4DA6A

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with ganciclovir
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
231
structure length
231
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 87
structure length 231
sequence length 231
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4da6A00
1RYZA 2HWUA 1ZL2A 4WKBA 3K8QA 4NY1A 2I4TA 4L0MA 5F77A 2OECA 3BGSA 4OY3A 2B94A 4DANA 2QPLA 3FWPA 2GUWA 1T8RA 5F73A 4I2VA 4KN5A 1Y1RA 1SD1A 3FUCA 1A69A 1ECPA 3IOMA 4DA0A 1PW7A 4OGLA 3OOEA 5B7GA 1LV8A 4M7WA 3EMVA 1NW4A 5EPUA 1LX7A 3UAVA 5B7QA 3DF9A 3KHSA 4R2WA 4DABA 1Y1SA 4DA8A 3FOWA 4M1EA 1RFGE 3F8WA 3KVRA 5C80A 2AI3A 1PR2A 5CYFA 1Z36A 4EB8A 4YNBA 1VMKA 1JE1A 4TTJA 1PWYE 1V41E 4LDNA 1Z37A 1RXSA 3ONVA 1WTAA 1XE3A 2QTTA 4BMYA 4EARA 1YQUA 4WKPA 1U1CA 1Z34A 1ODKA 1PR5A 4MARA 4TS9A 2PGAA 5JPCA 1U1EA 4DA6A 1RR6A 1SD2A 5EFOA 4IP0A 3P0FA 4F3KA 4LNHA 4GMHA 3MB8A 1NC1A 3LBAA 3KUKA 4P54A 4WKNA 1YR3A 5CCEA 5F7ZA 3IEXA 2I8AA 1RXCA 2BSXA 5DK6A 1K3FA 3C74A 1I80A 1CG6A 1YQQA 3FAZA 4QATA 5ETJA 1CB0A 4D98A 4MCHA 5B7NA 1A9QA 4H1TA 2RJ3A 1B8OA 4K6OA 1OV6A 1VHWA 4D9HA 1B8NA 3K8OE 4L5CA 3NM5A 4GKAA 3EUFA 3BJEA 1N3IA 4X24A 1C3XA 1Y6QA 2QTGA 2ISCA 1JDVA 4OEHA 5F78A 4BMXA 4YMLA 1FXUA 5EUBA 3E0QA 1U1DA 1V3QE 1G2OA 1U1GA 4LKRA 2IQ5A 4ECEA 4QAQA 2QDKA 3UAWA 1ODIA 2A8YA 3U40A 1RSZA 1PR6A 4QEZA 3OCCA 4OGKA 4F3CA 4TTIA 3GGSA 1YRYE 4L5YA 1ODLA 4L5AA 2OC9A 1T0UA 4R31A 3DJFA 1SJ9A 1PR4A 1JDTA 3FNQA 1VFNA 1ULAA 4TXNA 1LVUA 3E9RA 1T8YA 1OTYA 3KVYA 1SQ6A 2HRDA 3NM6B 4TXJA 3SCZA 2H8GA 1JYSA 4TTAA 2AI2A 4YJKA 5B7PA 3TL6A 2ON6A 4D8VA 3KU4A 1PR0A 1ODJA 1V45E 3OZCA 1Z35A 1JDSA 1T8SA 2P4SA 4TXHA 3DP9A 3OOHA 4BN0A 1Z5OA 3OZDA 3ENZA 3NBQA 3PNPA 3D1VA 4RJ2A 4G89A 1Y6RA 1Z38A 1A9OA 1RXYA 4G8JA 3P0EA 5F76A 4F1WA 3T94A 2OC4A 5F7JA 1RT9A 1TGVA 3EEIA 5K1ZA 3OF3A 5I3CA 3GB9A 3PNSA 1TGYA 5CXSA 3UAXA 2XRFA 1V48A 5F7OA 1QE5A 3QPBA 4TXLA 4L6IA 1A9SA 1OVGA 1K27A 3OZEA 4NSNA 1T8WA 4BMZA 4M3NA 3E9ZA 4JOSA 3UT6A 1Z39A 4TXMA 5IU6A 2HSWA 3BSFA 1A9PA 4E1VA 1Q1GA 1OTXA 1PR1A 3DDOA 1YBFA 3O4VA 4LZWA 2QSUA 1Y1QA 3EUEA 2OXFA 1A9RA 4YO8A 5FAKA 4R2XA 1RXUA 4OJTA 4OF4A 1TCUA 1Z33A 4TS3A 3PHBE 4TYMA 1JE0A 1PKEA 2AC7A 4DAEA 5CYGA 2A0YA 3KVVA 3OZBA 3MMSA 1V4NA 1TCVA 2A0XA 4NS1A 1Y1TA 4D8XA 4G41A 1OU4A 4MCIA 3UAZA 3LGSA 1V2HE 1M73E 4U2KA 3INYA 1PK9A 1JDZA 5IFKA 4DAOA 4QASA 1JP7A 4F2WA 2AI1A 4LNAA 1Z5PA 4WKCA 3LA8A 4JP5A 1ULBA 4JWTA 2Q7OE 1JPVA 1A9TA 3FB1A 4QFBA 3OPVA 5CXQA 4DARA 1Z5NA 4D8YA 4GLFA 1PK7A 3NM4A 4GLJA 4PR3A 1NC3A 4FFSA 1ZOSA 3DPSA 5CCDA 1TD1A 5KB3A 4UC0A 1PF7E 1U1FA 1JDUA 1OUMA 4WKOA 1K9SA 3O6VA 3ODGA 4PNPA 4F2PA 1RCTE 3PHCA 1PBNA 3UAYA 4QARA 1VHJA 2HN9A 4DA7A 5F7XA 2A0WA 3BL6A
chains in the Genus database with same CATH superfamily
3VH4A 3KSZO 2FDCA 3HB4X 1U8XX 4IEFB 4O2AA 3S7TA 3ZJ4A 1YQDA 3N0TA 1M8FA 1P1KA 1UP7A 2XQGA 2IV3A 2INGX 5LQMA 4ITVA 1USUA 4QPNA 2BTEA 3WL7A 1A72A 4I1SA 2O2IA 3ZV6A 2B34A 2EKPA 3B60A 3QHQA 4EI9A 3DMTA 3N0VA 1UC8A 1QMGA 3FWYA 4HFNA 1VA5A 1W0KD 4JZYA 4N3CA 3TW6A 4B3MB 4M6WA 1EHCA 2Y9MB 5ELMA 1FMFA 3I05A 1EGVB 4F06A 4IDNA 2EFDB 2R8BA 3BXZA 4OA5A 3B1KA 5L95A 2NUAA 1FP7A 1PZNA 3S2ZA 3M9LA 5FBZA 3ND9A 4BBPA 3V1NA 4CG0A 1S89A 1P8JA 1UPBA 2OM2A 5BWOA 2V7UA 5C8XA 4X0EA 3RVSA 1WETA 2HC9A 2ZR8A 4HUQB 3H2GA 4KG7A 4FYYA 4L02A 1CRZA 4LAFA 4WESB 2DWPA 3QWAA 3B6KA 2RH5A 5F1OA 3SQLA 3VR1A 4F6CA 5FWNA 3OD1A 1EH5A 5AJXA 5DIZA 3HSKA 2PO7A 2PH1A 2EZ4A 5LQJA 1D8AA 2VCYA 4BZQA 1OXUA 1OX5A 4RACA 4B2IA 5DHQA 2B2NA 3PWTA 4E3ZA 2RKBA 1NXQA 2PT5A 4JBHA 1UCFA 2HLDA 3KQTA 4U9UA 3VM6A 1NBOA 4EG5A 1NIPA 1SOMA 4FFPA 2XRZA 1QVRA 4WA8A 1E63A 4R68A 4RNCA 2D2EA 3TOVA 4R1MA 3ZCVA 2OHOA 3DFFA 1Y89A 4U9IS 3R5XA 1XDUA 1YXMA 2ZEJA 1OSNA 3A4VA 4ER7A 2PBLA 1SC3A 3LFHA 2W2NA 2VJMA 3QE4A 3DXZA 1XR3A 3CEJA 4YQFA 2JCBA 3PFHA 3GXOA 2QQ5A 4KK4A 4Y1EA 2J9ZB 1X3LA 3IA2A 4OVKA 1NPYA 3CONA 2C5AA 4PCUA 1S7GA 3R76A 1AKUA 1GAXA 2X77A 5BSMA 3P9KA 1YFJA 3DDCA 4OFXA 2XT6A 1NMEA 2HK7A 2Q07A 4URFA 3K9LA 4WRRA 3DQPA 4FMBB 3DUWA 1OGJA 2R2GA 3OJ0A 4I55A 3KBBA 4C1NA 4L28A 4D43A 4Y9DA 1MVNA 1Z0UA 5ECGC 2GBLA 4G85A 3I4LA 3N8IA 3WLNA 2WWXA 1CR4A 1A71A 1EIZA 4GL4A 4LSGA 5FCDA 5C8YF 3QE2A 4DWJA 5B53A 2OQVA 4FNGA 3HLYA 3A1WA 2J59A 2Z8XA 2GPAA 3F5FA 3VPDA 1N2CA 2PXAA 1M6VB 2PANA 2CFTA 1B1AA 1GGJA 2VH5R 2WM9B 2Z1MA 3CHYA 3DMPA 3FFWA 1NSTA 3U4HA 2H18A 4M0KA 3ITNA 3HO6A 1G41A 1KR5A 1Z37A 3EW7A 2L18A 1OKKD 1YA8A 2X2PA 3G9QA 2H54A 1WTAA 4LF9B 4Q3OA 3IMKA 2P68A 3HMKA 1VDMA 1E60A 3DA8A 4R40A 2C2BA 4YJ2A 3SIRA 3M1LA 2A9JA 2LW7A 3M2PA 3U62A 4I19A 1KKUA 4UPDA 2HZBA 1DBRA 1JEYB 3A31A 5EAIA 3RSLA 1Z2CA 1Z34A 1ODKA 1M7BA 2XUZA 5H59A 4YDRA 2JPDA 2E5FA 13PKA 1RC0A 2A1TR 1DVRA 4E3WA 2WC1A 3DEYX 5ALWA 4F45A 4E0BA 2BFNA 2YJZA 4BEBA 2RHCA 4F60A 3B6ZA 1J25A 4H3SA 3CNOA 1U1EA 3EMDA 4KXMA 3OLWA 4RVGA 3PC2A 4MR9B 4Q6BA 4YRFA 3THRA 4V3BA 3TX2A 1SD2A 1GAJA 4OGGA 2BMFA 5GV8A 4AZSA 3DVAA 1T9CA 1G5PA 4IFEA 1V16A 1IZ8A 1RI3A 1W2WB 2VHJA 3DWIA 3GJ5A 1GVNB 2VBGA 2P2DA 2P79A 4LF7B 4KUHA 5ER6A 1OD6A 4CMGA 1W4RA 3KUKA 5B36A 1IB0A 