4DA2A

The structure of pyrococcus furiosus sfsa in complex with ca2+
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
231
structure length
231
Chain Sequence
AMKLMEVSPLFPCIFLRRVNRFVGLVRIKERIERALITNTGRLNEFMIPGRIGYCTPKAGGKTRYILLGFEDHGKIAIIDTRLQGKAFEKIIEKELLPELEGCRIIKREPRVGESRLDYLIECSKGEIFVETKSAVLREGEYAMYPDCPSVRGQRHIKELIKLARDGKRAMIVFIGALPNVSKFKPYKKGDPKIAELLKEALEAGVEIRALGLHMELSGEIIYRGELGVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar fermentation stimulation protein homolog
publication title The structure of SfsA and its DNA complex; A DNA/RNA nuclease with a novel domain combination
rcsb
source organism Pyrococcus furiosus
molecule tags Dna binding protein
total genus 71
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03749 SfsA Sugar fermentation stimulation protein RE domain
A PF17746 SfsA_N SfsA N-terminal OB domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.580 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4da2A01
3.40.1350.60 Alpha Beta 3-Layer(aba) Sandwich Trna Endonuclease; Chain: A, domain 1 Trna Endonuclease; Chain: A, domain 1 4da2A02
4DA2A 4DAPA 4DAVA
chains in the Genus database with same CATH superfamily
3AQQA 3LGJA 2CZRA 5JEAJ 1C4QA 3GTMB 1X3GA 4R4CA 4G7OC 4EV1A 1U4MA 2K5WA 3U9SA 3PMFA 4UPAA 3L2PA 1MJEA 3AJVA 5LL6S 1UE5A 3Q22A 4KK7A 4O1NA 2PZWA 3EBEA 1AE3A 2K4KA 2B2VA 1VQMA 1I6HH 1IPIA 3MVVA 2OKFA 4JI4Q 4X65Q 1RCVD 2Z4HA 2GW6A 3C46A 1YNJC 3SEBA 4RMFA 4CDEC 1IKLA 4AIMA 3OIQA 1Q8IA 1PXUA 4K5WA 3SK4A 1WJJA 2YU9H 5IYBH 4JI4L 4X65L 3H0GG 3UDXA 4C3JG 1PTOB 3E0EA 4TRDA 1V1PB 1OB8A 2IX0A 1C48A 1U0LA 5C3EG 2PPBC 2RQXA 4HIDA 3HOVG 2DGYA 1VMPA 2I0QA 3HG9A 2UXCQ 1HH2P 1IZ6A 3A55A 1R9TH 5I9PA 1LTTD 2A6ED 2EO0A 1FGBD 3HGBA 3KYHC 3CCRA 1P8LA 3MTSA 1I3QB 4IALA 4LFBQ 2B29A 5E3FA 2UXCL 4LUVA 2VLDA 3TEHB 2VB2X 5BR8Q 1A3TA 2NN6H 1JICA 2NWGA 1B44D 4A3FB 4LFBL 1CKOA 1CFMA 3WDNA 1D5XC 2F0QA 2CQAA 3EJIA 1K28A 4TVAB 4EQNA 1SROA 4H13C 4P75A 1CZWA 3PSIA 5BR8L 3BDCA 5C3EH 2KHJA 1LTLA 3OPOA 4J15A 1BBWA 3MXPA 4QUCA 2D2CC 2MHVA 1QZHA 4IN3A 2OCEA 4UP7A 3ND9A 5C3WA 1K8GA 3GTJB 4OHJA 5IY0A 1EWIA 1HCZA 4X64Q 5GADC 1F2YA 2O5IC 1GXDC 4KN7C 1XWEA 1LO5D 2FLCA 1RZNA 5DM63 3M4OB 4KY7A 3ERQA 4X64L 4F7XA 3S16B 2NB0A 4CDCC 3LNNA 3S1QB 2QEXA 1DYQA 3F2CA 1X65A 4QBNA 5FK9C 1OXXK 3ULJA 4UP8A 3OHXC 2ZTDA 5D3DA 5ELNA 1PTOC 2YTVA 5C4JH 3AYHB 2FFKB 3C1EA 1F2MA 1X54A 1C9OA 2IT1A 3TP8A 3NHHA 3PUYA 1K0RA 5KYLA 4B3RQ 3VR5A 1KLGD 3DWPA 2CHBD 1Y1VG 4S3SA 1PH8A 4A3GG 1O7IA 2E74C 1A3VA 1SE4A 3K7AB 3DHQA 1EYCA 2RCFA 4B3RL 1V1PA 2E2JB 2SNSA 3J7AF 1U4LA 1SE2A 2XIWA 5F2DA 2NVTB 1D1IA 4DAPA 4CKEA 2F0PA 4K8IA 4UAIA 4PZ8A 5FLMG 4G4KA 1IYJB 1EWCA 3NUCA 4BS9A 2FXQA 1F9QA 1TIID 2CKZB 4KKUA 3KK7A 1HA6A 5J3BA 1CA5A 2R7FA 2A68C 2PI2E 3A54A 1W6KA 1Y1VH 1LACA 5JEAG 2UU9Q 1I50H 2K5HA 2K28A 1YNND 3VR4A 4DV5Q 4A3GH 4IZ8A 1QILA 3BZCA 3S2DH 1HJPA 2RF4A 2E5LQ 4QBOA 4KD3A 1QVGA 3S1RH 1XX8A 1UEAB 4O0AA 2FMCA 2UU9L 1W2BA 5HURA 2A6HC 3K5OA 4DV5L 2KHIA 1TS2A 5ELOA 3SE0A 1WTXA 3GTKB 2E5LL 2HIXA 4AQYQ 3CCJA 5COYA 4A3MG 1E22A 1E7ZA 3OWEB 1AZPA 3H0GB 4C3JB 3J81L 4AQYL 5E1FA 5C3EB 1GO3E 3A8JE 3HOVB 2J4XA 1ESFA 4ULLA 1RLVA 4APVA 1ZP7A 1Q7YC 4X6AH 2KHSA 3CC2A 2WFWA 1GUTA 1MI2A 1EYAA 1RL2A 1CZGA 1WTPA 3BS1A 4DN4M 1CKNA 3CMEA 4OIKA 4EX5A 1TS3A 4QB4A 4QBLA 5HY6A 1CK1A 3KBXA 1LT6D 4EQ5A 4X3TA 1KHIA 3I56A 4YWLA 4LUOA 2PMZE 4JI8Q 1ASYA 2FCOA 3OW2A 4LWCA 4QJFA 2ZXRA 2RCNA 4G6VA 1ET9A 3V05A 2MO1A 4POGA 5EQ0A 3BDOA 1G2SA 3TP7A 1LABA 4JI8L 4DGZA 2DNCA 3RZOB 2Q2TA 4MNOA 5M5YH 1D8LA 1SSOA 1T0FA 4YWMA 1IXRA 4RGTA 1HPCA 4L5SA 2ASBA 4GKJQ 1DM0B 3DM1A 5IIFA 1EY8A 5KEEA 1YJNA 1PZJD 4N9TA 1IYUA 3A5ZB 2IJ0A 5C44G 4JPBW 1EOTA 2ZJPA 2CH4W 3PIOA 2BE5C 4GKJL 3TZDA 4WJ3M 4OWXB 1YITA 2PW7A 5C4HA 1HNXQ 4FP5D 2F0DA 3I55A 1YJ9A 1XNRQ 1R4PB 1VQNA 5KNBA 1MSGA 4H02A 2K05A 5E7NA 3RN2A 1VQ6A 2OSTA 4Y7NH 1HZ9A 4G7ZC 2XVSA 1N36Q 1HNXL 4A4IA 2KCCA 4JI0Q 1XNRL 5CBEE 3K5LA 1UE1A 2C5CA 1GJXA 2BDNA 5FJ8G 4YCUA 1ILPA 3I3CA 1N36L 1EIGA 4JI0L 4K5XA 1IHZA 1SNOA 3BZDB 3SK6A 3J80E 1VF5C 5NUCA 1SLJA 1SYDA 2RHSB 3DXJC 3FOVA 1EZ8A 2VUMH 4OWTB 1STNA 4QMGA 1FD7D 3UDFA 1VQHA 4KHZA 1HZCA 2YYZA 5GAHC 2MQHA 2C9OA 1T9HA 1U9RA 1D7QA 4IURA 3VA7A 2L4NA 5BN4A 4DR3Q 2ID0A 2ENBA 1Q1EA 4ZKBB 1SYEA 1WD0A 4J1MA 2NVXH 1SAPA 2AMCB 4NMZA 2K6AA 4L8JA 2JA6G 5CV5A 2B2WA 1SEBD 3NE5B 1E2ZA 3I90A 4DAVA 4DR3L 1JJGA 1DJRD 1LTGD 3CCSA 4FF2A 4I7AA 1LTAD 2XWBB 4BBRH 1FYCA 1VQAA 4A3MB 2EPBA 3G71A 1B4OA 1SYBA 2Q2HA 2EY5A 3NELA 4UP9A 4NPSA 4F8MA 3FPPA 1K0SA 1VQKA 4H0LC 2IHFA 4LF8Q 3HOZH 2VQFQ 2VS1A 3D8GA 5C4XH 2PI2A 1F2LA 3NQIA 4GS3A 2KEEA 1WTWA 1CI3M 5FLXc 3RUZA 1CT1D 1HR0Q 4LF8L 3GTGB 2VQFL 4HJAA 1X6OA 4QL5A 3FVQA 3M3YB 3I72A 3PO2H 2I5MX 2KOLA 5C5LA 4DK1A 1HR0L 3E3XA 4A3EH 3K5NA 2E75C 1Q82C 1DGSA 1STGA 1F9PA 1AN8A 3R2IA 3C2PA 1UEBA 4LFCQ 3FDTA 3I73A 1N33Q 4KN4C 1H9JA 4DV6Q 2E2IH 2VB3X 4FXKC 2KUMA 5C44B 2JP1A 2LY7A 3HEJA 1STHA 4LFCL 4CBVA 3SHLA 4BXXH 1N33L 3VYUA 2ZTCA 4DV6L 1VQ5A 5IT9L 1Y88A 1RKNA 2KQ3A 3MZ5A 4WJ4A 1NTGA 2PW5A 3M7NA 2F0WA 3IFTA 5K36H 3Q23A 2R7ZH 4KJOA 4C2MB 1GUGA 1VQGA 1HHVA 3GV3A 2A6EC 2DY8A 4IJLA 4TKDA 5IT9c 4X62Q 1YBYA 1EY4A 2Z4IA 1JJ2A 3RNUA 1SYCA 1KD1C 3DUZA 4V190 2INBA 1TWAB 5CV4A 3HKZE 4RAUC 1Z47A 4X62L 4A3DG 4PV1C 1RDPD 4HCSA 2F1MA 1D1KA 5EKKA 2WACA 1STEA 1Y8PB 3EN2A 4B3TQ 4K0KQ 1CSQA 5C0XH 2R92H 2FMMA 3URYA 2F0NA 5D14A 1XXGA 3D4WA 4BY7G 4X3UA 1G8ZD 2N49A 5CC4A 3BJUA 4K0KL 4B3TL 3SR1A 2WB1E 5M5WB 1VQ8A 2F4VQ 1BO0A 2SDFA 1RIPA 4C3HG 1LT3D 4JV5Q 2JA5G 1B53A 3QOLA 4ZUJA 1NE3A 2HQEA 1KRSA 2F4VL 3HKSA 1EIFA 1QCBD 2JA6B 2EYLA 3GTMH 2UXDQ 3MEHA 4JV5L 4Y52H 1BOSA 1RODA 2GVAA 2MO0A 4HN7A 1QOHA 5ELBA 1EOVA 2EYJA 2LXKA 1VDZA 1PFSA 3J81E 1PMRA 4HEDA 3S1MH 2UXDL 2UUCQ 1VQIA 3MWYW 2NTTA 4WJWA 1KIXA 2HHHQ 4RGMA 5T1IA 2JQOA 1K8AC 3AJVB 1JORA 1WYDA 4LF4Q 1IW7C 1FGUA 1PTOH 2UUCL 3KUPA 3QG1A 3D4DA 4L6TB 3C3LA 2ALYB 1R4QB 3T56B 2HHHL 3KLSA 2WKCA 4KKTA 3KBGA 3TS2A 4LF4L 1XYIA 2KENA 1EU4A 2FJ2A 4C1NI 2JA9A 4G57A 2MJ8A 1B70B 2DY7A 3H3VC 5J22A 3ICEA 3RZDB 1X55A 1SRUA 1IBMQ 3M4QA 3V2TA 4A3FH 2Z6BA 2N78A 2HDMA 3SDZA 2EYFA 2WINB 1X32A 2AQ3B 2B2YC 5JVG3 1YNNC 1IBML 3CCEA 4JI1Q 2A69D 5EKLA 3J7AV 1B9NA 2KEDA 3BVZA 3MEFA 4DF7A 1LTSD 2KCTA 2PQAB 1KAWA 3A5UA 1U4RA 3RN5A 2OWOA 1XNQQ 3IAYA 1RTNA 3GTOB 3KJPA 2EXDA 4JI1L 3GTJH 4OO1I 3HOXG 1KC8C 1EY9A 2LMCB 4G6UA 1Q12A 1OXUA 2B2YA 2DBSA 1VQDA 1SXTA 1XNQL 5M9OA 2F0TA 1A15A 1N32Q 3M4OH 2WB1B 5ELEA 1OXSC 1LT5D 1W6JA 4DA2A 5IWAQ 1TY0A 3HOUG 2YTXA 1HZAA 4IUTA 2J7ZA 3LWEA 3K5MA 1EEFD 1S5BD 3S1QH 3OSOA 4Z9CB 1SBBB 4CJ1B 3PUWA 1N32L 5H1SE 1TS4A 4CDDC 3QIAA 5IODA 3IL8A 4EQOA 2K01A 4ZQUA 3CCLA 4FYDA 4P74A 5IWAL 3A8IE 3I7FA 4IFDH 3ERSX 2D0PA 1HTLD 4GOPA 2QILA 1BBUA 5TSSA 3HOXH 4H7BA 4XQQA 4A3DB 4JYAQ 1KNEA 2HCIA 4ZRZA 3VR3A 4IOAA 3NQTA 4Q0FA 1V8QA 1M8AA 5KRUA 4NKLA 3K7AH 5I4DA 2L5TA 1IKMA 4PMBA 3SXHA 4JYAL 3CCUA 1P16A 4A75A 1FL0A 2E2JH 3S1MB 2K5VA 2V1CC 2NVTH 4GN3B 4BY7B 1PZKD 2IXSA 2Z1CA 1I6VC 2N55A 1YIJA 4TKKA 4RG1A 3S1NB 3NTKA 2X69A 2JSOA 4A3LH 2AQ1B 3NBHB 3K81C 5FOBB 3DNXA 4C3HB 4KV6A 5CYUA 5G3LD 4J6HA 2JA5B 1VCIA 3H6MA 1XMXA 4V0BA 1E1OA 3R8BA 4KI0A 4OXPA 1LTBD 2WIIB 3CQZB 4JK1C 4MIUA 1E1TA 1K83B 3T53B 1DOKA 1JOKA 2HIVA 4LJZC 1CKMA 3JAML 3S14B 4CGYB 3Q6SA 3RMHA 4FXDA 4JI2Q 2PQAA 4GN4B 3RLOA 3W3AA 1VQEA 3GTKH 4WFN3 4HIKA 5FDKA 4I7ZC 1ET6A 3CMAA 2UUBQ 2EYPA 1L0WA 3JAMc 1UE6A 3H0GH 4JI2L 4C3JH 2F3VA 2GVBA 2SNMA 1BUVT 3DM3A 3P7JA 3E5SA 5FO9B 4DV2Q 1PH4A 2Z8LA 2JA7G 3HOVH 3S24A 4JC0A 2F0UA 2UUBL 4DKAC 4R4IA 3TBIB 3IFDA 5JJKA 3KFUA 3MHBA 4XT1B 3PIP3 4RH6A 2QDLA 1K73C 4DV2L 1IYVA 3S9WA 1E0BA 2R93G 3K80C 1H9KA 3HP3A 3RD4A 5C3XA 2XRQD 1O7ZA 3BT7A 1STAA 5A35A 1H9SB 1ICFB 4X3SA 1R11A 3CHBD 3STBD 3U4VA 2B2UC 5KYIA 3J81i 1B7YB 2PZTA 3CCMA 1E3PA 1NMFA 1XTCD 1CKNB 2K50A 2NN6I 5JOBA 1F1ZA 2WAQE 2NBFA 1VQOA 1JJCB 1HQMC 4HJ8A 4PQXA 2F4IA 3FP9A 3RZOH 1YI2A 3HOXB 5IT9E 3I4LA 2PNRC 1CM9A 4RHRA 2B2UA 2UUAQ 1JE4A 1FR3A 1IW7D 5GQOA 4ABNA 1CHPD 3NBHA 4KY5A 4MHEA 3SGIA 4GN5A 1N34Q 1G91A 2NZHA 3NENA 3W2DA 1KDBA 3HOUB 1YNXA 2UUAL 3J7ZC 3NPPA 1VQCA 3OMCA 1I4PA 3TQYA 3NWSA 2E8GA 3GDEA 3GTQB 1UAPA 1RHPA 5M3MG 5I9OA 2E2DC 1N34L 3D0FA 1PYBA 2VL6A 3MFYA 4GLXA 3A7LA 4LF5Q 3NBIA 3T4AC 1OXTA 1OXVA 2G9HD 2QKIC 2OQKA 