4DA2A

The structure of pyrococcus furiosus sfsa in complex with ca2+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar fermentation stimulation protein homolog
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
molecule tags Dna binding protein
total genus 71
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4da2A01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4da2A02
4DA2A 4DAPA 4DAVA
chains in the Genus database with same CATH superfamily
4R4QA 2VUMH 3F8TA 3K6OA 2JA7B 5G3LD 3BVGA 3OMGA 3S15H 3I4NG 1QVGA 3GTGB 3BT7A 2ZXRA 5C5MA 1A2TA 2KECA 4LK1C 4AIMA 1ENAA 2YV5A 1STEA 1E3PA 1D6EC 4U673 2MFIA 2IJ0A 2DJFC 4NB3A 3U9OA 2G9DA 3TBIB 2L5TA 4DFAA 1S5DD 3NWTA 4LFBL 5C6AA 2JYOA 2R93B 3HS0C 3B6YA 2K01A 2OQ0A 5C4HA 4G6UA 4JYAL 4XYOA 4BBRB 1IBLQ 3KYHC 1U4MA 2QW7A 4RCNA 1SNMA 2XSCA 3K57A 2B2YA 1YIJA 1WTXA 2F3WA 4LF9L 5EJWA 1X65A 1GHJA 1XWEA 2PI2A 4DA2A 1IBKQ 4DUZL 1LTSD 3AJVA 4PMCA 2GVBA 4LMQD 1STHA 3AYHB 2EE1A 4QL5A 4ZQUA 3MC0B 1ICFB 3VR5A 4R4TA 1BXTA 1SE8A 2BE5C 4CDCC 2EY1A 1BR9A 4WJ3M 1V9PA 3D8GA 1Y1VG 1UUPA 2HUGA 1HPCA 2K1BA 4A3EH 4KK7A 4BY1B 5ELDA 3T1YL 4F8MA 2GN5A 5BN5A 3H3VC 3PGZA 3MFYA 1TKWB 4DF7A 3RZOH 3S1NB 4EQ5A 2E5LQ 2NVYH 4WRDA 4PG3A 1SR3A 1LT6D 4HJ9A 2VB3X 4QQBX 5C4JH 2M9VA 3F2DA 1S3OA 4M1UB 4DV2L 4LF5L 1LT4D 2N8NA 4A3GG 1ASYA 3C2PA 4IPCA 4DR5L 4HJ7A 4RAUC 3U9SA 1NR2A 1SXTA 1TR5A 5FLMG 5JJIA 2L15A 5FJ8H 5ELFA 1J8IA 1OXUA 3RZOB 2QF7A 5GADC 3CCRA 1N36L 3A54A 3P75A 2CZRA 1I94L 1B70B 3I3CA 4IUTA 1Q90A 1LTBD 1TWCB 2K52A 1Z47A 4P75A 3J7A5 1X3GA 4QCLA 3I55A 2EJMA 1UNSA 4DK0A 1P16A 3P1HA 1YNMA 1YHQA 5JEAJ 1C0AA 4APVA 2QILA 3S2HH 4BXXG 4EQOA 4K5XA 1K8OA 2A5HA 1MBYA 2JA7G 2EDGA 3JAME 2PMZB 4J1MA 2NZ1D 4R4CA 3HOVH 4CJ1B 3CCLA 3PUWA 5C44B 1PZJD 1BCPB 3MAQA 1CI3M 4DR2Q 2B2TA 4KHPQ 5M5WH 4GKKQ 5HY6A 1T0FA 2DN8A 2KOLA 1TWFH 2VY3A 4QB4A 1JOQA 3AEVA 4YWKA 1FR3A 1QB5D 1PRTF 2NN6H 3PIP3 4LWCA 3S1MB 4UY8C 4DR7Q 4JI3L 1A15A 3MA2B 4A75A 2VW9A 3HEJA 3H3VH 1EQQA 3MXUA 1XPOA 2P5ZX 2WFWA 3GTQB 3TP5A 1E1OA 3F2UA 4GOPC 1NMGA 1IBKL 1HA6A 1GXDC 5IIFA 2NVQB 4JG2A 1IBML 5C4ZA 4CDFC 2BA1A 3SDZA 4I7AA 4KHVA 1AZPA 2KUMA 3J7AF 2I0QA 5M9OA 3A0JA 2O4XA 3G48A 1KIXA 3EQLC 2NTSA 1CFMA 3QG1A 1AE2A 1CZWA 2PZUA 1OB9A 2FMMA 2KCNA 1BVSA 1KAAA 5KNBA 2E5LL 3J81i 4NMZA 2WIZA 2E2JH 4A3IH 3ND9A 5FLXc 3K80C 3A8IE 5E3FA 1Q86C 1N34L 2HCCA 3K0YA 4A93H 2F0IA 4KN7C 3T13A 5TSSA 2CQAA 2K5NA 1JJGA 4BBSH 1EIYB 4LF8Q 1K83B 3E5SA 2E76C 3W3AA 2PCFB 3DXJC 1EY7A 4ME5A 1PLFA 4JBJA 4UHVA 3T56B 4A3EG 4RH6A 1M4VA 2JA6B 1ZXTA 1VQOA 1DGSA 4K6DA 1XNQQ 3A5UA 4GLVB 2IWHA 1TVXA 2DGYA 4AYBE 3AFQA 1JWMD 5FO7B 4Z9CB 4R4IA 1XMOQ 1VQ5A 4FO2A 5ELEA 4Y7NB 2A1AA 1KLUD 4CBVA 4DK3C 1G6PA 4GN3B 3TS2A 2HHHQ 3JAMc 1XTDA 3L9AX 5C0XH 4ZAIA 1KDBA 3OYYA 1MJCA 2XNAC 4P71A 2UXBQ 1NR4A 1SYEA 4LUOA 5DM63 1VQ4A 4P74A 1JWSD 1SYBA 3RN2A 1V1PB 3L7ZC 1PH4A 4DR2L 5GAHC 2RDHA 3OIPA 1VQ8A 4QBOA 3GTOH 4KHPL 4GKKL 4MNOA 5I2YA 4A3FB 2ID0A 2UXCL 2HQEA 2F4VQ 3IEYA 1HTPA 4G7OC 3DEPA 4N9PA 5C44G 4DAMA 2PNRC 1Z6HA 3I72A 1M90C 1TWGB 4K14A 5IGEA 4LFCQ 1E22A 1BBUA 3WOFA 1ZKOA 4JI8Q 3GP7A 5F2DA 3PIPA 2KCTA 5IYBG 5J3BA 1HFGA 3UDXA 3HKZB 1EWCA 4MHEA 4XT1B 3RZDB 2ZJRA 4C3HB 2FHTA 1STNA 1DZ1A 3M85A 3CHBD 2D5DA 1PH9A 2F0QA 2OEOA 3BU2A 2JE6I 2PW7A 1S5ED 4DV0Q 1F9QA 5CV6A 5I6WA 3DUZA 1WOCA 5GAEC 2EYMA 3U4ZA 1EY6A 5D3IB 3T1HQ 2MNAA 2VQEQ 1EEID 1NY4A 3M4QA 2ZJPA 1TWAH 1AFPA 2I46A 1L1OA 1Y1WB 4IQZA 5JAVA 1H9KA 4LFAL 2Q8TA 2E2IH 1CSPA 4B08A 2HCIA 5DEHA 5EKIA 4XXEA 1GUGA 3AFPA 4H02A 1YJNA 3H0GB 4YY3L 3M9BA 4POFA 3TZDA 1FYCA 3ZJYC 1ILPA 2VS1A 1A0IA 5FOBB 3HOWH 4CJ0B 3R2TA 4PMBA 5M5XB 2MO1A 2N78A 3NQTA 1L1OB 3TP8A 3M4PA 3M7GA 4Q5VA 3GTLH 2CKZB 1LABA 1TY2A 5BN3A 4LF8L 3NXWA 1TWHB 1K8AC 1V1QA 1HNZQ 4RFBA 4QIWE 1T5EA 3KUPA 3DEOA 3ULJA 1FNVA 1H9SB 5KIXA 2F0EA 3J81j 1TQOA 4XYQA 1RLVA 1SMYD 1G291 3V96A 5K5PA 4TKDA 5D65A 3K7AB 2YTYA 3MWYW 4POGA 5JOBA 1XMOL 1CHPD 2PYKA 1AP0A 3VYUA 1KDAA 2JA6G 3U4VA 1MSHA 4JI1Q 1PTOH 4A3IG 4K5WA 4RWSC 2TMPA 3TQYA 1PVOA 4MIUA 1PV4A 1PMRA 1N8RC 1U0LA 1IKLA 2N3SA 1N33Q 4HSPA 1O78A 3PUXA 3D4RA 4GNXB 1O7IA 4V190 2AQ1B 1E7ZA 4DNIA 2R6GA 3EA6A 1FNUA 3EBEA 5IY0A 1RODA 4R4OA 4UP7A 3I4NH 1YI2A 4BBSG 1LM0A 4DNTB 2Z0RA 1O7ZA 4NXMQ 3GTKH 2XGTA 2JA5B 3FEWX 2GVAA 1E2WA 2CV8A 4JI6Q 5JJLA 3HG9A 2MJ8A 2HD3A 4ZKCB 1XNRQ 4LFCL 2FXQA 5E4WC 4ABNA 2F52A 3RLOA 3S1RH 4JI8L 2CHBD 1IPIA 1I6HB 3EJIA 4A3FG 2CW0C 1X6OA 1HQRD 3IKJA 4HEDA 4G7ZC 3KLSX 4OIJA 3S16B 3DWQA 2Q8IB 1U4RA 5C0XG 3I7FA 4KV6A 4JI5Q 2A8VA 4RKLA 2AMCB 1CKOA 1K9MC 1BNZA 4OO1I 2X69A 1HTLD 1Q12A 1MJEA 3PF4A 2A73B 4DV0L 3ERSX 4S3SA 3I4MB 3HKZG 3I2ZA 3A56A 1LTRD 1I4QA 4C3HG 4IUVA 3A7LA 2XRQD 5LMNW 1BCPF 3H94A 3CC2A 2LFNA 2IW3A 3RNUA 3MTSA 5FK9C 2IHFA 3ULPA 3IRBA 1Q8IA 4RG1A 3BVMA 3IL8A 2QA4A 1Y8PB 1HA5A 3S2DB 1Y1WG 2FFKB 4LFBQ 1I4PA 1JR0D 1PH6A 5IP9H 2D9UA 2QGQA 4NXNL 1QVFA 2KQ3A 2PI2E 2Q8RE 3VR4A 4JYAQ 4OXPA 4C3JB 4FF4A 4LF7L 3WDNA 1OTCA 1BBXC 1JORA 3BS1A 4EX5A 3GV3A 3HKSA 4LF9Q 4X64Q 4V0BA 3K5NA 1WCMB 1HR0L 1S5CD 4OX9L 1GOZA 1OXTA 1IXRA 4DUZQ 3HOZB 4FXDA 5DNFA 2WJ0A 1SNOA 4DAYB 2I5HA 3FOVA 1STAA 5FLMH 3D4DA 2OCEA 2RBMA 1BO0A 5IYDH 3TREA 3Q24A 1ONLA 4KI0A 5HURA 2K5QA 2B2YC 1Q1BA 1TS5A 1FD7D 4RA8A 3HOWG 3K8AA 5JVH3 1CA5A 2WCWA 4B3SQ 2HQLA 3NTKA 5D14A 3VDYA 1VQGA 5KYLA 1B1ZA 1AZQA 4NXML 1LV9A 1EU3A 3PO3B 2RSOA 1S5BD 3E9HA 4DV2Q 4L5SA 2JA7H 1C4QA 4JI6L 2JA9A 2A6HD 3D31A 4DR5Q 3FVQA 2KHSA 5IGCA 2FMCA 3GTJB 3GTGH 2JA5G 4IUQA 3RN5A 2B39A 1EOVA 2R7FA 2F0KA 2PNHA 1VCIA 4YWLA 5LMUL 1CSQA 1PRTD 4MTKA 1STBA 1KC8C 5KNCA 4YHHQ 1I94Q 4JI5L 1RCVD 3BVZA 3DHQA 4ZCKA 2A74C 2B2VA 3DWPA 1F77A 2WP8J 3F1ZA 2R93H 2Q2UA 1EYCA 1NTGA 4EGVA 4A3DB 5I9PA 3PUVA 3BZCA 2ICIA 4JI2Q 5JEAH 3CXCA 3K5OA 1DOMA 4BBRH 1EQVA 1ILQA 1YZ6A 2XWBB 4DU9A 3OMCA 3I4MG 1PH3A 4JBWA 3WWVA 1BCPC 4HIMA 2K28A 1RL2A 2F0LA 1ZP7A 3K5LA 4JPBW 3I4LA 4C1NK 4JBMA 1W3SA 4A3BB 2WAQB 4QBNA 3CMAA 1FJGL 1H9MA 3UE1A 4UP9A 1T5XD 4K2LA 1RHPA 5C3EB 1C48A 3K59A 2NVXH 3N52A 3Q22A 1CZGA 3PIO3 1WTRA 1FL0A 1HHVA 1WFQA 4JI3Q 2KEEA 4BY1H 3NK9A 3WOEA 5M5YB 1UE5A 3S17B 1JT8A 1YNNC 2JN4A 3BDCA 1X56A 1ZEQX 4X64L 1M8AA 3S1NH 1NUCA 4H44C 3G4SA 1SE4A 2B8GA 2B2TC 3PV0A 3UE0A 1HZAA 3PQIA 2PQEA 5FLXL 3P20A 3J81c 2ENBA 3GO5A 1I3QB 3ULLA 4DV7L 3IFDA 1DONA 1IBMQ 2WCZA 2EYJA 1JOOA 1SJED 4HTHA 1WCMG 1OO9B 1JOKA 2NVXB 1B53A 2EQSA 1JB7A 3HOZG 2QCPX 1MIUA 2F0NA 2EYFA 4IOCA 1X32A 5IP9G 1A79A 2K6AA 4FF3A 1GUWA 4QUCA 4UAIA 4IO9A 3HOXB 2XTIA 3Q6SA 4DNRB 4LW1A 3CRKC 4B3SL 3GV6A 2KCMA 1TWCH 2FJ2A 3P1ZB 4JV5L 1D5XC 1RF2D 4JK1C 1E24A 5BR8Q 3TEHB 1N34Q 4KD3A 3JAML 1B3QA 4N8FA 3NE5B 3ICEA 4J8QA 4IPDA 4P2CB 3CCJA 4KTAA 5FLXE 1MSGA 1ZYRD 5EKKA 4DV5Q 4HSVA 3BZDB 3PO3G 3C1EA 4IUNA 2SDFA 2Z6KA 1EZ8A 4BS9A 4IZ8A 5IYDG 5I9OA 2B2UA 4JI7L 2VQFQ 3IF0X 1VMCA 1MGSA 2QEJC 4FXGC 1L0WA 5C44H 4YHHL 3U50C 2IX0A 1Q3LA 4ZKBB 2MO0A 1OXXK 2B29A 1TIID 5EBDA 5CV9A 1DCZA 5FKAC 4IFDI 3DM3A 3RUZA 5ELBA 5IYBH 1F1ZA 4C2MB 4OELB 3MHBA 3W1BA 1SNCA 3BG3A 2GW6A 3T16A 4XQNA 3S1MH 1UAPA 4JI2L 3OOCA 1CT1D 1SE2A 2HIVA 1TS3A 1QOHA 4GLAC 4G7HC 3GTQH 1GKHA 1IHZA 3BDLA 4ZQ3A 3OW2A 3NPPA 1EOTA 2R92B 3K81C 1SFOB 2NVTB 1B9MA 1XX8A 3C1FA 1D5MC 1WTHA 2RCFA 1PTOF 3X3NA 1IZ6A 2UUAL 2NVQH 4OO1G 1TS2A 2UXCQ 1YNJC 2K5VA 3J80i 3SR1A 4DAVA 2DY7A 2FKHB 1Y69U 1Q82C 1J6QA 2QDBA 4A3BG 2WAQG 2MHVA 1XTCD 1C7YA 3IFTA 3PIOA 1YJ9A 4B3MQ 2R93G 1VF5C 5C3EG 3I70A 4GN5A 1XPRA 4HR7B 2J7ZA 2NZHA 5JEAG 1PH8A 1SYGA 5CBAE 4BBRG 2UUCQ 2F0WA 3T53B 1PXUA 2A68C 4IPGA 4EVOA 2JEAI 2WB1E 2A69D 2INBA 1NMFA 1A62A 2ZXPA 1FNWA 2IY5B 2LXJA 4PZ7A 2N55A 4A3KB 3CRLC 1PZKD 1K83H 2V4DA 4CDEC 4LFAQ 5G3LF 4X66Q 1NNXA 1IL2A 2E8GA 1T9HA 2JA6H 4X3TA 4BY1G 4PZ8A 5EPLA 4YY3Q 1VS0A 4A3JB 3LGJA 1X9NA 4DV4Q 5BR8L 2L9HA 2K05A 1QG7A 2AQ3B 2V1CC 3V2TA 4Y7NH 3OTOL 1E2ZA 1TS4A 1L1OC 2JXMB 4NW2A 3VA5A 3HOYB 1RDPD 2NUCA 1I4GA 2A6EC 4DV5L 4P73A 1Q1EA 2AWOA 3NP8A 2RVLA 3MZ5A 1RJTA 3NTIA 3QWNA 3U58A 1WJJA 5AJ3Q 4CKBA 2VQFL 1ET9A 1KTKA 3D4WA 4ZYSA 3STBD 1TY0A 4O42A 1KLGD 5H1SE 2L12A 1HH2P 1YEZA 4PNYA 2EO0A 2F0UA 1V1PA 2K04A 2ZJQA 4NPSA 2F3IA 4FXKC 5I4DA 2LS01 1HUMA 4A3FH 2RKSA 3F2BA 2J0TD 1W6KA 2X6LA 1IW7D 2B63B 1TWGH 4H7BA 2AKWB 1QUQB 1TT2A 4BWGB 5IODA 1R9TB 