PPQA 4XH9B 5K1ZA 2DBRA 4ZYWA 2D6FA 5KB3A 3F8WA 2B98A 4TN5A 3PEWA 2G04A 1I80A 1XLUA 4IMPA 3VNRA 4ER6A 2BR4A 5B2FA 5BNIA 1G66A 4WHMA 5ER9A 4ENQA 1N57A 5BR4A 4DKJA 2UUAB 1L5OA 4I1UA 3I6BA 5BSWA 2WABA 2OV4A 3DBHB 1C7EA 4YRQA 1MA3A 1GAXA 3GJXC 2Y1CA 3O82A 4EW3A 3VU9B 1Q95A 1P9WA 2VBCA 3BTOA 3GLHE 4GWLA 3N6RA 3P9YA 1DEHA 1K6XA 2PG3A 3HA7A 3BAZA 1QYVA 4KE6A 2GR9A 3QWAA 4ZODA 3DVLA 3OJFA 3AVUA 2Y1GA 2IIQA 1SBIA 2HRZA 4M54A 4DGSA 2JKVA 4JP3A 3J7AC 2BP7A 2YFHA 1A9XB 3FLAA 4WJKB 1GHTA 3IDFA 2HH9A 1M0SA 1UFQA 3EUFA 2Q07A 5EQFA 3P2OA 3WSVA 4YMUA 1E3WB 5IAEA 2N0SA 3HWWA 1C80A 1IEWA 4MIOA 1LVGA 2Q1TA 4MGYR 4N82A 4CTMA 5MFPA 3JR7A 3QUQA 4ALMA 3OOEA 4NXMB 3QMMA 3OZRA 3VPXA 1X3SA 2JFYA 3W0LB 1NKSA 3DZKA 1MC5A 2MT9A 4JQOA 1U7WA 2OXIA 4B7XA 3F47A 4EHDA 4EY4A 3CCCA 5CIWA 4R2LA 3QY0A 4PYOA 3WWCA 3B3GA 2FF5A 4XM1A 5BYBA 5K0JA 1J22A 3OKAA 4JC8A 4Z4FA 3T7TA 1AGYA 2KW5A 4BMZA 2AA3A 2PKXA 1XQ1A 2RGEA 1H5QA 2HJRA 3IBCA 1EWKA 3JVEA 5FOWA 2HDNB 3JVUA 1KJ9A 5DIZA 1N4AA 2C94A 2FMIA 5B3LA 2YICA 3H5RA 1JHAA 2QG4A 2ZRCA 4QLOA 4UAUA 5ALVA 3GBSA 4BO5A 1H0KA 4QDJA 3KQSA 4R1LA 3E1KA 2WJ3A 4DIUA 4N3CA 1BU5A 2CZGA 3O93A 2YWGA 4PX2A 1FNCA 3WOVA 1WXXA 1NN0A 4JKYA 4N41A 1PS0A 4XCXA 2WB4A 1BX1A 2DHEA 5FIUA 2W70A 3FF4A 3FTEA 4NKRA 4CXMA 2JEYA 4WKBA 2CLIB 5FFMA 4DV0B 3OOWA 2QSYA 3GGPA 3K5IA 4Q4HA 5E6RA 1UBMS 3G2QA 4L4SA 5I51A 4OI0A 5KTRA 3RG2A 1QIDA 1KMHA 4KMOA 1SRRA 1TD1A 5I9IA 3DMFA 3U81A 2Z6UA 4BVGA 3BE4A 3K92A 1DC7A 3F67A 1L4NA 5AXCA 1PR4A 4OJKA 3VYUB 3GJYA 4CKCA 3BRQA 4E2FA 3HCBA 2RMKA 1HNZB 2O5EA 1BFKA 3JSAA 3UBMA 2GTIA 3WAGA 1BCRA 1SWWA 1G0NA 3DM5A 1J8DA 1UXOA 1Q3TA 1W30A 2C97A 4CG0A 5EPEA 1D2RA 4CM9A 4QOSA 1VM6A 2ODAA 3HXPA 1MX5A 3FB4A 3L0OA 5CNKA 3GXOA 5A5DA 4K7JA 3HCDA 1Z8HA 2EV9A 2V7TA 3QLVC 2PSFA 4HDOB 3BZBA 1SXGA 4NYIQ 1D7AA 4R6WA 2W2VA 2ZR7A 5HJ2A 3W5BA 2NP7A 2FAXA 2OO7A 4KMSA 2P2ZA 1A1SA 4V0NA 1JX6A 1VHTA 3AL2A 3SC2A 3T54A 3GLIB 1N7JA 1E0SA 2H2IA 1TPZA 4BLRA 3NMUF 4AY3A 1TX4B 5U1PA 2WMNB 3NC1C 1U6IA 2OXEA 4K9RA 3SEQA 1E3QA 3ORFA 4XQ0A 3HUTA 1I6LA 3JQ8A 4V24A 1VZ2A 4CEJA 2B1RA 4PWYA 2VSQA 5E9JA 1FZQA 4ZQGA 2OVFA 2XNHA 1RFLA 4I1PA 1A5TA 4EG6A 2GCOA 4B74A 3V1TC 3L7JA 1KC3A 2QUIA 4L2IA 1HDYA 2H4JA 1YOVA 4AJOA 4KAAA 4YJHA 3RBZA 3B82A 2G08A 5CH3A 1IJEA 1W2GA 1GTL1 3HGTA 1E92A 3VYSB 4WY2A 2O0LA 4TM8A 3ONWA 3ESQA 2CYCA 3ONNA 1D2GA 3EUEA 3Q5DA 4L8LA 2DWUA 5ELMA 4QHYA 3NUZA 3DXZA 3LWDA 3AK4A 1NYQA 4BIMA 1J39A 4DDKA 4F9TA 1TVEA 4L5BA 4I1IA 4WW0A 2XCUA 4E07A 2E4AA 3O31A 1DG3A 1WDWB 2G4VA 1L8AA 5ALTA 4AT1A 1C1XA 1QFZA 3JYOA 2XWJI 4AJHA 4DPLA 3KEFA 1E79A 3WLLA 1L0BA 3C7CB 3W8NA 3TZCA 1VTKA 3L8ZA 4P83A 5IUJC 4REMA 1PSDA 4B4WA 4IVNA 4I1VA 1LS1A 1LLCA 3KQQA 3WGQA 4YALA 2C03A 2UXCB 4MMXB 3ZHCA 1I5RA 4MYRA 1X7ZA 4LRXA 3HM9A 3OPQA 3W8RA 4DSOA 1P2TA 3WFJA 3FF1A 2IZ6A 1Z7WA 2IXFA 5L3SA 1X1AA 2W00A 3ZCPA 2ZB3A 4HB4A 4KPUB 5I5EA 1FDOA 1BQ4A 2B8WA 2LGJA 1WE2A 1M2FA 2WJIA 4P31A 3OQNA 3OPVA 