1B1ZA 2L0CA 1KXLA 4POFA 4R9WA 1DXMA 4IPCA 2WKDA 1K3RA 3A8KE 4LF5L 3TP5A 1CSPA 1MKHA 3K7UC 3BVGA 1VS0A 1K8MA 2O2LD 4F88A 1A3UA 2B8FA 3M85A 2QGQA 1EFID 5I2XA 5EAYA 1JOQA 4C3IG 3HZXA 5FLMH 4RFBA 1NJIC 1IBLQ 2R7DA 3EVQA 3M9BA 2B8GA 2ZXOA 2Z6KC 2AKWB 1D6EC 5AFWA 1HQRD 1L0XB 2FINB 4FF1A 4DV4Q 2ZT9C 1IBLL 1VQJA 1H9SA 2NYZD 5JEAH 1WOCA 1X9NA 4UDUC 2LFNA 1HRJA 1RJTA 4A93G 3W1BA 3A56A 4DV4L 5DEHA 4X3KA 2Z6KA 3PIPA 1VQFA 1Q90A 3IRBA 3G48A 4C3IH 1PH5A 2I5HA 1FNUA 4TQUS 1O7LA 3N52A 2WIWA 1S5ED 2RDFA 1SNPA 1XMQQ 4A3MH 3ONAB 1LT4D 2RKSA 4CDFC 2ICEC 4DFAA 2CWPA 2JA7B 2IHEA 2C35B 1WTRA 1XMQL 2Z9HA 2R6GA 1LTID 1TWCH 5J1ZA 2F0JA 4BWGB 1QB5D 1EIHA 4ZUIA 2MP1A 1JMCA 3FPUB 4P2CB 3TN2A 2F0KA 1JB7A 2R93B 4DAYB 3FEWX 2L12A 1PVOA 1M90C 1MBYA 1A2UA 1VMCA 3GTGH 5L37A 2AWOA 1K3BC 2F0IA 1J8IA 1VQBA 1JWUD 3M4YA 2I07B 3M3YH 2XSCA 4HTHA 4K14A 1PYWD 4IOCA 1RTOA 3AB9A 4JVZA 4K2LA 1HA5A 1NAPA 3T1YQ 1Z9FA 2R61A 2F03A 4JW0A 5KGUA 2OXPA 3MXNA 2FKHB 5EPLA 3OTOQ 2NVYB 3FKIG 4L5RC 1JE5A 2JEAI 1JT8A 4RKBA 4O42A 3T1YL 1MGSA 2AWNA 1PH6A 4NDXA 4B08A 3OTOL 5M3FG 1D2BA 5C44H 4C56C 2NVQB 3G6JB 2VY3A 1AW7A 5G3LF 4DR7Q 1DOLA 1L1OA 4NXMQ 5M3MB 3SVMA 5JJZA 2ZJQA 5DLQE 3W1GA 1EQVA 2Y0SE 4C2MH 1BCPD 1TWFB 4B9XA 2RHQB 4DR7L 1Y8NB 2B2WC 1CQFA 5ELCA 2EZVA 5IYCG 3DEOA 1XMOQ 4NXML 2SEBD 4OGQC 4ZKCB 4ILWA 3N6RA 1Y69U 2GN5A 1TWAH 4K6LA 4DR5Q 2F0MA 2IL8A 5FJ8H 1XMOL 4LQEA 4HAEA 2N88A 1X3EA 2JXMB 3PCOB 2PMZB 2W8MA 1N9WA 4IJHA 4DR5L 5IYDG 1EUJA 3H3VH 2H1EA 2OTJA 4C3IB 4A3IG 2A69C 5ELDA 4E6ZA 2CW0D 2QA4A 1YEZA 2EE1A 2EY1A 2PZUA 1YJWA 3PF4A 4KHPQ 2F0VA 3QB3A 4ME3A 4DAYA 4P73A 5M5WH 3NXWA 4EVOA 3X3MA 2NZ1D 1HFGA 2H4OA 2I5LX 5EKIA 4IUPA 5J39A 3AFQA 1TWCB 3CF5A 4KHPL 1UUPA 3D6WA 4XTCS 5A2QL 5LMNQ 5FLXL 2LSSA 4A93B 1A8VA 2JA6H 1TWGB 5HGTA 3JC66 1AH9A 2IWHA 4LF6Q 1Q46A 1WTHA 1ICWA 1QJOA 4ZAIA 1I4RA 2L1BA 3Q8DA 2CV8A 4H44C 5LMNL 3AFPA 3F8TA 3GV6A 4QGUA 2DJGC 1PH7A 4JBWA 4PZ6A 2OTLA 2IX1A 1SE8A 2ATWA 4LF6L 3UE1A 4A3KG 1WVLA 3GD7A 1S5CD 1MD2D 1U5KA 2VW9A 3CAMA 1JWMD 2BH8A 3HKZG 2EYOA 2PO4A 2RA4A 1A62A 2F0GA 1BBXC 4OIJA 4CJ2C 1S5DD 2ZXPA 2KVMA 3QWNA 5GROA 1XTDA 3IF0X 4R8IA 5JJIA 1KQSA 4DUZQ 4N9PA 1JB3A 2EIFA 4MN3A 4LF7Q 3RZDH 4A76A 2EYMA 2Q8IB 3SK8A 3L7ZC 1SDFA 2WB1G 3HOWG 4DUZL 1DD2A 3NSWA 1VQ9A 4LF7L 4AYBE 4OONA 4QIWE 1ZKOA 4U68A 1EYGA 1F9RA 4DK6C 3FKIB 4KD4A 2OQ0A 2TSSA 4DR2Q 1SNQA 3CD6A 4B3SL 1ZXTA 1PFMA 1O7YA 3GO5A 3GTOH 3S17B 3UE0A 1EY0A 3UDIA 5M3FB 1EY6A 4DR2L 4FVMA 3S15B 2F52A 2FL3A 4JI3Q 1B3AA 1Y14B 5M5XB 5C4ZA 1TWHB 3PF5A 4I65A 1PV4A 3EFXD 3NK9A 5DNFA 3T13A 1JWSD 1WCMB 5CORA 3ULPA 4JI3L 1NNXA 4ZLTF 1HXYD 1R0VA 4RKLA 3C1FA 3OWFA 3S2HB 5CV7A 4KJNA 4A3BG 1IBKQ 4JG2A 2JK8A 1FNWA 3TMEA 2L55A 4HMIA 2RVLA 2VZAA 3F1ZA 1ML0D 5IGBA 2HUGA 2KCMA 3VR2A 5JVH3 1L2FA 2DNEA 4A3DH 2RSOA 3WOEA 1D5ZC 2A1AA 4LMQD 1IBKL 1S4ZA 1ONLA 3STBC 3H94A 3Q24A 2OEOA 4PMCA 1LUZA 1Z6HA 2EDGA 2SOBA 2QEJC 2K04A 4A3IB 1ESRA 2KECA 2PQEA 1H95A 4GOPB 3GTLH 3NTIA 2F0FA 4YIJA 2CH4A 2H5XA 1ENCA 1QUQA 2B63G 4BY7H 5C5MA 2K5DA 4OO1G 5KIXA 3HOYG 1UE7A 3S1NH 2JA8G 1U4PA 1XPOA 2EJFC 3KF8B 1MHWC 3LWUA 1GD7A 1M4VA 4C3HH 1II3A 5C0XI 5CV9A 2JA5H 5EJWA 3D6CA 1B9MA 2EYHA 3IKJA 2F3WA 5LL6X 5ELFA 1FVIA 1Y1WG 1WTOA 3PV0A 3F2DA 1QE6A 2K75A 3CQZH 1PH2A 2K52A 5JAVA 5IP9G 2EJMA 1K83H 4IPHA 2CQOA 1NR4A 2CWAA 1W3SA 4FDBA 5D65A 3BU2A 2A74C 4NP5A 5KNCA 4IO9A 3UDGA 1VQ4A 3S14H 4QQBX 4QCLA 1G51A 3P75A 5E4WC 4A3KB 3K0XA 4XIGS 3D31A 1HTPA 3BDLA 1BXTA 1ZYRD 2Z0SA 2F0OA 1TQOA 2K7VA 4DU9A 3OYYA 1Z7TA 3HKZB 4GKKQ 4A3JG 2MGSA 3I4MG 2EVBA 4L63B 1ZEQX 2EXZA 5CBAE 1PRTD 1DOMA 4GKKL 1TY2A 3JAMi 2HCCA 3G7LA 2O4XA 5FO8B 3VDYA 2F0EA 2CVRA 1X56A 3H91A 1BCPF 2RDHA 2WCZA 2AQ2B 1FNVA 4PZ7A 5EGTA 5EBCA 1AFPA 1B2TA 1MJCA 2X6LA 4DNIA 3HOWB 4GOPC 1Q86C 2FKCA 2AUJD 2MPMA 1S3OA 3W5OA 4NW2A 4LK1C 3VYSA 1PH3A 1GHJA 2CCZA 5IGDA 1HFNA 2V4DA 1NY4A 4BY1G 1QZGA 2RBMA 2OF1A 4YCWA 1GVPA 4WRDA 1HUNA 1GUOA 1EFWA 5EPKA 1KTKA 1BDOA 3I70A 4DR4Q 4P71A 2J0TD 5JJLA 2FHTA 1BCPB 2JJQA 3KF8A 2KCNA 1YHAA 2TMPA 4PG3A 1QG7A 4JBKA 3HOUH 4CKCA 1I94Q 1TXYA 4HSVA 5CR3A 3GTLB 3J80L 4DR4L 1QNUA 2MUYA 3QOJA 2K14A 4YCVA 5IYBG 1TR5A 4MTNA 3GTQH 3VYTA 3E9IA 4C1NK 4K8JA 4A3BB 2CFMA 1I94L 2RSNA 4FF3A 3FMCA 3J80c 3U58A 1YNMA 2VQEQ 4KLKA 1KLUD 4DR6Q 2EQSA 3IEYB 2XTIA 2JEBI 2G9DA 3K59A 4P72A 4JBJA 5LMNW 2VQEL 4IFDI 1I5FA 1DONA 3K8AA 4DR6L 3CC4A 1QVCA 2NN6G 3PO3B 3F2BA 3TSSA 1EZ6A 4CKBA 4XDXA 3TS0A 1SYFA 1HNWQ 4Q5VA 2B63B 1EQRA 1BKBA 1HR0W 1H9MA 3HOYB 2WAQG 1A79A 1WI5A 2BOSA 2JA8B 5A2QE 5FLXE 1HNWL 3DWQA 1TKWB 3NEMA 5GAEC 2OT2A 1BNZA 4R4OA 3VR6A 4QUFA 1HZBA 4CJ0B 1SFOB 4ID6A 4LUZA 4BBSB 1Y1WB 2K5QA 1IL2A 1CA6A 3R2TA 4YHHQ 1I4GA 3PUXA 2O5JC 1JOOA 2GJWA 4MZ9A 2KBNA 3DMUA 4IUQA 1JR0D 1KNAA 4PMWA 1WTVA 1NUCA 1BCPC 3GQBA 4GLVB 4HR7B 2K1BA 4YHHL 3CP0A 4JOIC 1CHQD 4X66Q 2EJGC 4FNFA 1BF4A 1BQQT 2HDLA 1B50A 1V1QA 3D4RA 3L0OA 2ZJRA 1XJVA 2KA7A 1SMYD 2AUKA 4IPGA 1HNZQ 1J6QA 1NMGA 1V1OA 4A3JB 4EGVA 3I4MB 4X66L 4IQZA 4TSSA 3GTPB 2MFIA 4JI5Q 2JA7H 4DXGA 1HNZL 4JOIA 2WV6D 4JBMA 1ENAA 1HUMA 3TREA 1TT2A 2F0HA 3P1HA 3WOFA 2DJFC 3J81j 4MTKA 3U4ZA 2M2LA 4JI5L 2AHOB 2R93H 2CW0C 3CU7A 4UY8C 1A6XA 4GZYC 4BA1I 4ZK9B 2B2TC 1TS5A 3EIVA 5LMUQ 4DV7Q 1KAAA 1SNMA 4RGNA 3DLLA 2KJXA 2RDGA 1EWHA 1I4QA 4L5TA 2XGTA 3IEYA 4DV7L 4O2DA 5LMUL 2QDBA 1AP0A 4BY1B 3P20A 4QY7A 5C6AA 2A19A 3R93A 2IPKD 2B2TA 4ZQ3A 2BCOA 4M8AA 2NVYH 1J9OA 4U673 1E2VA 3ER0A 2PYKA 4FO2A 3PIO3 5GAGC 5I6YA 3BG3A 5FO7B 1I6HB 2HT1A 5T1GA 2L15A 5EPJA 4YWKA 2NVQH 3MXNB 1EQTA 1B3QA 1VQ7A 1EY7A 3U9OA 1SE3A 4OL7A 3TRZA 1NCVA 1G291 2YU9B 1KL9A 5M3MH 1JC7A 1AE2A 1TWFH 5IGGA 3PUVA 1G2TA 5IGCA 2N8NA 4L5QA 4DAMA 1R9TB 4ZCKA 3PQIA 4LNQA 2QW7A 3T1HQ 3TP6A 1L1OB 4HJ5A 3I4NG 1IL8A 3A7AB 3KLRA 4E6IA 1AZQA 3WWVA 1OTCA 4DV1Q 3T1HL 1GKHA 2E2HH 2X6GA 4RCNA 4RWSC 3M7GA 4XQJA 2PNHA 3NWTA 5BN5A 1PFNA 4LW1A 3CRLC 4TKOB 3L3OC 2WAQB 4DV1L 3TZUA 3U50C 1VQPA 1PRTF 2K5NA 3CCQA 3DEPA 1N8RC 1Q81C 3KDFB 3MXUA 3I4NH 1MIUA 3J81c 1J5EQ 1OB9A 4M1UB 1HH1A 1F2ZA 4A93H 1WFQA 3OOCA 5I6WA 4OX9Q 1TWGH 4DXFA 2WIZA 1K9MC 1J5EL 2P5ZX 1VQLA 2Y0SG 4OX9L 2Z0RA 2JE6I 3VA5A 4XYQA 4KMUC 3HFZB 1PRTB 5C4JB 4F87A 1YNJD 3B6YA 3K0YA 2LKVA 1LYLA 4G7HC 1RD9D 4N8FA 1STBA 1G6ZA 4RA8A 2Q2UA 2UXBQ 1KRTA 4OWWB 1L1OC 2WP8J 3BYTB 3T16A 1I4XA 1Q8KA 2K03A 3V96A 3X3NA 4NB3A 2UXBL 5E4XA 2IY5B 5KNDA 5C0XJ 2VUMG 1EU3A 1M1KC 2F0SA 2E76C 4WORA 2D0OA 1WCMG 4B9WA 2NTSA 2A73B 1Y1VB 1ENFA 1E2WA 5D3IB 1I50B 3FKIH 1S40A 3H09A 4A3GB 1GOZA 3UI2A 3S2DB 1S5FD 1H9RA 5HGQA 4HCEA 3S1RB 4XQNA 3S17H 3QO2A 5M3FH 5AJ3Q 2G5DA 3L9AX 3S15H 1ZYRC 2DUDA 3OIPA 4OELB 4QF4A 1CTMA 2E2HB 1SMXA 5M5XH 4UHVA 3ND8A 1T5EA 4BBRG 1TWHH 3KDFA 1YHQA 3ZJYC 4DV0Q 3E6ZX 2LXJA 5AJ3L 1WCMH 1C7YA 4KTAA 2K33A 3CW2C 4FXGC 1PRTC 4DV0L 5IYCH 2XN9C 3S2HH 3A74A 3A0JA 1KDCA 2JYOA 2A5HA 3AMUA 3RLFA 3HRZC 3I4NB 3HOZG 4KY6A 4LF9Q 2ZYZB 2EY6A 5K5PA 1PTOD 3JAME 1WTQA 1PHJA 1EQQA 5CV8A 5C4XG 2ES2A 2QF7A 1GEFA 4LF9L 1EIYB 2IW3A 5CGKA 5IYDH 3EA6A 2Q2IA 4A3IH 3O13A 2BA0A 3PO2G 1DZ1A 2M00A 4AYBG 4BA2I 1EEID 1X3FA 4A3EG 3E0JA 1A0IA 2XNAC 4GNXB 3H3VI 5JPNC 1RF2D 1LLRD 3ITPA 1SN8A 3NP8A 3MFGA 5M5YB 4OEMB 3K6OA 1OO9B 2L11A 1KDAA 3HS0C 3FRPB 1QUQB 4XT3B 3P1ZB 2B39A 2A68D 2F0LA 5DM73 1NSNS 1MSHA 3CPWA 4BXXG 1GUNA 3AU7A 4HJ9A 1E24A 5I2YA 3Q0AA 2XWJB 2Y0SB 2BH2A 4IUVA 1F77A 5K36G 2GA4B 2R7ZG 4A3KH 2YV5A 1QVFA 2PCFB 2A6HD 3MXGA 3RR5A 4Y7NB 1B8AA 2D9UA 1SYGA 1UNSA 4IFDJ 4B3SQ 5IGFA 1PYSB 2NZOA 5IP7G 2YTYA 1DCZA 4KHVA 3K58A 2I46A 4ALPA 3J7YW 2A8VA 1X3PA 1XPUA 3VYRA 2K32A 2EY2A 3FHWA 5JPMC 1TVXA 4IUNA 3CXCA 1NBWA 2VNUD 3D3RA 4R1JA 4DNTB 1YHBA 2BA1A 5C0XG 2R92G 3KF6B 4K2KA 3H15A 2VUMB 1SR3A 5CMDA 3HOWH 1Q3LA 3K57A 4HIMA 4RCOA 2ZYZA 5IE8A 4CHTB 4DUYQ 1SJED 1Q1BA 1QNKA 3ZYYX 4DK0A 4GNXC 4HJ7A 1V9PA 5IP7H 1PH9A 1EYDA 4DK3C 5LHY1 4DUYL 2NVXB 2EOTA 1STYA 1YZ6A 1JCKB 1NR2A 1ASZA 4XYOA 1V43A 2L9HA 4A3CG 3OMGA 2F3IA 4GNXA 1LV9A 1SMYC 2D5DA 4LAAA 4YY3Q 3G4SA 4N8X1 4BBRB 1D5MC 3KLWA 5IOCA 1EY5A 2WCWA 1A2TA 2MNAA 2Q8RE 3PO3G 3OW7A 4JCVE 3CRKC 3RLNA 1TU2B 4YY3L 4HMJA 3BZKA 3KLSX 2BE5D 3F2UA 3I91A 4AH6A 4FF4A 3P1ZA 4K6DA 1PFBA 4A3BH 2LS01 5BN3A 1CQVA 2IX3A 3QJYA 3HOZB 3CC7A 1WD1A 5FKAC 4A3CH 5C4XB 3NTHA 3BYYB 1I4HA 3I2ZA 3ULLA 4B3MQ 1Y1OA 2WJ0A 4BBSG 1PH1A 3M4PA 1F9SA 1GUWA 4J8QA 3KOJA 4ODGA 5ISRA 2B3GA 2ZTEA 3EQLC 4DNRB 3J80i 3BVMA 1PLFA 3G6EA 4PNYA 4EQPA 1JQYD 4B3ML 3PO3H 3CKIB 3CCVA 5EBDA 4A3FG 3PO2B 2BDOA 3P1YA 1S72A 4AYBB 4QIWB 4A3EB 2D62A 2B63H 1KABA 1SJHD 4R4QA 5DAUA 1GUSA 1C8CA 4OO1H 1AEXA 3R3OA 3HOYH 2JA8H 1BVSA 3DWAA 1PA6A 4DR1Q 1GM5A 1YVCA 4R8NA 1XPRA 2JN4A 4ME5A 4K5VA 1VF7A 3MA2B 1SFOH 1I3QH 2E2IB 4LFAQ 2M9VA 4BBSH 1Y1WH 3KF6A 1LTRD 4IUUA 4HIOA 4DR1L 3TDQA 1CUKA 1K8OA 2ZM6Q 3QR8A 5IP9H 4RGOS 4KKSA 4RHSA 2HD3A 3E9HA 4DV3Q 4LFAL 1C0AA 1SNCA 4ZYSA 3I4OA 1L0YB 2ZM6L 1ILQA 2R7ZB 2XRSD 5IGEA 3MC0B 4IPDA 1BR9A 4XXEA 3SK5A 4DV3L 1EL0A 3MAQA 3CPFA 1PZID 3GP7A 3KJOA 1G6PA 4IFDG 4A3JH 3I4MH 2Q8TA 3AEVA 3I8ZA 3PGZA 3PUZA 2QCPX 3GTPH 3EROA 2N3SA 2NUCA 1FJGQ 2R3ZA 4JI6Q 1O78A 1PDQA 4JI7Q 3J7A5 4NXNQ 1UWVA 1O80A 4DPGA 1FJGL 3T51B 3S16H 4JI6L 4HSPA 2R92B 1LM0A 5CV6A 4R4TA 4JI7L 4NXNL 1X3QA 1GHKA 2VXWA 2DN8A 1Y8OB 2HQLA 1QWYA 1T5XD 1SNDA 3LX0A 1PTOF 4A3LG 4GLAC 2B2VC 2ICIA 1A63A 4BY1H