2CWAA 2FKCA 1PZID 1N9WA 1XXGA 4MZ9A 2NYZD 3GQBA 1WI5A 1GUNA 1U5KA 4RHRA 2BA0A 2VZAA 3FKIB 4BA2I 3RZDH 4C3HH 3DM1A 3CCMA 3BDOA 4Y52H 3SK5A 3N6RA 1H95A 4DV1L 1TU2B 4X3KA 2F0PA 2YU9B 3S14B 4XDXA 3SGIA 1KXLA 1Q8KA 2DUDA 2K4KA 3G71A 4TQUS 2R92G 1PTOC 3QO2A 2E2HB 1HH1A 3ITPA 1EY9A 1F2YA 1A3UA 2YTXA 4LF4L 3KDFA 1Y1WH 2H1EA 2MGSA 2Z8LA 3I56A 3A55A 2UUBL 4B3ML 3VYRA 2C5CA 3M4YA 2K7VA 3E3XA 4Q0FA 1H9RA 1I4XA 2XVSA 1O7YA 4UPAA 3H0GH 3KJOA 3J7AV 2LY7A 2R7ZB 2UUCL 4N8X1 3CQZH 3E6ZX 2BE5D 4RGNA 4LNQA 4ALPA 2PZWA 1SDFA 5FO8B 3MVVA 2PW5A 4ME3A 1WTVA 4CGYB 1N32Q 1EYGA 2EVBA 5M5XH 4TRDA 3KDFB 2AHOB 1KNEA 1CUKA 2UXDL 2K14A 3KFUA 5M3MB 1F2MA 3K58A 4TKKA 1U9RA 4X66L 1TWHH 3K5MA 2MPMA 4OWXB 2O5IC 1SROA 4EV1A 3CPFA 1AW7A 1K28A 1BUVT 1W2BA 1JICA 5FDKA 3FP9A 2EYHA 4A3KG 5IGFA 1H9SA 4R8NA 3FMCA 3S24A 2UU9L 3CQZB 3AQQA 1CA6A 3K7AH 4R1JA 2FCOA 1D1KA 1JB3A 1PDQA 4DV4L 3SK6A 4NXNQ 3M7NA 2JEBI 2Z1CA 4LF7Q 1Q7YC 2IX3A 2JQOA 4YIJA 1HFNA 4O0AA 2BCOA 4KY5A 2ZYZB 2OF1A 1HR0Q 2QDLA 4OX9Q 4IFDJ 5AJ3L 1PH7A 4JW0A 5I2XA 3HOYG 3F2CA 4GNXA 1HCZA 4OWTB 2D62A 2JA5H 1EQTA 4R8IA 1HUNA 4L6TB 3TP7A 5CORA 3GTMB 4X65Q 1O80A 4XIGS 1NSNS 3ER0A 3UI2A 2SNSA 1I6HH 1CK1A 1MKHA 1SEBD 1KRSA 3UDGA 3KK7A 1BKBA 4DR3L 2OSTA 3S16H 1VQDA 1TXYA 2ZM6Q 1EY0A 1HZ9A 1DJRD 2FINB 5C5LA 3O13A 3E0JA 4G6VA 4TVAB 5IYCH 1Y8OB 2NBFA 4K8IA 1FGUA 1ICWA 5IOCA 3G7LA 4IFDG 1DYQA 3I4MH 3FKIG 4HJ8A 2B2WA 1A63A 3D3RA 3G6JB 2ES2A 5C4XB 4HAEA 1G2TA 2L11A 4N9TA 5LMUQ 4A3CG 1HZBA 3BZKA 2JA8B 2QKIC 4A3MB 3FPUB 1G8ZD 5M3FB 3GTPB 5JVG3 1NJIC 4PZ6A 3ZYYX 1ML0D 1HQMC 4DR4L 3S2DH 1SNDA 4AYBB 2WKCA 2E2DC 4HCSA 4ULLA 1X55A 3JAMi 2EZVA 1VQLA 2RQXA 5T1IA 3HOUB 4IN3A 1N32L 1GM5A 2VXWA 1P8LA 1PRTB 4C3JH 1VDZA 2R7ZG 4QF4A 1A2UA 4XQQA 2Y0SB 5C3XA 1SYFA 1Y14B 5HGTA 3J81L 1WCMH 3CCSA 3H91A 4OWWB 1F9RA 2B2VC 3HOZH 3KF6A 2F03A 1SSOA 3CU7A 2RSNA 3KBXA 2M2LA 1KQSA 1FJGQ 1S5FD 4KD4A 4DAYA 3MXNA 4ZK9B 4DR6L 4X6AH 3H6MA 5IE8A 5IP7G 5IWAQ 2BDNA 3NWSA 1D7QA 1VF7A 2R7DA 1UE6A 1B7YB 3H0GG 2KCCA 2F0JA 2JP1A 5IT9L 1PH2A 4P72A 5EGTA 3CCEA 1WD1A 1ENFA 2HDMA 3KF6B 4RHSA 4DV7Q 3MXNB 3I90A 4C56C 3OW7A 3J7ZC 3PO3H 5DM73 1V1OA 4H0LC 3J81E 1S40A 4KJNA 4EQNA 4CHTB 1A3VA 3M3YB 1FVIA 3KLRA 3NEMA 1MD2D 1W6JA 2G9HD 4ZUIA 1RKNA 4RMFA 4KHZA 4X65L 4QMGA 3GTJH 4FNFA 2N88A 5A35A 1UWVA 2WV6D 1Y1VB 4K8JA 3DNXA 4J6HA 2DY8A 1QVCA 5A2QL 5KGUA 2LXKA 1VQFA 2ZM6L 2I07B 1U4LA 3TZUA 3H15A 2IXSA 1RTOA 5CR3A 1JE5A 2A69C 5IT9E 4JV5Q 1K8GA 1LT3D 1VQ9A 2JSOA 2SEBD 2A19A 1CTMA 1B2TA 4OHJA 4DK6C 3I8ZA 4A3DH 1EY8A 2D2CC 2PMZE 4M8AA 4GKJQ 1X3PA 4O2DA 3L0OA 2Q2TA 3C46A 1G6ZA 3PF5A 3FRPB 3A5ZB 3D0FA 4A3GB 5HGQA 2DBSA 1D1IA 4C3IB 4OO1H 4B3TL 4JI7Q 2K5WA 2PZTA 1PH1A 3CCQA 3H09A 5DAUA 1EL0A 4J15A 2B3GA 5C4XG 2ZTCA 4NDXA 1E2VA 4A3BH 5JPNC 2JA8G 2H4OA 2SOBA 3E9IA 5A2QE 4A3MG 3J80c 3IAYA 2GJWA 2EYPA 5CBEE 5C3EH 4NP5A 2L55A 1GUSA 4YWMA 5M3FG 1A8VA 3P7JA 5K36G 2XRSD 4L5RC 2Z6KC 1GUTA 3RD4A 4JI4L 1LUZA 4AYBG 2AWNA 5IYCG 5ELOA 3BJUA 3STBC 2F0GA 2B2UC 5M5YH 1L0XB 3S17H 3PMFA 1CQVA 3OPOA 3PO2B 1OXVA 2X6GA 2F0TA 3HOUG 1E1TA 4G57A 2HIXA 5CGKA 1Y88A 4BY7B 3EROA 4F88A 4EQPA 1I3QH 1IW7C 2Y0SG 4E6ZA 3PCOB 2UUAQ 3GD7A 3QR8A 2WIWA 2K50A 5IWAL 3D6WA 2EYLA 1G2SA 4K5VA 3M4OB 3G6EA 1YJWA 2VL6A 3S1QB 5C3WA 1U4PA 5KEEA 4JI0L 1EWHA 2OTJA 1SYCA 4DKAC 2EIFA 2EY2A 3HOXH 1ESFA 5BN4A 1WTQA 4JOIA 1EIFA 1QJOA 2VUMB 4C3JG 5LL6S 5COYA 5IGBA 1CM9A 5LL6X 1JQYD 1PYBA 1M1KC 1BQQT 1QCBD 3S15B 1Q46A 5JJZA 1EUJA 2Q2IA 3P1ZA 1J5EL 4GS3A 4HIOA 2L4NA 1HRJA 3HP3A 2RHQB 1EEFD 1D8LA 2NN6I 2OXPA 4IUUA 3S9WA 3TSSA 1LTID 3TMEA 3H3VI 2C9OA 4CKEA 3NELA 4LAAA 3L2PA 5IT9c 1KNAA 3R8BA 5KNDA 4AQYQ 5E1FA 1C8CA 5JJKA 1D2BA 1PH5A 5EKLA 3SVMA 2FLCA 2R3ZA 4A3LH 4O1NA 5JPMC 4K0KL 4X62Q 4L5QA 3OTOQ 4C2MH 1EY4A 4X3SA 3AB9A 1YVCA 4GKJL 2BDOA 3ONAB 1X54A 3AJVB 5J39A 5CV4A 3UDIA 2E75C 2CW0D 3DLLA 5CV8A 1NCVA 3OSOA 4FF1A 3EFXD 1LTAD 2XN9C 5CYUA 2R92H 1SFOH 3MEHA 2NVTH 3RLNA 2XWJB 1F2LA 4C3IG 4K2KA 4A3EB 1F9PA 1RZNA 1E0BA 2F0OA 3PUYA 1YITA 3HKZE 1LT5D 1RTNA 1JMCA 2RDFA 2NVYB 1NBWA 4A4IA 1QNUA 4JBKA 1SMYC 3J7YW 1K73C 1A3TA 2IPKD 3FPPA 4A3DG 2RF4A 2OT2A 3PSIA 3VYSA 5C4JB 4TKOB 4LQEA 4TSSA 1JJ2A 1X3QA 2ZTEA 1YNXA 2ZTDA 4DV1Q 5EPKA 1VQIA 3Q0AA 2KVMA 2F1MA 3PO2G 1O7LA 2ZXOA 5EBCA 4LUVA 3GDEA 5KYIA 2RHSB 2LSSA 3V05A 1DOLA 4BY7G 1V8QA 3SXHA 1EY5A 5C0XI 2ATWA 5ISRA 3CCUA 1VQKA 4LF4Q 2BH8A 1GHKA 4A3KH 4K6LA 2UUBQ 3CD6A 1IYUA 4IALA 1J9OA 1HNXQ 3T4AC 1SNQA 1CKNA 5DLQE 3I73A 1SYDA 2CCZA 4L5TA 5CV5A 4RKBA 5EAYA 4PV1C 2IL8A 4A3JH 2PO4A 1JWUD 2ZT9C 3R2IA 3CP0A 4FDBA 4ILWA 2LKVA 2OTLA 3S2HB 2F0SA 1YBYA 5KRUA 1IBLL 4B3RQ 2VUMG 3OWFA 3KLSA 1VQHA 3HOVB 5GAGC 3Q23A 3HOYH 3A8JE 2UXDQ 1YHBA 2G5DA 1SJHD 1QILA 4RCOA 4HN7A 1EFID 1UEAB 4HCEA 1GEFA 3D6CA 4IOAA 2KENA 1CKNB 1UE1A 1LTGD 5M5WB 3AMUA 3NHHA 4DPGA 4B9WA 1EU4A 1VQCA 4DV3Q 4AQYL 1B9NA 1TWFB 3RLFA 2EPBA 4MN3A 2HT1A 1MHWC 4QBLA 1SLJA 2FL3A 2UU9Q 1XJVA 3URYA 5J22A 1AN8A 3HOXG 5E4XA 3EN2A 2BH2A 1IYVA 4X62L 1AEXA 2VNUD 4IJHA 4RGMA 4HIKA 3CC4A 2B63H 1GVPA 3R93A 1BOSA 4HMIA 1ASZA 4FP5D 1QUQA 1BBWA 2WINB 5IGDA 1R9TH 3CF5A 2F0VA 2EY5A 1STYA 3KOJA 1JC7A 5CC4A 5T1GA 1BF4A 4IFDH 5CMDA 1NE3A 3FKIH 4C1NI 4DK1A 2ICEC 1MI2A 4XQJA 2YU9H 1VQAA 2CVRA 3S14H 1IL8A 4A3CH 1I6VC 1VQBA 2OKFA 3LNNA 2D0PA 2F0FA 2WIIB 2E2HH 4FVMA 4A3LG 4E6IA 3W1GA 2WACA 4PMWA 1DM0B 3W5OA 1NAPA 1I5FA 4H13C 2E2JB 4A3IB 4OEMB 3SE0A 1S4ZA 4DR3Q 4GNXC 3X3MA 1KABA 4AH6A 3K7UC 1BCPD 5ELNA 4ZUJA 2K33A 5IGGA 1F2ZA 1R0VA 4LJZC 4A93B 3K0XA 3HRZC 1B8AA 1ESRA 4JCVE 2R7ZH 4HMJA 1VQJA 1GJXA 1L0YB 1CKMA 4BBSB 1EYDA 4QJFA 2Y0SE 1K3RA 2ALYB 4FF2A 1VQEA 2AUKA 3VYTA 3CPWA 4JVZA 1L2FA 1K0SA 2L1BA 1GO3E 4I7ZC 5M3MH 1XMXA 4YCVA 1YNND 2F0DA 2I5MX 4GOPA 1HNWQ 1QE6A 4WJ4A 5CV7A 1HNXL 2OWOA 5FJ8G 1H9JA 5IP7H 5LMNQ 1QZGA 1FGBD 2H5XA 3CCVA 4I65A 3LX0A 2AQ2B 2W8MA 2YYZA 1STGA 4DR4Q 2A6HC 2NWGA 3A8KE 3SEBA 1K8MA 3R3OA 4JC0A 3NQIA 3KF8A 4GLXA 4HJAA 1SRUA 2R61A 1WVLA 4DR7L 5ELCA 3UDFA 2B2WC 1SNPA 2DNEA 4B3RL 2KBNA 1QNKA 1PRTC 1EIGA 3CAMA 4GOPB 2DNCA 3LWEA 2LMCB 5L37A 3A74A 4ID6A 4DGZA 2EYOA 1B50A 3GTOB 2D0OA 4R9WA 2F4IA 3OIQA 3IEYB 1XYIA 1JE4A 4DV3L 2ZYZA 3HOVG 2EY6A 2J4XA 3QIAA 2NTTA 5J1ZA 1PYWD 4OONA 2N49A 3KF8B 3W2DA 3Q8DA 4KN4C 2Z6BA 2RA4A 3TRZA 2I5LX 4QUFA 5LHY1 4DR6Q 1WTOA 4HJ5A 1Y8NB 1WD0A 4UDUC 1PFBA 1X3EA 3GTMH 2K5HA 1UEBA 1F9SA 4MTNA 4KMUC 5EQ0A 5E7NA 1HXYD 4RGOS 4A3JG 2NN6G 3PUZA 2PQAA 1CHQD 1R4PB 4GN4B 1JCKB 2CFMA 2GA4B 3KBGA 3ND8A 3SHLA 5AFWA 2CH4W 2ASBA 1TWAB 2O5JC 1XMQQ 1PYSB 2WB1B 1VQPA 1HZCA 1Z7TA 3ERQA 4KLKA 2E2IB 3NBIA 3QJYA 4YCWA 2RCNA 2WKDA 4ZRZA 2EXDA 4WORA 3MXGA 4OIKA 1A6XA 2PQAB 1XPUA 4A76A 5C4XH 1DD2A 1XNQL 2EXZA 2JA8H 1IKMA 4A3MH 2B63G 1KAWA 4DV6Q 3NTHA 5M3FH 2NZOA 3EVQA 1V43A 3GTPH 1VQMA 3HOWB 3QOLA 3FDTA 5K36H 3J80L 4HIDA 2HHHL 5GQOA 5C0XJ 1WYDA 1I4RA 3EIVA 4XTCS 4DR1Q 3GTLB 1DXMA 1PFSA 1YNJD 2F0MA 4ODGA 1KHIA 2JK8A 2M00A 3E0EA 3HOUH 2UXBL 2KHJA 3CMEA 2KA7A 3KJPA 4A93G 4U68A 3I4OA 1KRTA 3RR5A 2SNMA 4LF6Q 2EJFC 4B3TQ 4G4KA 4DUYQ 1HNWL 1B3AA 2WAQE 5LMNL 1GUOA 1Y1OA 1LACA 2F4VL 1KD1C 3MXPA 3A7AB 1EQRA 1OB8A 1PTOB 1ZYRC 4WFN3 1K0RA 2A68D 1K3BC 2Z4HA 1KL9A 3NENA 1DOKA 2L0CA 1S72A 1VMPA 2B8FA 1LLRD 1B4OA 4JI4Q 3J80E 1VQ6A 4XT3B 1AE3A 3KLWA 3I4NB 2BOSA 1LTLA 2KEDA 3GTKB 1BDOA 4PQXA 1SAPA 1C9OA 3NUCA 1ENCA 3VR6A 1I50H 3MFGA 4QGUA 1PFNA 5M3MG 2QEXA 1LTTD 4KY6A 4CJ2C 3T1HL 2DJGC 2VQEL 3S1RB 2K75A 3VR2A 3MEFA 4FYDA 1PFMA 1EZ6A 1SBBB 5D3DA 2MP1A 4IURA 3M3YH 2K03A 3HFZB 2A6ED 1WTPA 1YHAA 4JI0Q 1Y1VH 2KJXA 1IYJB 1VQ7A 1II3A 4X3UA 1EIHA 1D5ZC 1R4QB 3CC7A 3C3LA 2VB2X 2Z4IA 1I50B 2EOTA 3BYYB 2PPBC 2Q2HA 4KKTA 2IX1A 1GD7A 4KY7A 3TN2A 2TSSA 1J5EQ 1ET6A 3OHXC 1XMQL 4L8JA 5GROA 1G51A 4KJOA 4IPHA 3RMHA 3JC66 3FHWA 3NSWA 2VLDA 2K5DA 1HNZL 1SN8A 5I6YA 3TDQA 3NBHA 2MUYA 1EWIA 4A3GH 4JOIC 1QZHA 1Z9FA 3P1YA 2RDGA 4F7XA 3T51B 4C3IH 4GZYC 2WB1G 4B9XA 2MQHA 3HZXA 3CW2C 3SK8A 4UP8A 1X3FA 4DN4M 4YCUA 4DV6L 1LO5D 1VQNA 1KDCA 1AH9A 1G91A 4WJWA 4ZLTF 2IHEA 1SE3A 1HR0W 4JI1L 2Z9HA 3L3OC 4DR1L 3T1YQ 4K0KQ 4OGQC 1OXSC 2CH4A 1WTWA 1N33L 1PTOD 2E74C 3NBHB 1UE7A 4IJLA 4IUPA 1CQFA 1HJPA 4F87A 3TS0A 3TP6A 2JJQA 3QB3A 1JJCB 2EJGC 3AU7A 4OL7A 3SK4A 3DMUA 5EPJA 4CDDC 4BA1I 3VA7A 4LF6L 2Z0SA 3LWUA 4DUYL 4QIWB 2KHIA 1PA6A 1R11A 2F0HA 3PO2H 4NKLA 1Q81C 4BXXH 3OWEB 4DAPA 1RD9D 5FO9B 4LF5Q 3QOJA 3VR3A 4DXGA 4BY7H 1B44D 3BYTB 2CQOA 4KKUA 2C35B 2K32A 2XIWA 2OQKA 4L63B 4CKCA 1XNRL 4RGTA 2YTVA 1QWYA 2F3VA 1I4HA 5NUCA 4DXFA 4QY7A 1EYAA 3HGBA 1SMXA 2AUJD 3CKIB 3M4OH 1N36Q 3DWAA 3S1QH 1RIPA 2O2LD 1EFWA 1LYLA 1PHJA 2CWPA 3I91A 2IT1A 2NB0A 4LUZA 2HDLA 4KKSA