4RO0A 1E89A 3DMRA 5FTNA 5BSUA 3U49A 3FR8A 3HG7A 4GH5A 4QFCA 5IX8A 4JLWA 4QRIA 3KSDO 3UGKA 1ZI9A 2NSLA 4DR3B 2H9YA 1PU2A 3C45A 1EJ0A 4YWJA 4ZJZA 3JQBC 3UF0A 1RMQA 1G16A 5D2CA 2ONJA 1OAOA 4RIHA 1EK6A 4ENUA 4YT4A 2J3MA 4I55A 1MO4A 2O7QA 1CRWG 1ZRSA 2WMOB 2Z5LA 5DTEA 1IAQA 4Q9LA 1BKDR 5LNK6 3LYHA 1AG9A 1VJRA 4RD6A 4REQB 2QVCA 4WDRA 4CL8A 1KYWA 5HNKA 1GTZA 4FOPA 4AZ0A 4DCTA 3N3BC 3GN1A 3SXUA 4GM4A 2QXTA 1MF7A 4YV0A 2HU2A 3O1JC 3WGOA 1Q1EA 2FTKE 3KPYA 4UE6A 2FP3A 5T4HA 3WJAA 3DZIA 3O9MA 4Q66C 3DYIA 1A9TA 1PWYE 3IA7A 3Q6MA 2FW7A 4FBGA 4FFNA 1D0SA 1N9GA 1L5VA 5I4KA 2WPNA 4P5EA 2ATVA 4JI5B 2XXBA 3AHIA 5E8JA 3SLRA 3X0DA 3LRTA 4UM7A 1KYQA 2AOTB 2IX9A 3NM6B 1YE5A 3O92A 4MICA 2I4OA 2DFPA 3H18A 1ITZA 1XTQA 5G0WA 2DQKA 4BMYA 2Q5JA 5CBPB 2QTLA 3DJFA 1FP7A 3FVQA 3ZBPA 5LBIA 3ZWMA 1A9YA 1N8SA 3RIMA 5B7QA 5B7NA 3DE6X 1GGHA 3H6KA 3IPAA 1J25A 3KVYA 1UBHS 1YJQA 3GT3A 2ZIFA 1Q0HA 1BWSA 2OESA 4FR2A 4FYMA 3NOOA 1J8YF 1FE8A 4LWZA 4LQ4A 1V7QA 1UXJA 1E1DA 1TC1A 2C77A 1WZNA 3OJEA 4OB8A 4Q16A 4TT8A 4Q9IA 3R7AA 3RB8A 4QO7A 4GZ3A 4C7OB 4DJEC 2XTZA 3OCVA 1KIAA 4MWOA 2V6FA 3FMVA 4M1WA 4HEA1 4DARA 3GF4A 4F5EA 2FZVA 4ME6A 3SYNA 8AT1A 1FUKA 2IODA 1SXJC 3MIZA 1XHEA 1QZXA 1P0CA 3RC2A 3CVUA 1RWOA 2QM7A 4CM5A 4DXAA 1S2DA 2H3EA 2RIRA 4JAVC 5L6LB 3DLAA 3C3WA 3FFBA 4QLAA 2QX7A 1XHLA 4DJAA 1C0IA 3IP7A 3L1JA 1I4LD 3V2HA 1T5DX 2ECFA 4M1YA 2DLNA 2WF6A 1IZ0A 2ECQA 3DXXA 1PNTA 3OIVA 1NI4B 2W6JD 1FNMA 3D1JA 4R8SA 3C8HA 2I6SA 3WK8A 1LKZA 4R9RA 1HFWA 3UJHA 3WDMA 3U6KA 2QM0A 2OZEA 3OTHA 4AC9A 3R5HA 5CYPA 5JS1A 1C4WA 2HSDA 3D43A 3MWDA 4BV2A 4EYOA 3RTAA 1FDIA 2GPWA 4DV5B 1ZINA 5BVHB 1KMIY 4JFAA 1V8ZA 3LC2O 1DADA 2VTBB 3ETCA 1E9EA 1KO7A 4NZOA 2W2TA 4FX5A 3DTTA 1GQ2A 2Z6QA 2HU8A 1KBZA 4MGKR 1L2TA 2N9UA 3O1HB 2EDCA 4OHUA 5KNDA 1GNRA 1EXWA 4K46A 4IZIA 2EJBA 4R6XA 5CLIA 4ZO7A 1XQWA 4FT2A 5LMNB 1I9GA 2BFMA 3RJMA 3L6EA 4DYHA 1XAIA 3T9AA 3VUEA 4DV3B 2B1IA 1V7PC 2PSSA 3KUUA 1J2JA 2PDAA 4FHGA 4S24A 4OHZA 3F98A 4EABA 4MCJA 2CFCA 1N3YA 4Y0AA 4OL0A 2EW8A 2CMHA 5FHRA 1AK9A 3DMNA 2C2ZA 3ZCVA 2I6TA 4N0PA 5ISMA 2HFJA 3AFHA 4AO7A 4QXMA 4EFLA 4W5RA 1YRLA 5I7UA 1L4BA 3GCXA 4H15A 5GINE 2P5SA 1FSFA 3I5MA 1EUDB 1F20A 1M1NB 5ARDA 5LQDA 4MW2A 3DZHA 4OFXA 3PNQA 4NJEA 3FCSB 2AMJA 1JT2A 2FPPA 4PYIA 3CKYA 3WWOA 4B3IA 4GMKA 2HA6A 4CI0B 2I2AA 5AKIA 2IH5A 2PZKA 4QICA 4BE9A 1JR3A 1D8AA 2B99A 3ZNOA 4V0ME 1PJLA 3PIDA 5EYPA 1PJTA 3ICPA 4E5DA 3DLIA 3WIDA 2JFBA 1JEOA 2AJLI 3KUXA 3N59A 2NM0A 1O97D 4DMHA 3JWIA 4RA9B 2BFFA 3ZH2A 1AVTA 2DLDA 2PX5A 2WV9A 4MLCA 2AK3A 1UWLA 4O4IA 5AVRA 2GFIA 3O7MA 2PD4A 4JJ8A 4B0PA 4EX6A 4A16A 3G88A 4NSNA 1MC1A 1E1QA 2IBTA 4E1VA 4CEHA 5DP1A 3G89A 2I4MA 1WMBA 2IWHA 1NONA 5GP1A 4JD5A 3U0VA 4IWYA 3TXAA 4FM9A 4JL6A 1Y8QA 5AFSA 5IDWA 1V1MA 3GIDA 2Y8EA 4CBVA 3EVCA 4GM1A 4IIJA 2GD2A 2ZULA 3HZHA 4BFCA 5K8IA 4LQCA 4QXPA 4UEQA 1AHIA 4R31A 1R50A 1GG2A 4Q6BA 1SK8A 1YMVA 1YQTA 2H08A 5EJEA 4V1CA 4HH0A 4QDTA 