chains in the Genus database with same CATH topology
2CZRA 5JEAJ 1C4QA 3GTMB 4EV1A 4G7OC 1U4MA 2K5WA 3U9SA 3PMFA 3AJVA 5LL6S 3Q22A 4KK7A 4O1NA 2PZWA 2B2VA 1IPIA 3MVVA 2OKFA 1RCVD 2Z4HA 2GW6A 3C46A 1YNJC 3SEBA 1IKLA 1Q8IA 3OIQA 1PXUA 4K5WA 3SK4A 4C3JG 1PTOB 4TRDA 1V1PB 1OB8A 2IX0A 1C48A 2PPBC 2RQXA 1VMPA 3HG9A 3A55A 5I9PA 1LTTD 2A6ED 2EO0A 1FGBD 3HGBA 3MTSA 1I3QB 4IALA 5E3FA 2VLDA 2VB2X 1A3TA 2NN6H 1JICA 2NWGA 1B44D 4A3FB 1CFMA 3WDNA 1D5XC 2F0QA 2CQAA 3EJIA 4EQNA 4H13C 1CZWA 3BDCA 3OPOA 3MXPA 4QUCA 2D2CC 2MHVA 4IN3A 3ND9A 5C3WA 3GTJB 4OHJA 1HCZA 1F2YA 2O5IC 1GXDC 4KN7C 1XWEA 1LO5D 2FLCA 1RZNA 5DM63 3M4OB 4KY7A 3ERQA 4F7XA 3S16B 2NB0A 3LNNA 3S1QB 1DYQA 4QBNA 5FK9C 1OXXK 3OHXC 5D3DA 1PTOC 2FFKB 3C1EA 1F2MA 2IT1A 3TP8A 3NHHA 3PUYA 5KYLA 3VR5A 1KLGD 3DWPA 2CHBD 4S3SA 2E74C 1A3VA 1SE4A 3K7AB 3DHQA 1EYCA 1V1PA 2E2JB 2SNSA 3J7AF 1U4LA 1SE2A 2XIWA 5F2DA 2NVTB 1D1IA 4DAPA 4CKEA 2F0PA 4K8IA 4UAIA 4G4KA 1EWCA 3NUCA 4BS9A 1F9QA 1TIID 4KKUA 3KK7A 1HA6A 1CA5A 2A68C 1W6KA 3A54A 1LACA 5JEAG 2K28A 1YNND 3VR4A 4IZ8A 1QILA 4QBOA 4KD3A 1XX8A 1UEAB 2FMCA 5HURA 2A6HC 3K5OA 1TS2A 3SE0A 1WTXA 3GTKB 5COYA 3OWEB 1AZPA 3H0GB 4C3JB 3J81L 5E1FA 5C3EB 3A8JE 3HOVB 2J4XA 1ESFA 4ULLA 1RLVA 1ZP7A 2KHSA 1GUTA 1MI2A 1EYAA 1CZGA 1WTPA 3BS1A 4DN4M 4OIKA 1TS3A 4QB4A 4QBLA 1CK1A 3KBXA 1LT6D 4X3TA 2FCOA 2ZXRA 4G6VA 1ET9A 3V05A 5EQ0A 3BDOA 1G2SA 3TP7A 1LABA 4DGZA 2DNCA 3RZOB 1SSOA 1T0FA 4RGTA 1HPCA 1DM0B 3DM1A 5IIFA 1EY8A 5KEEA 1PZJD 4N9TA 1IYUA 2IJ0A 1EOTA 2BE5C 3TZDA 2PW7A 5C4HA 4FP5D 2F0DA 1R4PB 5KNBA 1MSGA 2K05A 2OSTA 4G7ZC 2XVSA 2KCCA 5CBEE 3K5LA 2C5CA 1GJXA 2BDNA 1ILPA 3I3CA 1EIGA 4K5XA 1IHZA 1SNOA 3BZDB 3SK6A 3J80E 1VF5C 5NUCA 1SYDA 3DXJC 3FOVA 1EZ8A 1STNA 4QMGA 1FD7D 4KHZA 2YYZA 2C9OA 1U9RA 4IURA 3VA7A 2L4NA 5BN4A 2ID0A 2ENBA 1Q1EA 4ZKBB 1SYEA 1WD0A 4J1MA 1SAPA 4NMZA 2K6AA 4L8JA 5CV5A 2B2WA 1SEBD 3NE5B 1E2ZA 3I90A 4DAVA 1DJRD 1LTGD 4FF2A 1LTAD 2XWBB 1FYCA 4A3MB 2EPBA 1B4OA 1SYBA 2EY5A 4F8MA 3FPPA 4H0LC 2VS1A 3D8GA 1F2LA 3NQIA 2KEEA 1WTWA 1CI3M 3RUZA 1CT1D 3GTGB 3FVQA 3M3YB 3I72A 2KOLA 5C5LA 4DK1A 3K5NA 2E75C 1STGA 1F9PA 1AN8A 3R2IA 3C2PA 3FDTA 3I73A 4KN4C 1H9JA 2VB3X 4FXKC 2KUMA 5C44B 2JP1A 2LY7A 3HEJA 1STHA 4CBVA 3SHLA 3VYUA 5IT9L 1Y88A 1RKNA 2KQ3A 3MZ5A 2PW5A 3M7NA 2F0WA 3IFTA 5K36H 3Q23A 4KJOA 4C2MB 1GUGA 1HHVA 3GV3A 2A6EC 2DY8A 4TKDA 1EY4A 2Z4IA 1SYCA 3DUZA 4V190 2INBA 1TWAB 5CV4A 4RAUC 1Z47A 4PV1C 1RDPD 4HCSA 2F1MA 1D1KA 5EKKA 2WACA 1STEA 1Y8PB 5C0XH 2FMMA 3URYA 2F0NA 5D14A 1XXGA 3D4WA 4X3UA 1G8ZD 5CC4A 3SR1A 5M5WB 1BO0A 2SDFA 4C3HG 1LT3D 1B53A 3QOLA 4ZUJA 2HQEA 1QCBD 2JA6B 2EYLA 3MEHA 1BOSA 1RODA 4HN7A 1QOHA 5ELBA 2EYJA 1VDZA 3J81E 1PMRA 4HEDA 3MWYW 2NTTA 4WJWA 4RGMA 5T1IA 3AJVB 1JORA 1IW7C 1PTOH 3KUPA 3QG1A 3D4DA 4L6TB 3C3LA 3T56B 1R4QB 3KLSA 2WKCA 4KKTA 3KBGA 1XYIA 1EU4A 2FJ2A 4C1NI 4G57A 2MJ8A 2DY7A 3H3VC 5J22A 3RZDB 3V2TA 2HDMA 3SDZA 2EYFA 2WINB 1X32A 2AQ3B 2B2YC 5JVG3 1YNNC 2A69D 5EKLA 3J7AV 1B9NA 2KEDA 3BVZA 4DF7A 1LTSD 1U4RA 3IAYA 1RTNA 3GTOB 4OO1I 1EY9A 2LMCB 4G6UA 1Q12A 1OXUA 2B2YA 2DBSA 1SXTA 5M9OA 2F0TA 1A15A 2WB1B 5ELEA 1OXSC 1LT5D 1W6JA 4DA2A 1TY0A 4IUTA 2J7ZA 3LWEA 3K5MA 1EEFD 1S5BD 3OSOA 4Z9CB 1SBBB 4CJ1B 3PUWA 1TS4A 5IODA 3QIAA 3IL8A 4EQOA 2K01A 4ZQUA 4FYDA 3A8IE 4IFDH 1HTLD 2QILA 5TSSA 4H7BA 4XQQA 4A3DB 1KNEA 2HCIA 4ZRZA 3VR3A 3NQTA 4Q0FA 1V8QA 1M8AA 5KRUA 4NKLA 5I4DA 1IKMA 2L5TA 4PMBA 3SXHA 3S1MB 4BY7B 1PZKD 2IXSA 2Z1CA 1I6VC 2N55A 4TKKA 3S1NB 3NTKA 2X69A 2JSOA 2AQ1B 5FOBB 3DNXA 4C3HB 4KV6A 5CYUA 5G3LD 4J6HA 2JA5B 1VCIA 3H6MA 1XMXA 4V0BA 3R8BA 4KI0A 1LTBD 2WIIB 3CQZB 4JK1C 4MIUA 1K83B 3T53B 1DOKA 1JOKA 4LJZC 3JAML 3S14B 4CGYB 3Q6SA 3RMHA 4FXDA 3W3AA 4WFN3 5FDKA 4I7ZC 1ET6A 2EYPA 2F3VA 2SNMA 3P7JA 1BUVT 3E5SA 5FO9B 2Z8LA 2F0UA 3TBIB 3IFDA 3MHBA 4XT1B 3PIP3 4RH6A 1IYVA 3S9WA 1E0BA 1H9KA 3RD4A 3HP3A 5C3XA 2XRQD 1O7ZA 3BT7A 1STAA 5A35A 1H9SB 4X3SA 1R11A 3CHBD 2B2UC 5KYIA 2PZTA 1XTCD 2NN6I 5JOBA 1F1ZA 2NBFA 1HQMC 4PQXA 2F4IA 3HOXB 5IT9E 3I4LA 2PNRC 1CM9A 4RHRA 2B2UA 1JE4A 1FR3A 1IW7D 4ABNA 1CHPD 3NBHA 4KY5A 4MHEA 1G91A 3W2DA 1KDBA 3HOUB 3NPPA 3OMCA 1I4PA 3NWSA 3GTQB 1UAPA 1RHPA 5I9OA 2E2DC 3MFYA 3A7LA 3NBIA 3T4AC 1OXTA 1OXVA 2G9HD 2QKIC 1B1ZA 2L0CA 4R9WA 1DXMA 2WKDA 3A8KE 3TP5A 3BVGA 1K8MA 2O2LD 4F88A 1A3UA 2B8FA 3M85A 1EFID 5I2XA 1JOQA 4C3IG 3HZXA 4RFBA 3EVQA 2B8GA 2ZXOA 1D6EC 5AFWA 1HQRD 1L0XB 2FINB 4FF1A 2ZT9C 1H9SA 2NYZD 5JEAH 4UDUC 2LFNA 1HRJA 1RJTA 3A56A 5DEHA 4X3KA 1Q90A 1FNUA 4TQUS 1O7LA 3N52A 2WIWA 1S5ED 2RDFA 1SNPA 3ONAB 1LT4D 2RKSA 2ICEC 4DFAA 2JA7B 1WTRA 2R6GA 1LTID 5J1ZA 2F0JA 4BWGB 1QB5D 1EIHA 4ZUIA 2MP1A 3FPUB 4P2CB 3TN2A 2F0KA 2R93B 3FEWX 2L12A 1MBYA 1A2UA 1VMCA 2AWOA 2F0IA 1J8IA 1JWUD 3M4YA 2I07B 2XSCA 4HTHA 4K14A 1PYWD 1RTOA 3AB9A 4K2LA 1HA5A 1NAPA 2R61A 2F03A 5KGUA 2OXPA 3MXNA 2FKHB 5EPLA 2NVYB 2JEAI 4RKBA 4O42A 1MGSA 2AWNA 4NDXA 4B08A 1D2BA 4C56C 2NVQB 3G6JB 1AW7A 5G3LF 1DOLA 5M3MB 3SVMA 5JJZA 1EQVA 1BCPD 1TWFB 4B9XA 1Y8NB 2B2WC 1CQFA 5ELCA 2EZVA 3DEOA 2SEBD 4OGQC 4ZKCB 4ILWA 3N6RA 1Y69U 4K6LA 2F0MA 2IL8A 4LQEA 4HAEA 2N88A 2JXMB 2PMZB 2W8MA 2H1EA 4C3IB 2A69C 5ELDA 4E6ZA 2CW0D 2EE1A 2EY1A 2PZUA 2F0VA 3QB3A 4DAYA 3NXWA 4EVOA 3X3MA 2NZ1D 1HFGA 2H4OA 5EKIA 4IUPA 5J39A 1TWCB 1UUPA 3D6WA 4XTCS 5A2QL 5FLXL 4A93B 1TWGB 5HGTA 2IWHA 1ICWA 1QJOA 4ZAIA 1I4RA 2L1BA 2CV8A 4H44C 3GV6A 4JBWA 2IX1A 1WVLA 3GD7A 1S5CD 1MD2D 1JWMD 2EYOA 2PO4A 2RA4A 2F0GA 1BBXC 4OIJA 4CJ2C 1S5DD 2ZXPA 2KVMA 3QWNA 3IF0X 4R8IA 4N9PA 1JB3A 4MN3A 2EYMA 2Q8IB 3SK8A 3L7ZC 1SDFA 1DD2A 3NSWA 4U68A 1ZKOA 1F9RA 3FKIB 4KD4A 2TSSA 1SNQA 1ZXTA 1PFMA 1O7YA 3GO5A 3S17B 1EY0A 5M3FB 1EY6A 4FVMA 3S15B 2FL3A 1B3AA 5M5XB 5C4ZA 1TWHB 4I65A 3EFXD 3NK9A 5DNFA 3T13A 1JWSD 1WCMB 5CORA 4ZLTF 1HXYD 1R0VA 4RKLA 3C1FA 3OWFA 3S2HB 5CV7A 4KJNA 1FNWA 3TMEA 4HMIA 2L55A 2RVLA 5IGBA 1ML0D 2HUGA 3VR2A 5JVH3 2DNEA 2RSOA 3WOEA 1D5ZC 4LMQD 1S4ZA 1ONLA 3H94A 3Q24A 2OEOA 4PMCA 1Z6HA 2EDGA 2SOBA 2QEJC 2K04A 4A3IB 1ESRA 2KECA 2PQEA 3NTIA 2F0FA 4YIJA 1ENCA 5C5MA 2K5DA 4OO1G 5KIXA 1U4PA 2EJFC 3LWUA 1M4VA 1II3A 5C0XI 5CV9A 5EJWA 3D6CA 1B9MA 2EYHA 3IKJA 2F3WA 5LL6X 5ELFA 1WTOA 3PV0A 1QE6A 5JAVA 2EJMA 1NR4A 5D65A 2A74C 4NP5A 5KNCA 4QCLA 3P75A 5E4WC 4A3KB 4XIGS 3D31A 1HTPA 3BDLA 1BXTA 1ZYRD 2F0OA 1TQOA 2K7VA 4DU9A 1Z7TA 3HKZB 2MGSA 2EVBA 4L63B 1ZEQX 2EXZA 5CBAE 1PRTD 1DOMA 1TY2A 2HCCA 3G7LA 2O4XA 5FO8B 2F0EA 2CVRA 2RDHA 3H91A 1BCPF 2WCZA 2AQ2B 1FNVA 5EGTA 5EBCA 1AFPA 1B2TA 2X6LA 3HOWB 2FKCA 2AUJD 2MPMA 4NW2A 4LK1C 3VYSA 1GHJA 5IGDA 1HFNA 2V4DA 2RBMA 2OF1A 4WRDA 1HUNA 1GUOA 5EPKA 1KTKA 1BDOA 3I70A 2J0TD 2FHTA 1BCPB 2JJQA 3KF8A 2KCNA 2TMPA 1QG7A 4CKCA 4HSVA 5CR3A 3GTLB 3J80L 1QNUA 2MUYA 3QOJA 1TR5A 3VYTA 4C1NK 4K8JA 4A3BB 2RSNA 4FF3A 3FMCA 1YNMA 1KLUD 3IEYB 2JEBI 2G9DA 3K59A 4IFDI 1DONA 2NN6G 3PO3B 3TSSA 1EZ6A 4CKBA 4XDXA 1SYFA 4Q5VA 2B63B 1H9MA 3HOYB 1A79A 2BOSA 2JA8B 5A2QE 5FLXE 3DWQA 1TKWB 2OT2A 1BNZA 3VR6A 4QUFA 4CJ0B 1SFOB 4ID6A 4BBSB 1Y1WB 2K5QA 1CA6A 3R2TA 1I4GA 3PUXA 2O5JC 1JOOA 2GJWA 3DMUA 4IUQA 1JR0D 1KNAA 4PMWA 1WTVA 1NUCA 1BCPC 3GQBA 4HR7B 2K1BA 1CHQD 2EJGC 4FNFA 1BF4A 1BQQT 2HDLA 1B50A 3D4RA 2KA7A 1SMYD 2AUKA 1V1OA 4A3JB 4EGVA 3I4MB 4IQZA 4TSSA 3GTPB 4DXGA 2WV6D 1ENAA 1HUMA 1TT2A 2F0HA 3P1HA 3WOFA 2M2LA 2CW0C 3CU7A 1A6XA 4GZYC 4BA1I 4ZK9B 2B2TC 1TS5A 1KAAA 1SNMA 4RGNA 2KJXA 