4L51A 1EU1A 4UM8B 5THXA 3GLIA 3RHZA 2ILTA 3BMOA 1PTKA 3D4BA 2FJ0A 3BWYA 1E7QA 3ESQA 4TKVB 3RTDA 2PX0A 1DX6A 2ZB7A 1EYZA 4PAQA 5EE9A 3A6DA 4BBAA 2PAAA 4M1WA 1XQ1A 2DPGA 1RRKA 1WUHS 4WDRA 3ZI7A 1LV7A 2NT4A 5JH7A 4YRMA 3I4CA 4QT0A 1RXCA 3HZRA 4KXXA 4A6DA 1G6HA 1KETA 2JAOA 2UZ1A 3NHLA 3QYJA 4FFNA 4Q1CA 4JUCA 5AVJA 3VO2A 4RTNA 4GEGA 4FMDB 4E6PA 2JFXA 1EFAA 2VNAA 4JYAB 1TI7A 2NQ8A 1I32A 3B51X 1RJGA 3VO9A 3L7MA 1XN4A 2AV6A 3AUSA 5B7NA 1DUIA 2OZKA 3IQEA 1VCNA 3ZGXA 3PGKA 2PD4A 2RGGA 2IIBA 4G37A 4Y6LA 1KO5A 1DEKA 3ESYA 1VHWA 2LR0A 3A26A 4N39A 1L4UA 1QVZA 3ZY2A 1LSUA 5JWOA 3H5LA 4A2WA 3M34A 1NFQA 1K8XB 1Z56C 1GLVA 3G2IA 3NOQA 3N8GA 3UT5A 1FDWA 4DRXB 2SNIE 4QRIA 3DLHA 4HWKA 3ZDBA 4CQLB 1JEQB 2QIOA 3IH5A 1M6WA 2PZKA 1P4RA 2GCNA 4ZYTA 3INGA 1DIOB 3EVAA 4B5LA 5AW6A 4GXTA 3IP6A 4B4VA 4DSUA 1M8PA 3IDAA 5EWLB 1EX7A 1RPTA 2WAYA 2HI0A 4GNKA 1S2IA 5HGXA 1Z4MA 2IE0A 2O07A 3HA3A 3OQIA 4GOMD 4U6QA 4WX2B 3SIXA 5BWCA 1LPNA 1PBTA 3PJEA 4F5EA 1NP3A 2OLJA 4ZCSA 3ZU2A 4YIHA 2JH8A 2Q0QA 3Q7QA 1IM2A 4MW1A 1U3FA 1XCGB 3DMYA 4X1IB 1YIOA 3MJSA 4ZRMA 1SVSA 3ZWYA 4YAOA 4GICA 2Y67A 4NBVA 1IRXA 5GPBA 2HPVA 2FMKA 4IIDA 3KK0A 2VDOB 3PPVA 1X1EA 3ZWOA 4DCOA 4U0JA 2B9VA 1PK8A 3HBNA 1LI5A 1SCUA 3PQ4A 4WXPA 3L41A 3EVDA 4BKMA 1NV9A 1PFKA 1ZD2P 1V5FA 3TRDA 3G02A 3IGFA 3TRIA 3WK7A 1YRYE 4L5YA 3N07A 1YMUA 4A6EA 4FT2A 4MLZA 3GMDA 2ZWPA 2J3KA 1AKYA 4TTRA 1DQZA 4OCZA 5FD8A 4OQ4A 4FB5A 1GPMA 1N4AA 1GFSA 2D7CA 2XUJA 4AB1A 2JKZA 3IAHA 2G72A 1IEVA 2FOXA 2VHTA 2ZYSA 4P3YA 5IJXA 2PSHA 4BQNA 1RZRA 1D4AA 3TLKA 2IKQA 1E1RD 1OOEA 1NA5A 4FOPA 3I09A 1LX6A 2NU8B 1CULC 4PXSA 3BORA 1E7WA 3F9RA 3L0OA 1KQFA 2D1TA 5DHPA 3VA7A 4KDEA 4Q9AA 4MQBA 2H7XA 2HGZA 3E9RA 3VSDA 1CV2A 1L5QA 3CV3A 5C1OA 1MZVA 1MUUA 3GEDA 3L4BA 1TJYA 2XNKA 1V3VA 3VTKA 3EZ2A 4ENVA 5KSZA 2VP3A 4BUZA 1VJ0A 3OX3A 3TL3A 5ULLA 1BXGA 1E5VA 1MTZA 3LQFA 1T3LA 2RJNA 1E8NA 2WHXA 4LXTA 1V8ZA 4BFSA 3MC1A 3AHIA 2I2AA 1JG7A 1G4UR 4X6XA 2YYAA 1XD2A 2QRNA 2YWEA 2D5BA 3FNFA 3OP1A 1QVVA 3DL4A 3TNLA 2UYHA 1CS0B 4UATA 1Z16A 1REQB 1W1WA 4ER0A 1R16A 3BFXA 2W6IA 3AR3A 3IDSA 3RASA 4CKWA 5L3SA 3PXBA 3NBXX 1FZTA 4MKFA 1GTJ1 1EUCA 2ZSIA 3HRHA 3ZTWA 5FUVA 2P3QA 4UBMA 1A7KA 4IMJB 4L0DA 2HHLA 2V0CA 3ELUA 4Y1FA 5CGQB 1L5HA 3SKVA 3DO6A 1UL1X 4MRMB 2Q7DA 1WVIA 3U4MA 5CNJA 1SHJA 2FWIA 2D2XA 4FWBA 1W76A 2GLXA 5K99A 3CCFA 4UMVA 2QB5A 3G49A 3U60B 1BMDA 1M2VA 2XNDD 2OZPA 1KI9A 1J2YA 1SQ0A 3A4YA 3K0FB 1H2HA 4J3NA 5JW6A 4CFZA 3G2NA 3TNJA 4DMCA 2QL9A 1A2BA 2IOHA 1NP7A 4GYJA 2CL5A 4S1OA 4ZC1A 2OSBA 2YMPA 3LVBA 1Y8AA 4CLHA 3DMHA 3RE1A 3DE4X 2DEUA 4F91B 1J56A 2WWGA 2EWWA 3OEHD 4DUZB 2G70A 5DE3A 2C2KA 5DF1A 2D62A 1DEOA 1GU1A 1NV8A 1L4BA 3DTNA 5DHRA 3MQ2A 1NSFA 3JYLA 2YJ4A 3EGOA 1EVIA 1ORHA 2AS0A 3RO7A 1D9ZA 4AO8A 2QP9X 2Y0CA 5ALJA 3ZJ5A 5AVUA 2CXXA 3GO4A 2C2YA 3LGXA 1GPDG 2I67A 2JI4A 3QVWA 1JAZA 2V7GA 4INPA 1G16A 3HKEA 3M6UA 2BHSA 2EW8A 3E8XA 4LUCA 4U6NA 3I45A 1YFZA 2QX9A 3F5SA 4HPWA 1KFCB 4N9QA 4MHSA 1E7RA 2RH8A 3QYPA 4RFVA 1V48A 1ISRA 5FPYA 2HSEA 4RJLA 4EABA 5C2JB 2QLNA 4Z5XA 3U7QB 3QPBA 4D57A 2F1IA 3ICOA 4QVGA 3EIWA 4AY3A 1QIJA 2ANCA 5FHQA 4DNFA 2F48A 3OMXA 3VTFA 4NSNA 5CFNA 1NYTA 1POXA 4BO2A 4QA9A 4I4CA 1Q7EA 4DR4B 3RVKA 1ZYUA 1U2DA 4FWIB 2WWTA 4BQIA 5F1YA 1UBHS 1H8HA 5FTMA 4GSLA 3V4SA 1KTVA 1FOEB 2OLKA 3BHNA 5BY2A 2IPNA 2PKEA 1Z13A 3ABQB 3DMTC 4AF8A 1ORWA 3JWHA 2ZS9A 1L7BA 3A9TA 5I5GA 5FNVA 1P0IA 4LZPA 1DINA 4NHOA 2ZYWX 2B20A 3JW8A 2IPXA 4RZUA 3UF0A 1P62B 4QGAA 1ESMA 4O4JF 4Z9AA 3WLOA 5HKKA 1YS6A 1QPGA 1XHFA 2J09A 2UDPA 3BXXA 1VBNA 3E6AA 2D13A 1MB4A 2G06A 2O9JA 2YNMC 4BRUA 5YASA 1FMLA 2NNWB 3PQCA 3ZE7A 3DR3A 1GNTA 1PL6A 1SQ5A 2YZ2A 3PSAA 1V7PC 1DDOA 2V3WA 5H7XA 4L95C 4ERNA 1KC1A 5LL6P 4NDNE 2IBTA 3HP4A 2EDAA 2WJWA 1XFAA 2XR1A 4MPTA 1Q3KA 3H87A 3LWNA 4E14A 5SYMA 4OO3A 3TKLA 1IJFA 3VR2A 1U0JA 2HGSA 4KIUA 4XDYA 3H8VA 4OREX 1VSQA 1II8B 1R74A 2HEIA 4IJWA 1KZYC 2YY7A 4P3KA 4G1MB 2XUIA 1HDCA 4OBWA 2JGDB 4N7BA 1X70A 1PYGA 1UK9A 1P9NA 1FXWF 1K92A 4RMJA 2ZCUA 3RAPR 1ZR2A 5DW3A 2WTBA 3LZCA 5E38A 5IASA 3AEUA 1YRHA 2JFWA 4RSHA 3VHRA 1LPMA 3C45A 3JZIA 4FYPA 4PO9A 3HDGA 1U3UA 5K0JA 3NDBB 3CLRD 5GWXA 4OSOA 1DBIA 3EAGA 3FPGA 3KHKA 2VQFB 1RVV1 2PX8A 3KT3A 3LV8A 3PHJA 4TMVA 4OUKX 4JD5A 4R8LA 3FTCA 1LPPA 3O3MB 1E6UA 3Q8MA 2HFKA 1KO4A 4XPZA 5BWMA 1ZLYA 1TKRA 2TMGA 1L1QA 1T4CB 3V00A 4GL2A 1RPNA 4Y8VA 5COBA 4BJHB 3UVEA 3D7RA 3THXA 4KJXA 5AKEA 2J7KA 5T5QA 4GVLA 3R9XA 4GBED 1JLMA 4H7FA 3LD9A 3G5UA 3JPYA 2CVHA 1IN5A 2AZTA 2P9GA 4LZNA 1ZHHA 1EVQA 4J6FA 1T2EA 5IXYA 1QRUA 4RQBA 3LHFA 3PXXA 3N76A 2RB4A 2Q6LA 3INRA 4GEKA 3RWBA 1YJAA 3RV4A 4I1OA 5DBIA 1C29B 1GQRA 4I1IA 1FNDA 3L4EA 3NFRA 3LDHA 2P9TA 2Z3ZA 3HVJA 3CZAA 2G5GX 2ONZA 3CXRA 1LK0A 1WCIA 4FD3A 1TLTA 1W88B 4XFKA 4XQ9A 4FZVA 3O8LA 2ZJ1A 1N34B 4JJGA 4ZOCA 3AJRA 3RQSA 1UM8A 3RC2A 3WLIA 3KPWA 1I8TA 4AYXA 1DX9A 2EKQA 3WNBA 4ZOQI 3JARA 5GJWC 4NBRA 2PRKA 3DMDA 3U0BA 4P4UA 4A6XA 1B3BA 1E79A 1X42A 3QJGA 3FIJA 3TW0A 3GDFA 1Y3DE 1ECGA 4QUHA 3IUYA 5DKFA 2HTFA 1RWVA 1J0XO 2JFZA 3UCFA 5ICMA 2C8LA 5TVKA 4KQEA 4H3KB 5BOSB 5DFAA 4BIIA 