chains in the Genus database with same CATH topology
3K6OA 2JA7B 5G3LD 3BVGA 3OMGA 3GTGB 3BT7A 2ZXRA 5C5MA 1A2TA 2KECA 4LK1C 1ENAA 1STEA 1D6EC 4U673 2IJ0A 3U9OA 2G9DA 3TBIB 2L5TA 4DFAA 1S5DD 3NWTA 5C6AA 2JYOA 2R93B 3HS0C 2K01A 5C4HA 4G6UA 4XYOA 4BBRB 1U4MA 4RCNA 1SNMA 2XSCA 3K57A 2B2YA 1WTXA 2F3WA 5EJWA 1XWEA 1GHJA 4DA2A 1LTSD 3AJVA 4PMCA 4LMQD 1STHA 2EE1A 4ZQUA 3MC0B 3VR5A 1BXTA 2BE5C 2EY1A 1BR9A 3D8GA 1UUPA 2HUGA 1HPCA 2K1BA 4KK7A 4BY1B 5ELDA 4F8MA 5BN5A 3H3VC 3MFYA 1TKWB 4DF7A 3S1NB 4WRDA 1LT6D 2VB3X 2M9VA 4M1UB 1LT4D 3C2PA 4RAUC 3U9SA 1NR2A 1SXTA 1TR5A 5ELFA 1J8IA 1OXUA 3RZOB 2QF7A 3A54A 3P75A 2CZRA 3I3CA 4IUTA 1Q90A 1LTBD 1TWCB 1Z47A 4QCLA 2EJMA 1UNSA 4DK0A 3P1HA 1YNMA 5JEAJ 2QILA 4EQOA 4K5XA 1K8OA 2A5HA 1MBYA 2EDGA 3JAME 2PMZB 4J1MA 2NZ1D 4CJ1B 3PUWA 5C44B 1PZJD 1BCPB 3MAQA 1CI3M 2B2TA 1T0FA 2DN8A 2KOLA 4QB4A 1JOQA 1FR3A 1QB5D 1PRTF 2NN6H 3PIP3 3S1MB 1A15A 3MA2B 3HEJA 3MXUA 3GTQB 3TP5A 3F2UA 1HA6A 1GXDC 5IIFA 2NVQB 5C4ZA 2BA1A 3SDZA 4KHVA 1AZPA 2KUMA 3J7AF 5M9OA 2O4XA 3EQLC 2NTSA 1CFMA 3QG1A 1CZWA 2PZUA 1OB9A 2FMMA 2KCNA 1KAAA 5KNBA 4NMZA 2WIZA 3ND9A 3A8IE 5E3FA 2HCCA 3K0YA 2F0IA 4KN7C 3T13A 5TSSA 2CQAA 1K83B 3E5SA 2E76C 3W3AA 2PCFB 3DXJC 1EY7A 4ME5A 1PLFA 3T56B 4RH6A 1M4VA 2JA6B 1ZXTA 4K6DA 2IWHA 1TVXA 1JWMD 5FO7B 4Z9CB 4FO2A 5ELEA 4Y7NB 1KLUD 4CBVA 3L9AX 5C0XH 4ZAIA 1KDBA 2XNAC 1NR4A 1SYEA 5DM63 1JWSD 1SYBA 1V1PB 3L7ZC 2RDHA 3OIPA 4QBOA 5I2YA 4A3FB 2ID0A 2HQEA 3IEYA 1HTPA 4G7OC 3DEPA 4N9PA 2PNRC 1Z6HA 3I72A 1TWGB 4K14A 5IGEA 3WOFA 1ZKOA 3GP7A 5F2DA 1HFGA 3HKZB 1EWCA 4MHEA 4XT1B 3RZDB 4C3HB 2FHTA 1STNA 1DZ1A 3M85A 3CHBD 2D5DA 2F0QA 2OEOA 2JE6I 2PW7A 1S5ED 1F9QA 5CV6A 5I6WA 3DUZA 2EYMA 1EY6A 5D3IB 1EEID 1AFPA 2I46A 1Y1WB 4IQZA 5JAVA 1H9KA 2Q8TA 4B08A 2HCIA 5DEHA 5EKIA 4XXEA 1GUGA 3H0GB 3TZDA 1FYCA 1ILPA 2VS1A 5FOBB 4CJ0B 3R2TA 4PMBA 5M5XB 3NQTA 3TP8A 3M7GA 4Q5VA 1LABA 1TY2A 5BN3A 3NXWA 1TWHB 4RFBA 1T5EA 3KUPA 3DEOA 1FNVA 1H9SB 5KIXA 2F0EA 1TQOA 4XYQA 1RLVA 1SMYD 1G291 3V96A 5K5PA 4TKDA 5D65A 3K7AB 3MWYW 5JOBA 1CHPD 2PYKA 1AP0A 3VYUA 1KDAA 1MSHA 1PTOH 4K5WA 4RWSC 2TMPA 4MIUA 1PMRA 1IKLA 4HSPA 1O78A 3PUXA 3D4RA 4V190 2AQ1B 2R6GA 3EA6A 1FNUA 3P1YA 1RODA 4DNTB 2Z0RA 1O7ZA 2JA5B 3FEWX 1E2WA 2CV8A 3HG9A 2MJ8A 4ZKCB 5E4WC 4ABNA 1IPIA 2CHBD 1I6HB 3EJIA 2CW0C 1HQRD 3IKJA 4HEDA 4G7ZC 3KLSX 4OIJA 3S16B 3DWQA 2Q8IB 1U4RA 5C0XG 4KV6A 4RKLA 1BNZA 4OO1I 2X69A 1HTLD 1Q12A 2A73B 4S3SA 3I4MB 3A56A 1LTRD 1I4QA 4C3HG 4IUVA 3A7LA 2XRQD 1BCPF 3H94A 2LFNA 2IW3A 3MTSA 5FK9C 1Q8IA 3BVMA 3IL8A 1Y8PB 1HA5A 3S2DB 2FFKB 1I4PA 1JR0D 2D9UA 2KQ3A 2Q8RE 3VR4A 4C3JB 4FF4A 3WDNA 1BBXC 1JORA 3BS1A 3GV3A 4V0BA 3K5NA 1WCMB 1S5CD 1GOZA 1OXTA 3HOZB 4FXDA 5DNFA 2WJ0A 1SNOA 3FOVA 1STAA 3D4DA 2RBMA 1BO0A 3Q24A 1ONLA 4KI0A 5HURA 2K5QA 2B2YC 1Q1BA 1TS5A 1FD7D 4RA8A 5JVH3 1CA5A 2WCWA 3NTKA 5D14A 5KYLA 1B1ZA 1AZQA 1LV9A 1EU3A 3PO3B 2RSOA 1S5BD 1C4QA 2A6HD 3D31A 3FVQA 2KHSA 5IGCA 2FMCA 3GTJB 4IUQA 2B39A 2F0KA 1VCIA 1PRTD 1STBA 5KNCA 1RCVD 3BVZA 3DHQA 2A74C 2B2VA 3DWPA 1F77A 2WP8J 1EYCA 4EGVA 4A3DB 5I9PA 3PUVA 2ICIA 5JEAH 3K5OA 1DOMA 1EQVA 1ILQA 2XWBB 4DU9A 3OMCA 4JBWA 1BCPC 2K28A 2F0LA 1ZP7A 3K5LA 3I4LA 4C1NK 4A3BB 2WAQB 4QBNA 1H9MA 1T5XD 4K2LA 1RHPA 5C3EB 1C48A 3K59A 3N52A 3Q22A 1CZGA 3PIO3 1WTRA 1HHVA 2KEEA 3NK9A 3WOEA 5M5YB 3S17B 1YNNC 3BDCA 1ZEQX 1M8AA 1NUCA 4H44C 1SE4A 2B8GA 2B2TC 3PV0A 2PQEA 5FLXL 3P20A 2ENBA 3GO5A 1I3QB 3IFDA 1DONA 2WCZA 2EYJA 1JOOA 1SJED 4HTHA 1OO9B 1JOKA 2NVXB 1B53A 2QCPX 2F0NA 2EYFA 1X32A 1A79A 2K6AA 4FF3A 1GUWA 4QUCA 4UAIA 3HOXB 3Q6SA 4DNRB 3CRKC 3GV6A 2FJ2A 3P1ZB 1D5XC 1RF2D 4JK1C 4KD3A 3JAML 3NE5B 4J8QA 4P2CB 4KTAA 5FLXE 1MSGA 1ZYRD 5EKKA 4HSVA 3BZDB 3C1EA 4IUNA 2SDFA 1EZ8A 4BS9A 4IZ8A 5I9OA 2B2UA 3IF0X 1VMCA 1MGSA 2QEJC 4FXGC 2IX0A 1Q3LA 4ZKBB 1OXXK 1TIID 5EBDA 5CV9A 1DCZA 5FKAC 4IFDI 3RUZA 5ELBA 1F1ZA 4C2MB 3MHBA 1SNCA 3BG3A 2GW6A 3T16A 4XQNA 1UAPA 3OOCA 1CT1D 1SE2A 1TS3A 1QOHA 4G7HC 1IHZA 3BDLA 4ZQ3A 3NPPA 1EOTA 2R92B 1SFOB 2NVTB 1B9MA 1XX8A 3C1FA 1D5MC 1PTOF 3X3NA 4OO1G 1TS2A 1YNJC 3SR1A 4DAVA 2DY7A 2FKHB 1Y69U 2QDBA 2MHVA 1XTCD 3IFTA 1VF5C 3I70A 4HR7B 2J7ZA 5JEAG 1SYGA 5CBAE 2F0WA 3T53B 1PXUA 2A68C 4EVOA 2JEAI 2A69D 2INBA 2ZXPA 1FNWA 2N55A 4A3KB 3CRLC 1PZKD 2V4DA 5G3LF 4X3TA 5EPLA 4A3JB 2L9HA 2K05A 1QG7A 2AQ3B 3V2TA 1E2ZA 1TS4A 4NW2A 2JXMB 3VA5A 3HOYB 1RDPD 2NUCA 1I4GA 2A6EC 1Q1EA 2AWOA 3NP8A 2RVLA 3MZ5A 1RJTA 3NTIA 3QWNA 4CKBA 1ET9A 1KTKA 3D4WA 4ZYSA 1TY0A 4O42A 1KLGD 2L12A 4PNYA 2EO0A 2F0UA 1V1PA 2K04A 4FXKC 5I4DA 2LS01 1HUMA 2RKSA 2J0TD 1W6KA 2X6LA 1IW7D 2B63B 4H7BA 4BWGB 1TT2A 5IODA 1R9TB 2FKCA 1PZID 1XXGA 2NYZD 3GQBA 1GUNA 4RHRA 2BA0A 3FKIB 4BA2I 3DM1A 3BDOA 3SK5A 3N6RA 2YU9B 1TU2B 4X3KA 2F0PA 3S14B 4XDXA 4TQUS 1PTOC 3QO2A 2E2HB 1HH1A 3ITPA 1EY9A 1F2YA 1A3UA 2H1EA 2MGSA 2Z8LA 3A55A 3VYRA 2C5CA 3M4YA 2K7VA 4Q0FA 1H9RA 1I4XA 2XVSA 1O7YA 3J7AV 2LY7A 2R7ZB 3E6ZX 2BE5D 4RGNA 2PZWA 1SDFA 5FO8B 3MVVA 2PW5A 1WTVA 4CGYB 2EVBA 4TRDA 1KNEA 5M3MB 1F2MA 3K58A 4TKKA 1U9RA 3K5MA 2MPMA 2O5IC 4EV1A 1AW7A 1BUVT 1JICA 5FDKA 2EYHA 5IGFA 1H9SA 4R8NA 3FMCA 3CQZB 1CA6A 2FCOA 1D1KA 1JB3A 1PDQA 3SK6A 3M7NA 2JEBI 2Z1CA 2IX3A 4YIJA 1HFNA 2BCOA 4KY5A 2ZYZB 2OF1A 4IFDJ 5I2XA 1HCZA 2D62A 1EQTA 4R8IA 1HUNA 4L6TB 3TP7A 5CORA 3GTMB 1O80A 4XIGS 1NSNS 3UI2A 2SNSA 1CK1A 1SEBD 3KK7A 2OSTA 1EY0A 1DJRD 2FINB 5C5LA 3O13A 3E0JA 4G6VA 1Y8OB 2NBFA 4K8IA 1ICWA 5IOCA 3G7LA 4IFDG 1DYQA 2B2WA 3D3RA 3G6JB 5C4XB 4HAEA 1G2TA 2L11A 4N9TA 2JA8B 2QKIC 4A3MB 3FPUB 1G8ZD 5M3FB 3GTPB 5JVG3 3ZYYX 1ML0D 1HQMC 1SNDA 4AYBB 2WKCA 2E2DC 4HCSA 4ULLA 2EZVA 2RQXA 5T1IA 3HOUB 4IN3A 2VXWA 1PRTB 1VDZA 4QF4A 1A2UA 4XQQA 2Y0SB 5C3XA 1SYFA 5HGTA 3J81L 3H91A 1F9RA 2B2VC 2F03A 1SSOA 3CU7A 2RSNA 3KBXA 2M2LA 1S5FD 4KD4A 4DAYA 3MXNA 4ZK9B 3H6MA 2BDNA 3NWSA 1VF7A 2KCCA 2F0JA 2JP1A 5IT9L 5EGTA 1WD1A 1ENFA 2HDMA 4RHSA 3I90A 4C56C 3OW7A 5DM73 1V1OA 4H0LC 3J81E 4KJNA 4EQNA 4CHTB 1A3VA 3M3YB 3KLRA 1MD2D 1W6JA 2G9HD 4ZUIA 1RKNA 4KHZA 4QMGA 4FNFA 2N88A 5A35A 1UWVA 2WV6D 1Y1VB 4K8JA 3DNXA 4J6HA 2DY8A 5A2QL 5KGUA 2I07B 1U4LA 3TZUA 2IXSA 1RTOA 5CR3A 2A69C 5IT9E 1LT3D 2JSOA 2SEBD 1CTMA 1B2TA 4OHJA 3I8ZA 1EY8A 2D2CC 4M8AA 1X3PA 3C46A 1G6ZA 3FRPB 4A3GB 2DBSA 1D1IA 4C3IB 4OO1H 2K5WA 2PZTA 3H09A 5DAUA 1EL0A 4NDXA 1E2VA 5JPNC 2H4OA 2SOBA 5A2QE 3IAYA 2GJWA 2EYPA 5CBEE 4NP5A 2L55A 1GUSA 3P7JA 5K36G 2XRSD 1GUTA 3RD4A 2AWNA 2F0GA 2B2UC 1L0XB 3PMFA 1CQVA 3OPOA 3PO2B 1OXVA 2X6GA 2F0TA 4G57A 5CGKA 1Y88A 4BY7B 3EROA 4F88A 4EQPA 1IW7C 4E6ZA 3GD7A 2WIWA 3D6WA 2EYLA 1G2SA 4K5VA 3M4OB 3S1QB 5C3WA 1U4PA 5KEEA 1EWHA 1SYCA 2EY2A 1ESFA 5BN4A 1WTQA 1QJOA 2VUMB 4C3JG 5LL6S 5COYA 5IGBA 1CM9A 5LL6X 1JQYD 1BQQT 1QCBD 3S15B 5JJZA 3P1ZA 2L4NA 1HRJA 3HP3A 1EEFD 2NN6I 2OXPA 4IUUA 3S9WA 3TSSA 1LTID 3TMEA 2C9OA 4CKEA 4LAAA 1KNAA 3R8BA 5KNDA 5E1FA 1C8CA 1D2BA 5EKLA 3SVMA 2FLCA 2R3ZA 4O1NA 5JPMC 1EY4A 4X3SA 3AB9A 2BDOA 3ONAB 3AJVB 5J39A 5CV4A 2E75C 2CW0D 5CV8A 1NCVA 3OSOA 4FF1A 3EFXD 1LTAD 2XN9C 5CYUA 3MEHA 2XWJB 1F2LA 4C3IG 4K2KA 4A3EB 1F9PA 1RZNA 1E0BA 2F0OA 3PUYA 1LT5D 1RTNA 2RDFA 2NVYB 1QNUA 1SMYC 3J7YW 1A3TA 2IPKD 3FPPA 2OT2A 3VYSA 5C4JB 4LQEA 4TKOB 4TSSA 1X3QA 5EPKA 3Q0AA 2KVMA 2F1MA 1O7LA 2ZXOA 5EBCA 5KYIA 3V05A 1DOLA 1V8QA 3SXHA 1EY5A 5C0XI 5ISRA 1GHKA 4K6LA 1IYUA 4IALA 1J9OA 3T4AC 1SNQA 3I73A 1SYDA 5CV5A 4RKBA 4PV1C 2IL8A 2PO4A 1JWUD 2ZT9C 3R2IA 4ILWA 2LKVA 3S2HB 2F0SA 5KRUA 3OWFA 3KLSA 3HOVB 3Q23A 3A8JE 1SJHD 1QILA 4RCOA 4HN7A 1EFID 1UEAB 4HCEA 1GEFA 3D6CA 1LTGD 5M5WB 3AMUA 3NHHA 4B9WA 1EU4A 1B9NA 1TWFB 3RLFA 2EPBA 4MN3A 4QBLA 2FL3A 3URYA 5J22A 1AN8A 5E4XA 2BH2A 1IYVA 1AEXA 2VNUD 4RGMA 3R93A 1BOSA 4HMIA 4FP5D 2WINB 5IGDA 2F0VA 2EY5A 1STYA 1JC7A 5CC4A 5T1GA 1BF4A 4IFDH 5CMDA 4C1NI 4DK1A 2ICEC 1MI2A 4XQJA 2CVRA 1IL8A 1I6VC 2OKFA 3LNNA 2F0FA 2WIIB 4FVMA 