4DA6A

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with ganciclovir
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
231
structure length
231
Chain Sequence
b'SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 87
structure length 231
sequence length 231
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4da6A00
4LZWA 2QSUA 1B8NA 5I3CA 5CCEA 1WTAA 1OTYA 2AC7A 5C80A 3F8WA 3QPBA 1V3QE 1G2OA 1Y1TA 4EARA 4TXMA 1RXUA 4L6IA 4RJ2A 4IP0A 4WKNA 4TS3A 3UT6A 4WKPA 4TS9A 1V41E 4BMYA 1XE3A 5K1ZA 3MB8A 4OEHA 1VHJA 4I2VA 5F7XA 1ULBA 1I80A 1RXSA 3KUKA 4JP5A 4K6OA 3UAYA 4GKAA 3DP9A 1JDVA 5KB3A 1JDUA 5F73A 4QARA 3T94A 1RYZA 2QDKA 3NBQA 2ISCA 3DJFA 1T0UA 1M73E 1V45E 1T8SA 5ETJA 4EB8A 1OUMA 4WKOA 4D9HA 4G41A 2GUWA 3GGSA 3FB1A 3IEXA 1Y1SA 1Z5NA 1JE1A 1TGVA 4PNPA 4M7WA 1OTXA 4DABA 3EMVA 4NS1A 4F2WA 5IU6A 4YO8A 1T8WA 1Z33A 4WKCA 1PR1A 1A9RA 1PR2A 4TTAA 4D8YA 1T8RA 3KU4A 1ODKA 3OOHA 3O6VA 3D1VA 3EUEA 3E0QA 3P0FA 4R31A 1T8YA 1Z5OA 3MMSA 4TTIA 2OECA 5B7NA 1YR3A 1VFNA 4QAQA 2OXFA 1Z5PA 5CYFA 3LA8A 4M1EA 1Z35A 4TTJA 4F2PA 1TD1A 4QEZA 1SD1A 1RT9A 1JPVA 1CB0A 1TCVA 5CXQA 1PW7A 2OC4A 4LNHA 3LGSA 4KN5A 2AI1A 1JP7A 1YBFA 3UAZA 4MCIA 3ENZA 3PNSA 1JDSA 3FAZA 1Z39A 1U1FA 3DF9A 4L5CA 1OVGA 2QTGA 3IOMA 4OY3A 1V2HE 1RSZA 4JWTA 4PR3A 1OV6A 1PF7E 4BMZA 1U1CA 1V4NA 4NSNA 5B7PA 3OZEA 3KVRA 5CCDA 1PBNA 5EUBA 5JPCA 1U1EA 3PHCA 1A9OA 4U2KA 1Y6QA 1U1GA 4F3KA 4P54A 4D8VA 3ONVA 4G8JA 4TXJA 1RR6A 4R2XA 1JDTA 4QATA 3C74A 1K3FA 3DDOA 2QPLA 1JDZA 3KVYA 5F7JA 3BGSA 1LV8A 3OCCA 2H8GA 2PGAA 3KHSA 3ODGA 1Y1QA 3OZCA 4L5AA 5IFKA 5F78A 3K8OE 3E9RA 3E9ZA 4OF4A 4F1WA 3UAVA 4OGLA 5F77A 4DARA 4GMHA 1OU4A 4LNAA 4UC0A 4R2WA 5EFOA 1SJ9A 1A9TA 2HRDA 4TYMA 4JOSA 2HWUA 4QASA 1ODIA 5F7ZA 4LKRA 4LDNA 2IQ5A 3BSFA 4TXNA 1ZOSA 1A9SA 2OC9A 1A9PA 2XRFA 1RXCA 2RJ3A 1Y6RA 4ECEA 3OOEA 1PR5A 4G89A 3GB9A 5F76A 4BMXA 3FWPA 1ULAA 1K27A 1NC1A 1PK9A 4NY1A 4E1VA 1SQ6A 2A8YA 4TXLA 4D8XA 4F3CA 1PK7A 4FFSA 4DA8A 3PNPA 1PWYE 4MCHA 1ODLA 3INYA 4X24A 5CYGA 4D98A 1Z36A 4L5YA 4OJTA 5DK6A 1A69A 1SD2A 4GLFA 3LBAA 2I4TA 2P4SA 1Z37A 1Q1GA 1TGYA 1YRYE 1PR0A 4BN0A 3OZBA 4MARA 5EPUA 1TCUA 4OGKA 2HSWA 3U40A 5CXSA 5F7OA 3NM5A 3FUCA 2AI3A 1Z34A 1CG6A 4DA6A 2B94A 3UAWA 3PHBE 3EUFA 1PKEA 2Q7OE 1QE5A 1C3XA 4M3NA 1U1DA 1ZL2A 1Y1RA 4WKBA 2ON6A 2A0XA 3NM6B 3O4VA 4DAOA 4DA7A 5B7QA 1B8OA 1A9QA 1NC3A 3OPVA 4YMLA 1FXUA 2QTTA 1NW4A 2HN9A 3NM4A 3BJEA 1V48A 1RFGE 1LVUA 2A0YA 4GLJA 4DAEA 1YQUA 3KVVA 1JE0A 3SCZA 3EEIA 1JYSA 1VHWA 3BL6A 3DPSA 2I8AA 3OF3A 2AI2A 1PR4A 2BSXA 4L0MA 4H1TA 4QFBA 3P0EA 1VMKA 4DA0A 1ECPA 3FNQA 1YQQA 5FAKA 1PR6A 4YNBA 3TL6A 1LX7A 1RCTE 5B7GA 3UAXA 3K8QA 3OZDA 1Z38A 1ODJA 2A0WA 4DANA 3FOWA 4YJKA 4TXHA 1K9SA 1RXYA 1N3IA