4FNOA 1NMSA 4J3FA 3VDQA 5LZ9A 4GLOA 4U7HA 3SEFA 4QU5A 4UPVA 4E5UA 5ALZA 1ZM9A 2BKVA 1N3LA 1R37A 4H6XA 1GPJA 3UC9A 4Z9BA 4WA7A 1R6XA 3E3OA 4HMOA 5CR9A 1ZH8A 5G1NA 3TK1A 5B2ZA 1KH3A 1IL0A 1JAYA 1ZO8A 2SICE 1S7CA 4LS3A 2B6NA 5K3FB 3U3ZA 3ENWA 1XNHA 3M8KA 4LZOA 4RIFA 4CZ2A 1XTIA 1QCCA 4ZT5A 2P6PA 3SDZA 4F2GA 1YBHA 3PHCA 4WDQA 2PSEA 1AKVA 1BVYF 4YAFA 3UAYA 1SWWA 1XU9A 6NULA 5EJAA 3V1LA 2XBMA 3PEUA 5CD1A 1PGOA 4UNQA 3V1MA 4EPXA 4NYMQ 5B1HA 5BO5A 1W34A 3MHTA 1NLFA 3NNSA 4DG5A 3VR4D 2Y8EA 3ZCTA 2HWUA 4JENA 3URMA 3SEZA 1ZD9A 2CYBA 4RHXA 1L5GB 4MUYA 3IUPA 1DOZA 1O5IA 1U5BA 3GEEA 1C9MA 5HE9A 1M2HA 3F2VA 3GP5A 2GEJA 4RKRA 3VR0A 5E9QA 5ES3A 3W2TA 1U4SA 2V96A 2B94A 3QU9A 3NWPA 1TW3A 1ZIYA 2O0KA 2RGYA 2XBUA 1M6NA 3BJMA 3WTBA 2VWQA 4NZOA 2E5LB 3IS3A 4MPPA 3EXEA 3LP6A 5FFMA 4EY8A 4QE3A 1UQUA 5LSAA 2V7WA 1GV0A 4XVQA 1KRXA 2G0TA 2QRQA 3COZA 2P6RA 2H4XA 2UXCB 1E2EA 1UM9B 3EASA 3LCRA 5F4ZA 1CY4A 2JIZD 2WM2A 4EWLA 5TMDA 3IKVA 5JAPA 1BCSB 4F12A 2XWJI 3B1WA 3NJ4A 1ECPA 1E9SA 3ZDZB 1ML4A 2C2GA 1PDOA 3DXXA 4C29A 5EMNA 3OOEA 4K05A 1PKXA 2VDLB 2QT0A 221PA 3RVLA 1VE9A 4O2BF 2R7LA 1XQVA 1VL2A 2QLTA 3EMVA 3ESDA 4HGNA 4QUBA 3TLGB 2ZSUA 1V96A 3Q3IA 3ROPA 1GSHA 2XRYA 3WGVA 2VNKA 4G5YA 4J0HA 2FRXA 1LLCA 2XD9A 3O91A 5K3OA 1GNQA 4Q12A 4OOEA 4C7KA 2ZRJA 2QENA 1H1TA 4WN9B 5LB2A 1MAWA 5EZYB 3C7AA 4RC9A 1BU8A 4R8MA 2QU8A 4HOYA 4ZD6A 5KTRA 1EXDA 2H1IA 2Y1OA 4LG1A 3TXXA 1VYUA 2VUIB 2B8NA 3ROXA 5I7VA 1Y7TA 5DH9A 2AMVA 4B4UA 4R8SA 4IY1A 2FUCA 1Z6ZA 1BN6A 2HSJA 1T8TA 3DEKA 3OT5A 4A26A 2X0KA 3D3KA 2F9LA 3PHIA 2A5LA 3QH4A 5E2AA 1GZUA 5GJCA 5L6LB 4BNDA 1ZOIA 3DYIA 4S2UA 1Z36A 3NOVA 4MVJP 5AOCA 4BCDA 1T2CA 2A5DA 3ZGNA 4DCJA 3GLRA 4EJFA 5BV7A 3KOUA 4CF7A 1H3EA 4QRHA 1RBYA 1EZ1A 4TTJA 4B45A 2P62A 4BZZA 5BMVF 3L4KA 2EBHX 4YAEA 4K87A 1SVWA 3SLRA 1NXVA 4HF7A 5ALOA 1IONA 4MVJD 1CR1A 1ECBA 3SZRA 1W85B 3I64A 1W4ZA 4IH9A 2YIVX 1RXSA 5EIAA 2PQ2A 1FUIA 1MOZA 1SUWA 4FFRA 3QPUA 2GJSA 2FQWA 4WZ6A 4Y18A 4Z9FA 2RCNA 4R81A 5BNFA 4DGQA 3TWOA 4P7BA 4MW9A 5D87A 2X5KO 3O4GA 3EISA 3GEGA 5AW3A 4ESVA 4DV2B 3MTQA 3N0RA 5FLKA 2AT1A 3DO5A 3WHPA 2ZJ4A 3HFRA 4ND8A 2BGNA 4K7JA 5REQA 1T8UA 5IH3A 3UHPA 1YS1X 2C5HA 2H4JA 2UXBB 2R1ZA 2OT3B 1Z2DA 3WWEA 1Z6TA 1PJSA 2WHQA 3HEBA 2IOFA 4XYBA 1AKQA 5CX1B 3UGTA 4QGHA 4COKA 4MB2A 2DR2A 3EPHA 3G6KA 2A78A 1LBHA 1OJ7A 4EB6B 5A1TA 5ARBA 5FWYA 2DBZA 5L3QA 3MTIA 4LJ5A 1M7GA 4RH1A 4F9FA 1OH8A 5JANA 1MR3F 4I1RA 4JU9A 5BRNA 3JAWB 4UBNA 4XWKA 3DLBA 4OXIA 1UC5B 4WBXC 1AGPA 1R9JA 2A9PA 4GMHA 4NABA 2XITA 3TNFA 3BWXA 1NC1A 1OKKA 3DZKA 4A27A 1URPA 4WZZA 4WXRA 1TYAE 1IG3A 2WM8A 5EIFA 2XJ4A 1UADA 4BX3A 2GXAA 2HK9A 4M89A 4MI3A 2VBIA 2LWIA 4QREA 1HDIA 5DNYB 5AW9A 3T4XA 4FR0A 1P7PA 2VK1A 4P58A 3B1XA 3CWQA 2FU5C 4XVUA 1I9GA 2EGGA 2R6CA 3ETNA 1LNQA 4D46A 2GZDA 2ZI9A 4G65A 4YREA 4B32A 3VPCA 2ZPUA 1FFBA 2I1VB 1O6GA 1HNWB 1F6WA 1MC8A 4PPGA 4D80A 4Z49A 5KYGA 1KI1A 3I73A 4MWOA 4TN5A 1MIHA 3FW1A 1Q83A 2W6ZA 1ACJA 3ZVMA 4NF2A 4MCHA 2WPDD 1AKTA 1E2HA 3SXUB 4X8LA 4ZU1X 1RXEA 3E7FA 2FGJA 2IDMA 3B3FA 4UAGA 5AHOA 1UFOA 2WIAA 3AUTA 1BS1A 4B09A 5F64A 3LBNA 4QYSA 4WACA 2GF0A 5DLYA 1DKMA 4X85A 2FEPA 5TQVA 4I14A 3U49A 1Y4SA 2DUJA 2FZWA 3G9TA 1L7MA 2BD0A 2QJRA 3KVOA 1QDEA 2FH5B 3NBAA 3Q3HA 3SYMA 3WMGA 4FHFA 4EFNA 4BVFA 1O6BA 3EUFA 3H9BA 3KKKA 4CCYA 4D2IA 4DNQA 1T24A 5C8VA 1X7XA 1BWRA 5IWAB 1F17A 2RKOA 2IWRA 4UTNA 1ND6A 1A4UA 1Y6QA 4AUNA 2IUTA 3VSAA 4RTOA 4RPHA 3E3NA 4HCJA 3TEJA 2IHBA 3C0KA 5AVVA 2JJQA 1AMOA 4B3IA 2PKYX 4L9RA 5ITZA 4EMSA 2R9VA 5J1SB 1SBCA 1JKJB 2VR1A 3GU3A 2CXHA 5EC8A 3WLHA 4MULA 2G8NA 3A3PA 1AKWA 3EFHA 4H7DA 4D45A 1RABA 2W6MA 4LKRA 3RYFA 2Y4NA 4N5HX 5E1OA 3RIYA 4WLFA 1G7SA 1O2DA 3BFJA 5K8IA 3JVVA 1WUJS 5AM3A 2V7BA 1B0PA 3VRHA 4X66B 4LXXA 1GZ5A 1V26A 1QO9A 5A06A 5CB0A 4A0HA 3RYCB 2F3PA 1XNGA 4KFTA 5TQ2A 4ZI2A 3JALB 4DMGA 5CG2A 3N28A 3EPKA 1GM5A 4JQYA 3ZDRA 3L0BA 3UJBA 2RH4A 4RXTA 4J7UA 3P26A 5CNMA 4MQ5A 3IUEA 4B8YA 1EFRA 1JSXA 1XXLA 1ZISA 3GYBA 4IGEA 1KDVA 1K68A 4OI0A 1MAHA 5C4IA 4RORA 1DQNA 1EQAA 1G98A 1ZH4A 2HLDD 3N9IA 4Z1OA 3UW3A 4NPAA 1Y5RA 2HW8A 4GXQA 1SJ9A 1PR4A 1N0HA 2H00A 3EOZA 3UH1A 3FNQA 5I45A 3UOGA 2V4UA 3IRUA 3LDGA 4MUBA 4EJSA 2ZRCA 2QAGB 4I4TB 1UAYA 2YHSA 3L6RA 4EF6A 2GTPA 2J4FA 2KJQA 2LCFA 2Q27A 2XMZA 2YXDA 3IT2A 4XIGS 5GQSA 4ZGGA 1JALA 3QYAA 1FB5A 3WIDA 4D5EA 4L16A 1FYDA 1VKZA 2BTOA 4G2NA 3WY9A 4H08A 3PWZA 2FVXA 2GZ3A 3F97A 4QAJA 5CT9A 3E61A 1QB7A 1YC5A 4XDZA 1OW3B 4GI1A 4JXKA 1UOEA 1NVGA 1OI4A 1RXWA 3GLHB 2R25B 4YPFA 2MMCA 4RV4A 4BRWA 2BM1A 3HEAA 4GDFA 1P2BA 1UBRS 1RVDA 2I4NA 3BILA 3I9KA 3LUGA 1COZA 4EGCB 2ILVA 2OG2A 3MINA 4LYJA 4ZIRA 4F11A 1CU1A 1XTZA 1DU4A 4MLPA 5KX5B 2IXTA 5IVKA 5JQGA 4ZKEA 1ZONA 3O0TA 4Y6GB 4MP3A 5C8DA 1HF3A 2O5VA 1YQGA 3KJGA 2NMVA 3CTMA 2BI7A 4OK6A 1ZJWA 2JGLA 4FGUA 2X2FA 4PLFA 4RJJA 5ICEA 4C4ZA 1XJ0A 3HPRA 2CWWA 3QTTA 2IUUA 4MW7A 1T6BY 4OGFA 1EG7A 1T5DX 1FTGA 1FEZA 3BFKA 4ADSG 1SBYA 3K2QA 4KWCA 1ODJA 4D5GA 4N6NA 2EIXA 4OQMA 4Y6OA 3U2QA 1T8SA 2I4OA 1I3MA 2XF8A 3F6PA 4M4SA 3AEXA 4PLWA 4Q39A 4TMXA 4YWHA 1NHGA 3AVYA 1QF6A 3N5KA 