4E6IA 2WACA 4PMWA 1DM0B 1NAPA 4H13C 2E2JB 4A3IB 3SE0A 1S4ZA 3X3MA 1KABA 1BCPD 4ZUJA 2K33A 5IGGA 1F2ZA 1R0VA 4LJZC 4A93B 3HRZC 1ESRA 4HMJA 1GJXA 1L0YB 4BBSB 1EYDA 4FF2A 2AUKA 3VYTA 2L1BA 4I7ZC 1XMXA 1YNND 2F0DA 1QE6A 5CV7A 1H9JA 1FGBD 4I65A 3LX0A 2AQ2B 2W8MA 2YYZA 1STGA 2A6HC 2NWGA 3A8KE 3SEBA 1K8MA 3R3OA 3NQIA 3KF8A 1WVLA 2R61A 5ELCA 2B2WC 1SNPA 2DNEA 1QNKA 1PRTC 1EIGA 2DNCA 3LWEA 2LMCB 4ID6A 4DGZA 2EYOA 1B50A 3GTOB 4R9WA 2F4IA 3OIQA 3IEYB 1XYIA 1JE4A 2ZYZA 2EY6A 2J4XA 3QIAA 2NTTA 5J1ZA 1PYWD 3W2DA 4KN4C 2RA4A 4QUFA 5LHY1 1WTOA 1Y8NB 1WD0A 4UDUC 1PFBA 5EQ0A 1F9SA 4KMUC 1HXYD 4RGOS 2NN6G 3PUZA 1CHQD 1R4PB 1JCKB 2GA4B 3KBGA 3ND8A 3SHLA 5AFWA 1TWAB 2O5JC 2WB1B 1Z7TA 3ERQA 2E2IB 3NBIA 3QJYA 2WKDA 4ZRZA 4WORA 3MXGA 4OIKA 1A6XA 1DD2A 2EXZA 1IKMA 3NTHA 3EVQA 3HOWB 1V43A 3QOLA 3FDTA 5K36H 3J80L 5C0XJ 1I4RA 4XTCS 3GTLB 1DXMA 1YNJD 2F0MA 4ODGA 2M00A 2KA7A 4U68A 2SNMA 2EJFC 4G4KA 1B3AA 1GUOA 1Y1OA 1LACA 3MXPA 3A7AB 1OB8A 1PTOB 1ZYRC 4WFN3 2A68D 2Z4HA 1DOKA 2L0CA 1VMPA 2B8FA 1LLRD 1B4OA 3J80E 4XT3B 3I4NB 2BOSA 2KEDA 3GTKB 1BDOA 4PQXA 1SAPA 3NUCA 1ENCA 3VR6A 3MFGA 1PFNA 1LTTD 4KY6A 4CJ2C 3S1RB 3VR2A 4FYDA 1PFMA 1EZ6A 1SBBB 5D3DA 2MP1A 4IURA 2K03A 2A6ED 1WTPA 2KJXA 1II3A 4X3UA 1EIHA 1D5ZC 1R4QB 3C3LA 2VB2X 2Z4IA 1I50B 2EOTA 3BYYB 2PPBC 4KKTA 2IX1A 4KY7A 3TN2A 2TSSA 1ET6A 3OHXC 4L8JA 4KJOA 3RMHA 2VLDA 3NSWA 2K5DA 5I6YA 3TDQA 3NBHA 2MUYA 2RDGA 4F7XA 3T51B 4GZYC 4B9XA 3HZXA 3SK8A 4DN4M 1LO5D 1KDCA 1G91A 4WJWA 4ZLTF 1SE3A 3L3OC 4OGQC 1OXSC 1WTWA 1PTOD 2E74C 4IUPA 1CQFA 4F87A 3TP6A 2JJQA 2EJGC 3QB3A 3AU7A 3SK4A 4OL7A 3DMUA 5EPJA 3VA7A 4BA1I 3LWUA 4QIWB 1R11A 2F0HA 4NKLA 3OWEB 4DAPA 1RD9D 5FO9B 3QOJA 3VR3A 4DXGA 1B44D 3BYTB 4KKUA 2K32A 2XIWA 4L63B 4CKCA 4RGTA 1QWYA 2F3VA 1I4HA 5NUCA 4DXFA 1EYAA 3HGBA 2AUJD 3CKIB 3DWAA 2O2LD 3I91A 2IT1A 2NB0A 2HDLA 4KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA2 A;  4DAP A;  4DAV A; 
#chains in the Genus database with same CATH topology
 4R4Q A;  2VUM H;  3F8T A;  3K6O A;  2JA7 B;  5G3L D;  3BVG A;  3OMG A;  3S15 H;  3I4N G;  1QVG A;  3GTG B;  3BT7 A;  2ZXR A;  5C5M A;  1A2T A;  2KEC A;  4LK1 C;  4AIM A;  1ENA A;  2YV5 A;  1STE A;  1E3P A;  1D6E C;  4U67 3;  2MFI A;  2IJ0 A;  2DJF C;  4NB3 A;  3U9O A;  2G9D A;  3TBI B;  2L5T A;  4DFA A;  1S5D D;  3NWT A;  4LFB L;  5C6A A;  2JYO A;  2R93 B;  3HS0 C;  3B6Y A;  2K01 A;  2OQ0 A;  5C4H A;  4G6U A;  4JYA L;  4XYO A;  4BBR B;  1IBL Q;  3KYH C;  1U4M A;  2QW7 A;  4RCN A;  1SNM A;  2XSC A;  3K57 A;  2B2Y A;  1YIJ A;  1WTX A;  2F3W A;  4LF9 L;  5EJW A;  1X65 A;  1GHJ A;  1XWE A;  2PI2 A;  4DA2 A;  1IBK Q;  4DUZ L;  1LTS D;  3AJV A;  4PMC A;  2GVB A;  4LMQ D;  1STH A;  3AYH B;  2EE1 A;  4QL5 A;  4ZQU A;  3MC0 B;  1ICF B;  3VR5 A;  4R4T A;  1BXT A;  1SE8 A;  2BE5 C;  4CDC C;  2EY1 A;  1BR9 A;  4WJ3 M;  1V9P A;  3D8G A;  1Y1V G;  1UUP A;  2HUG A;  1HPC A;  2K1B A;  4A3E H;  4KK7 A;  4BY1 B;  5ELD A;  3T1Y L;  4F8M A;  2GN5 A;  5BN5 A;  3H3V C;  3PGZ A;  3MFY A;  1TKW B;  4DF7 A;  3RZO H;  3S1N B;  4EQ5 A;  2E5L Q;  2NVY H;  4WRD A;  4PG3 A;  1SR3 A;  1LT6 D;  4HJ9 A;  2VB3 X;  4QQB X;  5C4J H;  2M9V A;  3F2D A;  1S3O A;  4M1U B;  4DV2 L;  4LF5 L;  1LT4 D;  2N8N A;  4A3G G;  1ASY A;  3C2P A;  4IPC A;  4DR5 L;  4HJ7 A;  4RAU C;  3U9S A;  1NR2 A;  1SXT A;  1TR5 A;  5FLM G;  5JJI A;  2L15 A;  5FJ8 H;  5ELF A;  1J8I A;  1OXU A;  3RZO B;  2QF7 A;  5GAD C;  3CCR A;  1N36 L;  3A54 A;  3P75 A;  2CZR A;  1I94 L;  1B70 B;  3I3C A;  4IUT A;  1Q90 A;  1LTB D;  1TWC B;  2K52 A;  1Z47 A;  4P75 A;  3J7A 5;  1X3G A;  4QCL A;  3I55 A;  2EJM A;  1UNS A;  4DK0 A;  1P16 A;  3P1H A;  1YNM A;  1YHQ A;  5JEA J;  1C0A A;  4APV A;  2QIL A;  3S2H H;  4BXX G;  4EQO A;  4K5X A;  1K8O A;  2A5H A;  1MBY A;  2JA7 G;  2EDG A;  3JAM E;  2PMZ B;  4J1M A;  2NZ1 D;  4R4C A;  3HOV H;  4CJ1 B;  3CCL A;  3PUW A;  5C44 B;  1PZJ D;  1BCP B;  3MAQ A;  1CI3 M;  4DR2 Q;  2B2T A;  4KHP Q;  5M5W H;  4GKK Q;  5HY6 A;  1T0F A;  2DN8 A;  2KOL A;  1TWF H;  2VY3 A;  4QB4 A;  1JOQ A;  3AEV A;  4YWK A;  1FR3 A;  1QB5 D;  1PRT F;  2NN6 H;  3PIP 3;  4LWC A;  3S1M B;  4UY8 C;  4DR7 Q;  4JI3 L;  1A15 A;  3MA2 B;  4A75 A;  2VW9 A;  3HEJ A;  3H3V H;  1EQQ A;  3MXU A;  1XPO A;  2P5Z X;  2WFW A;  3GTQ B;  3TP5 A;  1E1O A;  3F2U A;  4GOP C;  1NMG A;  1IBK L;  1HA6 A;  1GXD C;  5IIF A;  2NVQ B;  4JG2 A;  1IBM L;  5C4Z A;  4CDF C;  2BA1 A;  3SDZ A;  4I7A A;  4KHV A;  1AZP A;  2KUM A;  3J7A F;  2I0Q A;  5M9O A;  3A0J A;  2O4X A;  3G48 A;  1KIX A;  3EQL C;  2NTS A;  1CFM A;  3QG1 A;  1AE2 A;  1CZW A;  2PZU A;  1OB9 A;  2FMM A;  2KCN A;  1BVS A;  1KAA A;  5KNB A;  2E5L L;  3J81 i;  4NMZ A;  2WIZ A;  2E2J H;  4A3I H;  3ND9 A;  5FLX c;  3K80 C;  3A8I E;  5E3F A;  1Q86 C;  1N34 L;  2HCC A;  3K0Y A;  4A93 H;  2F0I A;  4KN7 C;  3T13 A;  5TSS A;  2CQA A;  2K5N A;  1JJG A;  4BBS H;  1EIY B;  4LF8 Q;  1K83 B;  3E5S A;  2E76 C;  3W3A A;  2PCF B;  3DXJ C;  1EY7 A;  4ME5 A;  1PLF A;  4JBJ A;  4UHV A;  3T56 B;  4A3E G;  4RH6 A;  1M4V A;  2JA6 B;  1ZXT A;  1VQO A;  1DGS A;  4K6D A;  1XNQ Q;  3A5U A;  4GLV B;  2IWH A;  1TVX A;  2DGY A;  4AYB E;  3AFQ A;  1JWM D;  5FO7 B;  4Z9C B;  4R4I A;  1XMO Q;  1VQ5 A;  4FO2 A;  5ELE A;  4Y7N B;  2A1A A;  1KLU D;  4CBV A;  4DK3 C;  1G6P A;  4GN3 B;  3TS2 A;  2HHH Q;  3JAM c;  1XTD A;  3L9A X;  5C0X H;  4ZAI A;  1KDB A;  3OYY A;  1MJC A;  2XNA C;  4P71 A;  2UXB Q;  1NR4 A;  1SYE A;  4LUO A;  5DM6 3;  1VQ4 A;  4P74 A;  1JWS D;  1SYB A;  3RN2 A;  1V1P B;  3L7Z C;  1PH4 A;  4DR2 L;  5GAH C;  2RDH A;  3OIP A;  1VQ8 A;  4QBO A;  3GTO H;  4KHP L;  4GKK L;  4MNO A;  5I2Y A;  4A3F B;  2ID0 A;  2UXC L;  2HQE A;  2F4V Q;  3IEY A;  1HTP A;  4G7O C;  3DEP A;  4N9P A;  5C44 G;  4DAM A;  2PNR C;  1Z6H A;  3I72 A;  1M90 C;  1TWG B;  4K14 A;  5IGE A;  4LFC Q;  1E22 A;  1BBU A;  3WOF A;  1ZKO A;  4JI8 Q;  3GP7 A;  5F2D A;  3PIP A;  2KCT A;  5IYB G;  5J3B A;  1HFG A;  3UDX A;  3HKZ B;  1EWC A;  4MHE A;  4XT1 B;  3RZD B;  2ZJR A;  4C3H B;  2FHT A;  1STN A;  1DZ1 A;  3M85 A;  3CHB D;  2D5D A;  1PH9 A;  2F0Q A;  2OEO A;  3BU2 A;  2JE6 I;  2PW7 A;  1S5E D;  4DV0 Q;  1F9Q A;  5CV6 A;  5I6W A;  3DUZ A;  1WOC A;  5GAE C;  2EYM A;  3U4Z A;  1EY6 A;  5D3I B;  3T1H Q;  2MNA A;  2VQE Q;  1EEI D;  1NY4 A;  3M4Q A;  2ZJP A;  1TWA H;  1AFP A;  2I46 A;  1L1O A;  1Y1W B;  4IQZ A;  5JAV A;  1H9K A;  4LFA L;  2Q8T A;  2E2I H;  1CSP A;  4B08 A;  2HCI A;  5DEH A;  5EKI A;  4XXE A;  1GUG A;  3AFP A;  4H02 A;  1YJN A;  3H0G B;  4YY3 L;  3M9B A;  4POF A;  3TZD A;  1FYC A;  3ZJY C;  1ILP A;  2VS1 A;  1A0I A;  5FOB B;  3HOW H;  4CJ0 B;  3R2T A;  4PMB A;  5M5X B;  2MO1 A;  2N78 A;  3NQT A;  1L1O B;  3TP8 A;  3M4P A;  3M7G A;  4Q5V A;  3GTL H;  2CKZ B;  1LAB A;  1TY2 A;  5BN3 A;  4LF8 L;  3NXW A;  1TWH B;  1K8A C;  1V1Q A;  1HNZ Q;  4RFB A;  4QIW E;  1T5E A;  3KUP A;  3DEO A;  3ULJ A;  1FNV A;  1H9S B;  5KIX A;  2F0E A;  3J81 j;  1TQO A;  4XYQ A;  1RLV A;  1SMY D;  1G29 1;  3V96 A;  5K5P A;  4TKD A;  5D65 A;  3K7A B;  2YTY A;  3MWY W;  4POG A;  5JOB A;  1XMO L;  1CHP D;  2PYK A;  1AP0 A;  3VYU A;  1KDA A;  2JA6 G;  3U4V A;  1MSH A;  4JI1 Q;  1PTO H;  4A3I G;  4K5W A;  4RWS C;  2TMP A;  3TQY A;  1PVO A;  4MIU A;  1PV4 A;  1PMR A;  1N8R C;  1U0L A;  1IKL A;  2N3S A;  1N33 Q;  4HSP A;  1O78 A;  3PUX A;  3D4R A;  4GNX B;  1O7I A;  4V19 0;  2AQ1 B;  1E7Z A;  4DNI A;  2R6G A;  3EA6 A;  1FNU A;  3EBE A;  5IY0 A;  1ROD A;  4R4O A;  4UP7 A;  3I4N H;  1YI2 A;  4BBS G;  1LM0 A;  4DNT B;  2Z0R A;  1O7Z A;  4NXM Q;  3GTK H;  2XGT A;  2JA5 B;  3FEW X;  2GVA A;  1E2W A;  2CV8 A;  4JI6 Q;  5JJL A;  3HG9 A;  2MJ8 A;  2HD3 A;  4ZKC B;  1XNR Q;  4LFC L;  2FXQ A;  5E4W C;  4ABN A;  2F52 A;  3RLO A;  3S1R H;  4JI8 L;  2CHB D;  1IPI A;  1I6H B;  3EJI A;  4A3F G;  2CW0 C;  1X6O A;  1HQR D;  3IKJ A;  4HED A;  4G7Z C;  3KLS X;  4OIJ A;  3S16 B;  3DWQ A;  2Q8I B;  1U4R A;  5C0X G;  3I7F A;  4KV6 A;  4JI5 Q;  2A8V A;  4RKL A;  2AMC B;  1CKO A;  1K9M C;  1BNZ A;  4OO1 I;  2X69 A;  1HTL D;  1Q12 A;  1MJE A;  3PF4 A;  2A73 B;  4DV0 L;  3ERS X;  4S3S A;  