1KQFA 5FNVF 2DF8A 4HEA6 4KO2S 5MDHA 2YWXA 3FTFA 2XBLA 5ILGA 4WOJA 1R0YA 4US1R 3DG9A 3NNDA 1HQCA 5HIAA 3B78A 1Q50A 2KE5A 4OU5A 4TLLB 2QMZA 4U9HS 4UAGA 4CM4B 5GIOE 2N46A 4BMXA 3SHQA 1D0IA 5HRAA 2JBAA 4RYDA 2OKGA 1XE3A 2PWZA 3UKJA 3EPHA 4PRLA 1HDGO 4DVJA 1U0EA 3G1TA 3ESBA 1N5DA 3T1VA 3A2MA 5GV7A 3HWSA 4NNJA 3W5CA 3RO7A 3UEOA 5FULA 1GPYA 4LWPA 1VCIA 3WLKX 2G76A 4KUGA 3FH0A 1DUVG 4AM8A 2R8EA 4BQFA 3DPSA 5JYDA 1Z26A 1QBKC 2F9FA 3FYCA 4HC4A 1ECGA 2YOFA 2YYZA 3WNDA 3Q7IA 2PUCA 3NHRA 1CWUA 2R7AA 1JMVA 3A3PA 4IUDS 4EKGA 5C46F 2Z09A 5JHGB 3UK1A 1FVXA 2IUUA 1C1YA 1UJNA 2ENWA 4WPGA 3V55A 4HDRA 4Q9DA 3KEOA 1QIMA 4NQRA 4EUSA 1FU8A 3NHAA 4N65A 1PV4A 3WQSB 1ZN8A 3C3DA 4DWJA 1MEJA 2O2XA 1SUBA 3H1AA 3BORA 3D0QA 4IS3A 1E59A 3KJXA 3O4FA 3O4IA 3KETA 1IUNA 1U98A 1KRHA 2O1EA 1R10A 1GAJA 1EXMA 4F60A 2Q9BA 1AUQA 2WY2D 5CVTA 1U8CB 3FYUA 4CM1A 4KQHA 3VA7A 2E9SA 1TRKA 1UFKA 1F4VA 1ENYA 4I4LA 4O6VA 4WOBA 1KEWA 2P6NA 4DS3A 2FUG6 1WIWA 3OQ6A 4FFWA 4OL9A 3TW0A 4BNYA 3PD7A 3K0FA 1DFGA 5CJJA 1EMDA 1Y3CE 3UJPA 3KR1A 4QOIA 2EAUA 2QOEA 4IDNA 1UM8A 2EHJA 3L0BA 4X5OA 2Q5OA 3THRA 4NESA 4PLFA 3MSCA 3QLTA 4QXRA 3W8DA 5C8ZA 4LJ7A 4CR7A 3LU1A 1WMFA 2I65A 3BYZA 1KDOA 3LVFO 2JFZA 4RLHA 1OTXA 2EFDB 2GVNA 2JS7A 3CRW1 1DKRA 3MIIA 4M60A 3RCBA 2ZYIA 4J1TA 3RHFA 5AW2A 4CR6A 1K8ZB 3AJ8A 3EUWA 1NLYA 1OBFO 2L0XA 3EXIA 5E2BA 5F35A 3EGVA 1L5LA 4MA0A 1Z2DA 2QW0X 4R1TA 4NYJR 3H4IA 3AP1A 1T2VA 1Q22A 1U9CA 1JYSA 2B4KA 3GFSA 2FEPA 3EWSA 4L50A 1YDWA 3LX5A 4IGIA 4N0DA 1NVGA 4WXHA 3WHIA 1G5QA 5IWCA 2ZUTA 1KWGA 3FCYA 4ZVTA 1ZP6A 3A9TA 4FLFA 3KE9A 4XM0A 2OA0A 1YBVA 1AQ6A 1SC1A 2Y1EA 3BXGA 3CWCA 3F7MA 1RDFA 3LY9A 3GGCA 5IAGA 2PUGA 2FEMA 3K6JA 4CIBA 1BE0A 1DRUA 2IPNA 2ST1A 2X4LA 3PKZA 1VRVA 4I8XA 2G80A 3UPDA 2HWXA 3GJ0A 2F6RA 4UEKA 4D9KA 3IHTA 2ENUA 2E1PA 3S55A 2F43B 2JCBA 4TQGA 3QXXA 4P81A 4CQLA 1I4DD 2OG1A 3ERCA 1D0VA 2O54A 1SZJG 1RC1A 3L6CA 2X9VA 4U2GA 3WL3A 5EJ5A 3H4VA 4G0VA 1NBOA 1UKZA 1X8LA 3B6JA 3DLTA 2QMHA 3FKSD 3GVPA 4J0HA 3CB4A 4A2CA 5LU9A 3GRAA 3EFOB 2WIDA 2WD9A 1U0NA 1KU0A 3O8NA 4JLSA 4AO8A 5K01A 3QVXA 4UM9D 4LGCA 3WK7A 1K7SN 4XARA 3LNCA 3I61A 3K71B 3QRWA 3ZYCA 3TTVA 3WGMA 2DAPA 5JROA 1UADA 3U7RA 3O26A 4GM0A 4JP8A 3TUIC 1VCNA 1F8FA 1MJNA 1YQUA 3P2KA 5TQ0A 1M83A 4PE5B 1XU4A 4MIKA 5DT2A 2DCUA 1SVUA 4CLXA 3AY0A 5KVSA 4URFA 3K6KA 1ZUHA 5IXYA 3PEYA 3EWAA 1EFUA 2ECOA 4UCFA 2KI5A 2JAHA 4ZKEA 4O3MA 1PFUA 4DT1B 1H22A 1AT1A 1XI2A 4DQDA 1BHJA 1UJCA 1AKVA 3FBWA 1JFVA 1GUAA 3BA1A 1BXGB 3F78A 3W5HA 1IM2A 4LY9A 1OCEA 2DQSA 4Q1DA 1Z5GA 2ETXA 1L1FA 3VI3B 1QH9A 2W9XA 2MYNA 4RZQA 3EN0A 3ICOA 9LDBA 1EFDN 3N8HA 3T1HB 4Y6OA 5TT0A 2I3DA 1DJOA 4W9NA 5KOIA 1RHMA 1V8FA 3I9V6 5FAKA 4LHWA 3HEAA 4KBFA 3RFFA 1G8YA 2FX3A 2WT4A 4INAA 3K9HA 4H77A 3TIFA 4PW0A 1J2EA 2AIRA 2G7MC 4W9NC 1RYNA 2UZIR 2A5JA 1E3EA 5SZIA 3RFXA 3WGUA 5BUSA 5HUHA 2IUSA 1BRMA 1T3HA 4RY2A 3TE7A 5AK3A 3CRMA 1DX4A 4ZT6A 3OX3A 3RS3A 4B7UA 721PA 3O21A 1NYTA 