2RDGA 1EWHA 1I4QA 3IEYA 2QDBA 1AP0A 4BY1B 3P20A 5C6AA 3R93A 2IPKD 2B2TA 4ZQ3A 2BCOA 4M8AA 1J9OA 4U673 1E2VA 2PYKA 4FO2A 3PIO3 5I6YA 3BG3A 5FO7B 1I6HB 5T1GA 5EPJA 1EQTA 1EY7A 3U9OA 1SE3A 4OL7A 1NCVA 1G291 2YU9B 1JC7A 5IGGA 3PUVA 1G2TA 5IGCA 1R9TB 3TP6A 1IL8A 3A7AB 3KLRA 4E6IA 1AZQA 2X6GA 4RCNA 4RWSC 3M7GA 4XQJA 3NWTA 5BN5A 1PFNA 3CRLC 4TKOB 3L3OC 2WAQB 3TZUA 1PRTF 3DEPA 3MXUA 1OB9A 4M1UB 1HH1A 1F2ZA 5I6WA 3OOCA 4DXFA 2WIZA 2Z0RA 2JE6I 3VA5A 4XYQA 4KMUC 1PRTB 5C4JB 4F87A 1YNJD 3K0YA 2LKVA 4G7HC 1RD9D 1STBA 1G6ZA 4RA8A 2WP8J 3BYTB 3T16A 1I4XA 2K03A 3V96A 3X3NA 5E4XA 5KNDA 5C0XJ 1EU3A 2F0SA 2E76C 4WORA 4B9WA 2NTSA 2A73B 1Y1VB 1ENFA 1E2WA 5D3IB 1I50B 3H09A 4A3GB 1GOZA 3UI2A 3S2DB 1S5FD 1H9RA 4HCEA 3S1RB 4XQNA 3QO2A 3L9AX 1ZYRC 3OIPA 4QF4A 1CTMA 2E2HB 1T5EA 3ND8A 3E6ZX 4KTAA 2K33A 4FXGC 1PRTC 2XN9C 1KDCA 2JYOA 2A5HA 3AMUA 3RLFA 3HRZC 3I4NB 4KY6A 2ZYZB 2EY6A 5K5PA 1PTOD 3JAME 1WTQA 5CV8A 2QF7A 1GEFA 2IW3A 5CGKA 3EA6A 3O13A 2BA0A 1DZ1A 2M00A 4BA2I 1EEID 3E0JA 2XNAC 5JPNC 1RF2D 1LLRD 3ITPA 3NP8A 3MFGA 5M5YB 3K6OA 1OO9B 2L11A 1KDAA 3HS0C 3FRPB 3P1ZB 4XT3B 2B39A 2A68D 2F0LA 5DM73 1NSNS 1MSHA 1GUNA 3AU7A 5I2YA 3Q0AA 2XWJB 2Y0SB 2BH2A 4IUVA 1F77A 5K36G 2GA4B 2PCFB 2A6HD 3MXGA 4Y7NB 2D9UA 1SYGA 1UNSA 4IFDJ 5IGFA 1DCZA 4KHVA 3K58A 2I46A 3J7YW 1X3PA 3VYRA 2K32A 2EY2A 5JPMC 1TVXA 4IUNA 2VNUD 3D3RA 4DNTB 2BA1A 5C0XG 4K2KA 2VUMB 5CMDA 1Q3LA 3K57A 4RCOA 2ZYZA 4CHTB 1SJED 1Q1BA 1QNKA 3ZYYX 4DK0A 1EYDA 5LHY1 2NVXB 2EOTA 1STYA 1JCKB 1NR2A 4XYOA 1V43A 2L9HA 3OMGA 1LV9A 1SMYC 2D5DA 4LAAA 4BBRB 1D5MC 5IOCA 1EY5A 2WCWA 1A2TA 2Q8RE 3OW7A 3CRKC 1TU2B 4HMJA 3KLSX 2BE5D 3F2UA 3I91A 4FF4A 3P1ZA 4K6DA 1PFBA 2LS01 5BN3A 1CQVA 2IX3A 3QJYA 3HOZB 1WD1A 5FKAC 5C4XB 3NTHA 3BYYB 1I4HA 2WJ0A 1Y1OA 1F9SA 1GUWA 4J8QA 4ODGA 5ISRA 3EQLC 4DNRB 3BVMA 1PLFA 4PNYA 4EQPA 1JQYD 3CKIB 5EBDA 3PO2B 2BDOA 3P1YA 4AYBB 4QIWB 4A3EB 2D62A 1KABA 1SJHD 5DAUA 1GUSA 1C8CA 4OO1H 1AEXA 3R3OA 3DWAA 4R8NA 4ME5A 4K5VA 1VF7A 3MA2B 2E2IB 2M9VA 1LTRD 4IUUA 3TDQA 1K8OA 4RGOS 4KKSA 4RHSA 1SNCA 4ZYSA 1L0YB 1ILQA 2R7ZB 2XRSD 5IGEA 3MC0B 1BR9A 4XXEA 3SK5A 1EL0A 3MAQA 1PZID 3GP7A 4IFDG 2Q8TA 3I8ZA 3PUZA 2QCPX 3EROA 2NUCA 2R3ZA 1O78A 1PDQA 1UWVA 1O80A 3T51B 4HSPA 2R92B 5CV6A 1GHKA 1X3QA 2VXWA 2DN8A 1Y8OB 1T5XD 1QWYA 1SNDA 3LX0A 1PTOF 2B2VC 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DA2 A;  4DAP A;  4DAV A; 
#chains in the Genus database with same CATH topology
 3AQQ A;  3LGJ A;  2CZR A;  5JEA J;  1C4Q A;  3GTM B;  1X3G A;  4R4C A;  4G7O C;  4EV1 A;  1U4M A;  2K5W A;  3U9S A;  3PMF A;  4UPA A;  3L2P A;  1MJE A;  3AJV A;  5LL6 S;  1UE5 A;  3Q22 A;  4KK7 A;  4O1N A;  2PZW A;  3EBE A;  1AE3 A;  2K4K A;  2B2V A;  1VQM A;  1I6H H;  1IPI A;  3MVV A;  2OKF A;  4JI4 Q;  4X65 Q;  1RCV D;  2Z4H A;  2GW6 A;  3C46 A;  1YNJ C;  3SEB A;  4RMF A;  4CDE C;  1IKL A;  4AIM A;  3OIQ A;  1Q8I A;  1PXU A;  4K5W A;  3SK4 A;  1WJJ A;  2YU9 H;  5IYB H;  4JI4 L;  4X65 L;  3H0G G;  3UDX A;  4C3J G;  1PTO B;  3E0E A;  4TRD A;  1V1P B;  1OB8 A;  2IX0 A;  1C48 A;  1U0L A;  5C3E G;  2PPB C;  2RQX A;  4HID A;  3HOV G;  2DGY A;  1VMP A;  2I0Q A;  3HG9 A;  2UXC Q;  1HH2 P;  1IZ6 A;  3A55 A;  1R9T H;  5I9P A;  1LTT D;  2A6E D;  2EO0 A;  1FGB D;  3HGB A;  3KYH C;  3CCR A;  1P8L A;  3MTS A;  1I3Q B;  4IAL A;  4LFB Q;  2B29 A;  5E3F A;  2UXC L;  4LUV A;  2VLD A;  3TEH B;  2VB2 X;  5BR8 Q;  1A3T A;  2NN6 H;  1JIC A;  2NWG A;  1B44 D;  4A3F B;  4LFB L;  1CKO A;  1CFM A;  3WDN A;  1D5X C;  2F0Q A;  2CQA A;  3EJI A;  1K28 A;  4TVA B;  4EQN A;  1SRO A;  4H13 C;  4P75 A;  1CZW A;  3PSI A;  5BR8 L;  3BDC A;  5C3E H;  2KHJ A;  1LTL A;  3OPO A;  4J15 A;  1BBW A;  3MXP A;  4QUC A;  2D2C C;  2MHV A;  1QZH A;  4IN3 A;  2OCE A;  4UP7 A;  3ND9 A;  5C3W A;  1K8G A;  3GTJ B;  4OHJ A;  5IY0 A;  1EWI A;  1HCZ A;  4X64 Q;  5GAD C;  1F2Y A;  2O5I C;  1GXD C;  4KN7 C;  1XWE A;  1LO5 D;  2FLC A;  1RZN A;  5DM6 3;  3M4O B;  4KY7 A;  3ERQ A;  4X64 L;  4F7X A;  3S16 B;  2NB0 A;  4CDC C;  3LNN A;  3S1Q B;  2QEX A;  1DYQ A;  3F2C A;  1X65 A;  4QBN A;  5FK9 C;  1OXX K;  3ULJ A;  4UP8 A;  3OHX C;  2ZTD A;  5D3D A;  5ELN A;  1PTO C;  2YTV A;  5C4J H;  3AYH B;  2FFK B;  3C1E A;  1F2M A;  1X54 A;  1C9O A;  2IT1 A;  3TP8 A;  3NHH A;  3PUY A;  1K0R A;  5KYL A;  4B3R Q;  3VR5 A;  1KLG D;  3DWP A;  2CHB D;  1Y1V G;  4S3S A;  1PH8 A;  4A3G G;  1O7I A;  2E74 C;  1A3V A;  1SE4 A;  3K7A B;  3DHQ A;  1EYC A;  2RCF A;  4B3R L;  1V1P A;  2E2J B;  2SNS A;  3J7A F;  1U4L A;  1SE2 A;  2XIW A;  5F2D A;  2NVT B;  1D1I A;  4DAP A;  4CKE A;  2F0P A;  4K8I A;  4UAI A;  4PZ8 A;  5FLM G;  4G4K A;  1IYJ B;  1EWC A;  3NUC A;  4BS9 A;  2FXQ A;  1F9Q A;  1TII D;  2CKZ B;  4KKU A;  3KK7 A;  1HA6 A;  5J3B A;  1CA5 A;  2R7F A;  2A68 C;  2PI2 E;  3A54 A;  1W6K A;  1Y1V H;  1LAC A;  5JEA G;  2UU9 Q;  1I50 H;  2K5H A;  2K28 A;  1YNN D;  3VR4 A;  4DV5 Q;  4A3G H;  4IZ8 A;  1QIL A;  3BZC A;  3S2D H;  1HJP A;  2RF4 A;  2E5L Q;  4QBO A;  4KD3 A;  1QVG A;  3S1R H;  1XX8 A;  1UEA B;  4O0A A;  2FMC A;  2UU9 L;  1W2B A;  5HUR A;  2A6H C;  3K5O A;  4DV5 L;  2KHI A;  1TS2 A;  5ELO A;  3SE0 A;  1WTX A;  3GTK B;  2E5L L;  2HIX A;  4AQY Q;  3CCJ A;  5COY A;  4A3M G;  1E22 A;  1E7Z A;  3OWE B;  1AZP A;  3H0G B;  4C3J B;  3J81 L;  4AQY L;  5E1F A;  5C3E B;  1GO3 E;  3A8J E;  3HOV B;  2J4X A;  1ESF A;  4ULL A;  1RLV A;  4APV A;  1ZP7 A;  1Q7Y C;  4X6A H;  2KHS A;  3CC2 A;  2WFW A;  1GUT A;  1MI2 A;  1EYA A;  1RL2 A;  1CZG A;  1WTP A;  3BS1 A;  4DN4 M;  1CKN A;  3CME A;  4OIK A;  4EX5 A;  1TS3 A;  4QB4 A;  4QBL A;  5HY6 A;  1CK1 A;  3KBX A;  1LT6 D;  4EQ5 A;  4X3T A;  1KHI A;  3I56 A;  4YWL A;  4LUO A;  2PMZ E;  4JI8 Q;  1ASY A;  2FCO A;  3OW2 A;  4LWC A;  4QJF A;  2ZXR A;  2RCN A;  4G6V A;  1ET9 A;  3V05 A;  2MO1 A;  4POG A;  5EQ0 A;  3BDO A;  1G2S A;  3TP7 A;  1LAB A;  4JI8 L;  4DGZ A;  2DNC A;  3RZO B;  2Q2T A;  4MNO A;  5M5Y H;  1D8L A;  1SSO A;  1T0F A;  4YWM A;  1IXR A;  4RGT A;  1HPC A;  4L5S A;  2ASB A;  4GKJ Q;  1DM0 B;  3DM1 A;  5IIF A;  1EY8 A;  5KEE A;  1YJN A;  1PZJ D;  4N9T A;  1IYU A;  3A5Z B;  2IJ0 A;  5C44 G;  4JPB W;  1EOT A;  2ZJP A;  2CH4 W;  3PIO A;  2BE5 C;  4GKJ L;  3TZD A;  4WJ3 M;  4OWX B;  1YIT A;  2PW7 A;  5C4H A;  1HNX Q;  4FP5 D;  2F0D A;  3I55 A;  1YJ9 A;  1XNR Q;  1R4P B;  1VQN A;  5KNB A;  1MSG A;  4H02 A;  2K05 A;  5E7N A;  3RN2 A;  1VQ6 A;  2OST A;  4Y7N H;  1HZ9 A;  4G7Z C;  2XVS A;  1N36 Q;  1HNX L;  4A4I A;  2KCC A;  4JI0 Q;  1XNR L;  5CBE E;  3K5L A;  1UE1 A;  2C5C A;  1GJX A;  2BDN A;  5FJ8 G;  4YCU A;  1ILP A;  3I3C A;  1N36 L;  1EIG A;  4JI0 L;  4K5X A;  1IHZ A;  1SNO A;  3BZD B;  3SK6 A;  3J80 E;  1VF5 C;  5NUC A;  1SLJ A;  1SYD A;  2RHS B;  3DXJ C;  3FOV A;  1EZ8 A;  2VUM H;  4OWT B;  1STN A;  4QMG A;  1FD7 D;  3UDF A;  1VQH A;  4KHZ A;  1HZC A;  2YYZ A;  5GAH C;  2MQH A;  2C9O A;  1T9H A;  1U9R A;  1D7Q A;  4IUR A;  3VA7 A;  2L4N A;  5BN4 A;  4DR3 Q;  2ID0 A;  2ENB A;  1Q1E A;  4ZKB B;  1SYE A;  1WD0 A;  4J1M A;  2NVX H;  1SAP A;  2AMC B;  4NMZ A;  2K6A A;  4L8J A;  2JA6 G;  5CV5 A;  2B2W A;  1SEB D;  3NE5 B;  1E2Z A;  3I90 A;  4DAV A;  4DR3 L;  1JJG A;  1DJR D;  1LTG D;  3CCS A;  4FF2 A;  4I7A A;  1LTA D;  2XWB B;  4BBR H;  1FYC A;  1VQA A;  4A3M B;  2EPB A;  3G71 A;  1B4O A;  1SYB A;  2Q2H A;  2EY5 A;  3NEL A;  4UP9 A;  4NPS A;  4F8M A;  3FPP A;  1K0S A;  1VQK A;  4H0L C;  2IHF A;  4LF8 Q;  3HOZ H;  2VQF Q;  2VS1 A;  3D8G A;  5C4X H;  2PI2 A;  1F2L A;  3NQI A;  4GS3 A;  2KEE A;  1WTW A;  1CI3 M;  5FLX c;  3RUZ A;  1CT1 D;  1HR0 Q;  4LF8 L;  3GTG B;  2VQF L;  4HJA A;  1X6O A;  4QL5 A;  3FVQ A;  3M3Y B;  3I72 A;  3PO2 H;  2I5M X;  2KOL A;  5C5L A;  4DK1 A;  1HR0 L;  3E3X A;  4A3E H;  3K5N A;  2E75 C;  1Q82 C;  1DGS A;  1STG A;  1F9P A;  1AN8 A;  3R2I A;  3C2P A;  1UEB A;  4LFC Q;  3FDT A;  3I73 A;  1N33 Q;  4KN4 C;  1H9J A;  4DV6 Q;  2E2I H;  2VB3 X;  4FXK C;  2KUM A;  5C44 B;  2JP1 A;  2LY7 A;  3HEJ A;  1STH A;  4LFC L;  4CBV A;  3SHL A;  4BXX H;  1N33 L;  3VYU A;  2ZTC A;  4DV6 L;  1VQ5 A;  5IT9 L;  1Y88 A;  1RKN A;  2KQ3 A;  3MZ5 A;  4WJ4 A;  1NTG A;  2PW5 A;  3M7N A;  2F0W A;  3IFT A;  5K36 H;  3Q23 A;  2R7Z H;  4KJO A;  