3I4M B;  3HKZ G;  3I2Z A;  3A56 A;  1LTR D;  1I4Q A;  4C3H G;  4IUV A;  3A7L A;  2XRQ D;  5LMN W;  1BCP F;  3H94 A;  3CC2 A;  2LFN A;  2IW3 A;  3RNU A;  3MTS A;  5FK9 C;  2IHF A;  3ULP A;  3IRB A;  1Q8I A;  4RG1 A;  3BVM A;  3IL8 A;  2QA4 A;  1Y8P B;  1HA5 A;  3S2D B;  1Y1W G;  2FFK B;  4LFB Q;  1I4P A;  1JR0 D;  1PH6 A;  5IP9 H;  2D9U A;  2QGQ A;  4NXN L;  1QVF A;  2KQ3 A;  2PI2 E;  2Q8R E;  3VR4 A;  4JYA Q;  4OXP A;  4C3J B;  4FF4 A;  4LF7 L;  3WDN A;  1OTC A;  1BBX C;  1JOR A;  3BS1 A;  4EX5 A;  3GV3 A;  3HKS A;  4LF9 Q;  4X64 Q;  4V0B A;  3K5N A;  1WCM B;  1HR0 L;  1S5C D;  4OX9 L;  1GOZ A;  1OXT A;  1IXR A;  4DUZ Q;  3HOZ B;  4FXD A;  5DNF A;  2WJ0 A;  1SNO A;  4DAY B;  2I5H A;  3FOV A;  1STA A;  5FLM H;  3D4D A;  2OCE A;  2RBM A;  1BO0 A;  5IYD H;  3TRE A;  3Q24 A;  1ONL A;  4KI0 A;  5HUR A;  2K5Q A;  2B2Y C;  1Q1B A;  1TS5 A;  1FD7 D;  4RA8 A;  3HOW G;  3K8A A;  5JVH 3;  1CA5 A;  2WCW A;  4B3S Q;  2HQL A;  3NTK A;  5D14 A;  3VDY A;  1VQG A;  5KYL A;  1B1Z A;  1AZQ A;  4NXM L;  1LV9 A;  1EU3 A;  3PO3 B;  2RSO A;  1S5B D;  3E9H A;  4DV2 Q;  4L5S A;  2JA7 H;  1C4Q A;  4JI6 L;  2JA9 A;  2A6H D;  3D31 A;  4DR5 Q;  3FVQ A;  2KHS A;  5IGC A;  2FMC A;  3GTJ B;  3GTG H;  2JA5 G;  4IUQ A;  3RN5 A;  2B39 A;  1EOV A;  2R7F A;  2F0K A;  2PNH A;  1VCI A;  4YWL A;  5LMU L;  1CSQ A;  1PRT D;  4MTK A;  1STB A;  1KC8 C;  5KNC A;  4YHH Q;  1I94 Q;  4JI5 L;  1RCV D;  3BVZ A;  3DHQ A;  4ZCK A;  2A74 C;  2B2V A;  3DWP A;  1F77 A;  2WP8 J;  3F1Z A;  2R93 H;  2Q2U A;  1EYC A;  1NTG A;  4EGV A;  4A3D B;  5I9P A;  3PUV A;  3BZC A;  2ICI A;  4JI2 Q;  5JEA H;  3CXC A;  3K5O A;  1DOM A;  4BBR H;  1EQV A;  1ILQ A;  1YZ6 A;  2XWB B;  4DU9 A;  3OMC A;  3I4M G;  1PH3 A;  4JBW A;  3WWV A;  1BCP C;  4HIM A;  2K28 A;  1RL2 A;  2F0L A;  1ZP7 A;  3K5L A;  4JPB W;  3I4L A;  4C1N K;  4JBM A;  1W3S A;  4A3B B;  2WAQ B;  4QBN A;  3CMA A;  1FJG L;  1H9M A;  3UE1 A;  4UP9 A;  1T5X D;  4K2L A;  1RHP A;  5C3E B;  1C48 A;  3K59 A;  2NVX H;  3N52 A;  3Q22 A;  1CZG A;  3PIO 3;  1WTR A;  1FL0 A;  1HHV A;  1WFQ A;  4JI3 Q;  2KEE A;  4BY1 H;  3NK9 A;  3WOE A;  5M5Y B;  1UE5 A;  3S17 B;  1JT8 A;  1YNN C;  2JN4 A;  3BDC A;  1X56 A;  1ZEQ X;  4X64 L;  1M8A A;  3S1N H;  1NUC A;  4H44 C;  3G4S A;  1SE4 A;  2B8G A;  2B2T C;  3PV0 A;  3UE0 A;  1HZA A;  3PQI A;  2PQE A;  5FLX L;  3P20 A;  3J81 c;  2ENB A;  3GO5 A;  1I3Q B;  3ULL A;  4DV7 L;  3IFD A;  1DON A;  1IBM Q;  2WCZ A;  2EYJ A;  1JOO A;  1SJE D;  4HTH A;  1WCM G;  1OO9 B;  1JOK A;  2NVX B;  1B53 A;  2EQS A;  1JB7 A;  3HOZ G;  2QCP X;  1MIU A;  2F0N A;  2EYF A;  4IOC A;  1X32 A;  5IP9 G;  1A79 A;  2K6A A;  4FF3 A;  1GUW A;  4QUC A;  4UAI A;  4IO9 A;  3HOX B;  2XTI A;  3Q6S A;  4DNR B;  4LW1 A;  3CRK C;  4B3S L;  3GV6 A;  2KCM A;  1TWC H;  2FJ2 A;  3P1Z B;  4JV5 L;  1D5X C;  1RF2 D;  4JK1 C;  1E24 A;  5BR8 Q;  3TEH B;  1N34 Q;  4KD3 A;  3JAM L;  1B3Q A;  4N8F A;  3NE5 B;  3ICE A;  4J8Q A;  4IPD A;  4P2C B;  3CCJ A;  4KTA A;  5FLX E;  1MSG A;  1ZYR D;  5EKK A;  4DV5 Q;  4HSV A;  3BZD B;  3PO3 G;  3C1E A;  4IUN A;  2SDF A;  2Z6K A;  1EZ8 A;  4BS9 A;  4IZ8 A;  5IYD G;  5I9O A;  2B2U A;  4JI7 L;  2VQF Q;  3IF0 X;  1VMC A;  1MGS A;  2QEJ C;  4FXG C;  1L0W A;  5C44 H;  4YHH L;  3U50 C;  2IX0 A;  1Q3L A;  4ZKB B;  2MO0 A;  1OXX K;  2B29 A;  1TII D;  5EBD A;  5CV9 A;  1DCZ A;  5FKA C;  4IFD I;  3DM3 A;  3RUZ A;  5ELB A;  5IYB H;  1F1Z A;  4C2M B;  4OEL B;  3MHB A;  3W1B A;  1SNC A;  3BG3 A;  2GW6 A;  3T16 A;  4XQN A;  3S1M H;  1UAP A;  4JI2 L;  3OOC A;  1CT1 D;  1SE2 A;  2HIV A;  1TS3 A;  1QOH A;  4GLA C;  4G7H C;  3GTQ H;  1GKH A;  1IHZ A;  3BDL A;  4ZQ3 A;  3OW2 A;  3NPP A;  1EOT A;  2R92 B;  3K81 C;  1SFO B;  2NVT B;  1B9M A;  1XX8 A;  3C1F A;  1D5M C;  1WTH A;  2RCF A;  1PTO F;  3X3N A;  1IZ6 A;  2UUA L;  2NVQ H;  4OO1 G;  1TS2 A;  2UXC Q;  1YNJ C;  2K5V A;  3J80 i;  3SR1 A;  4DAV A;  2DY7 A;  2FKH B;  1Y69 U;  1Q82 C;  1J6Q A;  2QDB A;  4A3B G;  2WAQ G;  2MHV A;  1XTC D;  1C7Y A;  3IFT A;  3PIO A;  1YJ9 A;  4B3M Q;  2R93 G;  1VF5 C;  5C3E G;  3I70 A;  4GN5 A;  1XPR A;  4HR7 B;  2J7Z A;  2NZH A;  5JEA G;  1PH8 A;  1SYG A;  5CBA E;  4BBR G;  2UUC Q;  2F0W A;  3T53 B;  1PXU A;  2A68 C;  4IPG A;  4EVO A;  2JEA I;  2WB1 E;  2A69 D;  2INB A;  1NMF A;  1A62 A;  2ZXP A;  1FNW A;  2IY5 B;  2LXJ A;  4PZ7 A;  2N55 A;  4A3K B;  3CRL C;  1PZK D;  1K83 H;  2V4D A;  4CDE C;  4LFA Q;  5G3L F;  4X66 Q;  1NNX A;  1IL2 A;  2E8G A;  1T9H A;  2JA6 H;  4X3T A;  4BY1 G;  4PZ8 A;  5EPL A;  4YY3 Q;  1VS0 A;  4A3J B;  3LGJ A;  1X9N A;  4DV4 Q;  5BR8 L;  2L9H A;  2K05 A;  1QG7 A;  2AQ3 B;  2V1C C;  3V2T A;  4Y7N H;  3OTO L;  1E2Z A;  1TS4 A;  1L1O C;  2JXM B;  4NW2 A;  3VA5 A;  3HOY B;  1RDP D;  2NUC A;  1I4G A;  2A6E C;  4DV5 L;  4P73 A;  1Q1E A;  2AWO A;  3NP8 A;  2RVL A;  3MZ5 A;  1RJT A;  3NTI A;  3QWN A;  3U58 A;  1WJJ A;  5AJ3 Q;  4CKB A;  2VQF L;  1ET9 A;  1KTK A;  3D4W A;  4ZYS A;  3STB D;  1TY0 A;  4O42 A;  1KLG D;  5H1S E;  2L12 A;  1HH2 P;  1YEZ A;  4PNY A;  2EO0 A;  2F0U A;  1V1P A;  2K04 A;  2ZJQ A;  4NPS A;  2F3I A;  4FXK C;  5I4D A;  2LS0 1;  1HUM A;  4A3F H;  2RKS A;  3F2B A;  2J0T D;  1W6K A;  2X6L A;  1IW7 D;  2B63 B;  1TWG H;  4H7B A;  2AKW B;  1QUQ B;  1TT2 A;  4BWG B;  5IOD A;  1R9T B;  2CWA A;  2FKC A;  1PZI D;  1N9W A;  1XXG A;  4MZ9 A;  2NYZ D;  3GQB A;  1WI5 A;  1GUN A;  1U5K A;  4RHR A;  2BA0 A;  2VZA A;  3FKI B;  4BA2 I;  3RZD H;  4C3H H;  3DM1 A;  3CCM A;  3BDO A;  4Y52 H;  3SK5 A;  3N6R A;  1H95 A;  4DV1 L;  1TU2 B;  4X3K A;  2F0P A;  2YU9 B;  3S14 B;  4XDX A;  3SGI A;  1KXL A;  1Q8K A;  2DUD A;  2K4K A;  3G71 A;  4TQU S;  2R92 G;  1PTO C;  3QO2 A;  2E2H B;  1HH1 A;  3ITP A;  1EY9 A;  1F2Y A;  1A3U A;  2YTX A;  4LF4 L;  3KDF A;  1Y1W H;  2H1E A;  2MGS A;  2Z8L A;  3I56 A;  3A55 A;  2UUB L;  4B3M L;  3VYR A;  2C5C A;  3M4Y A;  2K7V A;  3E3X A;  4Q0F A;  1H9R A;  1I4X A;  2XVS A;  1O7Y A;  4UPA A;  3H0G H;  3KJO A;  3J7A V;  2LY7 A;  2R7Z B;  2UUC L;  4N8X 1;  3CQZ H;  3E6Z X;  2BE5 D;  4RGN A;  4LNQ A;  4ALP A;  2PZW A;  1SDF A;  5FO8 B;  3MVV A;  2PW5 A;  4ME3 A;  1WTV A;  4CGY B;  1N32 Q;  1EYG A;  2EVB A;  5M5X H;  4TRD A;  3KDF B;  2AHO B;  1KNE A;  1CUK A;  2UXD L;  2K14 A;  3KFU A;  5M3M B;  1F2M A;  3K58 A;  4TKK A;  1U9R A;  4X66 L;  1TWH H;  3K5M A;  2MPM A;  4OWX B;  2O5I C;  1SRO A;  4EV1 A;  3CPF A;  1AW7 A;  1K28 A;  1BUV T;  1W2B A;  1JIC A;  5FDK A;  3FP9 A;  2EYH A;  4A3K G;  5IGF A;  1H9S A;  4R8N A;  3FMC A;  3S24 A;  2UU9 L;  3CQZ B;  3AQQ A;  1CA6 A;  3K7A H;  4R1J A;  2FCO A;  1D1K A;  1JB3 A;  1PDQ A;  4DV4 L;  3SK6 A;  4NXN Q;  3M7N A;  2JEB I;  2Z1C A;  4LF7 Q;  1Q7Y C;  2IX3 A;  2JQO A;  4YIJ A;  1HFN A;  4O0A A;  2BCO A;  4KY5 A;  2ZYZ B;  2OF1 A;  1HR0 Q;  2QDL A;  4OX9 Q;  4IFD J;  5AJ3 L;  1PH7 A;  4JW0 A;  5I2X A;  3HOY G;  3F2C A;  4GNX A;  1HCZ A;  4OWT B;  2D62 A;  2JA5 H;  1EQT A;  4R8I A;  1HUN A;  4L6T B;  3TP7 A;  5COR A;  3GTM B;  4X65 Q;  1O80 A;  4XIG S;  1NSN S;  3ER0 A;  3UI2 A;  2SNS A;  1I6H H;  1CK1 A;  1MKH A;  1SEB D;  1KRS A;  3UDG A;  3KK7 A;  1BKB A;  4DR3 L;  2OST A;  3S16 H;  1VQD A;  1TXY A;  2ZM6 Q;  1EY0 A;  1HZ9 A;  1DJR D;  2FIN B;  5C5L A;  3O13 A;  3E0J A;  4G6V A;  4TVA B;  5IYC H;  1Y8O B;  2NBF A;  4K8I A;  1FGU A;  1ICW A;  5IOC A;  3G7L A;  4IFD G;  1DYQ A;  3I4M H;  3FKI G;  4HJ8 A;  2B2W A;  1A63 A;  3D3R A;  3G6J B;  2ES2 A;  5C4X B;  4HAE A;  1G2T A;  2L11 A;  4N9T A;  5LMU Q;  4A3C G;  1HZB A;  3BZK A;  2JA8 B;  2QKI C;  4A3M B;  3FPU B;  1G8Z D;  5M3F B;  3GTP B;  5JVG 3;  1NJI C;  4PZ6 A;  3ZYY X;  1ML0 D;  1HQM C;  4DR4 L;  3S2D H;  1SND A;  4AYB B;  2WKC A;  2E2D C;  4HCS A;  4ULL A;  1X55 A;  3JAM i;  2EZV A;  1VQL A;  2RQX A;  5T1I A;  3HOU B;  4IN3 A;  1N32 L;  1GM5 A;  2VXW A;  1P8L A;  1PRT B;  4C3J H;  1VDZ A;  2R7Z G;  4QF4 A;  1A2U A;  4XQQ A;  2Y0S B;  5C3X A;  1SYF A;  1Y14 B;  5HGT A;  3J81 L;  1WCM H;  3CCS A;  3H91 A;  4OWW B;  1F9R A;  2B2V C;  3HOZ H;  3KF6 A;  2F03 A;  1SSO A;  3CU7 A;  2RSN A;  3KBX A;  2M2L