2QUKA 4R83A 4JVSB 3NTXA 1NV9A 2JIPA 3FROA 2YFKA 1IEQA 1HE3A 4HFMA 4CMKA 1PFQA 5CCBA 4YDSA 3NX4A 1ZRMA 5IJ9A 1MDBA 4ZI7F 4M2LA 5B55A 2QTVA 2EBHX 3PL1A 3GEGA 3W5UA 5AI6A 4IHQA 4MR8B 1ECFA 3L43A 2WR8A 3LQ1A 1Z7GA 4CMIA 4EITA 2MDTA 2FPUA 4M83A 4CTOA 4ZCPA 4DN6A 1M9NA 4Q4AA 1GR0A 1NC1A 2C78A 1C30B 1TM4E 1X0VA 3E9NA 3QM1A 2W6IA 4WV3A 3SG0A 4C76A 1W0KD 5TT1A 5KNCD 2QM8A 1YXMA 5DLDA 1V5GA 3DO6A 3P7MA 1DBVO 2MSEB 5SZKB 5DM1A 1ZD2P 1CHNA 3AINA 5FNZA 1W1WA 1XP5A 2IXBA 1ZD4A 2PANA 3LH5A 3J80A 2AOTA 2NSJA 5AXDA 1R4ZA 1O57A 1NPYA 3LDUA 4LXHA 1S96A 2NTJA 4R41A 1EBUA 5IG2A 5CNMA 2OSBA 3LT1A 4YQZA 3T38A 3A2LA 2ZQZA 1Z62A 4UNRA 1DTEA 4P7KA 2AMLA 2ZRIA 4OQMA 5C7YA 4ZDJA 5IBRA 2ZTHA 4UDOA 1IBCA 3RS5A 3NDRA 4IIJF 5JI3E 1CUVA 3PHIA 3ITEA 1HEUA 1KMQA 2X40A 4A2WA 2RCYA 2V58A 3HRIA 4MW1A 4R69A 3GLIE 1P1BA 1NJFA 1E5XA 1AV7A 5HGXA 2FWPA 2VHUA 5I5GA 1RTTA 3D3NA 4GYJA 1NBME 5CGQB 2BSXA 1L9KA 1G6Q1 2PK3A 2H2AA 4I0WB 2J1LA 1FNSA 4X0EA 3RSSA 2BP7B 3A8TA 2EARA 3QG5A 1JG1A 4GWKA 5AOBA 3EBPA 4UOZA 4QDZA 3DH0A 1ORTA 4TVBA 2WTUA 3TTYA 3DHEA 1QX3A 1M7HA 2WE7A 2Y67A 4Z99A 1Y7TA 3WJ2A 2IYAA 4RNDB 2QKYA 4FB4A 2WJ4A 2IXDA 2R5FA 3RF6A 1CNFA 3E9MA 5KDDA 2RH4A 3KXIA 1BVHA 3L4BC 1JB9A 3EQ9A 2ACKA 4MJ7A 4EYQA 1I2CA 1Y5NA 1PFGA 3PHCA 3PENA 4GKVA 3TLMA 1KJNA 1SCQA 4TTRA 1SQFA 4GOMD 2EZUA 3ICVA 4RWEA 1E4YA 5JS7A 2AD5A 5DWVA 2FDRA 2ZB2A 4XGNA 2P1RA 2KLHA 3T7JA 1Y9AA 4NJMB 1GGFA 1L7XA 3RVKA 5LQSA 1SQ6A 1HE2A 1U6KA 3NORA 3FPBA 4EZIA 2BMFA 5BRAA 3GB9A 4ZD6A 2G71A 3INGA 3ROGA 1IQ0A 5EHXA 4R68A 4PHGA 1SB8A 4EYEA 2C20A 3B7PA 4UUNA 4ZOLF 5TS2A 3HA5A 3R3SA 4I4TA 1E3MA 1W0JA 3R7BA 4PHFA 5DHRA 1YQWA 4EDHA 2CB0A 2QPOA 2ZRGA 4JSRA 4L9SA 3NETA 3N1UA 4HSGA 1EK2A 4QQKA 2JGJA 2Q4DA 3KU1A 5F1PA 2PWYA 4PGHA 5KEIA 3OKFA 3R7WB 5GZ1A 3NDPA 3JD3A 3ZVLA 3JD0A 1HOTA 2CLEB 5CU7A 2IYLD 3TNFA 1MW9X 4OM8A 2VTKA 3TMAA 3K16A 4IOMA 2F4NA 4OK3A 4M1KA 2QVBA 2FMFA 1O87A 1SU8A 1O0SA 3U9SA 4RDIA 1PEAA 3M2PA 4QYMA 4JLVA 1G38A 1AKEA 3WKEA 5J1TB 1RACA 2E49A 1LBIA 2ZIGA 4PVCA 3FMIA 4ZAYA 4AVYA 3PR1A 4DL9A 3PIRA 1G5HA 4EJSA 1TAHA 2B0CA 3NHYA 3O84A 4H1HA 4AW9A 4RD2A 4XIYA 3U37A 4J4HA 2R8YA 3KJNA 2YKGA 2VPXA 5KVAA 2FQQA 3OCXA 3JRXA 1MRSA 2WAAA 3MJEA 4JEHA 4ZQCB 1EX7A 1OZFA 2QS9A 3BN3A 5LQJA 3TAXA 3FTQA 2H17A 2B1JA 2IEGA 4NHEA 4HUTA 1YNOA 2PYDA 1ZMOA 1WBDA 1Y4AE 2IP4A 2BLNA 3ZBTA 4XUEA 3W9UA 4OHMA 4YV7A 2UUOA 5DNDA 3Q8XB 4G1FA 1G21A 5FADA 5A0FA 1J09A 2I54A 3U3OA 1FP6A 2BTQB 3RAFC 1JZSA 2LR0A 4R9NA 1UK6A 2ZSJA 3BFXA 3ESZA 3FYSA 4PYKA 3TG8A 2REXB 1D09A 4BNNA 5EAIA 3UXMA 2YVLA 5JE8A 3M5CA 1Z6TA 4KGXA 5KVQA 1E4EA 4LXQA 3RWOA 5KZMB 2IYPA 2HWWA 4R1NA 1UKBA 4TS3A 4UKDA 5JBIA 4HG2A 4BKOA 2VF4X 1INLA 1PG2A 1Z8NA 3PCRB 5HKBA 3FMPB 5JCJA 1RXIA 1HDRA 1AKWA 3R8CA 3HU1A 2QX8A 4K6HA 3LL7A 3EPKA 3ODGA 4OTZA 4PPYA 2XCIA 2P6UA 2VDOB 5KNCA 1HRKA 3OM9A 5EE0A 5FO0A 3GL9A 2BGJA 5AVXA 1CETA 1U2SA 1KAEA 2AQKA 4WASA 3RS9A 2GO7A 5LBUA 4XYLA 2A57A 