2XCUA 4RMHA 3AR9A 2WJAA 4AROA 2I4RA 2CXSA 3WX0A 2AZMA 5JBNA 1TECE 1WU7A 2AOVA 3D6NB 3OZDA 3R40A 4KO1S 5CU7A 2VDVE 5GONB 1Q91A 1XCOA 4Q9NA 5G4KA 2WTUA 2HWYA 2YXNA 4F5DA 2Q2OA 3Q3VA 4NMLA 4NIMA 4OHWA 1DBVO 3R0VA 3WKDA 1O94D 3ZKWA 2FWBA 1MFZA 1RM4A 5I7EA 3WBJA 1A2KC 2AOTB 2DSTA 2WINI 2XRMA 3OJCA 3R5SA 3NHKA 5ER9A 1YU9A 2O0LA 4YUYA 3GLIB 1XPRA 5HFNA 1JA9A 1FL9A 2GVZC 5IVDA 1KI7A 5CFRA 1AKRA 2OILA 3KUXA 1X80A 3NCHA 5E2IA 5JISA 3BWCA 1U8ZA 3RAGA 1M2WA 5EQJB 1TYCA 4RE6A 4AJ2A 1FSSA 2O2ZA 2GS9A 1HL3A 3I6YA 3GT4A 1QOZA 1NWHA 1YAHA 2NU7A 3K09C 1SKYB 3QLJA 1GGHA 3ZQKA 2A86A 4J4HA 3WOVA 4DR3B 3EDRA 3OD5A 4QODA 1DUVG 4E70A 3ZD6A 4IW3B 3WAKA 2B98A 1E62A 1R0XA 5LCXA 1L5YA 1TQ2A 1BW9A 5TDHA 1Z7BA 1KQPA 1FSZA 3ANTA 5B5SA 1JQEA 1J97A 4MYCA 2H9YA 4RULA 4FYVA 2KSQA 2I6SA 3OM0A 4B2YA 1YA6A 3TZQA 4LYGA 3IVMA 4MWZA 2YCLA 3PRHA 2DKOA 3JRXA 4OAOA 3TSYA 3VR6H 2GEDA 4E5NA 1UDCA 5I9LA 3PXEA 3E5RA 4K9QA 4RIGA 4PZDA 4YHHB 1H4TA 1JIXA 1Q1GA 2MT9A 2Q3JA 3N0WA 3UWDA 4Y6RA 3FAKA 1GZ3A 1QUEA 2YRXA 4Y9UA 1CUUA 1X2BA 3LTNC 1N5MA 2W93A 1EFVB 2QSUA 3W7BA 2JHPA 2WSSD 4MKGA 5BOVA 1E4VA 1KKMA 1VRCA 2HNKA 1FLDA 1GV1A 2P7HA 2VI5A 1ONBA 5FPTA 4O2LA 4QLAA 1NXWA 4L5IA 1I36A 3QW2A 2FG6C 1MORA 1P7ZA 2Q5FA 4R2XA 4U39A 5EP3A 3P7MA 4C6SA 3WDLA 1QZTA 2VVTA 5L3SB 2J6BA 4ZAZA 2RAFA 3HJFA 3PXAA 1MG5A 2LE0A 3HA5A 2IS4A 1Y98A 5DGXA 1VLLA 4LISA 3Q98A 4IRUB 4UJ3A 3FKSD 5EIWA 1ZI9A 4XM1A 3W2EA 4R2MA 2D1YA 2PNFA 2Q4OA 4A2PA 1UK8A 4QOIA 4NCNA 5HJ5A 4ND2A 1TM4E 4R01A 3Q6IA 5CYGA 3HJHA 3IE0A 6LDHA 1X7ZB 1XLTA 4UE3S 5T7BA 3O4JA 4HG2A 4MLDA 3ZYZA 3ZJTA 2FPPB 2V8BA 2NO9A 1LEHA 3G6WA 4N9WA 4RH3A 2KLHA 4X71A 2WZQA 2GSWA 5JLJA 3ICQB 1UMKA 4YRJA 1K7EB 1ZC3A 5KOHB 3KPJA 1ARZA 4KUGA 3W8NA 3A06A 3EA4A 1N92A 3IVXA 3OETA 4YLGA 5DJ5A 3VKVA 3GBSA 1U80A 3QFTA 3D6JA 1KIFA 3F7TA 3WZLA 2QUBA 4JI2B 1GUZA 1KEKA 4B33A 1E1RA 1Y80A 5BUZA 3MPUA 4F9TA 1UANA 2QY9A 2H5JA 1EHIA 1GDDA 3UHAA 1Q0SA 3VJLA 4MO9A 5I9BA 1C9DB 2JHAA 2EFYA 2QEQA 3DULA 4ZK6A 1WNTA 2G83A 3DBVO 2MSDB 1TKBA 1E4YA 4HAYA 3MTAA 3FMFA 1P9LA 2OORC 4JJZA 5DGDA 1EVEA 3WGMA 2BH9A 5CJPA 4BBZA 2J3IA 4YV0A 3ZGYA 2D0DA 1A5SB 3C2QA 3ET5A 1C81A 1XMJA 4EUEA 4ARCA 3O0DA 4CEIA 1ZQ1A 2ZLBA 2WABA 1SKQA 3EIOA 4PLGA 3OEWA 4KO3S 4Q37A 3IIEA 3NYWA 4ES6A 5F2OA 1WQ4A 4RGVA 2EJVA 2IY7A 2PR7A 4OBEA 4ZHQA 3PC3A 4OHZA 4BLRA 5BNIA 4ZJYA 4NU0A 3C6KA 3EG9A 2OENG 2GX6A 2C4TA 5AI9A 3RVDA 2PUEA 2ATCA 2ZKLA 4W63A 1Q0QA 3E23A 5EY5B 2OYRA 4L9SA 3FPAA 4M83A 4Q9IA 5FYQA 3DHWC 4QTYA 1N6IA 1GRQA 3EPJA 4KYVA 1VIDA 1QKIA 1VI2A 2EAUA 3E9YA 1TZJA 3IB6A 3Q7PA 3TZKA 3UATA 3ZHOA 3DPSA 4EENA 3K70D 3HO1A 4LPSA 2XOXA 2C77A 1XZIA 4XWYA 2GPSA 3IKMB 1IQPA 5HKOA 2VYQA 2AUTA 3STHA 3T4EA 4K9OA 3PFGA 4WBNB 5FA8A 1TA9A 3MBIA 2Y1XA 3MJHA 2Q5QA 2A6PA 5J47A 4B4OA 5AM5A 5HVNA 1SKYE 3NHAA 4MW0A 4JSRA 4B3TB 2GAJA 2HF2A 2BTQA 4PNPA 5DM4A 1DAPA 2W48A 3ZX4A 3WFZA 3LPAA 3Q1KA 4GPAA 4ZVQA 1J33A 3FNIA 3NX4A 4YT5A 3VPGA 1WS6A 5DYIA 5DN6A 5KKNB 1A1VA 2XEXA 3NVAA 4FSDA 4UNPA 1A5TA 4JJEA 1TF7A 2PRIA 2DY1A 5A2GA 3OEHA 3H1AA 3OPQA 4K86A 3KWFA 1NVMB 3WBBA 2YJTD 4QXOA 3GGPA 3ZBQA 4D8WA 1R0RE 2PH7A 2XLCA 4P3NA 2B69A 2OBBA 4B7UA 4UHHA 2GF9A 1DMSA 4LJKA 3EH2A 4X54A 4CQLA 3KJEA 5JFOA 2XUDA 4E2ZA 2FSUA 1EB9A 4QJ4A 2AN4A 2PHZA 4HB4A 1GPYA 1O8BA 2FPPA 5EZ5A 1JBEA 3RRJA 1FZQA 2R8PA 1C9JA 3TFWA 4CU5A 4ZEVA 2V59A 3RS0A 4DANA 4XJSA 4FC6A 1MZPA 5F73A 1IPHA 3PKZA 4K2AA 3BERA 2A5GA 1TT5B 2ORIA 4L22A 3V34A 1PJCA 3KNZA 3RTGA 2FF7A 4LOAA 2E49A 2YDXA 3NATA 4RVUA 1EA7A 1HT0A 2C9DA 2B83A 2Q3BA 3G5AA 4AMYA 4ZYVA 3E22A 2REBA 2DQKA 4C0HA 1TVKB 3LOUA 3OQVA 5JCPA 1P6QA 2YNMD 1C9EA 2ATIA 4JI4B 4YRIA 2PU5A 4H4DA 2AL7A 3IEPA 4F6RA 1Y3FE 3J81A 1PW7A 3LHKA 4MMZB 1J70A 1H3FA 4E46A 2YJ6A 1P4SA 1Q3TA 4KDFA 2FXIA 1L1FA 3OZ7A 5CDFE 3BF7A 5E4JA 1K88A 4HR7A 4CMIB 4DV6B 5L7YA 2XWSA 3GJ4A 4KX3A 4JLAA 3PEYA 1PEDA 4ZVRA 2ZWIA 5FWXA 3AO0B 1VL8A 4IH1A 4M9SA 4R2JA 2RBEA 2VXCA 3M3PA 3UKDA 2UYCA 1PFGA 3K0EA 4NG5A 3JARB 3K2IA 3BCRA 3EXAA 4ZDIA 1H6DA 2F6RA 2IXGA 1JYEA 3D81A 3PQEA 1PJTA 1DQSA 3QFHA 5K0SA 5A0VA 4NZ9A 2QTVB 5K0NA 4C7OB 4DJ5X 3C3CA 1G21B 3FOFC 4UU1A 5BV1A 3JD1A 1OXMA 3ZHYA 4DR7B 4Y1RB 4TPKA 3AVTA 1SOWA 1HQYE 1TC2A 2NLOA 2RBGA 4G0ZA 1S3GA 2CFOA 5J63A 5PNTA 2DH5A 1L1RA 4C4PA 4CODB 3EVNA 1IZ7A 5ALIA 3CUKA 2PUHA 2H16A 1C1DB 2VZ8A 1ISJA 3L7AA 4FZRA 4TV8A 1DLJA 3W8EA 3WDMA 1JVSA 3OE5A 3WIVA 3ZE8A 1DIRA 2EYUA 3Q12A 3I32A 4BFYA 5H81A 1GLGA 5K0CA 3WDKA 1UXIA 2AJLI 2MWMA 3IDOA 1KJJA 2X5XA 3DDUA 4LY9A 3RQIA 3N05A 4BQOA 4P82A 1EUZA 1SBIA 2DQ4A 2GCPA 4LDNA 2DFVA 3KPUA 3U9TA 3BZWA 4J0KA 3HYTA 1I3LA 3ZDQA 1J39A 3EXHB 3R0JA 3R3YA 1OBCA 1TCAA 2HDHA 4AECA 4DKJA 3AILA 5CH8A 1K9VF 4RVNA 1R66A 1VGVA 4HN4B 4BQQA 3PLAE 4QUJA 3GRPA 3V8RA 2CXTA 3MFQA 1M0EA 1B8VA 3WLKX 1QLWA 4ESOA 4NXMB 5A6SB 2I3DA 3H42B 3MS7A 5C8YA 4D4HA 4L85A 4B6PA 5J40A 2NO1A 1U1CA 3CPHA 4BO4A 1NUTA 2FMIA 1CQPA 2F62A 2JB9A 3AF5A 3OE4A 3VKWA 2X8WA 2C1ZA 2XE4A 4D9JA 2J3DA 2AG6A 4P4GA 4CGYA 1FRQA 2FW8A 2HUPA 1XYVA 2JGNA 3MXTA 5FWDA 4C05A 1I2CA 5IKPA 1E5TA 2Y1FA 4DB2A 4QUIA 1N9GA 4XD2A 5BYKA 