4C2M B;  1GUG A;  1VQG A;  1HHV A;  3GV3 A;  2A6E C;  2DY8 A;  4IJL A;  4TKD A;  5IT9 c;  4X62 Q;  1YBY A;  1EY4 A;  2Z4I A;  1JJ2 A;  3RNU A;  1SYC A;  1KD1 C;  3DUZ A;  4V19 0;  2INB A;  1TWA B;  5CV4 A;  3HKZ E;  4RAU C;  1Z47 A;  4X62 L;  4A3D G;  4PV1 C;  1RDP D;  4HCS A;  2F1M A;  1D1K A;  5EKK A;  2WAC A;  1STE A;  1Y8P B;  3EN2 A;  4B3T Q;  4K0K Q;  1CSQ A;  5C0X H;  2R92 H;  2FMM A;  3URY A;  2F0N A;  5D14 A;  1XXG A;  3D4W A;  4BY7 G;  4X3U A;  1G8Z D;  2N49 A;  5CC4 A;  3BJU A;  4K0K L;  4B3T L;  3SR1 A;  2WB1 E;  5M5W B;  1VQ8 A;  2F4V Q;  1BO0 A;  2SDF A;  1RIP A;  4C3H G;  1LT3 D;  4JV5 Q;  2JA5 G;  1B53 A;  3QOL A;  4ZUJ A;  1NE3 A;  2HQE A;  1KRS A;  2F4V L;  3HKS A;  1EIF A;  1QCB D;  2JA6 B;  2EYL A;  3GTM H;  2UXD Q;  3MEH A;  4JV5 L;  4Y52 H;  1BOS A;  1ROD A;  2GVA A;  2MO0 A;  4HN7 A;  1QOH A;  5ELB A;  1EOV A;  2EYJ A;  2LXK A;  1VDZ A;  1PFS A;  3J81 E;  1PMR A;  4HED A;  3S1M H;  2UXD L;  2UUC Q;  1VQI A;  3MWY W;  2NTT A;  4WJW A;  1KIX A;  2HHH Q;  4RGM A;  5T1I A;  2JQO A;  1K8A C;  3AJV B;  1JOR A;  1WYD A;  4LF4 Q;  1IW7 C;  1FGU A;  1PTO H;  2UUC L;  3KUP A;  3QG1 A;  3D4D A;  4L6T B;  3C3L A;  2ALY B;  1R4Q B;  3T56 B;  2HHH L;  3KLS A;  2WKC A;  4KKT A;  3KBG A;  3TS2 A;  4LF4 L;  1XYI A;  2KEN A;  1EU4 A;  2FJ2 A;  4C1N I;  2JA9 A;  4G57 A;  2MJ8 A;  1B70 B;  2DY7 A;  3H3V C;  5J22 A;  3ICE A;  3RZD B;  1X55 A;  1SRU A;  1IBM Q;  3M4Q A;  3V2T A;  4A3F H;  2Z6B A;  2N78 A;  2HDM A;  3SDZ A;  2EYF A;  2WIN B;  1X32 A;  2AQ3 B;  2B2Y C;  5JVG 3;  1YNN C;  1IBM L;  3CCE A;  4JI1 Q;  2A69 D;  5EKL A;  3J7A V;  1B9N A;  2KED A;  3BVZ A;  3MEF A;  4DF7 A;  1LTS D;  2KCT A;  2PQA B;  1KAW A;  3A5U A;  1U4R A;  3RN5 A;  2OWO A;  1XNQ Q;  3IAY A;  1RTN A;  3GTO B;  3KJP A;  2EXD A;  4JI1 L;  3GTJ H;  4OO1 I;  3HOX G;  1KC8 C;  1EY9 A;  2LMC B;  4G6U A;  1Q12 A;  1OXU A;  2B2Y A;  2DBS A;  1VQD A;  1SXT A;  1XNQ L;  5M9O A;  2F0T A;  1A15 A;  1N32 Q;  3M4O H;  2WB1 B;  5ELE A;  1OXS C;  1LT5 D;  1W6J A;  4DA2 A;  5IWA Q;  1TY0 A;  3HOU G;  2YTX A;  1HZA A;  4IUT A;  2J7Z A;  3LWE A;  3K5M A;  1EEF D;  1S5B D;  3S1Q H;  3OSO A;  4Z9C B;  1SBB B;  4CJ1 B;  3PUW A;  1N32 L;  5H1S E;  1TS4 A;  4CDD C;  3QIA A;  5IOD A;  3IL8 A;  4EQO A;  2K01 A;  4ZQU A;  3CCL A;  4FYD A;  4P74 A;  5IWA L;  3A8I E;  3I7F A;  4IFD H;  3ERS X;  2D0P A;  1HTL D;  4GOP A;  2QIL A;  1BBU A;  5TSS A;  3HOX H;  4H7B A;  4XQQ A;  4A3D B;  4JYA Q;  1KNE A;  2HCI A;  4ZRZ A;  3VR3 A;  4IOA A;  3NQT A;  4Q0F A;  1V8Q A;  1M8A A;  5KRU A;  4NKL A;  3K7A H;  5I4D A;  2L5T A;  1IKM A;  4PMB A;  3SXH A;  4JYA L;  3CCU A;  1P16 A;  4A75 A;  1FL0 A;  2E2J H;  3S1M B;  2K5V A;  2V1C C;  2NVT H;  4GN3 B;  4BY7 B;  1PZK D;  2IXS A;  2Z1C A;  1I6V C;  2N55 A;  1YIJ A;  4TKK A;  4RG1 A;  3S1N B;  3NTK A;  2X69 A;  2JSO A;  4A3L H;  2AQ1 B;  3NBH B;  3K81 C;  5FOB B;  3DNX A;  4C3H B;  4KV6 A;  5CYU A;  5G3L D;  4J6H A;  2JA5 B;  1VCI A;  3H6M A;  1XMX A;  4V0B A;  1E1O A;  3R8B A;  4KI0 A;  4OXP A;  1LTB D;  2WII B;  3CQZ B;  4JK1 C;  4MIU A;  1E1T A;  1K83 B;  3T53 B;  1DOK A;  1JOK A;  2HIV A;  4LJZ C;  1CKM A;  3JAM L;  3S14 B;  4CGY B;  3Q6S A;  3RMH A;  4FXD A;  4JI2 Q;  2PQA A;  4GN4 B;  3RLO A;  3W3A A;  1VQE A;  3GTK H;  4WFN 3;  4HIK A;  5FDK A;  4I7Z C;  1ET6 A;  3CMA A;  2UUB Q;  2EYP A;  1L0W A;  3JAM c;  1UE6 A;  3H0G H;  4JI2 L;  4C3J H;  2F3V A;  2GVB A;  2SNM A;  1BUV T;  3DM3 A;  3P7J A;  3E5S A;  5FO9 B;  4DV2 Q;  1PH4 A;  2Z8L A;  2JA7 G;  3HOV H;  3S24 A;  4JC0 A;  2F0U A;  2UUB L;  4DKA C;  4R4I A;  3TBI B;  3IFD A;  5JJK A;  3KFU A;  3MHB A;  4XT1 B;  3PIP 3;  4RH6 A;  2QDL A;  1K73 C;  4DV2 L;  1IYV A;  3S9W A;  1E0B A;  2R93 G;  3K80 C;  1H9K A;  3HP3 A;  3RD4 A;  5C3X A;  2XRQ D;  1O7Z A;  3BT7 A;  1STA A;  5A35 A;  1H9S B;  1ICF B;  4X3S A;  1R11 A;  3CHB D;  3STB D;  3U4V A;  2B2U C;  5KYI A;  3J81 i;  1B7Y B;  2PZT A;  3CCM A;  1E3P A;  1NMF A;  1XTC D;  1CKN B;  2K50 A;  2NN6 I;  5JOB A;  1F1Z A;  2WAQ E;  2NBF A;  1VQO A;  1JJC B;  1HQM C;  4HJ8 A;  4PQX A;  2F4I A;  3FP9 A;  3RZO H;  1YI2 A;  3HOX B;  5IT9 E;  3I4L A;  2PNR C;  1CM9 A;  4RHR A;  2B2U A;  2UUA Q;  1JE4 A;  1FR3 A;  1IW7 D;  5GQO A;  4ABN A;  1CHP D;  3NBH A;  4KY5 A;  4MHE A;  3SGI A;  4GN5 A;  1N34 Q;  1G91 A;  2NZH A;  3NEN A;  3W2D A;  1KDB A;  3HOU B;  1YNX A;  2UUA L;  3J7Z C;  3NPP A;  1VQC A;  3OMC A;  1I4P A;  3TQY A;  3NWS A;  2E8G A;  3GDE A;  3GTQ B;  1UAP A;  1RHP A;  5M3M G;  5I9O A;  2E2D C;  1N34 L;  3D0F A;  1PYB A;  2VL6 A;  3MFY A;  4GLX A;  3A7L A;  4LF5 Q;  3NBI A;  3T4A C;  1OXT A;  1OXV A;  2G9H D;  2QKI C;  2OQK A;  1B1Z A;  2L0C A;  1KXL A;  4POF A;  4R9W A;  1DXM A;  4IPC A;  2WKD A;  1K3R A;  3A8K E;  4LF5 L;  3TP5 A;  1CSP A;  1MKH A;  3K7U C;  3BVG A;  1VS0 A;  1K8M A;  2O2L D;  4F88 A;  1A3U A;  2B8F A;  3M85 A;  2QGQ A;  1EFI D;  5I2X A;  5EAY A;  1JOQ A;  4C3I G;  3HZX A;  5FLM H;  4RFB A;  1NJI C;  1IBL Q;  2R7D A;  3EVQ A;  3M9B A;  2B8G A;  2ZXO A;  2Z6K C;  2AKW B;  1D6E C;  5AFW A;  1HQR D;  1L0X B;  2FIN B;  4FF1 A;  4DV4 Q;  2ZT9 C;  1IBL L;  1VQJ A;  1H9S A;  2NYZ D;  5JEA H;  1WOC A;  1X9N A;  4UDU C;  2LFN A;  1HRJ A;  1RJT A;  4A93 G;  3W1B A;  3A56 A;  4DV4 L;  5DEH A;  4X3K A;  2Z6K A;  3PIP A;  1VQF A;  1Q90 A;  3IRB A;  3G48 A;  4C3I H;  1PH5 A;  2I5H A;  1FNU A;  4TQU S;  1O7L A;  3N52 A;  2WIW A;  1S5E D;  2RDF A;  1SNP A;  1XMQ Q;  4A3M H;  3ONA B;  1LT4 D;  2RKS A;  4CDF C;  2ICE C;  4DFA A;  2CWP A;  2JA7 B;  2IHE A;  2C35 B;  1WTR A;  1XMQ L;  2Z9H A;  2R6G A;  1LTI D;  1TWC H;  5J1Z A;  2F0J A;  4BWG B;  1QB5 D;  1EIH A;  4ZUI A;  2MP1 A;  1JMC A;  3FPU B;  4P2C B;  3TN2 A;  2F0K A;  1JB7 A;  2R93 B;  4DAY B;  3FEW X;  2L12 A;  1PVO A;  1M90 C;  1MBY A;  1A2U A;  1VMC A;  3GTG H;  5L37 A;  2AWO A;  1K3B C;  2F0I A;  1J8I A;  1VQB A;  1JWU D;  3M4Y A;  2I07 B;  3M3Y H;  2XSC A;  4HTH A;  4K14 A;  1PYW D;  4IOC A;  1RTO A;  3AB9 A;  4JVZ A;  4K2L A;  1HA5 A;  1NAP A;  3T1Y Q;  1Z9F A;  2R61 A;  2F03 A;  4JW0 A;  5KGU A;  2OXP A;  3MXN A;  2FKH B;  5EPL A;  3OTO Q;  2NVY B;  3FKI G;  4L5R C;  1JE5 A;  2JEA I;  1JT8 A;  4RKB A;  4O42 A;  3T1Y L;  1MGS A;  2AWN A;  1PH6 A;  4NDX A;  4B08 A;  3OTO L;  5M3F G;  1D2B A;  5C44 H;  4C56 C;  2NVQ B;  3G6J B;  2VY3 A;  1AW7 A;  5G3L F;  4DR7 Q;  1DOL A;  1L1O A;  4NXM Q;  5M3M B;  3SVM A;  5JJZ A;  2ZJQ A;  5DLQ E;  3W1G A;  1EQV A;  2Y0S E;  4C2M H;  1BCP D;  1TWF B;  4B9X A;  2RHQ B;  4DR7 L;  1Y8N B;  2B2W C;  1CQF A;  5ELC A;  2EZV A;  5IYC G;  3DEO A;  1XMO Q;  4NXM L;  2SEB D;  4OGQ C;  4ZKC B;  4ILW A;  3N6R A;  1Y69 U;  2GN5 A;  1TWA H;  4K6L A;  4DR5 Q;  2F0M A;  2IL8 A;  5FJ8 H;  1XMO L;  4LQE A;  4HAE A;  2N88 A;  1X3E A;  2JXM B;  3PCO B;  2PMZ B;  2W8M A;  1N9W A;  4IJH A;  4DR5 L;  5IYD G;  1EUJ A;  3H3V H;  2H1E A;  2OTJ A;  4C3I B;  4A3I G;  2A69 C;  5ELD A;  4E6Z A;  2CW0 D;  2QA4 A;  1YEZ A;  2EE1 A;  2EY1 A;  2PZU A;  1YJW A;  3PF4 A;  4KHP Q;  2F0V A;  3QB3 A;  4ME3 A;  4DAY A;  4P73 A;  5M5W H;  3NXW A;  4EVO A;  3X3M A;  2NZ1 D;  1HFG A;  2H4O A;  2I5L X;  5EKI A;  4IUP A;  5J39 A;  3AFQ A;  1TWC B;  3CF5 A;  4KHP L;  1UUP A;  3D6W A;  4XTC S;  5A2Q L;  5LMN Q;  5FLX L;  2LSS A;  4A93 B;  1A8V A;  2JA6 H;  1TWG B;  5HGT A;  3JC6 6;  1AH9 A;  2IWH A;  4LF6 Q;  1Q46 A;  1WTH A;  1ICW A;  1QJO A;  4ZAI A;  1I4R A;  2L1B A;  3Q8D A;  2CV8 A;  4H44 C;  5LMN L;  3AFP A;  3F8T A;  3GV6 A;  4QGU A;  2DJG C;  1PH7 A;  4JBW A;  4PZ6 A;  2OTL A;  2IX1 A;  1SE8 A;  2ATW A;  4LF6 L;  3UE1 A;  4A3K G;  1WVL A;  3GD7 A;  1S5C D;  1MD2 D;  1U5K A;  2VW9 A;  3CAM A;  1JWM D;  2BH8 A;  3HKZ G;  2EYO A;  2PO4 A;  2RA4 A;  1A62 A;  2F0G A;  1BBX C;  4OIJ A;  4CJ2 C;  1S5D D;  2ZXP A;  2KVM A;  3QWN A;  5GRO A;  1XTD A;  3IF0 X;  4R8I A;  5JJI A;  1KQS A;  4DUZ Q;  4N9P A;  1JB3 A;  2EIF A;  4MN3 A;  4LF7 Q;  3RZD H;  4A76 A;  2EYM A;  2Q8I B;  3SK8 A;  3L7Z C;  1SDF A;  2WB1 G;  3HOW G;  4DUZ L;  1DD2 A;  3NSW A;  1VQ9 A;  4LF7 L;  4AYB E;  4OON A;  4QIW E;  1ZKO A;  4U68 A;  1EYG A;  1F9R A;  4DK6 C;  3FKI B;  