2WJYA 3LK7A 1P9NA 1N9KA 3IYLW 3C5VA 2J5XA 5JI2E 4P54A 1U63A 3OJOA 4G4SP 4ND7A 4P3XA 3SR3A 1Q1AA 3HN2A 4DIKA 2PTGA 1DI0A 1QCZA 4M21A 4ZDKA 1SXQA 3HL4A 4HTAA 1RSZA 1SU6A 4QYTA 5K0CA 1XTJA 1GPKA 4F46A 5ALDA 4RJTA 1M10A 4AYWA 3IOEA 2O8FB 5IF9A 2PUEA 4B7AA 5BQFA 1J2YA 3VGJA 3NG1A 3VI4B 1JQKA 3HLTA 1TUGA 4Q19A 4ZIRB 5TGDA 2I6XA 2YV1A 1U5BA 5C1PA 4K9MA 1N2BA 4G6ZA 4JP2A 4RUKA 4U6QA 4XPIB 2EP7A 3AJ9A 3GPCA 3KBOA 3UW3A 4MULA 3KEMA 4KV9A 3T3OA 3WWDA 2Q3LA 1ZJ6A 1I0IA 2AHRA 2O4UX 2YYSA 4FMDF 3RGGA 5IKMA 4US0R 3EBOA 5K8JB 2B1QA 3P9ZA 4X6UA 1EFAA 5U4XA 4U0JA 3FNGA 1W5SA 3L7NA 1OU0A 1PJSA 1C81A 2QZPA 2UDPA 4F7WA 3HBMA 5FL3A 2FDCA 4D6XA 3ZKAA 3PWSA 5GM2A 2VSNA 2GHQA 4O4HA 4OBEA 2EJWA 3CG0A 4M87A 4IUBS 5DK4A 4ZQIA 3N28A 5BQPA 4EG1A 2RK4A 3I23A 4BPBA 1C2TA 3HJCA 3L01A 2BR5A 2PBRA 1XYVA 3OT1B 4GOND 2DUJA 3ITDA 1BN7A 2OLKA 4HNTA 4PSCA 2IYSA 1Q92A 3W4KA 3OPYI 2PVSA 1FTSA 2QTZA 5K3AA 3ISVA 1P1JA 2J09A 1U9ZA 2LKCA 3NW9A 2HJGA 3HWRA 4I4IA 2GVDC 5C1IA 1IULA 1SGWA 4WFIA 1HO3A 3ILXA 1D6SA 2A9RA 2R48A 2WHPB 1CJMA 2MSKA 3WNQA 4F71A 4IZHA 1W36B 1PJAA 5ALWA 3UYKA 1CS0A 4JLDA 2NPIA 4HO1X 1ZM9A 2PX8A 2GEVA 5BW4A 3QVGB 4J29A 4P33A 2WKPA 1WZ2A 2X5NA 2FHSA 3IALA 4QAJA 2DG2A 3RGWS 3SBEA 1UMDA 1G7TA 4RPJA 3MPOA 4WEQA 2A9QA 3QEAZ 2BFFB 1YK1A 3DKRA 3WK6A 2IYFA 1YT5A 3WSWA 1E20A 3NEPX 4Y2PA 2JAWA 4UASA 2A59A 2EFEB 2X42A 2DQZA 1SXJA 2KYRA 2HK9A 3FBGA 5G1PA 3TQFA 3JZDA 3PPWA 1EFRA 5I4IA 4QQRA 1EFTA 5ECGC 2Q0SA 3KYCB 2X3UA 1OWNA 1DSSG 2AF3C 3T1NA 5J23A 3WNBA 5NLLA 3OCYA 4FWIB 2QNRA 4BLPA 4ETMA 4R9SA 2H5LA 1GDTA 4N12A 4MTLA 5FTLA 4GIBA 3SBXA 5IT5A 1MB4A 4DOMA 4ECAA 1ICIA 2IY8A 1NBHA 4J7CA 1V5EA 2REOA 5F1YA 5CLJA 5K0BA 4L4RA 5CYFA 3WB9A 5F2EA 1R66A 3TSZA 3BHMA 3K1JA 2ZJ8A 3AVQA 1QGDA 1FMLA 5L7YA 2GUGA 4C1BA 3AR5A 4HEHA 1B7GO 1RW4A 3CLVA 4NPHA 10MHA 3WLOA 1PZGA 4KQMA 4OUKX 2QI9C 2F43A 1U8XX 3VBEA 1IHUA 1SHUX 1XEXA 3U7HB 1GA1A 1UP4A 3CEHA 4NC9A 2C9CA 2ODPA 1W76A 2ZYDA 3BL8A 4XVCA 2HJWA 4D46A 4KAXA 1JEQB 1K1EA 5KNCH 5EZYF 4BNZA 4NBWA 5KCMA 1RPZA 4KP7A 4N4AA 3TZBA 1JBEA 3ECCA 3ZDBA 1JRLA 3G2KA 2NUAA 3HQ4O 1V11B 2H7VA 3DVAA 4MWCA 2JGDB 1GUFA 3W04A 3I83A 2XEXA 3RRJA 5JQGA 3DMGA 4XX1A 2WD7B 1PT8A 4KK4A 5SYAA 2HRDA 1MJGM 5EZSA 2BBSA 2WF8A 3PNBA 3HA3A 4L0QA 4XFKA 3VX3A 4S1TA 3SQXA 5G02A 5LPNA 3KOUA 1F51E 3F73A 2CJFA 1BSVA 1Y34E 1Y48E 2IL1A 4UBJA 3MWYW 4TXHA 3BKWA 2I80A 1VMEA 1XB2A 1Y3AA 1MBZA 4DUGD 3UWSA 1T1JA 1ZCFA 4KGDA 4HWKA 2DGDA 3FKJA 4F56A 2IELA 1FLDA 1VMDA 3D8SA 1MEOA 4Q6WA 5JO0A 4BCDA 1FFSA 1TEVA 3TL2A 3AERA 1G98A 2XX3A 1JILA 4MV8A 1LUAA 2AN1A 3KJFA 4DTCA 4HWOA 3IUPA 1H4TA 4F4FA 2I1WA 2V3VA 1RADA 5EP4A 5ILQA 1UP7A 2UYQA 3AL3A 5AJUA 4YAGA 3FJYA 4IWXA 4KQ9A 4PTYA 5HX7A 2NAPA 3L0CA 2C7QA 1UWVA 3L4EA 1BEZA 2PS3A 2XVAA 2ZJAA 1BH2A 4IKEA 5IUKC 1XTRA 3C6MA 1GUDA 3TSAA 4PVDA 1OXUA 4LIPD 4JHLA 3LDGA 5LCXA 3TN7A 3KQLA 3PCTA 3ZNPA 2QD2A 3DP9A 4O2LA 5DBOA 3I05A 3AVPA 4ESOA 3GCDA 3GJ6A 