3TAXA 4EITA 4ENTA 4I8XA 4NJMA 3I3SR 2O4UX 3JVUA 3N1UA 2VIIA 1OI3A 4I99A 4E21A 4PFQA 1JR3A 1NRJB 2GHQA 1DXYA 5HKBA 1A4IA 3L1JA 4MVWA 3G2HA 3U4CA 1M34E 4HWOA 4A8PA 2DUMA 4CPDA 2D2VA 1P44A 1JKMA 3QENA 3O31A 4OH1A 1PJ4A 1EGMB 3AV0B 3K8YA 5FT9A 4F6RB 3WJAA 2K2QB 2OXEA 1YR3A 4BNZA 4DNOA 1M54A 1IBSA 1VE1A 2VYCA 5ADVA 1FVOA 2QYHA 4M55A 2VF7A 1MRSA 5B1SA 3E70C 5L8VA 2O14A 4ZQBA 3VUEA 1ZUIA 4EX6A 3ETGA 3TUJC 1BXRB 2BSXA 5ALMA 3K0CA 4TS1A 2IUEA 2MSNA 4GXRA 3R6WA 2PUJA 1IK4A 1SC1A 3ENKA 4ND1A 1XMIA 2PX6A 1JEEA 3FCSB 2O3RA 4F2HA 1CB7A 2A84A 1FX0B 4XX1A 1E2NA 4Q9JA 2CJPA 4ZPXA 3TG8A 1N2JA 4AWBA 2VWPA 2YWXA 4EY3A 2VNSA 1X2EA 1SR8A 5D2CA 1NVEA 1MEEA 5IPFA 5KOJB 1X1CA 1PJ3A 1UMDA 2W2QA 3GYGA 2VPPA 2I2WA 5K3EA 2EQ5A 1E3JA 3R3JA 4D9HA 3ZV5A 4D9NA 4X92A 1QQTA 2AFVA 4BVLA 5ISMA 2QUAA 1QE3A 5CDUA 1G17A 4TV8B 2O8FA 1WZUA 2HCTA 2ZB2A 4UZFA 3U81A 4QTUB 3A28A 2FSSA 1SEPA 3UCEA 3ANSA 3LFUA 1TK2A 3TF5A 3NEYA 1TTHA 1MB2A 2ISCA 3V4LA 3DMFA 1FMJA 3R8CA 2D1RA 4A1OA 3RVQA 1B0UA 1KZHA 3C4JA 3U6BA 3QVUA 2FRVA 4BMXA 4JN6B 2WK1A 1PV4A 5KSYA 1H05A 2AE2A 3WK6A 1XUOA 5I48A 1POWA 2P5YA 2QTMA 1I14A 1KARA 1F2TB 2R7AA 4MGZR 4QXRA 4LECA 2VP6A 2IQ5A 1L6RA 2TMDA 2R7MA 4MPJA 4N5NA 4OQYA 3JQAB 3RIGA 4CTNA 2FPIA 2V5AA 5KNBD 2QUKA 4B83A 4ZVSA 1HH4A 1SC9A 2CUNA 3QY9A 3SJBA 2ERYA 4UPEA 1WKCA 3IV9A 4G4SP 2H92A 1OHHD 4MYRA 1QYRA 4QEZA 2R47A 1W4BA 4ZTZB 3HDHA 2E4ZA 3O9ZA 1HNNA 4TYQA 3RJ9A 1E2PA 2P0EA 1TEVA 2CV1A 1U2PA 1BX3A 3EZNA 3L93A 3N87A 3NONA 1U28A 4ED9A 1WXXA 1OWOA 5LP1A 2H85A 4CMAA 4CLRA 1UJ6A 3DFMA 1ICEA 2OK8A 1PFUA 1T4CA 1D4ZA 1ZMOA 2P9HA 1NG9A 5ITSA 1QFJA 1N9KA 4L4YA 1TAGA 5IJZA 2Q4EA 1XEXB 3LUFA 4KN8A 5E1MA 2GK4A 3EVCA 4DIMA 1N2IA 2YFQA 4R71A 4PYJA 5BSTA 1DOAA 3TB4A 1HL7A 1ZZGA 4QQFA 5EJ4A 1SG9A 5G1OA 4ZCQA 3RKSA 1BXKA 3FDIA 4LOIA 4MUKA 3W77A 5JFTA 5C3UA 1R0YA 2V7QA 1TJ5A 1LGYA 5DCWA 4ZO6A 2SCUB 3AESA 1U9IC 1PG0A 2QMEA 3D7KA 1B23P 1XDZA 5KTSA 2FYTA 1AS0A 1Y42X 2AEFA 3IERA 3KV1A 4LJ8A 4WZAE 4A8JA 1WOYA 1N2CE 4MQUA 2VYND 3L43A 1EM8A 1V25A 4R1NA 3B70A 2E18A 4V0MA 1X1AA 1P2VA 5HM6A 3WV5A 4WOKA 3D2BA 2RIRA 4EKNB 1EFRD 2OD2A 2W11A 1Z4JA 3RD5A 5KNDA 5MFZA 1SA0A 5JI2E 2VCHA 3LNTA 2DTXA 1Q1ZA 5J4KA 1Y6FA 1WXWA 3CZMA 2EFEB 3TL6A 1Q2UA 2ON6A 4C3UA 3C3DA 3U09A 4HVCA 4MV4A 1FFYA 5KNDH 4NH4A 1SCNE 2HJWA 2J4DA 2WMDA 3UT0A 2D54A 4Q9LA 5IYZB 4IQ4A 1J00A 4FEAA 3OZCA 3U17A 3OX2A 1SUCA 4NLLA 4DV4B 1YB4A 1SULA 4EJ2A 1HXHA 5HILA 1NKTA 1R6AA 3WICA 1RTKA 4PO8A 1IUPA 1GO2A 2OE2A 4GNRA 3I0ZA 4B82A 5IWCA 3PHGA 5EUMA 3U61B 4KQCA 5JALA 3GRUA 1WDKA 1EE9A 5TS2A 2TRSB 1JAHA 3VX4A 1LLDA 3B1FA 4Q15A 1I3CA 1JFLA 1U2ZA 5TF4A 3ILSA 1QIIA 1B2LA 3OJOA 3PC8A 5DEOA 1NQAO 5A3VA 4Z4QA 3LCJA 3T5TA 4G89A 3UIEA 1HTTA 4LRXA 3RBAA 3DVQX 2ZRMA 4YGYA 3QPDA 4GQAA 4KI0A 1GCGA 1XRRA 4LQ4A 4FFVA 2EZTA 3IILA 4PYOA 4MV0A 4QXAA 3ZHUA 4C76A 2I03A 1RU3A 4II3A 1ZK3A 5EE1A 2VYFA 3WMRA 4ZREA 2VQDA 5IARA 3LRTA 1TEZA 1H94A 1K75A 1TGVA 2MSWA 3UICA 5CPBA 1NJ8A 2DF8A 5BN1A 3IAXA 4M1ZA 4XZ3A 4TL9A 5A7GA 2P2ZA 4QYTA 3K2BA 1DAKA 1FDUA 3SBEA 1FA9A 7AT1A 1XTTA 3PV0A 1T4GA 2PT7A 3D6HA 3O38A 4YR9A 1NY6A 1LD3A 3ONDA 5KTKA 2X4IA 2FE1A 3W5UA 4UNRA 3OFND 3WNZA 2P5TB 1Q2XA 2ZBVA 1ETUA 1DFIA 4P7KA 3RT7A 5CLFA 2I33A 1QTNA 4YMGA 3W6UA 2QZ4A 2XHEA 5KO2A 5A3RA 3OZVA 4N82A 1US8B 3E2MA 1SQFA 1X8JA 2C8JA 4F5YA 5MF6A 3HI4A 3NALA 3P4UA 4NDAA 4B9EA 2BAGA 3R3UA 1XMOB 1UM9A 4JLBA 2Q4BA 3JV7A 1NF8A 3VC3A 1C8VB 1N2XA 3Q15C 5DHFA 4CM1A 1B26A 5HNKA 5JPDA 2A92A 4GD3Q 4F84A 4P7GA 5JV5A 1NN5A 3WRYA 3B89A 5FI1B 4MUIA 2DVMA 1UPTA 4LZZA 3A14A 4IIGA 2QAGC 5CM2Z 5ERGB 3H4IA 3A1CA 5KYWB 1A9PA 4E1VA 1CY8A 4NATA 5AW1A 1ZJZA 1DWOA 1VRWA 1JEQA 1KFJB 3EVFA 3FTNA 4MB6A 4FQ7A 4H15A 1EUQA 4P6VF 1U3VA 2GRAA 1TYEB 3T41A 4D4IA 3TRJA 3QOXA 1WPQA 3DLAA 3E1KA 5DI9A 5WRFA 4N0EA 4YAGA 1BDJA 1A9RA 3AL3A 4YO8A 2P9QA 1U2QA 1UPXA 1MV5A 2QRVB 2ZR0A 4MINA 3HADA 3GP8A 3LA6A 4F9EA 1UZLA 4RESA 5LMNB 4QWMA 3E84A 2PU7A 4IV0A 4D7AA 4X1IA 4E2FA 2WWHA 3LK7A 1QFSA 3DLIA 2JAQA 4Z99A 1W5BA 1OYOA 3BA1A 2IYAA 1XK6A 3T3GA 2JKYA 4I08A 1TYDE 3G7UA 2ZB4A 2BDUA 3F78A 3PQ7A 4HDKB 3GZNB 1E3IA 3O83A 4M1KA 1I4OA 1L4GA 2BE9A 2IYYA 4OHVA 2IEIA 4KXLA 4QQNA 1TA0A 5DVZA 5I9MA 3DTVB 4FYHA 4GG1A 4YIKA 2AC7A 2QJWA 1YMVA 3MWJA 3NJRA 2H1HA 2XQIA 2ZR7A 3D8HA 1XMVA 1JDBC 3IOCA 1NBHA 1YD7A 4HSGA 3MRSA 4MV1A 2I7DA 4XGIA 1MF7A 3CB4A 1UJCA 3KVVA 3H65A 5JLAA 1E2JA 1S3SA 1TMGE 4PWZA 3L0ZA 2NUTA 5E6RA 3TNYA 1G19A 4FR5A 4KRXA 2FEXA 2LBPA 2YS7A 4LRQA 2NG1A 5CM9C 3A9VA 3AL2A 4WSOA 3TTXA 5JNWA 3RSCA 3LYAA 4Y2XA 1FVHA 2DB3A 2FSGA 1WUKS 4YCCA 1X94A 1Q1EA 4EA6A 1KYQA 3AUKA 3ILXA 3PJFA 5AVTA 3MT9A 5FUBA 2ZI7A 3I1YA 2XYQA 1PS0A 3F49S 1Z2AA 5H4HA 2NU8A 2HF7A 4KQMA 4LDZA 4PQEA 1GZ6A 4R0VA 3OLQA 5AK0A 3U4DA 4YMVA 2RK3A 4QASA 2GEFA 3GFQA 1KZGB 2ZIFA 3CZ5A 3LQKA 2OZEA 3EZXA 4W5JA 5TARA 5ALHA 2O54A 4H3HB 3Q7TA 3W3AH 2JEYA 4EQ6B 1QGED 3GLHA 4UDYX 1YS7A 1O6FA 5B3JC 5LLTA 1D2CA 2PMBA 3LTEA 1ZVKA 3MIIA 3MINB 5LLDA 3A0UA 1I4WA 3VDMA 4RMGA 2CLIB 1QH9A 3URKA 2YVUA 1G3QA 2ZAYA 3D8NA 5K0LA 5BSRA 1T5TA 1RADA 3AXTA 2IYLD 2P3SA 4WJLA 