A;  1KQS A;  1FJG Q;  1S5F D;  4KD4 A;  4DAY A;  3MXN A;  4ZK9 B;  4DR6 L;  4X6A H;  3H6M A;  5IE8 A;  5IP7 G;  5IWA Q;  2BDN A;  3NWS A;  1D7Q A;  1VF7 A;  2R7D A;  1UE6 A;  1B7Y B;  3H0G G;  2KCC A;  2F0J A;  2JP1 A;  5IT9 L;  1PH2 A;  4P72 A;  5EGT A;  3CCE A;  1WD1 A;  1ENF A;  2HDM A;  3KF6 B;  4RHS A;  4DV7 Q;  3MXN B;  3I90 A;  4C56 C;  3OW7 A;  3J7Z C;  3PO3 H;  5DM7 3;  1V1O A;  4H0L C;  3J81 E;  1S40 A;  4KJN A;  4EQN A;  4CHT B;  1A3V A;  3M3Y B;  1FVI A;  3KLR A;  3NEM A;  1MD2 D;  1W6J A;  2G9H D;  4ZUI A;  1RKN A;  4RMF A;  4KHZ A;  4X65 L;  4QMG A;  3GTJ H;  4FNF A;  2N88 A;  5A35 A;  1UWV A;  2WV6 D;  1Y1V B;  4K8J A;  3DNX A;  4J6H A;  2DY8 A;  1QVC A;  5A2Q L;  5KGU A;  2LXK A;  1VQF A;  2ZM6 L;  2I07 B;  1U4L A;  3TZU A;  3H15 A;  2IXS A;  1RTO A;  5CR3 A;  1JE5 A;  2A69 C;  5IT9 E;  4JV5 Q;  1K8G A;  1LT3 D;  1VQ9 A;  2JSO A;  2SEB D;  2A19 A;  1CTM A;  1B2T A;  4OHJ A;  4DK6 C;  3I8Z A;  4A3D H;  1EY8 A;  2D2C C;  2PMZ E;  4M8A A;  4GKJ Q;  1X3P A;  4O2D A;  3L0O A;  2Q2T A;  3C46 A;  1G6Z A;  3PF5 A;  3FRP B;  3A5Z B;  3D0F A;  4A3G B;  5HGQ A;  2DBS A;  1D1I A;  4C3I B;  4OO1 H;  4B3T L;  4JI7 Q;  2K5W A;  2PZT A;  1PH1 A;  3CCQ A;  3H09 A;  5DAU A;  1EL0 A;  4J15 A;  2B3G A;  5C4X G;  2ZTC A;  4NDX A;  1E2V A;  4A3B H;  5JPN C;  2JA8 G;  2H4O A;  2SOB A;  3E9I A;  5A2Q E;  4A3M G;  3J80 c;  3IAY A;  2GJW A;  2EYP A;  5CBE E;  5C3E H;  4NP5 A;  2L55 A;  1GUS A;  4YWM A;  5M3F G;  1A8V A;  3P7J A;  5K36 G;  2XRS D;  4L5R C;  2Z6K C;  1GUT A;  3RD4 A;  4JI4 L;  1LUZ A;  4AYB G;  2AWN A;  5IYC G;  5ELO A;  3BJU A;  3STB C;  2F0G A;  2B2U C;  5M5Y H;  1L0X B;  3S17 H;  3PMF A;  1CQV A;  3OPO A;  3PO2 B;  1OXV A;  2X6G A;  2F0T A;  3HOU G;  1E1T A;  4G57 A;  2HIX A;  5CGK A;  1Y88 A;  4BY7 B;  3ERO A;  4F88 A;  4EQP A;  1I3Q H;  1IW7 C;  2Y0S G;  4E6Z A;  3PCO B;  2UUA Q;  3GD7 A;  3QR8 A;  2WIW A;  2K50 A;  5IWA L;  3D6W A;  2EYL A;  1G2S A;  4K5V A;  3M4O B;  3G6E A;  1YJW A;  2VL6 A;  3S1Q B;  5C3W A;  1U4P A;  5KEE A;  4JI0 L;  1EWH A;  2OTJ A;  1SYC A;  4DKA C;  2EIF A;  2EY2 A;  3HOX H;  1ESF A;  5BN4 A;  1WTQ A;  4JOI A;  1EIF A;  1QJO A;  2VUM B;  4C3J G;  5LL6 S;  5COY A;  5IGB A;  1CM9 A;  5LL6 X;  1JQY D;  1PYB A;  1M1K C;  1BQQ T;  1QCB D;  3S15 B;  1Q46 A;  5JJZ A;  1EUJ A;  2Q2I A;  3P1Z A;  1J5E L;  4GS3 A;  4HIO A;  2L4N A;  1HRJ A;  3HP3 A;  2RHQ B;  1EEF D;  1D8L A;  2NN6 I;  2OXP A;  4IUU A;  3S9W A;  3TSS A;  1LTI D;  3TME A;  3H3V I;  2C9O A;  4CKE A;  3NEL A;  4LAA A;  3L2P A;  5IT9 c;  1KNA A;  3R8B A;  5KND A;  4AQY Q;  5E1F A;  1C8C A;  5JJK A;  1D2B A;  1PH5 A;  5EKL A;  3SVM A;  2FLC A;  2R3Z A;  4A3L H;  4O1N A;  5JPM C;  4K0K L;  4X62 Q;  4L5Q A;  3OTO Q;  4C2M H;  1EY4 A;  4X3S A;  3AB9 A;  1YVC A;  4GKJ L;  2BDO A;  3ONA B;  1X54 A;  3AJV B;  5J39 A;  5CV4 A;  3UDI A;  2E75 C;  2CW0 D;  3DLL A;  5CV8 A;  1NCV A;  3OSO A;  4FF1 A;  3EFX D;  1LTA D;  2XN9 C;  5CYU A;  2R92 H;  1SFO H;  3MEH A;  2NVT H;  3RLN A;  2XWJ B;  1F2L A;  4C3I G;  4K2K A;  4A3E B;  1F9P A;  1RZN A;  1E0B A;  2F0O A;  3PUY A;  1YIT A;  3HKZ E;  1LT5 D;  1RTN A;  1JMC A;  2RDF A;  2NVY B;  1NBW A;  4A4I A;  1QNU A;  4JBK A;  1SMY C;  3J7Y W;  1K73 C;  1A3T A;  2IPK D;  3FPP A;  4A3D G;  2RF4 A;  2OT2 A;  3PSI A;  3VYS A;  5C4J B;  4TKO B;  4LQE A;  4TSS A;  1JJ2 A;  1X3Q A;  2ZTE A;  1YNX A;  2ZTD A;  4DV1 Q;  5EPK A;  1VQI A;  3Q0A A;  2KVM A;  2F1M A;  3PO2 G;  1O7L A;  2ZXO A;  5EBC A;  4LUV A;  3GDE A;  5KYI A;  2RHS B;  2LSS A;  3V05 A;  1DOL A;  4BY7 G;  1V8Q A;  3SXH A;  1EY5 A;  5C0X I;  2ATW A;  5ISR A;  3CCU A;  1VQK A;  4LF4 Q;  2BH8 A;  1GHK A;  4A3K H;  4K6L A;  2UUB Q;  3CD6 A;  1IYU A;  4IAL A;  1J9O A;  1HNX Q;  3T4A C;  1SNQ A;  1CKN A;  5DLQ E;  3I73 A;  1SYD A;  2CCZ A;  4L5T A;  5CV5 A;  4RKB A;  5EAY A;  4PV1 C;  2IL8 A;  4A3J H;  2PO4 A;  1JWU D;  2ZT9 C;  3R2I A;  3CP0 A;  4FDB A;  4ILW A;  2LKV A;  2OTL A;  3S2H B;  2F0S A;  1YBY A;  5KRU A;  1IBL L;  4B3R Q;  2VUM G;  3OWF A;  3KLS A;  1VQH A;  3HOV B;  5GAG C;  3Q23 A;  3HOY H;  3A8J E;  2UXD Q;  1YHB A;  2G5D A;  1SJH D;  1QIL A;  4RCO A;  4HN7 A;  1EFI D;  1UEA B;  4HCE A;  1GEF A;  3D6C A;  4IOA A;  2KEN A;  1CKN B;  1UE1 A;  1LTG D;  5M5W B;  3AMU A;  3NHH A;  4DPG A;  4B9W A;  1EU4 A;  1VQC A;  4DV3 Q;  4AQY L;  1B9N A;  1TWF B;  3RLF A;  2EPB A;  4MN3 A;  2HT1 A;  1MHW C;  4QBL A;  1SLJ A;  2FL3 A;  2UU9 Q;  1XJV A;  3URY A;  5J22 A;  1AN8 A;  3HOX G;  5E4X A;  3EN2 A;  2BH2 A;  1IYV A;  4X62 L;  1AEX A;  2VNU D;  4IJH A;  4RGM A;  4HIK A;  3CC4 A;  2B63 H;  1GVP A;  3R93 A;  1BOS A;  4HMI A;  1ASZ A;  4FP5 D;  1QUQ A;  1BBW A;  2WIN B;  5IGD A;  1R9T H;  3CF5 A;  2F0V A;  2EY5 A;  1STY A;  3KOJ A;  1JC7 A;  5CC4 A;  5T1G A;  1BF4 A;  4IFD H;  5CMD A;  1NE3 A;  3FKI H;  4C1N I;  4DK1 A;  2ICE C;  1MI2 A;  4XQJ A;  2YU9 H;  1VQA A;  2CVR A;  3S14 H;  1IL8 A;  4A3C H;  1I6V C;  1VQB A;  2OKF A;  3LNN A;  2D0P A;  2F0F A;  2WII B;  2E2H H;  4FVM A;  4A3L G;  4E6I A;  3W1G A;  2WAC A;  4PMW A;  1DM0 B;  3W5O A;  1NAP A;  1I5F A;  4H13 C;  2E2J B;  4A3I B;  4OEM B;  3SE0 A;  1S4Z A;  4DR3 Q;  4GNX C;  3X3M A;  1KAB A;  4AH6 A;  3K7U C;  1BCP D;  5ELN A;  4ZUJ A;  2K33 A;  5IGG A;  1F2Z A;  1R0V A;  4LJZ C;  4A93 B;  3K0X A;  3HRZ C;  1B8A A;  1ESR A;  4JCV E;  2R7Z H;  4HMJ A;  1VQJ A;  1GJX A;  1L0Y B;  1CKM A;  4BBS B;  1EYD A;  4QJF A;  2Y0S E;  1K3R A;  2ALY B;  4FF2 A;  1VQE A;  2AUK A;  3VYT A;  3CPW A;  4JVZ A;  1L2F A;  1K0S A;  2L1B A;  1GO3 E;  4I7Z C;  5M3M H;  1XMX A;  4YCV A;  1YNN D;  2F0D A;  2I5M X;  4GOP A;  1HNW Q;  1QE6 A;  4WJ4 A;  5CV7 A;  1HNX L;  2OWO A;  5FJ8 G;  1H9J A;  5IP7 H;  5LMN Q;  1QZG A;  1FGB D;  2H5X A;  3CCV A;  4I65 A;  3LX0 A;  2AQ2 B;  2W8M A;  2YYZ A;  1STG A;  4DR4 Q;  2A6H C;  2NWG A;  3A8K E;  3SEB A;  1K8M A;  3R3O A;  4JC0 A;  3NQI A;  3KF8 A;  4GLX A;  4HJA A;  1SRU A;  2R61 A;  1WVL A;  4DR7 L;  5ELC A;  3UDF A;  2B2W C;  1SNP A;  2DNE A;  4B3R L;  2KBN A;  1QNK A;  1PRT C;  1EIG A;  3CAM A;  4GOP B;  2DNC A;  3LWE A;  2LMC B;  5L37 A;  3A74 A;  4ID6 A;  4DGZ A;  2EYO A;  1B50 A;  3GTO B;  2D0O A;  4R9W A;  2F4I A;  3OIQ A;  3IEY B;  1XYI A;  1JE4 A;  4DV3 L;  2ZYZ A;  3HOV G;  2EY6 A;  2J4X A;  3QIA A;  2NTT A;  5J1Z A;  1PYW D;  4OON A;  2N49 A;  3KF8 B;  3W2D A;  3Q8D A;  4KN4 C;  2Z6B A;  2RA4 A;  3TRZ A;  2I5L X;  4QUF A;  5LHY 1;  4DR6 Q;  1WTO A;  4HJ5 A;  1Y8N B;  1WD0 A;  4UDU C;  1PFB A;  1X3E A;  3GTM H;  2K5H A;  1UEB A;  1F9S A;  4MTN A;  4KMU C;  5EQ0 A;  5E7N A;  1HXY D;  4RGO S;  4A3J G;  2NN6 G;  3PUZ A;  2PQA A;  1CHQ D;  1R4P B;  4GN4 B;  1JCK B;  2CFM A;  2GA4 B;  3KBG A;  3ND8 A;  3SHL A;  5AFW A;  2CH4 W;  2ASB A;  1TWA B;  2O5J C;  1XMQ Q;  1PYS B;  2WB1 B;  1VQP A;  1HZC A;  1Z7T A;  3ERQ A;  4KLK A;  2E2I B;  3NBI A;  3QJY A;  4YCW A;  2RCN A;  2WKD A;  4ZRZ A;  2EXD A;  4WOR A;  3MXG A;  4OIK A;  1A6X A;  2PQA B;  1XPU A;  4A76 A;  5C4X H;  1DD2 A;  1XNQ L;  2EXZ A;  2JA8 H;  1IKM A;  4A3M H;  2B63 G;  1KAW A;  4DV6 Q;  3NTH A;  5M3F H;  2NZO A;  3EVQ A;  1V43 A;  3GTP H;  1VQM A;  3HOW B;  3QOL A;  3FDT A;  5K36 H;  3J80 L;  4HID A;  2HHH L;  5GQO A;  5C0X J;  1WYD A;  1I4R A;  3EIV A;  4XTC S;  4DR1 Q;  3GTL B;  1DXM A;  1PFS A;  1YNJ D;  2F0M A;  4ODG A;  1KHI A;  2JK8 A;  2M00 A;  3E0E A;  3HOU H;  2UXB L;  2KHJ A;  3CME A;  2KA7 A;  3KJP A;  4A93 G;  4U68 A;  3I4O A;  1KRT A;  3RR5 A;  2SNM A;  4LF6 Q;  2EJF C;  4B3T Q;  4G4K A;  4DUY Q;  1HNW L;  1B3A A;  2WAQ E;  5LMN L;  1GUO A;  1Y1O A;  1LAC A;  2F4V L;  1KD1 C;  3MXP A;  3A7A B;  1EQR A;  1OB8 A;  1PTO B;  1ZYR C;  4WFN 3;  1K0R A;  2A68 D;  1K3B C;  2Z4H A;  1KL9 A;  3NEN A;  1DOK A;  2L0C A;  1S72 A;  1VMP A;  2B8F A;  1LLR D;  1B4O A;  4JI4 Q;  3J80 E;  1VQ6 A;  4XT3 B;  1AE3 A;  3KLW A;  3I4N B;  2BOS A;  1LTL A;  2KED A;  3GTK B;  1BDO A;  4PQX A;  1SAP A;  1C9O A;  3NUC A;  1ENC A;  3VR6 A;  1I50 H;  3MFG A;  4QGU A;  1PFN A;  5M3M G;  2QEX A;  1LTT D;  4KY6 A;  4CJ2 