4KD4 A;  2OQ0 A;  2TSS A;  4DR2 Q;  1SNQ A;  3CD6 A;  4B3S L;  1ZXT A;  1PFM A;  1O7Y A;  3GO5 A;  3GTO H;  3S17 B;  3UE0 A;  1EY0 A;  3UDI A;  5M3F B;  1EY6 A;  4DR2 L;  4FVM A;  3S15 B;  2F52 A;  2FL3 A;  4JI3 Q;  1B3A A;  1Y14 B;  5M5X B;  5C4Z A;  1TWH B;  3PF5 A;  4I65 A;  1PV4 A;  3EFX D;  3NK9 A;  5DNF A;  3T13 A;  1JWS D;  1WCM B;  5COR A;  3ULP A;  4JI3 L;  1NNX A;  4ZLT F;  1HXY D;  1R0V A;  4RKL A;  3C1F A;  3OWF A;  3S2H B;  5CV7 A;  4KJN A;  4A3B G;  1IBK Q;  4JG2 A;  2JK8 A;  1FNW A;  3TME A;  2L55 A;  4HMI A;  2RVL A;  2VZA A;  3F1Z A;  1ML0 D;  5IGB A;  2HUG A;  2KCM A;  3VR2 A;  5JVH 3;  1L2F A;  2DNE A;  4A3D H;  2RSO A;  3WOE A;  1D5Z C;  2A1A A;  4LMQ D;  1IBK L;  1S4Z A;  1ONL A;  3STB C;  3H94 A;  3Q24 A;  2OEO A;  4PMC A;  1LUZ A;  1Z6H A;  2EDG A;  2SOB A;  2QEJ C;  2K04 A;  4A3I B;  1ESR A;  2KEC A;  2PQE A;  1H95 A;  4GOP B;  3GTL H;  3NTI A;  2F0F A;  4YIJ A;  2CH4 A;  2H5X A;  1ENC A;  1QUQ A;  2B63 G;  4BY7 H;  5C5M A;  2K5D A;  4OO1 G;  5KIX A;  3HOY G;  1UE7 A;  3S1N H;  2JA8 G;  1U4P A;  1XPO A;  2EJF C;  3KF8 B;  1MHW C;  3LWU A;  1GD7 A;  1M4V A;  4C3H H;  1II3 A;  5C0X I;  5CV9 A;  2JA5 H;  5EJW A;  3D6C A;  1B9M A;  2EYH A;  3IKJ A;  2F3W A;  5LL6 X;  5ELF A;  1FVI A;  1Y1W G;  1WTO A;  3PV0 A;  3F2D A;  1QE6 A;  2K75 A;  3CQZ H;  1PH2 A;  2K52 A;  5JAV A;  5IP9 G;  2EJM A;  1K83 H;  4IPH A;  2CQO A;  1NR4 A;  2CWA A;  1W3S A;  4FDB A;  5D65 A;  3BU2 A;  2A74 C;  4NP5 A;  5KNC A;  4IO9 A;  3UDG A;  1VQ4 A;  3S14 H;  4QQB X;  4QCL A;  1G51 A;  3P75 A;  5E4W C;  4A3K B;  3K0X A;  4XIG S;  3D31 A;  1HTP A;  3BDL A;  1BXT A;  1ZYR D;  2Z0S A;  2F0O A;  1TQO A;  2K7V A;  4DU9 A;  3OYY A;  1Z7T A;  3HKZ B;  4GKK Q;  4A3J G;  2MGS A;  3I4M G;  2EVB A;  4L63 B;  1ZEQ X;  2EXZ A;  5CBA E;  1PRT D;  1DOM A;  4GKK L;  1TY2 A;  3JAM i;  2HCC A;  3G7L A;  2O4X A;  5FO8 B;  3VDY A;  2F0E A;  2CVR A;  1X56 A;  3H91 A;  1BCP F;  2RDH A;  2WCZ A;  2AQ2 B;  1FNV A;  4PZ7 A;  5EGT A;  5EBC A;  1AFP A;  1B2T A;  1MJC A;  2X6L A;  4DNI A;  3HOW B;  4GOP C;  1Q86 C;  2FKC A;  2AUJ D;  2MPM A;  1S3O A;  3W5O A;  4NW2 A;  4LK1 C;  3VYS A;  1PH3 A;  1GHJ A;  2CCZ A;  5IGD A;  1HFN A;  2V4D A;  1NY4 A;  4BY1 G;  1QZG A;  2RBM A;  2OF1 A;  4YCW A;  1GVP A;  4WRD A;  1HUN A;  1GUO A;  1EFW A;  5EPK A;  1KTK A;  1BDO A;  3I70 A;  4DR4 Q;  4P71 A;  2J0T D;  5JJL A;  2FHT A;  1BCP B;  2JJQ A;  3KF8 A;  2KCN A;  1YHA A;  2TMP A;  4PG3 A;  1QG7 A;  4JBK A;  3HOU H;  4CKC A;  1I94 Q;  1TXY A;  4HSV A;  5CR3 A;  3GTL B;  3J80 L;  4DR4 L;  1QNU A;  2MUY A;  3QOJ A;  2K14 A;  4YCV A;  5IYB G;  1TR5 A;  4MTN A;  3GTQ H;  3VYT A;  3E9I A;  4C1N K;  4K8J A;  4A3B B;  2CFM A;  1I94 L;  2RSN A;  4FF3 A;  3FMC A;  3J80 c;  3U58 A;  1YNM A;  2VQE Q;  4KLK A;  1KLU D;  4DR6 Q;  2EQS A;  3IEY B;  2XTI A;  2JEB I;  2G9D A;  3K59 A;  4P72 A;  4JBJ A;  5LMN W;  2VQE L;  4IFD I;  1I5F A;  1DON A;  3K8A A;  4DR6 L;  3CC4 A;  1QVC A;  2NN6 G;  3PO3 B;  3F2B A;  3TSS A;  1EZ6 A;  4CKB A;  4XDX A;  3TS0 A;  1SYF A;  1HNW Q;  4Q5V A;  2B63 B;  1EQR A;  1BKB A;  1HR0 W;  1H9M A;  3HOY B;  2WAQ G;  1A79 A;  1WI5 A;  2BOS A;  2JA8 B;  5A2Q E;  5FLX E;  1HNW L;  3DWQ A;  1TKW B;  3NEM A;  5GAE C;  2OT2 A;  1BNZ A;  4R4O A;  3VR6 A;  4QUF A;  1HZB A;  4CJ0 B;  1SFO B;  4ID6 A;  4LUZ A;  4BBS B;  1Y1W B;  2K5Q A;  1IL2 A;  1CA6 A;  3R2T A;  4YHH Q;  1I4G A;  3PUX A;  2O5J C;  1JOO A;  2GJW A;  4MZ9 A;  2KBN A;  3DMU A;  4IUQ A;  1JR0 D;  1KNA A;  4PMW A;  1WTV A;  1NUC A;  1BCP C;  3GQB A;  4GLV B;  4HR7 B;  2K1B A;  4YHH L;  3CP0 A;  4JOI C;  1CHQ D;  4X66 Q;  2EJG C;  4FNF A;  1BF4 A;  1BQQ T;  2HDL A;  1B50 A;  1V1Q A;  3D4R A;  3L0O A;  2ZJR A;  1XJV A;  2KA7 A;  1SMY D;  2AUK A;  4IPG A;  1HNZ Q;  1J6Q A;  1NMG A;  1V1O A;  4A3J B;  4EGV A;  3I4M B;  4X66 L;  4IQZ A;  4TSS A;  3GTP B;  2MFI A;  4JI5 Q;  2JA7 H;  4DXG A;  1HNZ L;  4JOI A;  2WV6 D;  4JBM A;  1ENA A;  1HUM A;  3TRE A;  1TT2 A;  2F0H A;  3P1H A;  3WOF A;  2DJF C;  3J81 j;  4MTK A;  3U4Z A;  2M2L A;  4JI5 L;  2AHO B;  2R93 H;  2CW0 C;  3CU7 A;  4UY8 C;  1A6X A;  4GZY C;  4BA1 I;  4ZK9 B;  2B2T C;  1TS5 A;  3EIV A;  5LMU Q;  4DV7 Q;  1KAA A;  1SNM A;  4RGN A;  3DLL A;  2KJX A;  2RDG A;  1EWH A;  1I4Q A;  4L5T A;  2XGT A;  3IEY A;  4DV7 L;  4O2D A;  5LMU L;  2QDB A;  1AP0 A;  4BY1 B;  3P20 A;  4QY7 A;  5C6A A;  2A19 A;  3R93 A;  2IPK D;  2B2T A;  4ZQ3 A;  2BCO A;  4M8A A;  2NVY H;  1J9O A;  4U67 3;  1E2V A;  3ER0 A;  2PYK A;  4FO2 A;  3PIO 3;  5GAG C;  5I6Y A;  3BG3 A;  5FO7 B;  1I6H B;  2HT1 A;  5T1G A;  2L15 A;  5EPJ A;  4YWK A;  2NVQ H;  3MXN B;  1EQT A;  1B3Q A;  1VQ7 A;  1EY7 A;  3U9O A;  1SE3 A;  4OL7 A;  3TRZ A;  1NCV A;  1G29 1;  2YU9 B;  1KL9 A;  5M3M H;  1JC7 A;  1AE2 A;  1TWF H;  5IGG A;  3PUV A;  1G2T A;  5IGC A;  2N8N A;  4L5Q A;  4DAM A;  1R9T B;  4ZCK A;  3PQI A;  4LNQ A;  2QW7 A;  3T1H Q;  3TP6 A;  1L1O B;  4HJ5 A;  3I4N G;  1IL8 A;  3A7A B;  3KLR A;  4E6I A;  1AZQ A;  3WWV A;  1OTC A;  4DV1 Q;  3T1H L;  1GKH A;  2E2H H;  2X6G A;  4RCN A;  4RWS C;  3M7G A;  4XQJ A;  2PNH A;  3NWT A;  5BN5 A;  1PFN A;  4LW1 A;  3CRL C;  4TKO B;  3L3O C;  2WAQ B;  4DV1 L;  3TZU A;  3U50 C;  1VQP A;  1PRT F;  2K5N A;  3CCQ A;  3DEP A;  1N8R C;  1Q81 C;  3KDF B;  3MXU A;  3I4N H;  1MIU A;  3J81 c;  1J5E Q;  1OB9 A;  4M1U B;  1HH1 A;  1F2Z A;  4A93 H;  1WFQ A;  3OOC A;  5I6W A;  4OX9 Q;  1TWG H;  4DXF A;  2WIZ A;  1K9M C;  1J5E L;  2P5Z X;  1VQL A;  2Y0S G;  4OX9 L;  2Z0R A;  2JE6 I;  3VA5 A;  4XYQ A;  4KMU C;  3HFZ B;  1PRT B;  5C4J B;  4F87 A;  1YNJ D;  3B6Y A;  3K0Y A;  2LKV A;  1LYL A;  4G7H C;  1RD9 D;  4N8F A;  1STB A;  1G6Z A;  4RA8 A;  2Q2U A;  2UXB Q;  1KRT A;  4OWW B;  1L1O C;  2WP8 J;  3BYT B;  3T16 A;  1I4X A;  1Q8K A;  2K03 A;  3V96 A;  3X3N A;  4NB3 A;  2UXB L;  5E4X A;  2IY5 B;  5KND A;  5C0X J;  2VUM G;  1EU3 A;  1M1K C;  2F0S A;  2E76 C;  4WOR A;  2D0O A;  1WCM G;  4B9W A;  2NTS A;  2A73 B;  1Y1V B;  1ENF A;  1E2W A;  5D3I B;  1I50 B;  3FKI H;  1S40 A;  3H09 A;  4A3G B;  1GOZ A;  3UI2 A;  3S2D B;  1S5F D;  1H9R A;  5HGQ A;  4HCE A;  3S1R B;  4XQN A;  3S17 H;  3QO2 A;  5M3F H;  5AJ3 Q;  2G5D A;  3L9A X;  3S15 H;  1ZYR C;  2DUD A;  3OIP A;  4OEL B;  4QF4 A;  1CTM A;  2E2H B;  1SMX A;  5M5X H;  4UHV A;  3ND8 A;  1T5E A;  4BBR G;  1TWH H;  3KDF A;  1YHQ A;  3ZJY C;  4DV0 Q;  3E6Z X;  2LXJ A;  5AJ3 L;  1WCM H;  1C7Y A;  4KTA A;  2K33 A;  3CW2 C;  4FXG C;  1PRT C;  4DV0 L;  5IYC H;  2XN9 C;  3S2H H;  3A74 A;  3A0J A;  1KDC A;  2JYO A;  2A5H A;  3AMU A;  3RLF A;  3HRZ C;  3I4N B;  3HOZ G;  4KY6 A;  4LF9 Q;  2ZYZ B;  2EY6 A;  5K5P A;  1PTO D;  3JAM E;  1WTQ A;  1PHJ A;  1EQQ A;  5CV8 A;  5C4X G;  2ES2 A;  2QF7 A;  1GEF A;  4LF9 L;  1EIY B;  2IW3 A;  5CGK A;  5IYD H;  3EA6 A;  2Q2I A;  4A3I H;  3O13 A;  2BA0 A;  3PO2 G;  1DZ1 A;  2M00 A;  4AYB G;  4BA2 I;  1EEI D;  1X3F A;  4A3E G;  3E0J A;  1A0I A;  2XNA C;  4GNX B;  3H3V I;  5JPN C;  1RF2 D;  1LLR D;  3ITP A;  1SN8 A;  3NP8 A;  3MFG A;  5M5Y B;  4OEM B;  3K6O A;  1OO9 B;  2L11 A;  1KDA A;  3HS0 C;  3FRP B;  1QUQ B;  4XT3 B;  3P1Z B;  2B39 A;  2A68 D;  2F0L A;  5DM7 3;  1NSN S;  1MSH A;  3CPW A;  4BXX G;  1GUN A;  3AU7 A;  4HJ9 A;  1E24 A;  5I2Y A;  3Q0A A;  2XWJ B;  2Y0S B;  2BH2 A;  4IUV A;  1F77 A;  5K36 G;  2GA4 B;  2R7Z G;  4A3K H;  2YV5 A;  1QVF A;  2PCF B;  2A6H D;  3MXG A;  3RR5 A;  4Y7N B;  1B8A A;  2D9U A;  1SYG A;  1UNS A;  4IFD J;  4B3S Q;  5IGF A;  1PYS B;  2NZO A;  5IP7 G;  2YTY A;  1DCZ A;  4KHV A;  3K58 A;  2I46 A;  4ALP A;  3J7Y W;  2A8V A;  1X3P A;  1XPU A;  3VYR A;  2K32 A;  2EY2 A;  3FHW A;  5JPM C;  1TVX A;  4IUN A;  3CXC A;  1NBW A;  2VNU D;  3D3R A;  4R1J A;  4DNT B;  1YHB A;  2BA1 A;  5C0X G;  2R92 G;  3KF6 B;  4K2K A;  3H15 A;  2VUM B;  1SR3 A;  5CMD A;  3HOW H;  1Q3L A;  3K57 A;  4HIM A;  4RCO A;  2ZYZ A;  5IE8 A;  4CHT B;  4DUY Q;  1SJE D;  1Q1B A;  1QNK A;  3ZYY X;  4DK0 A;  4GNX C;  4HJ7 A;  1V9P A;  5IP7 H;  1PH9 A;  1EYD A;  4DK3 C;  5LHY 1;  4DUY L;  2NVX B;  2EOT A;  1STY A;  1YZ6 A;  1JCK B;  1NR2 A;  1ASZ A;  4XYO A;  1V43 A;  2L9H A;  4A3C G;  3OMG A;  2F3I