1ZICA 1O8CA 1HKHA 2ZUWA 3FMIA 3OAAA 4HS9A 4TVSA 3L8EA 1ZI6A 5LZ7A 1G2PA 5KDOA 2BEVA 4ZTUB 1NNEA 1R50A 2J9GA 2GSDA 4FCVA 5A9SA 3OPVA 1BS9A 2BLNA 3D59A 2JJMA 4JQCA 3H75A 2IHTA 5FULA 5EQFA 4FPXA 3WGIA 1NUQA 1QP4A 4QSHA 1XMXA 1Z5NA 1I2ZA 5FBWB 4MIKA 4EUSA 3D02A 3HFJA 4PR3A 1M6HA 3A6FA 4KODA 1IN1A 1ZZEA 4GOKA 4U7DA 1VLVA 1P19A 4IEEA 1JG3A 1CF9A 4FFSA 2IZZA 3KJZA 5HFAA 3SZUA 4URYR 4BATA 2MSCB 1GTSA 5LA6A 2P41A 4CTKA 4FC7A 3ORSA 1AS3A 4MR8B 5DW0A 1XN1A 2QKYA 3DOIA 1E3QA 5A2QA 2AMJA 4IQGA 1OUMA 4IHJA 3JQCA 4EY5A 2D0IA 3GT7A 4LJYA 1C4XA 3SICE 5CT5A 4S04A 1PHPA 1DAIA 4JK3A 1PL7A 1A9ZA 1HE4A 1WQ3A 1YS4A 3VOBA 3GN1A 3KFVA 4PNZA 4CEJB 2XB2A 1J9ZA 2I22A 4FZ3A 1Q50A 2WWVD 2FG5A 4LCJA 4B17A 3GLKA 2IZ5A 3IP3A 4EJ0A 1P17A 1I5EA 1OXKB 2CEKA 2J9XB 3SG0A 3WK5A 5H8WA 2JFGA 1VBMA 4WJZA 3ZWNA 1SCIA 3WLPA 4CCYB 5BR4A 3QEBZ 2G1PA 3BSYA 4QSMA 4PZYA 4IGKA 1ZC4A 1HT2E 1YDHA 2P6NA 2WIDA 3JATB 5TNXA 4NBTA 5C5EA 1H65A 2B8TA 3CUVA 1BA3A 2NXCA 1QHGA 4BFCA 4DQUA 2GNAA 2IITA 2ZBEA 4JU8A 4L5BA 4PC1A 2LCQA 3ELDA 2XGSA 4GW3A 3WGJA 1LLUA 5GOZA 2OVFA 3RYIA 1QYIA 2Q1TA 2F43B 1L7AA 3OLVA 4LZAA 3UGQA 3PL1A 5K3CA 3OIWA 3ZQ4A 3NB0A 5LMCA 1V16B 2Q2WA 3IDQA 3CLUC 3VPAA 3GGOA 5CLQA 4YTEA 1PSDA 1Q77A 2BFAA 2ZS7A 5M34A 1DPFA 2AF3C 3T1HB 1PJ2A 1PLJA 2R4QA 2KBFA 3DD5A 3PE6A 4I1UA 4CG1A 4E4YA 1D6NA 2Q2VA 5D86A 2V0GA 1BIFA 2NV0A 1NW8A 5C35A 3HJAA 4Q4DA 3WOHA 1MFPA 1SCAA 4RK5A 2PMWB 3PF8A 3TAHA 1YGYA 4HNAB 2H59A 3CVWA 1EFVA 1IHYA 1K3TA 1UPCA 3DV0B 5K8JB 2E89A 1KC3A 4HFRA 1B73A 3RRXA 1IBLB 4HLUC 2G63A 2W8ZA 4JVMA 4NP6A 2N46A 5KVCA 2JIBA 1LK7A 3C14C 3NTOA 1KBQA 4O3MA 1QO0D 3V8VA 4N7MA 4OJYA 1JA1A 2IEGA 1L4NA 3KHSA 5ITWA 3G1TA 5CVCA 4HWRA 4M60A 2GD1O 4D1YA 1NXOA 3FOWA 3D6MA 2ZAOA 3UUFA 5KAPA 1LS1A 2X3FA 4N6GA 5A0FA 4X62B 3ZC3A 1FF9A 1TVEA 2FCRA 1W35A 2NSJA 2WTXA 5D3KA 2ZSAA 2ZSFA 4EI2A 2QR2A 2O8DA 3C6MA 3MYRA 5E6UA 3RJ5A 4BP1A 1WB5A 3BMXA 4PIPA 3QVVA 4LKOA 5KZMB 3RJMA 1KZ7B 3T5MA 3FKJA 1KY2A 3DT6A 5HR5A 2PE5A 1Z0JA 5DNCA 2PKQO 2I54A 3OTHA 3QLUA 4TL6A 4C2TA 1LSOA 2D5IA 3JQDA 4GGPA 3ZIAA 4CIBA 1USIA 1LA2A 2Z58A 2CLEB 5DXAA 1O4WA 2CNKA 1A4RA 3SE7A 3B9QA 2B92A 1LBTA 4DLWA 3TSOA 1UEJA 1NWCA 1ECCA 1TZKA 3OU7A 4DG9A 2V4ZA 1L7PA 1RYHA 1I7LA 1ILWA 1T3SA 3O1LA 3WLEA 3ZY4A 4MAFA 1FSGA 1SU6A 1SM4A 5HF9A 5A9RA 3COSA 2HXYA 3Q9SA 2RHTA 3TIVA 4QUEA 5CVVA 4YBZA 1EDZA 1NVVQ 2H0QA 1IXZA 4DN6A 2KMLA 5B6PA 2LIVA 2I7VA 1JUDA 2C4KA 3P4XA 3U3OA 5M2QA 5LD2C 8OHMA 3KJQA 3S0JA 3T15A 3EC2A 3DC7A 4TS9A 1WAMA 2QRKA 4Q05A 4RU1A 4WQMA 1Q19A 1OREA 2PZJA 3KHUA 1WP9A 3NIDB 5CITA 3NH6A 2XMPA 5H16A 3SBOA 4C4RA 5ALVA 1YBVA 4XRGA 2RC5A 1QWSA 1E6LA 1P1HA 3O74A 4D8TA 1VL0A 3I6MA 4YRZA 4DR5B 1IK6A 2IBMA 2V7EA 4W9NA 5EJGA 4Z51A 1Z0IA 1AUVA 3EA5A 4RLQA 1QIKA 4V02A 4A5SA 1OGIA 2ZIXA 3LBYA 4QO7A 1W96A 4FHCA 3ML1A 1Q1QA 3OJEA 3CNBA 3PNOA 1YHZA 4L2IB 1L6IA 4L4UA 3HDYA 4DM3A 2Z5FA 4RM2A 3DHYA 3OCXA 4RFSB 4JQSA 2BFMA 2VSQA 2WAXA 5DLEA 1MENA 2FW0A 5D7NA 2WV9A 1KXZA 3ETHA 5HF5A 1FS6A 2HO5A 4DY6A 2B9EA 2FLVA 2FMHA 2BP7B 2AX3A 3KTAB 3MAJA 2HCBA 2I6XA 3MTGA 3MWFA 4MXDA 3L02A 5AM0A 2X0EA 1K0UA 1V8PA 2E21A 4BQPA 2RG7A 5K8LA 1THMA 3GPBA 3IEXA 4I5GA 4EB6A 2Q1UA 4A23A 3A9RA 1EESA 4FYXA 2YHIA 2HJRA 3FB4A 4CMJA 1YQQA 4G36A 1K4KA 5BUQA 4YRDA 1PV1A 3EJ6A 3FSJX 3LNCA 3UG7A 1JB9A 3IELA 3CH5A 4KZPA 4IIVA 2OCKA 4PVDA 5CTJA 3RFVA 3RT9A 4DEVA 4KWHA 3Q7EA 2L0XA 3AJAA 4H1TA 1KL7A 3MTJA 3IP5A 4K6OA 4MJ7A 4R1SA 2I62A 4U02A 2HA4A 4TL7A 5EG5A 2XT0A 2IP1A 4UEWA 5AESA 3GRAA 4Y1RA 2BJHA 2WTMA 2NV6A 4IYJA 1TQ4A 3ICCA 3OLYA 2EWVA 4NEQA 1DBSA 1P0FA 2JA1A 2WJHA 1RFLA 1NBAA 1S5PA 1RQGA 3OOSA 4M76B 4XYGA 1L7EA 2OB1A 3ASYA 4MMXB 4EKEA 3RUAA 5ALPA 1QZXA 3WXBA 1W48A 4WJKB 3I8XA 2VJOA 5AD1A 2P65A 3BRQA 1WY5A 1IAQA 1YR2A 4UM5A 5GGXA 3T3NA 2OL4A 2SKDA 3NHPA 3NHWA 3VPBA 4AQDA 1T0IA 4DYHA 5JU6A 2QTGA 2XTZA 1N5KA 3HCEA 5IAKA 3GNSA 1JXOA 4HRXA 4JBXA 4XWAA 3RVJA 3D8UA 4QUAA 4KFUA 2ZTLA 1QGUB 2GHIA 1TNDA 2QR3A 3E2PA 1K6MA 3GFFA 4O2AB 4FZ5A 5EUBA 3TGLA 1KEPA 1I6KA 2ZATA 4O4JA 1J99A 4MGYR 3HH8A 4JL6A 3ZGLA 4BLVA 1G2OA 4H27A 4MUGA 4NFLA 1TVCA 4V0OA 4X65B 5AICA 2FEAA 1FFXA 1NUPA 3BL8A 4QAQA 2QDKA 2EBUA 1W25A 2ZRGA 3LP5A 4B87A 4L78A 1VLHA 2VHZA 3TM4A 3ZGZA 2EYQA 2HQRA 4M6WB 4UM7A 5GAJA 2WYVA 2QM7A 1NXXA 2Y1GA 3BKXA 2AG8A 2FFBA 1SZCA 2WWFA 3IYLW 4LSWA 4KMOA 3IBTA 2QAIA 4KNVA 5E95A 2H9AA 3H9GA 3T1TA 2FOLA 4YAKA 1Y8CA 1R0WA 4C2UA 1FFAA 4ESEA 1XWFA 1CT9A 2BMJA 3OHPA 4Y0NA 1MOSA 1E1CA 4LVUA 2EARA 4X84A 3TZEA 3JD4A 3FCYA 4M0MA 4X8HA 1R0ZA 4KE7A 2VLBA 1NVUQ 1WE2A 1NBWB 2AW3A 3PHHA 4CKXA 3HGMA 1PGNA 1EJ0A 2JGRA 4EHHA 1FJHA 4DCSA 4OMUA 4TSKA 2OHFA 4AMVA 2ZE5A 3L7YA 4F1JA 2LTAA 3DLPX 5C37A 2CXPA 4FE3A 3CLRC 3V46A 4Q7MB 2FQ1A 5AJYA 4Z1MA 1J8DA 3DBRB 1GPH1 2DT5A 3OMWA 1AGYA 5AVSA 1X86B 3B5EA 4I4IA 4P3PA 3TR6A 1TLLA 1U11A 4JHXA 4L8YA 1C1YA 2VHQA 1EPUA 4R8KA 3BDAA 1ZRMA 2PAFA 4A7PA 4JIGA 4FFWA 4GUAA 4ZJPA 5LUAA 3EEYA 3EIUA 4Q4JA 2OUKA 5DHSA 4DBLC 1RW4A 2GZSA 3GVHA 3RRZA 5JUWA 2R6JA 3GCWA 4R1QA 1MQSA 4JLMA 1U5AA 4WAUA 3B3AA 4IXMA 4HMQA 4OBXA 1VJDA 2CHUA 1CJSA 4DREA 4K6MA 