4G37A 5M7EA 1JPUA 1OZHA 2QT9A 1MRNA 3G2OA 3QFFA 4I5EA 4BTEA 3SJZA 1PWZA 5HTKA 1COZA 4KXUA 4E30A 3NYIA 4OP3A 3IVXA 2WJHA 1JKJA 5FOSA 1DCMA 3CY6A 3TRIA 4HYTA 4NAHA 2C00A 3T7EA 1YS6A 3MTGA 3SK0A 3KZ1E 3FR7A 1QWSA 2H16A 2HNBA 4GSKA 1RRGA 3MHPA 4J0KA 2OAGA 2YN2A 2NT4A 4LOJA 1NVDA 2IOYA 4UE3S 1ZJJA 4DBZA 2EFGA 4HXYA 1ABBA 1WCV1 3HNOA 3IEKA 4ZT3A 1CIVA 2CN1A 2KS6A 1XZAA 2YQZA 1SULA 3I1FA 4UZEA 4V0RA 1II9A 2A78A 4N1AA 1P61B 2FJPA 4PZYA 1E1QD 1CUSA 3QUCA 2P9TA 2ZYTX 3IP5A 1EINA 2AI2A 3B48A 3OJCA 4TL7A 3A1TA 4I1OA 4HDSA 4NMXB 1QGUB 2HJ9A 4M1OA 5KYYA 2R84A 4E31A 2QP9X 3WLJA 2ZIAA 1M6VA 2FQWA 3OUZA 3PKIA 3TR5A 4FGSA 5HF6A 3HO8A 4HAYA 4HWRA 2OYCA 4XX0B 1YVEI 2O05A 1NYRA 4BLQA 1WHSA 4DYDA 1YRWA 4ZTUB 5EPOA 5C5EA 5CX1A 1IU9A 1JR3D 3R3XA 3F0TA 5C1BA 2KJQA 1WSDA 3JPYA 1C8BA 1QDEA 2OHOA 3RG8A 4RM2A 2FFRA 1GQOA 3OEHD 4W1SA 2ISSD 3GD5A 1LSSA 2EFHB 1T2AA 5LP6C 4RMNA 3L0ZA 3PUYA 4MQEB 5THKA 2XKAA 3AHGA 1JG3A 4RD3A 1UEXC 2PRZA 5GONA 1T5IA 3KD2A 1QIHA 4WK6A 3QLEA 1B76A 1CUYA 4CKXA 5B6PA 1XRRA 3KJIA 4WCDA 4Q4JB 3TDMA 4QNMA 5JAZA 1VKJA 1W36D 1CCWA 4R5MA 5CFRA 3ZR4B 2J9FA 4G8BA 3AKEA 2P90A 5DHTA 5FOXA 4C04A 1R15A 1QO0A 2Q5LA 2JZCA 4MQMA 5AKJA 3H97A 3CH6A 4IIDA 2LE0A 3K9CA 3TM5A 4IV5A 1L9XA 1YCGA 3IVAA 1USWA 2G82A 3QXCA 4AX4A 2FXIA 3HU3A 1Z4PX 4ZKDA 4UU0A 5F3RA 3ET4A 2JEZA 1ZZGA 3L9WA 2B7BA 4TT3D 4AS3A 3RVMA 4Y18A 1LWOA 3TZ6A 2V7GA 4TS1A 4EGCB 1XA0A 1LPPA 2FZKA 3EVGA 1TYCA 3CRZA 1E1KA 5D1NA 3VDXA 4J0IA 3VPGA 3H5IA 1EU1A 2DFLA 4H6PA 1JJIA 3BWBA 2Y1DA 5H82A 4WKOA 5IYZA 5KTNA 1ZEMA 2NYVA 5FPYA 5JSUA 5TLSA 3CUTA 2DM6A 1ECPA 3RR2A 1V8OA 1C3EA 4I66A 4BNTA 4UTNA 4DLVA 4TKUB 3B13B 3WYCA 1TMOA 1HFJA 4F9GA 3K1ZA 1ZIDA 4R1OA 4UD6A 1GO2A 1Z6PA 1MJFA 3EB9A 3TLJA 5BN3A 1RWKA 1WW8A 3M0EA 5B36A 1XU7A 2HTEA 3V7UA 1P75A 4TKVA 2LVBA 5EQTA 7REQA 4A10A 1JS1X 1VC2A 4YLEA 3PVZA 3NVKI 3BHJA 1PEKE 5LP6B 3AHCA 1YOVB 3EYWA 3E9DA 3IT3A 1E2GA 2F90A 3I6IA 4HNAA 4OLHA 1FQJA 2A9FA 3TPCA 4BRUA 2W6PA 3I45A 2P3LA 4E5NA 1P1CA 1HLGA 1YRAA 2B4TO 3KCQA 4IRMA 1JDVA 4FLEA 4KEAA 5F7ZA 3C4VA 1GM5A 4IICA 2ZVDA 3WRWA 2YZNA 3OQPA 3CR8A 3P52A 2VP5A 4NAVA 1VE7A 1XHFA 3D31A 2P0EA 2NP6A 2BV3A 4BVLA 4C9BA 2ZB7A 3B9RA 1C41A 2GNOA 1Q12A 2QWXA 1K5HA 4HDAA 3A9UA 3P0RA 4JYCA 3CWZA 2C4TA 3HYCA 4YIHA 2HSEA 4QYIB 1ZLXA 3AR9A 3W3AH 3BGSA 4GL4A 1DOHA 4A1FA 2CE2X 4GVXA 1C3OA 1M75A 3H5AA 4FOSA 4AF6A 1X80B 4JYAB 3V4SA 1OYVA 4IXTA 2Z8ZA 3CLUC 5H1YA 4LDZA 1GRQA 3IAHA 3VKVA 3OTWA 1NASA 4R2MA 1I3LA 2O3SA 2XMPA 3ZWCA 4OFZA 3ZIUA 1SUIA 4EOGA 1A4XA 4O33A 4ZVQA 4MHOA 4QT4A 3C97A 1U90A 4B3FX 4JLPA 1DQNA 1N0UA 3NV9A 4I4CA 2VJMA 4OU4A 4PYLA 3EZGA 4IR7A 1KP9A 1T0HB 4KYTA 3G2IA 3EF1A 1EJ2A 1PZHA 1OX4B 1PJ3A 2B5VA 2QMOA 3KB1A 1GQRA 2IYUA 2PSEA 1KP3A 2QLBA 1MAHA 4L9RA 4CFSA 3GCZA 4KYUA 5CYOA 1C9EA 3M1YA 1GLVA 2O06A 2YMPA 4MPPA 3FYDA 3B9PA 2NUBA 1D9XA 4X7MA 4ED9A 2CSXA 2QQ5A 3ETJA 4QBTA 4ENPA 2Q3EA 2P40A 4H18A 3D8RA 5B3AA 4E5VA 4E14A 4YJGB 