C;  3T1H L;  2DJG C;  2VQE L;  3S1R B;  2K75 A;  3VR2 A;  3MEF A;  4FYD A;  1PFM A;  1EZ6 A;  1SBB B;  5D3D A;  2MP1 A;  4IUR A;  3M3Y H;  2K03 A;  3HFZ B;  2A6E D;  1WTP A;  1YHA A;  4JI0 Q;  1Y1V H;  2KJX A;  1IYJ B;  1VQ7 A;  1II3 A;  4X3U A;  1EIH A;  1D5Z C;  1R4Q B;  3CC7 A;  3C3L A;  2VB2 X;  2Z4I A;  1I50 B;  2EOT A;  3BYY B;  2PPB C;  2Q2H A;  4KKT A;  2IX1 A;  1GD7 A;  4KY7 A;  3TN2 A;  2TSS A;  1J5E Q;  1ET6 A;  3OHX C;  1XMQ L;  4L8J A;  5GRO A;  1G51 A;  4KJO A;  4IPH A;  3RMH A;  3JC6 6;  3FHW A;  3NSW A;  2VLD A;  2K5D A;  1HNZ L;  1SN8 A;  5I6Y A;  3TDQ A;  3NBH A;  2MUY A;  1EWI A;  4A3G H;  4JOI C;  1QZH A;  1Z9F A;  3P1Y A;  2RDG A;  4F7X A;  3T51 B;  4C3I H;  4GZY C;  2WB1 G;  4B9X A;  2MQH A;  3HZX A;  3CW2 C;  3SK8 A;  4UP8 A;  1X3F A;  4DN4 M;  4YCU A;  4DV6 L;  1LO5 D;  1VQN A;  1KDC A;  1AH9 A;  1G91 A;  4WJW A;  4ZLT F;  2IHE A;  1SE3 A;  1HR0 W;  4JI1 L;  2Z9H A;  3L3O C;  4DR1 L;  3T1Y Q;  4K0K Q;  4OGQ C;  1OXS C;  2CH4 A;  1WTW A;  1N33 L;  1PTO D;  2E74 C;  3NBH B;  1UE7 A;  4IJL A;  4IUP A;  1CQF A;  1HJP A;  4F87 A;  3TS0 A;  3TP6 A;  2JJQ A;  3QB3 A;  1JJC B;  2EJG C;  3AU7 A;  4OL7 A;  3SK4 A;  3DMU A;  5EPJ A;  4CDD C;  4BA1 I;  3VA7 A;  4LF6 L;  2Z0S A;  3LWU A;  4DUY L;  4QIW B;  2KHI A;  1PA6 A;  1R11 A;  2F0H A;  3PO2 H;  4NKL A;  1Q81 C;  4BXX H;  3OWE B;  4DAP A;  1RD9 D;  5FO9 B;  4LF5 Q;  3QOJ A;  3VR3 A;  4DXG A;  4BY7 H;  1B44 D;  3BYT B;  2CQO A;  4KKU A;  2C35 B;  2K32 A;  2XIW A;  2OQK A;  4L63 B;  4CKC A;  1XNR L;  4RGT A;  2YTV A;  1QWY A;  2F3V A;  1I4H A;  5NUC A;  4DXF A;  4QY7 A;  1EYA A;  3HGB A;  1SMX A;  2AUJ D;  3CKI B;  3M4O H;  1N36 Q;  3DWA A;  3S1Q H;  1RIP A;  2O2L D;  1EFW A;  1LYL A;  1PHJ A;  2CWP A;  3I91 A;  2IT1 A;  2NB0 A;  4LUZ A;  2HDL A;  4KKS A; 
#chains in the Genus database with same CATH homology
 3K6O A;  2JA7 B;  5G3L D;  3BVG A;  3OMG A;  3GTG B;  3BT7 A;  2ZXR A;  5C5M A;  1A2T A;  2KEC A;  4LK1 C;  1ENA A;  1STE A;  1D6E C;  4U67 3;  2IJ0 A;  3U9O A;  2G9D A;  3TBI B;  2L5T A;  4DFA A;  1S5D D;  3NWT A;  5C6A A;  2JYO A;  2R93 B;  3HS0 C;  2K01 A;  5C4H A;  4G6U A;  4XYO A;  4BBR B;  1U4M A;  4RCN A;  1SNM A;  2XSC A;  3K57 A;  2B2Y A;  1WTX A;  2F3W A;  5EJW A;  1XWE A;  1GHJ A;  4DA2 A;  1LTS D;  3AJV A;  4PMC A;  4LMQ D;  1STH A;  2EE1 A;  4ZQU A;  3MC0 B;  3VR5 A;  1BXT A;  2BE5 C;  2EY1 A;  1BR9 A;  3D8G A;  1UUP A;  2HUG A;  1HPC A;  2K1B A;  4KK7 A;  4BY1 B;  5ELD A;  4F8M A;  5BN5 A;  3H3V C;  3MFY A;  1TKW B;  4DF7 A;  3S1N B;  4WRD A;  1LT6 D;  2VB3 X;  2M9V A;  4M1U B;  1LT4 D;  3C2P A;  4RAU C;  3U9S A;  1NR2 A;  1SXT A;  1TR5 A;  5ELF A;  1J8I A;  1OXU A;  3RZO B;  2QF7 A;  3A54 A;  3P75 A;  2CZR A;  3I3C A;  4IUT A;  1Q90 A;  1LTB D;  1TWC B;  1Z47 A;  4QCL A;  2EJM A;  1UNS A;  4DK0 A;  3P1H A;  1YNM A;  5JEA J;  2QIL A;  4EQO A;  4K5X A;  1K8O A;  2A5H A;  1MBY A;  2EDG A;  3JAM E;  2PMZ B;  4J1M A;  2NZ1 D;  4CJ1 B;  3PUW A;  5C44 B;  1PZJ D;  1BCP B;  3MAQ A;  1CI3 M;  2B2T A;  1T0F A;  2DN8 A;  2KOL A;  4QB4 A;  1JOQ A;  1FR3 A;  1QB5 D;  1PRT F;  2NN6 H;  3PIP 3;  3S1M B;  1A15 A;  3MA2 B;  3HEJ A;  3MXU A;  3GTQ B;  3TP5 A;  3F2U A;  1HA6 A;  1GXD C;  5IIF A;  2NVQ B;  5C4Z A;  2BA1 A;  3SDZ A;  4KHV A;  1AZP A;  2KUM A;  3J7A F;  5M9O A;  2O4X A;  3EQL C;  2NTS A;  1CFM A;  3QG1 A;  1CZW A;  2PZU A;  1OB9 A;  2FMM A;  2KCN A;  1KAA A;  5KNB A;  4NMZ A;  2WIZ A;  3ND9 A;  3A8I E;  5E3F A;  2HCC A;  3K0Y A;  2F0I A;  4KN7 C;  3T13 A;  5TSS A;  2CQA A;  1K83 B;  3E5S A;  2E76 C;  3W3A A;  2PCF B;  3DXJ C;  1EY7 A;  4ME5 A;  1PLF A;  3T56 B;  4RH6 A;  1M4V A;  2JA6 B;  1ZXT A;  4K6D A;  2IWH A;  1TVX A;  1JWM D;  5FO7 B;  4Z9C B;  4FO2 A;  5ELE A;  4Y7N B;  1KLU D;  4CBV A;  3L9A X;  5C0X H;  4ZAI A;  1KDB A;  2XNA C;  1NR4 A;  1SYE A;  5DM6 3;  1JWS D;  1SYB A;  1V1P B;  3L7Z C;  2RDH A;  3OIP A;  4QBO A;  5I2Y A;  4A3F B;  2ID0 A;  2HQE A;  3IEY A;  1HTP A;  4G7O C;  3DEP A;  4N9P A;  2PNR C;  1Z6H A;  3I72 A;  1TWG B;  4K14 A;  5IGE A;  3WOF A;  1ZKO A;  3GP7 A;  5F2D A;  1HFG A;  3HKZ B;  1EWC A;  4MHE A;  4XT1 B;  3RZD B;  4C3H B;  2FHT A;  1STN A;  1DZ1 A;  3M85 A;  3CHB D;  2D5D A;  2F0Q A;  2OEO A;  2JE6 I;  2PW7 A;  1S5E D;  1F9Q A;  5CV6 A;  5I6W A;  3DUZ A;  2EYM A;  1EY6 A;  5D3I B;  1EEI D;  1AFP A;  2I46 A;  1Y1W B;  4IQZ A;  5JAV A;  1H9K A;  2Q8T A;  4B08 A;  2HCI A;  5DEH A;  5EKI A;  4XXE A;  1GUG A;  3H0G B;  3TZD A;  1FYC A;  1ILP A;  2VS1 A;  5FOB B;  4CJ0 B;  3R2T A;  4PMB A;  5M5X B;  3NQT A;  3TP8 A;  3M7G A;  4Q5V A;  1LAB A;  1TY2 A;  5BN3 A;  3NXW A;  1TWH B;  4RFB A;  1T5E A;  3KUP A;  3DEO A;  1FNV A;  1H9S B;  5KIX A;  2F0E A;  1TQO A;  4XYQ A;  1RLV A;  1SMY D;  1G29 1;  3V96 A;  5K5P A;  4TKD A;  5D65 A;  3K7A B;  3MWY W;  5JOB A;  1CHP D;  2PYK A;  1AP0 A;  3VYU A;  1KDA A;  1MSH A;  1PTO H;  4K5W A;  4RWS C;  2TMP A;  4MIU A;  1PMR A;  1IKL A;  4HSP A;  1O78 A;  3PUX A;  3D4R A;  4V19 0;  2AQ1 B;  2R6G A;  3EA6 A;  1FNU A;  3P1Y A;  1ROD A;  4DNT B;  2Z0R A;  1O7Z A;  2JA5 B;  3FEW X;  1E2W A;  2CV8 A;  3HG9 A;  2MJ8 A;  4ZKC B;  5E4W C;  4ABN A;  1IPI A;  2CHB D;  1I6H B;  3EJI A;  2CW0 C;  1HQR D;  3IKJ A;  4HED A;  4G7Z C;  3KLS X;  4OIJ A;  3S16 B;  3DWQ A;  2Q8I B;  1U4R A;  5C0X G;  4KV6 A;  4RKL A;  1BNZ A;  4OO1 I;  2X69 A;  1HTL D;  1Q12 A;  2A73 B;  4S3S A;  3I4M B;  3A56 A;  1LTR D;  1I4Q A;  4C3H G;  4IUV A;  3A7L A;  2XRQ D;  1BCP F;  3H94 A;  2LFN A;  2IW3 A;  3MTS A;  5FK9 C;  1Q8I A;  3BVM A;  3IL8 A;  1Y8P B;  1HA5 A;  3S2D B;  2FFK B;  1I4P A;  1JR0 D;  2D9U A;  2KQ3 A;  2Q8R E;  3VR4 A;  4C3J B;  4FF4 A;  3WDN A;  1BBX C;  1JOR A;  3BS1 A;  3GV3 A;  4V0B A;  3K5N A;  1WCM B;  1S5C D;  1GOZ A;  1OXT A;  3HOZ B;  4FXD A;  5DNF A;  2WJ0 A;  1SNO A;  3FOV A;  1STA A;  3D4D A;  2RBM A;  1BO0 A;  3Q24 A;  1ONL A;  4KI0 A;  5HUR A;  2K5Q A;  2B2Y C;  1Q1B A;  1TS5 A;  1FD7 D;  4RA8 A;  5JVH 3;  1CA5 A;  2WCW A;  3NTK A;  5D14 A;  5KYL A;  1B1Z A;  1AZQ A;  1LV9 A;  1EU3 A;  3PO3 B;  2RSO A;  1S5B D;  1C4Q A;  2A6H D;  3D31 A;  3FVQ A;  2KHS A;  5IGC A;  2FMC A;  3GTJ B;  4IUQ A;  2B39 A;  2F0K A;  1VCI A;  1PRT D;  1STB A;  5KNC A;  1RCV D;  3BVZ A;  3DHQ A;  2A74 C;  2B2V A;  3DWP A;  1F77 A;  2WP8 J;  1EYC A;  4EGV A;  4A3D B;  5I9P A;  3PUV A;  2ICI A;  5JEA H;  3K5O A;  1DOM A;  1EQV A;  1ILQ A;  2XWB B;  4DU9 A;  3OMC A;  4JBW A;  1BCP C;  2K28 A;  2F0L A;  1ZP7 A;  3K5L A;  3I4L A;  4C1N K;  4A3B B;  2WAQ B;  4QBN A;  1H9M A;  1T5X D;  4K2L A;  1RHP A;  5C3E B;  1C48 A;  3K59 A;  3N52 A;  3Q22 A;  1CZG A;  3PIO 3;  1WTR A;  1HHV A;  2KEE A;  3NK9 A;  3WOE A;  5M5Y B;  3S17 B;  1YNN C;  3BDC A;  1ZEQ X;  1M8A A;  1NUC A;  4H44 C;  1SE4 A;  2B8G A;  2B2T C;  3PV0 A;  2PQE A;  5FLX L;  3P20 A;  2ENB A;  3GO5 A;  1I3Q B;  3IFD A;  1DON A;  2WCZ A;  2EYJ A;  1JOO A;  1SJE D;  4HTH A;  1OO9 B;  1JOK A;  2NVX B;  1B53 A;  2QCP X;  2F0N A;  2EYF A;  1X32 A;  1A79 A;  2K6A A;  4FF3 A;  1GUW A;  4QUC A;  4UAI A;  3HOX B;  3Q6S A;  4DNR B;  3CRK C;  3GV6 A;  2FJ2 A;  3P1Z B;  1D5X C;  1RF2 D;  4JK1 C;  4KD3 A;  3JAM L;  3NE5 B;  4J8Q A;  4P2C B;  4KTA A;  5FLX E;  1MSG A;  1ZYR D;  5EKK A;  4HSV A;  3BZD B;  3C1E A;  4IUN A;  2SDF A;  1EZ8 A;  4BS9 A;  4IZ8 A;  5I9O A;  2B2U A;  3IF0 X;  1VMC A;  1MGS A;  2QEJ C;  4FXG C;  2IX0 A;  1Q3L A;  4ZKB B;  1OXX K;  1TII D;  5EBD A;  5CV9 A;  1DCZ A;  5FKA C;  4IFD I;  3RUZ A;  5ELB A;  1F1Z A;  4C2M B;  3MHB A;  1SNC A;  3BG3 A;  2GW6 A;  3T16 A;  4XQN A;  1UAP A;  3OOC A;  1CT1 D;  1SE2 A;  1TS3 A;  1QOH A;  4G7H C;  1IHZ A;  3BDL A;  4ZQ3 A;  3NPP A;  1EOT A;  2R92 B;  1SFO B;  2NVT B;  1B9M A;  1XX8 A;  3C1F A;  1D5M C;  1PTO F;  3X3N A;  4OO1 G;  1TS2 A;  1YNJ C;  3SR1 A;  4DAV A;  2DY7 A;  2FKH B;  1Y69 U;  2QDB A;  2MHV A;  1XTC D;  3IFT A;  1VF5 C;  3I70 A;  4HR7 B;  2J7Z A;  5JEA G;  1SYG A;  5CBA E;  2F0W A;  3T53 B;  1PXU A;  2A68 C;  4EVO A;  2JEA I;  2A69 D;  2INB A;  2ZXP A;  1FNW A;  2N55 A;  4A3K B;  