1MC4A 1E98A 3U4QA 2XYHA 2QUZA 3NKVA 3I9LA 1FDTA 3K72B 4KHZA 4OI2A 2JI6A 3UAGA 2POCA 4FLFA 2EFHB 3L6CA 3VR3D 1JTFA 2WF8A 1Z5GA 4PGFA 3CY6A 2B4YA 2MIIA 1KP3A 1S9DA 2PTGA 3PYLA 3CB2A 2QTAA 2BUBA 4OHMA 1XX6A 2JLWA 1UFVA 4LBWA 1AB5A 2IY9A 2B1IA 1C0KA 1AUXA 1ZD4A 3OT4A 2QL7A 4FX5A 4GR4A 1A2OA 5CP8A 3TSZA 1JEJA 4AY2A 3MCUA 2XKBA 1XF9A 2VWGA 5KJEA 4E09A 5KNDD 3LUPA 2P2LA 5J4YA 5SZJA 3W8FA 3BCUA 3O84A 4OMFG 4E5YA 4R4JA 1EGHA 4BQFA 5JT1A 4KPYA 2OYCA 2P9ZA 3HJUA 4IFBA 4HAVA 1IUOA 1DAMA 2OAP1 4PLYA 1UJBA 1F1BA 2APJA 4L0QA 1UT5A 4LA4A 1U2RA 1JZQA 2CF6A 3GCZA 3JQQA 2MSLA 2EBWA 4JH0A 1VTKA 2GGSA 3OM8A 1DELA 1FBTA 2A5FA 1YL6A 2NXEA 1ND5A 3LW8A 3PWSA 1XTPA 2IP2A 1DSSG 1Z5VA 3QFCA 4QGBA 4C9BA 5IC6A 2QI9F 1FSFA 5JCZA 1BKSB 4OYLA 4CLRB 3HACA 1XNJA 1QK5A 2LP4Y 1K06A 1N1GA 2QRJA 3T7AA 5B57C 5CA1B 4LGCA 3W2GA 1L5SA 3LOQA 3QX3A 3B3JA 4JUIA 5BNWA 5K9ZA 2ZXFA 2PEZA 4L6IA 4UHFA 2C57A 3DONA 2WI8A 3Q4GA 3AG6A 2QA5A 4HWSA 3EGXB 1KK0A 4LWPA 4AULA 5CFQA 3DVSX 1NI4B 2X3UA 4M3NA 4KR3A 1ZK1A 1NF2A 2W6JA 4FMDF 5C34B 3HGTA 1L4EA 3UT6A 4XIYA 2Q3CA 4YAUA 2BM8A 2RGEA 3X1DA 1IZ9A 4RJKA 2QBYA 5A5EA 3OFJA 3KCQA 3MWYW 3CLUD 1VYTA 4DSOA 4JJKA 2PWZA 4G8DA 4G0YA 3A1TA 2G04A 3LLMA 3OC6A 2FSIA 3BS4A 1Y8RB 4OIMA 3VGPA 1F20A 4GWKA 1KJYA 3HK2A 2EP5A 2FP4A 1IBKB 2J45A 4CMCA 3G5MA 4DDTA 4D9MA 4BUJA 3ZH2A 1CQIA 2VK4A 3QQPA 2ASEA 1E8DA 1A8QA 3UT5B 4DRXA 4LCBA 1CPYA 4E1BA 1CVLA 4ONEA 1G0OA 1WUTA 3JQFA 4TYYA 4M49A 4N47A 2UZ3A 4UQLA 5JHGB 1IXYA 1Y4AE 1EXMA 3E5NA 5L3RA 4Y1GA 2CVOA 4TZ6A 3PHBE 4Z7QB 4FDUA 3D3JA 2D8MA 4P5EA 2H0AA 4QYWA 3S81A 1EFTA 1HLFA 3EWSA 2ZJ8A 3NRJA 1OTHA 2A33A 3C15C 3EVTA 4PQGA 4DAEA 1EIWA 3DG9A 2WHPB 4PF1A 4CMHA 1E1NA 1P7CA 1QHEA 1YVRA 4OHUA 3VC7A 4HBZA 4DXAA 4EPYA 5JXWA 4V1CA 8ATCA 3G2KA 2OMEA 1SUSA 2OKGA 1PWZA 1U5BB 4UAVA 1Y1TA 4DC1A 3GDGA 5LMUB 3WGTA 4G41A 2D1QA 3NMUF 3F73A 1VKJA 4FDTA 4B47A 1U2DC 4PS1A 4RMNA 3S2YA 2BMEA 2IXEA 4NEHB 4RVDA 4DNPA 3O3OB 2WVJA 4MITA 5JI3E 4OB6A 5AI0A 1MP0A 2FPSA 3N3AC 1M5RA 3NWEA 3CGWA 2ZM6B 2HMYB 4R41A 3W06A 3BXPA 3S7ZA 1TZBA 1KS2A 3IAM6 1LI4A 4MKXA 2J6IA 4PAGA 1FTQA 2C7PA 5IAOA 3I9FA 1ABBA 1IEXA 1HPLA 2NU6B 1VKOA 1JMYA 1GL6A 1Z22A 4K3VA 4TUYB 3KL4A 3VZBA 2YXBA 1RAIA 2XAAA 2Q1SA 2R4TA 2NZVG 2V7QD 3QLVC 4R9VA 5FQOA 5BQ3A 1AN0A 1QC5B 4RV9A 4DV7B 1KI2A 1PJ8A 1U28C 3LU1A 4N18A 5CVJA 1MW9X 2VYNA 1MJ5A 1US8A 1K8YB 2AHRA 3A4IA 1VJTA 3ASVA 3IP8A 3MLBA 1G1AA 2DQSA 1W59A 2VRWA 1HE8B 3CX3A 4GDMA 5EZYF 3VUFA 4BO3A 1OPRA 4RKWA 1WXEA 4CMKA 3ZNQA 1C30B 2QJFA 4UEJA 4AQ7A 3GEBA 3HHEA 1IY1A 4V38A 1VB3A 1WXHA 4QJBA 3OQJA 4K0RA 3K9WA 2WSLA 3GFVA 5T4HA 4XUGB 1E1KA 2ZIVB 3G0DA 4Y2RA 1AUPA 4G4GA 5DWVA 3GJ8A 3WLQA 4O4HF 2J67A 2GEUA 2Q0SA 1R0BA 1ZP6A 2GNOA 3FSRA 4GIBA 3THWA 3I1JA 5JSYA 2R8YA 4MDFA 5JMOA 2ISSD 1TD1A 5H5JA 5D6NA 5BMVB 3WZMA 1G5IA 1REQA 1T15A 2OOSA 2G3YA 5KEIA 2E9SA 1MKYA 1AO3A 1E61A 5ILGA 3FVQA 4IGIA 4B3DA 2AZDA 3G8YA 3NBZC 4OSEA 5EVJA 3ODGA 1X6VA 4OB7A 3CR3C 2I34A 4I9GA 4ID3A 2BFCA 5F52A 4P2BA 1RRGA 3CNNA 4ZANA 3CWCA 4W7SA 3ANNA 3RS7A 3IBCA 2XZPA 4V2IA 3W7VA 5K2OA 2PUAA 2QSZA 4C5CA 4I81A 1XZPA 3ZDCA 4DE5A 1VCHA 4G1EB 2CY0A 1PUIA 2VKQA 2ZBUA 4RK6A 4XM0A 1OLXA 3SY8A 1SKAA 1EB8A 5I7UA 1ZWLA 3UPTA 1NYLA 2Q99A 2AJBA 3AXSA 2WTNA 1OT5A 5C9ZA 3I5YA 4E15A 1T9KA 3SDBA 4CL3A 1GT6A 3NW9A 3WWDA 4J9UE 1ISHA 4N0QA 3HKBA 4U7TB 2WKQA 2EKDA 1J2TA 3N2NA 5KNCH 5C31A 3KYCA 5JOQA 3OFNA 2ZSEA 5EWJA 5I8ZA 5FO1A 4XVHA 4KN5A 4LDRA 3WRWA 1TUIA 4N48A 3BHJA 3ABIA 3DYVA 3CUTA 4YCDA 4BNWA 2AD5A 3I83A 1Y1RA 5BSVA 5DXFA 5JDIA 4XWWA 5IDXA 1DQRA 2FKAA 2JKVA 2W2PA 2XUKA 3B7GA 3FRHA 4Q1AA 5E9WA 3FUCA 1A69A 1LQUA 4AMGA 3IOMA 1T9GR 4RX1A 5B30A 2I6TA 1GL7A 4G1FA 1RM5A 1VI6A 2Q5HA 3H8WA 3FSGD 1VLMA 2W4IA 3V7FA 4DHWA 2I3ZA 2ADOA 4DDVA 2CVZA 2C9BA 1SC4A 2A3RA 5DULA 1ZN2A 2NNLD 3O75A 5EPUA 3EG5A 2GLTA 1UIRA 2YHUA 2VUHB 3K3PA 1M2JA 3OUTA 3HQ4O 4QBHA 3VYRB 5B7QA 1VHDA 2QD3A 4R2WA 2HCRA 1PFQA 4KFCA 4NBKA 2H4FA 4JA2A 1CUGA 4YCBA 4QHYA 1TD9A 3L8GA 2JDID 3DH0A 3UYKA 4DCGA 4EG8A 4REQB 4M1EA 4RXUA 2WE8A 3BQNB 4Z4HA 1RHMA 4Q0MA 1KYIA 2RG1A 3PEFA 2QNIA 4TLCA 1HURA 3RSQA 2VHYA 4ZRNA 4HFJA 5I3ZA 5GOTA 1HKUA 2JZOA 3IPXA 3MGCA 4BFZA 4D97A 1Q0HA 2Q1WA 5EKDA 1KAHA 2XCOA 1YZKA 1DJQA 1HFEL 2BGJA 2PN1A 3QPCA 4W8GA 4QGFA 3B3GA 5JMPA 4NBNA 2ZB8A 4GM1A 1TO6A 2QMZA 3T7TA 3VBEA 1IJKA 2J8ZA 3GRYA 3I39X 2P35A 4G81A 3SPXA 2WKRA 2X4GA 1DT5A 1E59A 3O8OA 1QJ4A 3I04A 2Q21A 4NYJQ 4O4HB 4Q9HA 3P2JA 1N6PA 3ZCXA 4BLOA 1KHHA 1AGXA 1QO0A 2OO5C 5KWJA 4A4DA 2EP7A 4KPEC 5HP4A 4Y9RA 3H5IA 3TUIC 4AJOA 2C99A 2VTEA 2VP5A 4DUGA 2AG1A 1YQUA 3AUUA 4B0OA 3E15A 4IH4A 2OUIA 3B82A 3EUWA 1Q6ZA 4NE2A 1I2DA 2WB4A 5TXGA 2PZBA 1SXJB 3NPAA 4JEUA 1SXPA 3PFWO 3SFTA 1F51E 2GJKA 3PVSA 3QSGA 4I3GA 4K9LA 4ZAVA 4EHNA 4S12A 3THXB 1NVAA 3FZNA 4EGAA 5BV2P 1ESZA 2MINB 5HW0A 2WZBA 1QRTA 2HSDA 3LUDA 1TK9A 4OQQA 4R2IA 2IUYA 4HGOA 3VPHA 1INLA 4I6GA 1UMBB 4TOIA 1UQTA 3IMGA 3MTBA 3TTUA 2OV1A 1NNUA 2WD9A 3FN4A 3LT5A 3ZQJA 4C4XA 3ND7A 4A15A 1O9HA 3VBCA 4LNHA 3A6HA 2WYHA 4PQYA 3S2IA 1JHYA 4V0KA 2WQ6A 2JIDA 1RQRA 1XLVA 4JDPA 4KQJA 2V8OA 