3ADDA 3IUYA 1JQDA 2BFNA 2QUHA 3W9YA 2V7QD 4EG7A 3JYPA 1DC5A 1XPJA 1V7CA 3PC2A 1B0ZA 2OYRA 2VXYA 1G1AA 1P2UA 2E48A 4B0OA 1JGTA 1YBHA 3CNQS 2Z3ZA 3B1WA 4AMYA 2WFLB 4KVFA 3DTVA 4EFMA 2W4MA 3E2IA 1T9BA 1XF9A 3SF8A 4GOOD 5J2UF 3I58A 1RD4A 2JD2A 4F96A 3I34X 3DTVD 2MSLA 4X1IB 4YUYA 4GVLA 3RS7A 2W42A 1Z4MA 1VYTA 2R0QC 1P6QA 2BHTA 3G0BA 3PKJA 3Q9UA 4J3JA 2R00A 3SD7A 2ACEA 3T5PA 1C0EA 4GFDA 1A1VA 3S27A 1LVUA 2CLOB 2OHGA 1NJ2A 4TM7A 4W5WA 1W1UA 2COUA 4C7XA 1A82A 2GCPA 3DBVO 4PZLA 1SQGA 3F8TA 4M88A 4EEZA 4HGNA 2O59A 1MA0A 1VE3A 4G4GA 5FPKA 4RK4A 4UQPA 2Z8XA 3GQBB 3EGCA 3SOPA 1V0JA 3TL3A 4LBYA 3D7SA 2HD4A 2D8MA 2PZMA 1RRVA 1VDMA 2FR8A 4QXOA 4QX6A 4WCFA 3W78A 4B48A 2Q6KA 4GO1A 1SXPA 4IH9A 1IATA 3C1TA 4IEIA 4P7FA 2B78A 4PRYA 4XYBA 1H1LB 2EKDA 1JZTA 4IGEA 5F3WB 1E5DA 2IUEA 1FS5A 3P1JA 1Y3BE 4OYLA 4ZARA 2YXDA 5JECA 5AI9A 3AIOA 3MOSA 3NWEA 3O4HA 2JZNA 2BUAA 1H3FA 4G5SA 3OP1A 4ZV7A 2EFJA 2SKCA 2XYQA 2GLTA 2J3JA 3C15C 3I52A 3LTEA 2I99A 1DINA 3OJLA 3ANXA 2C84A 4QOHA 1ETHA 1FFBA 2GFQA 4ZT2A 2QLJA 5A0VA 1EFCA 4Y9UA 3WDLA 2Y9MB 3ZK9A 2PUBA 2XBUA 3L18A 4WFKA 1NAIA 1O6GA 2OORC 1M1YE 1G9TA 2OCYC 2QTNA 4RAQA 4EGAA 2PZEA 4PGAA 3DAHA 3S81A 1C0KA 2WM3A 3LCRA 4B4DA 1EQ2A 1U1EA 4MVJD 1QS0A 2ZIXB 2YWRA 3E9QA 4R7ZA 2OTCA 4Z0PA 3U7EB 1HBJA 2Q1WA 2J4CA 4KDEA 2WQ7A 2ZI3A 4PCLA 9ABPA 3RHSA 2VXBA 2XRYA 3B1FA 1Q20A 3GV0A 1EIWA 5FWYB 4FDUA 3DVRX 1VKOA 1RYYA 3F3SA 4MO9A 4ALJA 3OZIA 4XQGA 3V8QA 2E3JA 2ZUVA 4BNGA 5JQWA 3DT6A 4E3ZA 4YC7A 3HV0A 1AV6A 3P26A 5K8LA 1Z35A 2VAWA 4HEJA 4F5WA 2HMSA 4WX2B 5TC4A 4S1WA 4OKNA 3VR4H 1HYQA 4R1SA 2Y0PA 2ZPAA 3A7EA 4ZVOA 2HLDD 4MSUA 4TRJA 3CKKA 3LOQA 1Z47A 1U0RA 4OJYA 4CFYA 3B1XA 3E3OA 4X3OA 2FUKA 4B2LA 3LF2A 1C29B 2PGLA 3TB4A 1RM0A 1RKQA 1VG9B 2YWCA 3GQVA 4FR0A 3V8MA 5JZVA 1QG2A 3DSRA 1I7NA 5H8WA 3OC6A 5GZ6A 4IDAA 2Q99A 4LJ6A 3BXPA 1GQYA 4D92A 3EUAA 3IKVA 4IMJB 3QBTA 3SN6A 5AKKA 3O3CA 4PC3A 3IV6A 2OL4A 1HDCA 5E4TA 1ZHOA 2QVZX 3GROA 1YS4A 3L5KA 3N8IA 2AEJA 2ZCUA 5DBIA 3AVTA 1ML3A 1O3YA 3GT0A 2PPLA 4C0QC 1AQNA 2QLFA 1QFSA 1B6GA 5AHXA 2NTNA 3QITA 1EWRA 1I1QB 2QR5A 5JISA 4K40A 3NI2A 2D7CA 1JB1A 3CEAA 1YR8A 1YR9A 3PUHA 2WICA 3GA0A 4LNAA 1UZUA 3AETA 1YB2A 2Q4RA 2W2MA 2BL4A 3BGVA 1ZIPA 4XLLA 3S3TA 3ZWKA 1OH6A 1UJ4A 2A2ZA 3ANMA 2X5KO 4JLOA 1PR9A 4JXKA 4KWTA 1WD5A 2F1RA 2IV2X 2Q62A 4QOJA 1TI7A 4GYKA 1ZMXA 1RCUA 3LXXA 3V4PB 2I6GA 4PPFA 2DUNA 5P8WA 3H04A 4LBWA 4HAXA 4P0TA 1Z4LA 4Y2TA 1O58A 2G5PA 2QZSA 1C4XA 2YS6A 3KP1A 4M6WB 4RM3A 5EJFA 5EZYA 3ZY2A 1B2RA 4DCPA 5BQ3A 5AUNB 3GJ3A 1Z5WA 4BKPA 5DHPA 4GPTA 1IVNA 4S12A 3DFMA 4DSZA 1HT3A 3M6UA 1FYWA 4P2BA 2ECKA 1RM5A 5T64A 4L5IA 3IO3A 4MKFA 4L0DA 5IZCA 2P78A 1UDXA 3TW6A 1PKEA 1E9SA 2ZEJA 3F3KA 1Z07A 3MF4A 5FX2A 1KQ3A 3NAGA 4IHJA 5T3YA 1Y80A 2G8LA 2W6ZA 2WHXA 1X1RA 5G40A 3GA7A 5GGXA 2B83A 2BM1A 3RU7A 3S1AB 3BGWA 4AJ1A 5GWXA 4ALKA 4Y3UA 5HGJA 3BE8A 4JJEA 2PJUA 3SJAA 4FOOA 5IVPA 2VH1A 1DL5A 1L4HA 3PE6A 1ARZA 