A;  4GNX A;  1LV9 A;  1SMY C;  2D5D A;  4LAA A;  4YY3 Q;  3G4S A;  4N8X 1;  4BBR B;  1D5M C;  3KLW A;  5IOC A;  1EY5 A;  2WCW A;  1A2T A;  2MNA A;  2Q8R E;  3PO3 G;  3OW7 A;  4JCV E;  3CRK C;  3RLN A;  1TU2 B;  4YY3 L;  4HMJ A;  3BZK A;  3KLS X;  2BE5 D;  3F2U A;  3I91 A;  4AH6 A;  4FF4 A;  3P1Z A;  4K6D A;  1PFB A;  4A3B H;  2LS0 1;  5BN3 A;  1CQV A;  2IX3 A;  3QJY A;  3HOZ B;  3CC7 A;  1WD1 A;  5FKA C;  4A3C H;  5C4X B;  3NTH A;  3BYY B;  1I4H A;  3I2Z A;  3ULL A;  4B3M Q;  1Y1O A;  2WJ0 A;  4BBS G;  1PH1 A;  3M4P A;  1F9S A;  1GUW A;  4J8Q A;  3KOJ A;  4ODG A;  5ISR A;  2B3G A;  2ZTE A;  3EQL C;  4DNR B;  3J80 i;  3BVM A;  1PLF A;  3G6E A;  4PNY A;  4EQP A;  1JQY D;  4B3M L;  3PO3 H;  3CKI B;  3CCV A;  5EBD A;  4A3F G;  3PO2 B;  2BDO A;  3P1Y A;  1S72 A;  4AYB B;  4QIW B;  4A3E B;  2D62 A;  2B63 H;  1KAB A;  1SJH D;  4R4Q A;  5DAU A;  1GUS A;  1C8C A;  4OO1 H;  1AEX A;  3R3O A;  3HOY H;  2JA8 H;  1BVS A;  3DWA A;  1PA6 A;  4DR1 Q;  1GM5 A;  1YVC A;  4R8N A;  1XPR A;  2JN4 A;  4ME5 A;  4K5V A;  1VF7 A;  3MA2 B;  1SFO H;  1I3Q H;  2E2I B;  4LFA Q;  2M9V A;  4BBS H;  1Y1W H;  3KF6 A;  1LTR D;  4IUU A;  4HIO A;  4DR1 L;  3TDQ A;  1CUK A;  1K8O A;  2ZM6 Q;  3QR8 A;  5IP9 H;  4RGO S;  4KKS A;  4RHS A;  2HD3 A;  3E9H A;  4DV3 Q;  4LFA L;  1C0A A;  1SNC A;  4ZYS A;  3I4O A;  1L0Y B;  2ZM6 L;  1ILQ A;  2R7Z B;  2XRS D;  5IGE A;  3MC0 B;  4IPD A;  1BR9 A;  4XXE A;  3SK5 A;  4DV3 L;  1EL0 A;  3MAQ A;  3CPF A;  1PZI D;  3GP7 A;  3KJO A;  1G6P A;  4IFD G;  4A3J H;  3I4M H;  2Q8T A;  3AEV A;  3I8Z A;  3PGZ A;  3PUZ A;  2QCP X;  3GTP H;  3ERO A;  2N3S A;  2NUC A;  1FJG Q;  2R3Z A;  4JI6 Q;  1O78 A;  1PDQ A;  4JI7 Q;  3J7A 5;  4NXN Q;  1UWV A;  1O80 A;  4DPG A;  1FJG L;  3T51 B;  3S16 H;  4JI6 L;  4HSP A;  2R92 B;  1LM0 A;  5CV6 A;  4R4T A;  4JI7 L;  4NXN L;  1X3Q A;  1GHK A;  2VXW A;  2DN8 A;  1Y8O B;  2HQL A;  1QWY A;  1T5X D;  1SND A;  3LX0 A;  1PTO F;  4A3L G;  4GLA C;  2B2V C;  2ICI A;  1A63 A;  4BY1 H; 
#chains in the Genus database with same CATH homology
 2CZR A;  5JEA J;  1C4Q A;  3GTM B;  4EV1 A;  4G7O C;  1U4M A;  2K5W A;  3U9S A;  3PMF A;  3AJV A;  5LL6 S;  3Q22 A;  4KK7 A;  4O1N A;  2PZW A;  2B2V A;  1IPI A;  3MVV A;  2OKF A;  1RCV D;  2Z4H A;  2GW6 A;  3C46 A;  1YNJ C;  3SEB A;  1IKL A;  1Q8I A;  3OIQ A;  1PXU A;  4K5W A;  3SK4 A;  4C3J G;  1PTO B;  4TRD A;  1V1P B;  1OB8 A;  2IX0 A;  1C48 A;  2PPB C;  2RQX A;  1VMP A;  3HG9 A;  3A55 A;  5I9P A;  1LTT D;  2A6E D;  2EO0 A;  1FGB D;  3HGB A;  3MTS A;  1I3Q B;  4IAL A;  5E3F A;  2VLD A;  2VB2 X;  1A3T A;  2NN6 H;  1JIC A;  2NWG A;  1B44 D;  4A3F B;  1CFM A;  3WDN A;  1D5X C;  2F0Q A;  2CQA A;  3EJI A;  4EQN A;  4H13 C;  1CZW A;  3BDC A;  3OPO A;  3MXP A;  4QUC A;  2D2C C;  2MHV A;  4IN3 A;  3ND9 A;  5C3W A;  3GTJ B;  4OHJ A;  1HCZ A;  1F2Y A;  2O5I C;  1GXD C;  4KN7 C;  1XWE A;  1LO5 D;  2FLC A;  1RZN A;  5DM6 3;  3M4O B;  4KY7 A;  3ERQ A;  4F7X A;  3S16 B;  2NB0 A;  3LNN A;  3S1Q B;  1DYQ A;  4QBN A;  5FK9 C;  1OXX K;  3OHX C;  5D3D A;  1PTO C;  2FFK B;  3C1E A;  1F2M A;  2IT1 A;  3TP8 A;  3NHH A;  3PUY A;  5KYL A;  3VR5 A;  1KLG D;  3DWP A;  2CHB D;  4S3S A;  2E74 C;  1A3V A;  1SE4 A;  3K7A B;  3DHQ A;  1EYC A;  1V1P A;  2E2J B;  2SNS A;  3J7A F;  1U4L A;  1SE2 A;  2XIW A;  5F2D A;  2NVT B;  1D1I A;  4DAP A;  4CKE A;  2F0P A;  4K8I A;  4UAI A;  4G4K A;  1EWC A;  3NUC A;  4BS9 A;  1F9Q A;  1TII D;  4KKU A;  3KK7 A;  1HA6 A;  1CA5 A;  2A68 C;  1W6K A;  3A54 A;  1LAC A;  5JEA G;  2K28 A;  1YNN D;  3VR4 A;  4IZ8 A;  1QIL A;  4QBO A;  4KD3 A;  1XX8 A;  1UEA B;  2FMC A;  5HUR A;  2A6H C;  3K5O A;  1TS2 A;  3SE0 A;  1WTX A;  3GTK B;  5COY A;  3OWE B;  1AZP A;  3H0G B;  4C3J B;  3J81 L;  5E1F A;  5C3E B;  3A8J E;  3HOV B;  2J4X A;  1ESF A;  4ULL A;  1RLV A;  1ZP7 A;  2KHS A;  1GUT A;  1MI2 A;  1EYA A;  1CZG A;  1WTP A;  3BS1 A;  4DN4 M;  4OIK A;  1TS3 A;  4QB4 A;  4QBL A;  1CK1 A;  3KBX A;  1LT6 D;  4X3T A;  2FCO A;  2ZXR A;  4G6V A;  1ET9 A;  3V05 A;  5EQ0 A;  3BDO A;  1G2S A;  3TP7 A;  1LAB A;  4DGZ A;  2DNC A;  3RZO B;  1SSO A;  1T0F A;  4RGT A;  1HPC A;  1DM0 B;  3DM1 A;  5IIF A;  1EY8 A;  5KEE A;  1PZJ D;  4N9T A;  1IYU A;  2IJ0 A;  1EOT A;  2BE5 C;  3TZD A;  2PW7 A;  5C4H A;  4FP5 D;  2F0D A;  1R4P B;  5KNB A;  1MSG A;  2K05 A;  2OST A;  4G7Z C;  2XVS A;  2KCC A;  5CBE E;  3K5L A;  2C5C A;  1GJX A;  2BDN A;  1ILP A;  3I3C A;  1EIG A;  4K5X A;  1IHZ A;  1SNO A;  3BZD B;  3SK6 A;  3J80 E;  1VF5 C;  5NUC A;  1SYD A;  3DXJ C;  3FOV A;  1EZ8 A;  1STN A;  4QMG A;  1FD7 D;  4KHZ A;  2YYZ A;  2C9O A;  1U9R A;  4IUR A;  3VA7 A;  2L4N A;  5BN4 A;  2ID0 A;  2ENB A;  1Q1E A;  4ZKB B;  1SYE A;  1WD0 A;  4J1M A;  1SAP A;  4NMZ A;  2K6A A;  4L8J A;  5CV5 A;  2B2W A;  1SEB D;  3NE5 B;  1E2Z A;  3I90 A;  4DAV A;  1DJR D;  1LTG D;  4FF2 A;  1LTA D;  2XWB B;  1FYC A;  4A3M B;  2EPB A;  1B4O A;  1SYB A;  2EY5 A;  4F8M A;  3FPP A;  4H0L C;  2VS1 A;  3D8G A;  1F2L A;  3NQI A;  2KEE A;  1WTW A;  1CI3 M;  3RUZ A;  1CT1 D;  3GTG B;  3FVQ A;  3M3Y B;  3I72 A;  2KOL A;  5C5L A;  4DK1 A;  3K5N A;  2E75 C;  1STG A;  1F9P A;  1AN8 A;  3R2I A;  3C2P A;  3FDT A;  3I73 A;  4KN4 C;  1H9J A;  2VB3 X;  4FXK C;  2KUM A;  5C44 B;  2JP1 A;  2LY7 A;  3HEJ A;  1STH A;  4CBV A;  3SHL A;  3VYU A;  5IT9 L;  1Y88 A;  1RKN A;  2KQ3 A;  3MZ5 A;  2PW5 A;  3M7N A;  2F0W A;  3IFT A;  5K36 H;  3Q23 A;  4KJO A;  4C2M B;  1GUG A;  1HHV A;  3GV3 A;  2A6E C;  2DY8 A;  4TKD A;  1EY4 A;  2Z4I A;  1SYC A;  3DUZ A;  4V19 0;  2INB A;  1TWA B;  5CV4 A;  4RAU C;  1Z47 A;  4PV1 C;  1RDP D;  4HCS A;  2F1M A;  1D1K A;  5EKK A;  2WAC A;  1STE A;  1Y8P B;  5C0X H;  2FMM A;  3URY A;  2F0N A;  5D14 A;  1XXG A;  3D4W A;  4X3U A;  1G8Z D;  5CC4 A;  3SR1 A;  5M5W B;  1BO0 A;  2SDF A;  4C3H G;  1LT3 D;  1B53 A;  3QOL A;  4ZUJ A;  2HQE A;  1QCB D;  2JA6 B;  2EYL A;  3MEH A;  1BOS A;  1ROD A;  4HN7 A;  1QOH A;  5ELB A;  2EYJ A;  1VDZ A;  3J81 E;  1PMR A;  4HED A;  3MWY W;  2NTT A;  4WJW A;  4RGM A;  5T1I A;  3AJV B;  1JOR A;  1IW7 C;  1PTO H;  3KUP A;  3QG1 A;  3D4D A;  4L6T B;  3C3L A;  3T56 B;  1R4Q B;  3KLS A;  2WKC A;  4KKT A;  3KBG A;  1XYI A;  1EU4 A;  2FJ2 A;  4C1N I;  4G57 A;  2MJ8 A;  2DY7 A;  3H3V C;  5J22 A;  3RZD B;  3V2T A;  2HDM A;  3SDZ A;  2EYF A;  2WIN B;  1X32 A;  2AQ3 B;  2B2Y C;  5JVG 3;  1YNN C;  2A69 D;  5EKL A;  3J7A V;  1B9N A;  2KED A;  3BVZ A;  4DF7 A;  1LTS D;  1U4R A;  3IAY A;  1RTN A;  3GTO B;  4OO1 I;  1EY9 A;  2LMC B;  4G6U A;  1Q12 A;  1OXU A;  2B2Y A;  2DBS A;  1SXT A;  5M9O A;  2F0T A;  1A15 A;  2WB1 B;  5ELE A;  1OXS C;  1LT5 D;  1W6J A;  4DA2 A;  1TY0 A;  4IUT A;  2J7Z A;  3LWE A;  3K5M A;  1EEF D;  1S5B D;  3OSO A;  4Z9C B;  1SBB B;  4CJ1 B;  3PUW A;  1TS4 A;  5IOD A;  3QIA A;  3IL8 A;  4EQO A;  2K01 A;  4ZQU A;  4FYD A;  3A8I E;  4IFD H;  1HTL D;  2QIL A;  5TSS A;  4H7B A;  4XQQ A;  4A3D B;  1KNE A;  2HCI A;  4ZRZ A;  3VR3 A;  3NQT A;  4Q0F A;  1V8Q A;  1M8A A;  5KRU A;  4NKL A;  5I4D A;  1IKM A;  2L5T A;  4PMB A;  3SXH A;  3S1M B;  4BY7 B;  1PZK D;  2IXS A;  2Z1C A;  1I6V C;  2N55 A;  4TKK A;  3S1N B;  3NTK A;  2X69 A;  2JSO A;  2AQ1 B;  5FOB B;  3DNX A;  4C3H B;  4KV6 A;  5CYU A;  5G3L D;  4J6H A;  2JA5 B;  1VCI A;  3H6M A;  1XMX A;  4V0B A;  3R8B A;  4KI0 A;  1LTB D;  2WII B;  3CQZ B;  4JK1 C;  4MIU A;  1K83 B;  3T53 B;  1DOK A;  1JOK A;  4LJZ C;  3JAM L;  3S14 B;  4CGY B;  3Q6S A;  3RMH A;  4FXD A;  3W3A A;  4WFN 3;  5FDK A;  4I7Z C;  1ET6 A;  2EYP A;  2F3V A;  2SNM A;  3P7J A;  1BUV T;  3E5S A;  5FO9 B;  2Z8L A;  2F0U A;  3TBI B;  3IFD A;  3MHB A;  4XT1 B;  3PIP 3;  4RH6 A;  1IYV A;  3S9W A;  1E0B A;  1H9K A;  3RD4 A;  3HP3 A;  5C3X A;  2XRQ D;  1O7Z A;  3BT7 A;  1STA A;  5A35 A;  1H9S B;  4X3S A;  1R11 A;  3CHB D;  2B2U C;  5KYI A;  2PZT A;  1XTC D;  2NN6 I;  5JOB A;  1F1Z A;  2NBF A;  1HQM C;  4PQX A;  2F4I A;  3HOX B;  5IT9 E;  3I4L A;  2PNR C;  1CM9 A;  4RHR A;  2B2U A;  1JE4 A;  1FR3 A;  1IW7 D;  4ABN A;  1CHP D;  3NBH A;  4KY5 A;  4MHE A;  1G91 A;  3W2D A;  1KDB A;  3HOU B;  3NPP A;  3OMC A;  1I4P A;  3NWS A;  3GTQ B;  1UAP A;  1RHP A;  5I9O A;  2E2D C;  3MFY