4YYZA 5DCLA 5BR8B 4H1UA 4UARA 1QZZA 3PKJA 3OAAD 5JHHB 3CKYA 2WPNA 1EGAA 3GRFA 1LLFA 3NUQA 4GWLA 5HHTA 3LQYA 3CRW1 2ZBDA 5HKAA 1BHSA 1PT7A 2O8VA 2WAOA 3A9CA 4KLNA 2AFHA 4UTOA 3WYEA 1VM6A 4B40A 4GX2A 4NCKA 3R7WA 4OHYA 2YWDA 4O1HA 2DFLA 3AI3A 2WYWA 2HB6A 3CT4A 3CEHA 4P7JA 4BWYA 1I7QB 2IZ0A 1QRSA 4MMYB 2XUOA 1NUSA 3D0KA 4NMHA 4DBVO 1LRJA 1U0NA 4JROA 1YZYA 4P80A 1HMPA 2PBFA 1EVYA 4GI7A 3T54A 2EOAA 4E51A 3PZBA 4EOGA 2VSYA 5JJCA 4N01A 3FPEA 3OICA 4GM4A 2Z1NA 2D06A 4KAJA 1LFAA 2J08A 3Q9NA 1G8KA 3ZZUA 1ZU5A 3VSBA 5JQGB 4YRKA 2BLLA 2ST1A 1R6BX 1NVBA 3LBHA 3FOEC 1UKCA 4WK0B 1LTKA 2IYEA 3E7DA 1IIBA 3T3OA 4H7IA 4LZJA 3FBWA 3EBOA 3Q5EA 2QW8A 4KIJA 3VNBA 4Q3BA 1CUYA 1U7TA 4I3FA 1D03A 2XNHA 1Z0FA 5KTMA 1MAUA 3G9ZA 2AWOA 4DOMA 5KREA 3RVOA 4AL4A 4R51A 2O2JA 3WSWA 1YS9A 3RB8A 3L04A 2BUCA 4PHFA 4AJKA 4JLSA 3L3BA 2C29D 3U7EB 4YPOA 2R5WA 4XGRA 1I4LD 2HNAA 3MFYA 4EGJA 1MGPA 5E9JA 1OXBB 5EJ5A 3RYIB 1MXHA 2UUOA 1KK1A 3ZGOA 4BRSA 621PA 1ZH6A 3GDOA 4QPPA 3A58B 3L84A 3M5WA 1E18A 1VHQA 4IHAA 5JAMA 1RI2A 2ZAGA 1KGDA 3GX1A 4OHBA 1MNQA 1L5VA 4IIJA 4DQXA 3IQDB 3KXPA 3NBYC 3MJDA 3QKUA 1WZIA 4OI1A 2W00A 4F86A 3M6VA 3MELA 3I9JA 3U40A 1RSZA 5ALXA 2V0NA 6GPBA 3YASA 3NTLA 1MGOA 3SQOA 1F2DA 2QX6A 3O2NA 1TUEA 5FL7A 5F7XA 4YVFA 5BMOA 1ZUWA 1DO2A 1T2DA 3UA4A 2VUSA 3N53A 1AQUA 4WE3A 4BO6A 4EA7A 5JXHA 1E89A 1KY3A 1ONOA 2W7TA 1U02A 3DL7A 1WMBA 1BQ3A 1R9NA 1LTHR 1T0UA 3FPCA 3M6LA 3NKFA 4R0NA 3KLPX 1AQJA 3ORHA 4DJJA 1G291 1DT3A 4YQEA 3IAM1 1EFCA 3U1TA 3W5AA 2P6UA 3WLLA 1M66A 3H9JA 3OM1A 4P2GA 1DRJA 4EFMA 2GAIA 1U1IA 1ULSA 1X0VA 4BTLA 2C2MA 3W5HA 4U6SA 2J3EA 2E1PA 2Z1DA 4M38A 2QZJA 1SHZA 2QROA 3C1AA 4L0CA 3IVAA 1T8YA 1KFBB 2BKXA 3IJRA 2Z2KA 4KQ9A 4PE5B 3KXIA 5CG1A 3GA0A 4HQOA 1R5BA 1HE2A 3ONWA 5G40A 3OQNA 3BJZA 2C82A 3NLLA 3TFQA 3WYBA 1V7QA 3G1UA 3ZI4A 2H8GA 5ICSA 3REOA 1ES9A 2D3WA 2EF1A 1N2ZA 1W2GA 3HHPA 1QBKC 4W5NA 3H5AA 4BX0A 4CM8A 3AIMA 3OQPA 4LCEA 1KO1A 1E5DA 3FNEA 5I47A 3LPDA 1TM1E 2MMGA 4EHBA 1I6LA 1AGNA 3AC0A 2FMUA 2OTCA 1E4OA 2GWRA 2ORWA 4JEMA 5AI6A 2I3AA 4BNIA 1J2JA 3QOYA 3WNCA 4YWJA 3HXKA 3GGJA 1BD4A 4JEHA 1V9CA 1PEYA 2ZBGA 4FCTA 3LYLA 4YT2A 1NUUA 3FYDA 2H52A 3RFUA 4CKCB 3UN1A 3JD3A 3QVXA 4M7OA 1ZGZA 3RG2A 2P5UA 3L1UA 3E9MA 4Z1MD 1YRWA 2O5CA 2IW1A 2C83A 1PL0A 2HRQA 4IXNA 2XOKD 4LOJA 4OK3A 2QPTA 4NMXB 4E33A 3SKXA 3OQIB 3TKYA 3U4GA 4Y3UA 1VRVA 1W6UA 2K87A 3OP4A 3QVLA 5AKZA 3EQ2A 4QOHA 5J5CA 1Z6AA 5D01A 2PGIA 2CSUA 1YHNA 3PNPA 4IIXA 4NJMB 1GTVA 3KFLA 4XLZA 1F0NA 3FGPA 3H83A 4DMHA 2HIAA 5HRUA 2ZIXB 3KWLA 5EKXA 1E0AA 5AVQA 2VUTA 1A9OA 2FDRA 3I0NA 5CVTA 1ISPA 1E1QD 2IZ6A 2ZIGA 1GG9A 2X40A 3AY6A 2FEWB 4L2IA 3L1VA 4WUVA 4RZXA 2O8EA 2QYSA 4IJUA 5CTAA 3CVOA 1S8AA 2PZLA 4Y98A 5FWYB 5GONF 1XQ9A 2X22A 2IEDA 3FVTA 4CT0A 1FTWA 4DCMA 5HX7A 3KPYA 4H17A 1VGRA 5LFAA 5DTEA 4YALA 2VJLA 3CXUA 5SICE 1E5QA 4MTLA 1SVLA 2QORA 5A3JA 2QDXA 1QHYA 4DIFA 3RWMB 5I8WA 1EZZA 3S8EA 5DHUA 5CA1F 2Y1KA 4MHOA 1P7WA 4ME6A 1QH8A 5KOYA 3G17A 4RA9B 1EFDN 4ETMA 2JFNA 1N8NA 1E2IA 4PAOA 3UTDA 2WJIA 3EHEA 2VA8A 2ZM5A 2YWHA 3K0CC 1AJEA 1BU5A 3ETJA 1FTYA 2ODAA 5HUHA 1CK4A 2PXCA 5A4FS 1K2WA 4GHWA 2GAAA 4J2HA 3QEOA 4REOA 3S2GA 2AFIA 5IM4A 5JRZA 4O0LA 4CIXA 3DHVA 3RFXA 4JOCA 3U7FB 2JGMA 3K9BA 3FMGA 1O6ZA 3MTEA 3ZHTA 5JJIA 5AHKA 1WNFA 4KSBA 1IOVA 2DWQA 2QRGA 1NBEA 1OFHA 1RDFA 1RKVA 1WB6A 1Y9AA 3KB6A 2XD4A 4ZO4A 2NZYA 3SM9A 1GU7A 1SEVA 1ZXBA 3HFGA 1E6WA 2BE7A 3EIXA 3CZQA 3L77A 4Q4HA 4TWAA 1A8PA 1SQSA 2AMFA 2ACVA 3ZXIA 1H4QA 1BROA 2QY6A 3G2LA 3GELA 4N3BA 3VXKA 2X7HA 2QOEA 2Z30A 5AW4A 4HZGA 4KACA 3HXOA 5E8RA 4UUNA 4WLOA 4D6YA 4HB2A 3ANMA 3K20A 2C03A 3NP7A 4TKUA 5CA0A 3DCYA 5EIOA 2DFPA 5TQ0B 4EW6A 5F9HA 1OWPA 3L9WA 3CCCA 4KZKA 2BKUA 1O5OA 3V1KA 1JE0A 3IDFA 4F93B 1PT5A 4JI3B 3WFIA 3SU8A 1XDDA 3F6EX 3TJRA 4FBGA 1WDLA 1SUEA 1RQPA 3U3XA 1UWLA 4JLPA 1MJFA 2EDCA 4XQEA 4OQFA 4L9WA 4W1SA 2FX3A 2WHRA 3A11A 5TGDA 1BZYA 2GM5A 2E48A 2G1KA 2JNWA 3CIOA 3JVDA 3KKNA 3LKBA 3Q40A 3ZHRA 1DEAA 5EWMB 1H9CA 5B12A 5KCZA 3GNLA 3MCWA 2XYRA 3KYJB 4EHJA 2H2GA 1GD1O 2GN0A 2XVMA 3FI0A 5K6TA 4JBYA 2AD1A 4ITUA 3C43A 3JALA 2IHNA 3N59A 4HAIA 3QFRA 2WOJA 4G84A 3WQQA 1B16A 2D59A 4GPTA 2IYVA 1E1DA 4HZIA 3R7NA 1CDZA 4FX2A 4HMPA 3ZEAA 4ALMA 3DCNA 3M4ZA 4PC3A 3TS1A 3EDMA 4DAOA 1UXJA 3PENA 2B7BA 4IS3A 4QU0A 2UV8A 1SN7A 4Q7LA 1QHSA 2G5CA 3ZOZA 2C78A 1F6DA 3FUTA 2ZRQA 1G55A 2IIPA 4BFUA 3C5VA 4HN2A 5ALEA 3B36A 1EP9A 3NHRA 5K0TA 3Q88A 3QEMB 4OP1A 4QZVA 1C7IA 2EJTA 4MQFA 5J1TB 4B74A 1PQUA 3P45A 1MXFA 1P4AA 3D64A 4CM9A 3UJNA 4FUQA 4EVSA 2YJNA 2YFHA 3UK1A 3CZ4A 1XVLA 2B4AA 5DX1A 1Y9ZA 1XVAA 1JPVA 3L46A 3LPCA 4Y7CA 5JXJA 2C7OA 1NI4A 4YRSA 2PX3A 4I5EA 3K94A 2ZRHA 3PVZA 5EHIA 2HJGA 2X5JO 1KRWA 3TAUA 2RI1A 4QFBA 4C4YA 1HEIA 1ZM3A 2IOFK 4MRSA 3FE2A 3ROGA 4YT8A 1PJZA 4YUWA 3DEFA 3RUDA 5NULA 4EKIA 5IBCA 2EFGA 2XDQA 2VXBA 2EGUA 4LHVA 4M87A 4DUPA 2QLFA 4PAWA 1VGQA 1RP1A 5ESXA 2E85A 1C7RA 2A9KA 1HLDA 2GBIA 1U94A 2I1WA 3DZ8A 4EAAA 2O0MA 4EHDA 3E9NA 1JHXA 1MB3A 2LGJA 3PTZA 4HH3C 4NENB 2I2BA 2XTMA 4YXWD 1FMTA 5H70A 5CCXA 3COPA 3ONFA 3IKTA 4QGGA 2VHWA