3JD2A 1L1EA 3QYFA 1KERA 4TQ9A 3DOEA 1QZTA 3KKQA 4GNRA 2DSTA 2ZIWB 2CBZA 2WUFA 2O50A 3G9XA 1W88B 2FH5B 1WVMA 2KBEA 3PGVA 3NYWA 1D4ZA 1NMXA 2Y1LA 4OV6B 5K99A 2IU6A 3RKSA 5LLTA 1RZ3A 2XQGA 1TYAE 1XELA 4G63A 5CVCA 3TPZA 4DEYA 3GQBA 3TQRA 2ASEA 4N7MA 4NV1A 5T4EA 3LKBA 1G6OA 1UXKA 4L5CA 4BN0A 4WMLA 5IF3A 5AKEA 4HDNB 1CY1A 3S7ZA 4PFQA 4P3PA 1N6IA 2G09A 1U3TA 4M1ZA 3HY3A 3QF7A 1QHHA 1H1LA 1JLLB 4I9GA 3TZKA 5BVGA 1YWGO 5J4VA 1L4FA 2EGGA 1IN5A 2Y71A 3ZH9B 1UBLS 2AFIA 2IYOA 3R0QA 2RKBA 4CQMA 4BVJA 2ZM6B 3GC6A 2BZ1A 5T3UA 1Y1PA 2VT7A 4BO2A 5KHOC 4HFNA 3N2IA 3RRMA 1WTCA 1SUSA 5B1EA 4Z7JA 1GCOA 4BASA 1WHSB 3EVEA 3TRHA 2WUEA 2AC2A 4OQ4A 1M6YA 3DWGA 2FWBA 3B9QA 5H0IA 4QFMA 4GR5A 3IQFA 1CJVC 4YRNA 2R62A 4MDYA 3UIEA 1CEEA 5AI4A 2F55A 1AY0A 1ML4A 2JF0A 3VVCA 5LMUB 3SZOA 1IAVA 3LZ6A 4XW2A 4ZAFA 1FOEB 1VLVA 3USES 1M6VB 1HR0B 1W581 1PD1A 3SF0A 3DWFA 4KQ2A 1N5LA 5KYYB 1K63A 1ISHA 2C2BA 2QX4A 1CY7A 3IHWA 5DASA 3MK31 3R5FA 4B4OA 9MHTA 2WZQA 1NX6A 1Z4KA 3SZGA 5C1DA 3UK6A 3NAZA 2H1SA 5KDOA 2VWPA 4GLFA 2GEBA 5KYWA 5A0TA 2HRBA 4B83A 1G8PA 1RBYA 1QP0A 2ZTSA 3HZZA 1O95A 2WJ6A 3K8ZA 1TAQA 1EM6A 3GP8A 1NJSA 2G5CA 2I67A 2V6MA 5F23A 1UPFA 1VJTA 2BMDA 2EG5A 3OWXA 3LQYA 5AUPB 1OX5A 3KTOA 3WB0A 2G9UA 3CRRA 1N5MA 3STHA 4CCYA 5A1JA 4B73A 5BNZA 1CERA 5DT9A 3UJ3X 1U7ZA 4FHDA 1JWBB 1R3DA 2ZWMA 3ISTA 2YW2A 4P53A 3F1KA 4AD8A 2DFKB 2Z1MA 2Q3HA 5A9SA 1OD6A 2AG0A 3CLHA 4U8GA 1KAGA 3FBTA 4AMUA 1MG0A 3KJZA 3QUSA 1HYHA 3CUKA 4FGLA 4OJMX 3H2GA 1E8DA 1MFZA 5CBKA 3T7CA 2NACA 3G13A 4TXJA 4TV9A 4TV8B 4WECA 5CFMA 3IQGX 5LYJA 5F52A 3U48A 1QKIA 1J1UA 4JFRA 1ECLA 3ZDDA 1MB2A 4IIXA 1K7EB 2OGSA 3GGGA 3ZVNA 3DBLB 1ZJYA 3RYHB 1VYVA 2PHZA 2WINI 2BMAA 1K97A 3KPJA 1HEIA 1KVQA 3S1SA 3K0EA 3GRUA 4G67A 4C43A 4Z4CA 1AKUA 4G97A 4D9CA 4EZEA 4Q47A 1V4NA 1KA9H 2NZYA 2XMCA 5FUWA 2VP6A 1ELOA 2HA7A 2XE8A 4IJKA 1IG3A 2Q8PA 3HP4A 2VPZA 3LS2A 5DHQA 2WG0A 2FB9A 3Q2IA 1QZZA 1T5BA 4RHTA 2X19A 4UNNA 5HSGA 3HDTA 3QU5A 4OXKA 2DPGA 3ZCQA 3I4FA 1WEHA 1B74A 2HPAA 2CYBA 1EFVA 2VSXA 4BUJA 4QATA 3N87A 5FHQA 4L8YA 5REQB 5LNK1 5TIIA 3HJUA 3I2YX 4TTJA 1X2EA 2I9PA 4A0SA 3KJGA 2DVMA 3AFIA 1UKCA 5JYBA 1JWLA 1A98A 3QPWA 1E6WA 3H4TA 1M2WA 2CLCX 2CFTA 4WSOA 2UVDA 4LRUA 3FSGD 2RGCA 2SCUB 4JKOA 4TMFA 3U7IA 2VKTA 1CUIA 3DZJA 3GEHA 4QOFA 1UFRA 3SC6A 5JZ9A 2NUTB 4RIFA 1HG1A 4X63A 3GVHA 3HH8A 3LLUA 3T0FA 2GWHA 2NO9A 2AX4A 4UMFA 3BGDA 1FRNA 2VRNA 3E03A 3EZXA 1MO3A 3JYHA 3M1AA 4GR9A 3KVNA 4UFOA 1EFRD 4I50A 5HF5A 1A2OA 4ENRA 1FDRA 2Q4BA 3L7DA 2UXBB 1YKFA 2D0IA 5JLAA 1TXGA 2ZK7A 2G8NA 2HXYA 3UV7A 5HWSA 5CM2Z 3ZX4A 4X91A 4MS3A 1ULAA 2I91A 1RAGA 2EDAA 1X70A 2O5VA 5BUCA 3TKLA 5JSZB 2O7RA 2O14A 4X94A 2D3TA 3FGNA 3OFJA 2ZETA 3WIBA 4F21A 3HDGA 5E2AA 3WLHA 1DAOA 1D2NA 2AS0A 3T3GA 5C53B 1YOBA 2VQFB 1VHQA 1C9JA 4YR9A 3FIJA 1M2OA 2EYQA 1SUWA 1CBUA 1UC4B 2C7BA 4P4TA 4DNFA 1YI8A 2GO1A 4JZKA 3GEMA 4CIDA 3VX4A 1JEQA 2QY9A 3AGPA 4WLUA 3OMWA 3ROKA 1NPTO 3QNUA