A;  3A7L A;  3NBI A;  3T4A C;  1OXT A;  1OXV A;  2G9H D;  2QKI C;  1B1Z A;  2L0C A;  4R9W A;  1DXM A;  2WKD A;  3A8K E;  3TP5 A;  3BVG A;  1K8M A;  2O2L D;  4F88 A;  1A3U A;  2B8F A;  3M85 A;  1EFI D;  5I2X A;  1JOQ A;  4C3I G;  3HZX A;  4RFB A;  3EVQ A;  2B8G A;  2ZXO A;  1D6E C;  5AFW A;  1HQR D;  1L0X B;  2FIN B;  4FF1 A;  2ZT9 C;  1H9S A;  2NYZ D;  5JEA H;  4UDU C;  2LFN A;  1HRJ A;  1RJT A;  3A56 A;  5DEH A;  4X3K A;  1Q90 A;  1FNU A;  4TQU S;  1O7L A;  3N52 A;  2WIW A;  1S5E D;  2RDF A;  1SNP A;  3ONA B;  1LT4 D;  2RKS A;  2ICE C;  4DFA A;  2JA7 B;  1WTR A;  2R6G A;  1LTI D;  5J1Z A;  2F0J A;  4BWG B;  1QB5 D;  1EIH A;  4ZUI A;  2MP1 A;  3FPU B;  4P2C B;  3TN2 A;  2F0K A;  2R93 B;  3FEW X;  2L12 A;  1MBY A;  1A2U A;  1VMC A;  2AWO A;  2F0I A;  1J8I A;  1JWU D;  3M4Y A;  2I07 B;  2XSC A;  4HTH A;  4K14 A;  1PYW D;  1RTO A;  3AB9 A;  4K2L A;  1HA5 A;  1NAP A;  2R61 A;  2F03 A;  5KGU A;  2OXP A;  3MXN A;  2FKH B;  5EPL A;  2NVY B;  2JEA I;  4RKB A;  4O42 A;  1MGS A;  2AWN A;  4NDX A;  4B08 A;  1D2B A;  4C56 C;  2NVQ B;  3G6J B;  1AW7 A;  5G3L F;  1DOL A;  5M3M B;  3SVM A;  5JJZ A;  1EQV A;  1BCP D;  1TWF B;  4B9X A;  1Y8N B;  2B2W C;  1CQF A;  5ELC A;  2EZV A;  3DEO A;  2SEB D;  4OGQ C;  4ZKC B;  4ILW A;  3N6R A;  1Y69 U;  4K6L A;  2F0M A;  2IL8 A;  4LQE A;  4HAE A;  2N88 A;  2JXM B;  2PMZ B;  2W8M A;  2H1E A;  4C3I B;  2A69 C;  5ELD A;  4E6Z A;  2CW0 D;  2EE1 A;  2EY1 A;  2PZU A;  2F0V A;  3QB3 A;  4DAY A;  3NXW A;  4EVO A;  3X3M A;  2NZ1 D;  1HFG A;  2H4O A;  5EKI A;  4IUP A;  5J39 A;  1TWC B;  1UUP A;  3D6W A;  4XTC S;  5A2Q L;  5FLX L;  4A93 B;  1TWG B;  5HGT A;  2IWH A;  1ICW A;  1QJO A;  4ZAI A;  1I4R A;  2L1B A;  2CV8 A;  4H44 C;  3GV6 A;  4JBW A;  2IX1 A;  1WVL A;  3GD7 A;  1S5C D;  1MD2 D;  1JWM D;  2EYO A;  2PO4 A;  2RA4 A;  2F0G A;  1BBX C;  4OIJ A;  4CJ2 C;  1S5D D;  2ZXP A;  2KVM A;  3QWN A;  3IF0 X;  4R8I A;  4N9P A;  1JB3 A;  4MN3 A;  2EYM A;  2Q8I B;  3SK8 A;  3L7Z C;  1SDF A;  1DD2 A;  3NSW A;  4U68 A;  1ZKO A;  1F9R A;  3FKI B;  4KD4 A;  2TSS A;  1SNQ A;  1ZXT A;  1PFM A;  1O7Y A;  3GO5 A;  3S17 B;  1EY0 A;  5M3F B;  1EY6 A;  4FVM A;  3S15 B;  2FL3 A;  1B3A A;  5M5X B;  5C4Z A;  1TWH B;  4I65 A;  3EFX D;  3NK9 A;  5DNF A;  3T13 A;  1JWS D;  1WCM B;  5COR A;  4ZLT F;  1HXY D;  1R0V A;  4RKL A;  3C1F A;  3OWF A;  3S2H B;  5CV7 A;  4KJN A;  1FNW A;  3TME A;  4HMI A;  2L55 A;  2RVL A;  5IGB A;  1ML0 D;  2HUG A;  3VR2 A;  5JVH 3;  2DNE A;  2RSO A;  3WOE A;  1D5Z C;  4LMQ D;  1S4Z A;  1ONL A;  3H94 A;  3Q24 A;  2OEO A;  4PMC A;  1Z6H A;  2EDG A;  2SOB A;  2QEJ C;  2K04 A;  4A3I B;  1ESR A;  2KEC A;  2PQE A;  3NTI A;  2F0F A;  4YIJ A;  1ENC A;  5C5M A;  2K5D A;  4OO1 G;  5KIX A;  1U4P A;  2EJF C;  3LWU A;  1M4V A;  1II3 A;  5C0X I;  5CV9 A;  5EJW A;  3D6C A;  1B9M A;  2EYH A;  3IKJ A;  2F3W A;  5LL6 X;  5ELF A;  1WTO A;  3PV0 A;  1QE6 A;  5JAV A;  2EJM A;  1NR4 A;  5D65 A;  2A74 C;  4NP5 A;  5KNC A;  4QCL A;  3P75 A;  5E4W C;  4A3K B;  4XIG S;  3D31 A;  1HTP A;  3BDL A;  1BXT A;  1ZYR D;  2F0O A;  1TQO A;  2K7V A;  4DU9 A;  1Z7T A;  3HKZ B;  2MGS A;  2EVB A;  4L63 B;  1ZEQ X;  2EXZ A;  5CBA E;  1PRT D;  1DOM A;  1TY2 A;  2HCC A;  3G7L A;  2O4X A;  5FO8 B;  2F0E A;  2CVR A;  2RDH A;  3H91 A;  1BCP F;  2WCZ A;  2AQ2 B;  1FNV A;  5EGT A;  5EBC A;  1AFP A;  1B2T A;  2X6L A;  3HOW B;  2FKC A;  2AUJ D;  2MPM A;  4NW2 A;  4LK1 C;  3VYS A;  1GHJ A;  5IGD A;  1HFN A;  2V4D A;  2RBM A;  2OF1 A;  4WRD A;  1HUN A;  1GUO A;  5EPK A;  1KTK A;  1BDO A;  3I70 A;  2J0T D;  2FHT A;  1BCP B;  2JJQ A;  3KF8 A;  2KCN A;  2TMP A;  1QG7 A;  4CKC A;  4HSV A;  5CR3 A;  3GTL B;  3J80 L;  1QNU A;  2MUY A;  3QOJ A;  1TR5 A;  3VYT A;  4C1N K;  4K8J A;  4A3B B;  2RSN A;  4FF3 A;  3FMC A;  1YNM A;  1KLU D;  3IEY B;  2JEB I;  2G9D A;  3K59 A;  4IFD I;  1DON A;  2NN6 G;  3PO3 B;  3TSS A;  1EZ6 A;  4CKB A;  4XDX A;  1SYF A;  4Q5V A;  2B63 B;  1H9M A;  3HOY B;  1A79 A;  2BOS A;  2JA8 B;  5A2Q E;  5FLX E;  3DWQ A;  1TKW B;  2OT2 A;  1BNZ A;  3VR6 A;  4QUF A;  4CJ0 B;  1SFO B;  4ID6 A;  4BBS B;  1Y1W B;  2K5Q A;  1CA6 A;  3R2T A;  1I4G A;  3PUX A;  2O5J C;  1JOO A;  2GJW A;  3DMU A;  4IUQ A;  1JR0 D;  1KNA A;  4PMW A;  1WTV A;  1NUC A;  1BCP C;  3GQB A;  4HR7 B;  2K1B A;  1CHQ D;  2EJG C;  4FNF A;  1BF4 A;  1BQQ T;  2HDL A;  1B50 A;  3D4R A;  2KA7 A;  1SMY D;  2AUK A;  1V1O A;  4A3J B;  4EGV A;  3I4M B;  4IQZ A;  4TSS A;  3GTP B;  4DXG A;  2WV6 D;  1ENA A;  1HUM A;  1TT2 A;  2F0H A;  3P1H A;  3WOF A;  2M2L A;  2CW0 C;  3CU7 A;  1A6X A;  4GZY C;  4BA1 I;  4ZK9 B;  2B2T C;  1TS5 A;  1KAA A;  1SNM A;  4RGN A;  2KJX A;  2RDG A;  1EWH A;  1I4Q A;  3IEY A;  2QDB A;  1AP0 A;  4BY1 B;  3P20 A;  5C6A A;  3R93 A;  2IPK D;  2B2T A;  4ZQ3 A;  2BCO A;  4M8A A;  1J9O A;  4U67 3;  1E2V A;  2PYK A;  4FO2 A;  3PIO 3;  5I6Y A;  3BG3 A;  5FO7 B;  1I6H B;  5T1G A;  5EPJ A;  1EQT A;  1EY7 A;  3U9O A;  1SE3 A;  4OL7 A;  1NCV A;  1G29 1;  2YU9 B;  1JC7 A;  5IGG A;  3PUV A;  1G2T A;  5IGC A;  1R9T B;  3TP6 A;  1IL8 A;  3A7A B;  3KLR A;  4E6I A;  1AZQ A;  2X6G A;  4RCN A;  4RWS C;  3M7G A;  4XQJ A;  3NWT A;  5BN5 A;  1PFN A;  3CRL C;  4TKO B;  3L3O C;  2WAQ B;  3TZU A;  1PRT F;  3DEP A;  3MXU A;  1OB9 A;  4M1U B;  1HH1 A;  1F2Z A;  5I6W A;  3OOC A;  4DXF A;  2WIZ A;  2Z0R A;  2JE6 I;  3VA5 A;  4XYQ A;  4KMU C;  1PRT B;  5C4J B;  4F87 A;  1YNJ D;  3K0Y A;  2LKV A;  4G7H C;  1RD9 D;  1STB A;  1G6Z A;  4RA8 A;  2WP8 J;  3BYT B;  3T16 A;  1I4X A;  2K03 A;  3V96 A;  3X3N A;  5E4X A;  5KND A;  5C0X J;  1EU3 A;  2F0S A;  2E76 C;  4WOR A;  4B9W A;  2NTS A;  2A73 B;  1Y1V B;  1ENF A;  1E2W A;  5D3I B;  1I50 B;  3H09 A;  4A3G B;  1GOZ A;  3UI2 A;  3S2D B;  1S5F D;  1H9R A;  4HCE A;  3S1R B;  4XQN A;  3QO2 A;  3L9A X;  1ZYR C;  3OIP A;  4QF4 A;  1CTM A;  2E2H B;  1T5E A;  3ND8 A;  3E6Z X;  4KTA A;  2K33 A;  4FXG C;  1PRT C;  2XN9 C;  1KDC A;  2JYO A;  2A5H A;  3AMU A;  3RLF A;  3HRZ C;  3I4N B;  4KY6 A;  2ZYZ B;  2EY6 A;  5K5P A;  1PTO D;  3JAM E;  1WTQ A;  5CV8 A;  2QF7 A;  1GEF A;  2IW3 A;  5CGK A;  3EA6 A;  3O13 A;  2BA0 A;  1DZ1 A;  2M00 A;  4BA2 I;  1EEI D;  3E0J A;  2XNA C;  5JPN C;  1RF2 D;  1LLR D;  3ITP A;  3NP8 A;  3MFG A;  5M5Y B;  3K6O A;  1OO9 B;  2L11 A;  1KDA A;  3HS0 C;  3FRP B;  3P1Z B;  4XT3 B;  2B39 A;  2A68 D;  2F0L A;  5DM7 3;  1NSN S;  1MSH A;  1GUN A;  3AU7 A;  5I2Y A;  3Q0A A;  2XWJ B;  2Y0S B;  2BH2 A;  4IUV A;  1F77 A;  5K36 G;  2GA4 B;  2PCF B;  2A6H D;  3MXG A;  4Y7N B;  2D9U A;  1SYG A;  1UNS A;  4IFD J;  5IGF A;  1DCZ A;  4KHV A;  3K58 A;  2I46 A;  3J7Y W;  1X3P A;  3VYR A;  2K32 A;  2EY2 A;  5JPM C;  1TVX A;  4IUN A;  2VNU D;  3D3R A;  4DNT B;  2BA1 A;  5C0X G;  4K2K A;  2VUM B;  5CMD A;  1Q3L A;  3K57 A;  4RCO A;  2ZYZ A;  4CHT B;  1SJE D;  1Q1B A;  1QNK A;  3ZYY X;  4DK0 A;  1EYD A;  5LHY 1;  2NVX B;  2EOT A;  1STY A;  1JCK B;  1NR2 A;  4XYO A;  1V43 A;  2L9H A;  3OMG A;  1LV9 A;  1SMY C;  2D5D A;  4LAA A;  4BBR B;  1D5M C;  5IOC A;  1EY5 A;  2WCW A;  1A2T A;  2Q8R E;  3OW7 A;  3CRK C;  1TU2 B;  4HMJ A;  3KLS X;  2BE5 D;  3F2U A;  3I91 A;  4FF4 A;  3P1Z A;  4K6D A;  1PFB A;  2LS0 1;  5BN3 A;  1CQV A;  2IX3 A;  3QJY A;  3HOZ B;  1WD1 A;  5FKA C;  5C4X B;  3NTH A;  3BYY B;  1I4H A;  2WJ0 A;  1Y1O A;  1F9S A;  1GUW A;  4J8Q A;  4ODG A;  5ISR A;  3EQL C;  4DNR B;  3BVM A;  1PLF A;  4PNY A;  4EQP A;  1JQY D;  3CKI B;  5EBD A;  3PO2 B;  2BDO A;  3P1Y A;  4AYB B;  4QIW B;  4A3E B;  2D62 A;  1KAB A;  1SJH D;  5DAU A;  1GUS A;  1C8C A;  4OO1 H;  1AEX A;  3R3O A;  3DWA A;  4R8N A;  4ME5 A;  4K5V A;  1VF7 A;  3MA2 B;  2E2I B;  2M9V A;  1LTR D;  4IUU A;  3TDQ A;  1K8O A;  4RGO S;  4KKS A;  4RHS A;  1SNC A;  4ZYS A;  1L0Y B;  1ILQ A;  2R7Z B;  2XRS D;  5IGE A;  3MC0 B;  1BR9 A;  4XXE A;  3SK5 A;  1EL0 A;  3MAQ A;  1PZI D;  3GP7 A;  4IFD G;  2Q8T A;  3I8Z A;  3PUZ A;  2QCP X;  3ERO A;  2NUC A;  2R3Z A;  1O78 A;  1PDQ A;  1UWV A;  1O80 A;  3T51 B;  4HSP A;  2R92 B;  5CV6 A;  1GHK A;  1X3Q A;  2VXW A;  2DN8 A;  1Y8O B;  1T5X D;  1QWY A;  1SND A;  3LX0 A;  1PTO F;  2B2V C;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...