3CRL C;  1PZK D;  2V4D A;  5G3L F;  4X3T A;  5EPL A;  4A3J B;  2L9H A;  2K05 A;  1QG7 A;  2AQ3 B;  3V2T A;  1E2Z A;  1TS4 A;  4NW2 A;  2JXM B;  3VA5 A;  3HOY B;  1RDP D;  2NUC A;  1I4G A;  2A6E C;  1Q1E A;  2AWO A;  3NP8 A;  2RVL A;  3MZ5 A;  1RJT A;  3NTI A;  3QWN A;  4CKB A;  1ET9 A;  1KTK A;  3D4W A;  4ZYS A;  1TY0 A;  4O42 A;  1KLG D;  2L12 A;  4PNY A;  2EO0 A;  2F0U A;  1V1P A;  2K04 A;  4FXK C;  5I4D A;  2LS0 1;  1HUM A;  2RKS A;  2J0T D;  1W6K A;  2X6L A;  1IW7 D;  2B63 B;  4H7B A;  4BWG B;  1TT2 A;  5IOD A;  1R9T B;  2FKC A;  1PZI D;  1XXG A;  2NYZ D;  3GQB A;  1GUN A;  4RHR A;  2BA0 A;  3FKI B;  4BA2 I;  3DM1 A;  3BDO A;  3SK5 A;  3N6R A;  2YU9 B;  1TU2 B;  4X3K A;  2F0P A;  3S14 B;  4XDX A;  4TQU S;  1PTO C;  3QO2 A;  2E2H B;  1HH1 A;  3ITP A;  1EY9 A;  1F2Y A;  1A3U A;  2H1E A;  2MGS A;  2Z8L A;  3A55 A;  3VYR A;  2C5C A;  3M4Y A;  2K7V A;  4Q0F A;  1H9R A;  1I4X A;  2XVS A;  1O7Y A;  3J7A V;  2LY7 A;  2R7Z B;  3E6Z X;  2BE5 D;  4RGN A;  2PZW A;  1SDF A;  5FO8 B;  3MVV A;  2PW5 A;  1WTV A;  4CGY B;  2EVB A;  4TRD A;  1KNE A;  5M3M B;  1F2M A;  3K58 A;  4TKK A;  1U9R A;  3K5M A;  2MPM A;  2O5I C;  4EV1 A;  1AW7 A;  1BUV T;  1JIC A;  5FDK A;  2EYH A;  5IGF A;  1H9S A;  4R8N A;  3FMC A;  3CQZ B;  1CA6 A;  2FCO A;  1D1K A;  1JB3 A;  1PDQ A;  3SK6 A;  3M7N A;  2JEB I;  2Z1C A;  2IX3 A;  4YIJ A;  1HFN A;  2BCO A;  4KY5 A;  2ZYZ B;  2OF1 A;  4IFD J;  5I2X A;  1HCZ A;  2D62 A;  1EQT A;  4R8I A;  1HUN A;  4L6T B;  3TP7 A;  5COR A;  3GTM B;  1O80 A;  4XIG S;  1NSN S;  3UI2 A;  2SNS A;  1CK1 A;  1SEB D;  3KK7 A;  2OST A;  1EY0 A;  1DJR D;  2FIN B;  5C5L A;  3O13 A;  3E0J A;  4G6V A;  1Y8O B;  2NBF A;  4K8I A;  1ICW A;  5IOC A;  3G7L A;  4IFD G;  1DYQ A;  2B2W A;  3D3R A;  3G6J B;  5C4X B;  4HAE A;  1G2T A;  2L11 A;  4N9T A;  2JA8 B;  2QKI C;  4A3M B;  3FPU B;  1G8Z D;  5M3F B;  3GTP B;  5JVG 3;  3ZYY X;  1ML0 D;  1HQM C;  1SND A;  4AYB B;  2WKC A;  2E2D C;  4HCS A;  4ULL A;  2EZV A;  2RQX A;  5T1I A;  3HOU B;  4IN3 A;  2VXW A;  1PRT B;  1VDZ A;  4QF4 A;  1A2U A;  4XQQ A;  2Y0S B;  5C3X A;  1SYF A;  5HGT A;  3J81 L;  3H91 A;  1F9R A;  2B2V C;  2F03 A;  1SSO A;  3CU7 A;  2RSN A;  3KBX A;  2M2L A;  1S5F D;  4KD4 A;  4DAY A;  3MXN A;  4ZK9 B;  3H6M A;  2BDN A;  3NWS A;  1VF7 A;  2KCC A;  2F0J A;  2JP1 A;  5IT9 L;  5EGT A;  1WD1 A;  1ENF A;  2HDM A;  4RHS A;  3I90 A;  4C56 C;  3OW7 A;  5DM7 3;  1V1O A;  4H0L C;  3J81 E;  4KJN A;  4EQN A;  4CHT B;  1A3V A;  3M3Y B;  3KLR A;  1MD2 D;  1W6J A;  2G9H D;  4ZUI A;  1RKN A;  4KHZ A;  4QMG A;  4FNF A;  2N88 A;  5A35 A;  1UWV A;  2WV6 D;  1Y1V B;  4K8J A;  3DNX A;  4J6H A;  2DY8 A;  5A2Q L;  5KGU A;  2I07 B;  1U4L A;  3TZU A;  2IXS A;  1RTO A;  5CR3 A;  2A69 C;  5IT9 E;  1LT3 D;  2JSO A;  2SEB D;  1CTM A;  1B2T A;  4OHJ A;  3I8Z A;  1EY8 A;  2D2C C;  4M8A A;  1X3P A;  3C46 A;  1G6Z A;  3FRP B;  4A3G B;  2DBS A;  1D1I A;  4C3I B;  4OO1 H;  2K5W A;  2PZT A;  3H09 A;  5DAU A;  1EL0 A;  4NDX A;  1E2V A;  5JPN C;  2H4O A;  2SOB A;  5A2Q E;  3IAY A;  2GJW A;  2EYP A;  5CBE E;  4NP5 A;  2L55 A;  1GUS A;  3P7J A;  5K36 G;  2XRS D;  1GUT A;  3RD4 A;  2AWN A;  2F0G A;  2B2U C;  1L0X B;  3PMF A;  1CQV A;  3OPO A;  3PO2 B;  1OXV A;  2X6G A;  2F0T A;  4G57 A;  5CGK A;  1Y88 A;  4BY7 B;  3ERO A;  4F88 A;  4EQP A;  1IW7 C;  4E6Z A;  3GD7 A;  2WIW A;  3D6W A;  2EYL A;  1G2S A;  4K5V A;  3M4O B;  3S1Q B;  5C3W A;  1U4P A;  5KEE A;  1EWH A;  1SYC A;  2EY2 A;  1ESF A;  5BN4 A;  1WTQ A;  1QJO A;  2VUM B;  4C3J G;  5LL6 S;  5COY A;  5IGB A;  1CM9 A;  5LL6 X;  1JQY D;  1BQQ T;  1QCB D;  3S15 B;  5JJZ A;  3P1Z A;  2L4N A;  1HRJ A;  3HP3 A;  1EEF D;  2NN6 I;  2OXP A;  4IUU A;  3S9W A;  3TSS A;  1LTI D;  3TME A;  2C9O A;  4CKE A;  4LAA A;  1KNA A;  3R8B A;  5KND A;  5E1F A;  1C8C A;  1D2B A;  5EKL A;  3SVM A;  2FLC A;  2R3Z A;  4O1N A;  5JPM C;  1EY4 A;  4X3S A;  3AB9 A;  2BDO A;  3ONA B;  3AJV B;  5J39 A;  5CV4 A;  2E75 C;  2CW0 D;  5CV8 A;  1NCV A;  3OSO A;  4FF1 A;  3EFX D;  1LTA D;  2XN9 C;  5CYU A;  3MEH A;  2XWJ B;  1F2L A;  4C3I G;  4K2K A;  4A3E B;  1F9P A;  1RZN A;  1E0B A;  2F0O A;  3PUY A;  1LT5 D;  1RTN A;  2RDF A;  2NVY B;  1QNU A;  1SMY C;  3J7Y W;  1A3T A;  2IPK D;  3FPP A;  2OT2 A;  3VYS A;  5C4J B;  4LQE A;  4TKO B;  4TSS A;  1X3Q A;  5EPK A;  3Q0A A;  2KVM A;  2F1M A;  1O7L A;  2ZXO A;  5EBC A;  5KYI A;  3V05 A;  1DOL A;  1V8Q A;  3SXH A;  1EY5 A;  5C0X I;  5ISR A;  1GHK A;  4K6L A;  1IYU A;  4IAL A;  1J9O A;  3T4A C;  1SNQ A;  3I73 A;  1SYD A;  5CV5 A;  4RKB A;  4PV1 C;  2IL8 A;  2PO4 A;  1JWU D;  2ZT9 C;  3R2I A;  4ILW A;  2LKV A;  3S2H B;  2F0S A;  5KRU A;  3OWF A;  3KLS A;  3HOV B;  3Q23 A;  3A8J E;  1SJH D;  1QIL A;  4RCO A;  4HN7 A;  1EFI D;  1UEA B;  4HCE A;  1GEF A;  3D6C A;  1LTG D;  5M5W B;  3AMU A;  3NHH A;  4B9W A;  1EU4 A;  1B9N A;  1TWF B;  3RLF A;  2EPB A;  4MN3 A;  4QBL A;  2FL3 A;  3URY A;  5J22 A;  1AN8 A;  5E4X A;  2BH2 A;  1IYV A;  1AEX A;  2VNU D;  4RGM A;  3R93 A;  1BOS A;  4HMI A;  4FP5 D;  2WIN B;  5IGD A;  2F0V A;  2EY5 A;  1STY A;  1JC7 A;  5CC4 A;  5T1G A;  1BF4 A;  4IFD H;  5CMD A;  4C1N I;  4DK1 A;  2ICE C;  1MI2 A;  4XQJ A;  2CVR A;  1IL8 A;  1I6V C;  2OKF A;  3LNN A;  2F0F A;  2WII B;  4FVM A;  4E6I A;  2WAC A;  4PMW A;  1DM0 B;  1NAP A;  4H13 C;  2E2J B;  4A3I B;  3SE0 A;  1S4Z A;  3X3M A;  1KAB A;  1BCP D;  4ZUJ A;  2K33 A;  5IGG A;  1F2Z A;  1R0V A;  4LJZ C;  4A93 B;  3HRZ C;  1ESR A;  4HMJ A;  1GJX A;  1L0Y B;  4BBS B;  1EYD A;  4FF2 A;  2AUK A;  3VYT A;  2L1B A;  4I7Z C;  1XMX A;  1YNN D;  2F0D A;  1QE6 A;  5CV7 A;  1H9J A;  1FGB D;  4I65 A;  3LX0 A;  2AQ2 B;  2W8M A;  2YYZ A;  1STG A;  2A6H C;  2NWG A;  3A8K E;  3SEB A;  1K8M A;  3R3O A;  3NQI A;  3KF8 A;  1WVL A;  2R61 A;  5ELC A;  2B2W C;  1SNP A;  2DNE A;  1QNK A;  1PRT C;  1EIG A;  2DNC A;  3LWE A;  2LMC B;  4ID6 A;  4DGZ A;  2EYO A;  1B50 A;  3GTO B;  4R9W A;  2F4I A;  3OIQ A;  3IEY B;  1XYI A;  1JE4 A;  2ZYZ A;  2EY6 A;  2J4X A;  3QIA A;  2NTT A;  5J1Z A;  1PYW D;  3W2D A;  4KN4 C;  2RA4 A;  4QUF A;  5LHY 1;  1WTO A;  1Y8N B;  1WD0 A;  4UDU C;  1PFB A;  5EQ0 A;  1F9S A;  4KMU C;  1HXY D;  4RGO S;  2NN6 G;  3PUZ A;  1CHQ D;  1R4P B;  1JCK B;  2GA4 B;  3KBG A;  3ND8 A;  3SHL A;  5AFW A;  1TWA B;  2O5J C;  2WB1 B;  1Z7T A;  3ERQ A;  2E2I B;  3NBI A;  3QJY A;  2WKD A;  4ZRZ A;  4WOR A;  3MXG A;  4OIK A;  1A6X A;  1DD2 A;  2EXZ A;  1IKM A;  3NTH A;  3EVQ A;  3HOW B;  1V43 A;  3QOL A;  3FDT A;  5K36 H;  3J80 L;  5C0X J;  1I4R A;  4XTC S;  3GTL B;  1DXM A;  1YNJ D;  2F0M A;  4ODG A;  2M00 A;  2KA7 A;  4U68 A;  2SNM A;  2EJF C;  4G4K A;  1B3A A;  1GUO A;  1Y1O A;  1LAC A;  3MXP A;  3A7A B;  1OB8 A;  1PTO B;  1ZYR C;  4WFN 3;  2A68 D;  2Z4H A;  1DOK A;  2L0C A;  1VMP A;  2B8F A;  1LLR D;  1B4O A;  3J80 E;  4XT3 B;  3I4N B;  2BOS A;  2KED A;  3GTK B;  1BDO A;  4PQX A;  1SAP A;  3NUC A;  1ENC A;  3VR6 A;  3MFG A;  1PFN A;  1LTT D;  4KY6 A;  4CJ2 C;  3S1R B;  3VR2 A;  4FYD A;  1PFM A;  1EZ6 A;  1SBB B;  5D3D A;  2MP1 A;  4IUR A;  2K03 A;  2A6E D;  1WTP A;  2KJX A;  1II3 A;  4X3U A;  1EIH A;  1D5Z C;  1R4Q B;  3C3L A;  2VB2 X;  2Z4I A;  1I50 B;  2EOT A;  3BYY B;  2PPB C;  4KKT A;  2IX1 A;  4KY7 A;  3TN2 A;  2TSS A;  1ET6 A;  3OHX C;  4L8J A;  4KJO A;  3RMH A;  2VLD A;  3NSW A;  2K5D A;  5I6Y A;  3TDQ A;  3NBH A;  2MUY A;  2RDG A;  4F7X A;  3T51 B;  4GZY C;  4B9X A;  3HZX A;  3SK8 A;  4DN4 M;  1LO5 D;  1KDC A;  1G91 A;  4WJW A;  4ZLT F;  1SE3 A;  3L3O C;  4OGQ C;  1OXS C;  1WTW A;  1PTO D;  2E74 C;  4IUP A;  1CQF A;  4F87 A;  3TP6 A;  2JJQ A;  2EJG C;  3QB3 A;  3AU7 A;  3SK4 A;  4OL7 A;  3DMU A;  5EPJ A;  3VA7 A;  4BA1 I;  3LWU A;  4QIW B;  1R11 A;  2F0H A;  4NKL A;  3OWE B;  4DAP A;  1RD9 D;  5FO9 B;  3QOJ A;  3VR3 A;  4DXG A;  1B44 D;  3BYT B;  4KKU A;  2K32 A;  2XIW A;  4L63 B;  4CKC A;  4RGT A;  1QWY A;  2F3V A;  1I4H A;  5NUC A;  4DXF A;  1EYA A;  3HGB A;  2AUJ D;  3CKI B;  3DWA A;  2O2L D;  3I91 A;  2IT1 A;  2NB0 A;  2HDL A;  4KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...