chains in the Genus database with same CATH superfamily
3AY6A 4KQFA 4G56A 3L7NA 1CJCA 2R1UA 3HADA 5LXTA 5TE9A 1Q3KA 3I73A 4P7KA 4QRHA 1A1SA 2C92A 3OX2A 3AVXA 2V7QD 1P1KA 4ENUA 4YCDA 3ZGNA 2YY5A 4HZUB 4WXHA 1CQIA 2X8BA 1F0NA 5KCZA 2AQ8A 2GBFA 5P21A 1VXRA 3LYHA 4X63A 1H6DA 3LE8A 1DIGA 4PGAA 4IX9A 4E32A 3SVLA 1QF6A 1ORRA 3AUJB 1GV1A 1TDJA 1HG0A 2D1TA 4OQXA 5K3EA 4R3NA 3GLHB 4KFUA 3DE7X 3GMIA 1SVWA 5H16A 3PUIA 2C3MA 3WRXC 1UEJA 1T26A 2YY7A 1SB8A 3TTUA 1S3IA 2RK3A 1OV4A 3MWLA 4P3YA 1S2LA 1JQLB 3O2SB 1QYWA 3QXHA 1QB7A 5CITA 4JH0A 3U1TA 2V6BA 5BN3A 5SYAA 4LDRA 4A3SA 5IP5A 5AK5A 4Q6BA 4B6EA 1KI4A 5C5DA 2YOFA 3WV4A 4HO1X 2XT9A 4MYDA 1DXQA 1VCHA 4XD7D 3KT6A 5TX7A 4RLHA 3RVLA 4X1YA 2MYPA 2IOFA 4K1XA 1IIBA 4FFLA 1QH9A 4MRPA 1IK6A 2ACWA 2PXAA 4QHTA 4WVFA 1UBFA 1U63A 2GFIA 3KTDA 3GPIA 3F1LA 1G2IA 3ROMA 1JA9A 4UEOA 4P82A 1RM0A 4EGSA 2C7OA 4MDFA 1SUAA 1M75A 1X2BA 4WHMA 1C9EA 1U3WA 4EG4A 4KQIA 1AUPA 4KIGA 3VR4H 4R9SA 1GNQA 3BIJA 3M81A 4PXSA 3B1WA 4OLBA 2HSGA 4GI3A 1DFIA 2QUKA 2RKBA 4EP1A 1WV1A 1GZ3A 4FEAA 1FYVA 2NOAA 3CEJA 3CEMA 2NZ2A 4E08A 2RK4A 2BGRA 1D5CA 1DV2A 4R41A 4ZTZB 2X0KA 2QL9A 1SXJD 4CT4B 4HH1A 1L7VC 2FP4A 3L7AA 1I7NA 2DLDA 2QYOA 3LH5A 4AJLA 4KRGA 1LZLA 1ISFA 1DADA 3V48A 2QDKA 3U3JA 1QWSA 4DC9A 4CTMA 2HI0A 3WDSA 2PYZA 4U1RA 2GAFA 3LBFA 3DZFA 1OWNA 2ZI7A 3SX4A 3VOBA 3MWDB 1U0JA 1QRAA 5JFTA 4HVTA 4FW9A 1P4AA 1FRVA 2JLSA 2K6GA 2Q9BA 4PSAA 1JYEA 5HCNA 1G9TA 2P7IA 3PX2A 3TUZC 2NPFA 2ZUSA 1HMYA 2GXSA 4KMRA 4JJGA 1KY3A 1X8XA 3D4BA 4JBGA 1JE1A 1OXUA 5GOZA 4BIIA 4F5DA 1M6WA 4MAAA 4PZLA 4HWGA 2BF4A 2F1RA 2HA0A 4F2WA 2CLMB 4JBLA 1II8A 1R4ZA 2OUKA 4AS3A 2BZ0A 4MEJA 4GBED 5IU6A 5LA6A 4IRMA 3I58A 1T8WA 4KBFA 4B6SA 4BE9A 4YCLA 5JAPA 1S8FA 1V7ZA 2ZXEA 2QN8A 4S0ZA 5J5VA 5C1DA 1BO6A 1P29A 1U4SA 3A26A 5AHWA 2H9YA 2JJQA 2V96A 4O1HA 3B5IA 3KB1A 1BH2A 2R5WA 1SRRA 3E35A 3RHTA 3B1FA 2IF0A 4B09A 4XEHA 4H0NA 2V7BA 4PAMA 4C22A 4BMCA 2D1YA 1LNQA 4JL6A 3C41J 4IXWA 1P0MA 4NXMB 3EZ6A 2EGGA 1YR7A 1ZNXA 2BMVA 1ZBQA 2J08A 4OL9A 3WGUA 1U2DC 3ZDEA 1KFKB 2CL0X 1J0EA 1U2PA 2P41A 3A2MA 3D1VA 3EUEA 3LBNA 4ALMA 2R8BA 1E3SA 3I9LA 5INTA 5K3DA 1E6LA 2YWBA 3BAZA 4K26A 1JSRA 2WHRA 1BDHA 1E0AA 3EGDB 2V0CA 4L57A 4XGKA 4ZDKA 1GRQA 3BMQB 3D6VA 4QAQA 2HGZA 4IHAA 3CSDA 4YT8A 2QMQA 4JLAA 4KV9A 4ENSA 5LQAA 2CVOA 5C7YA 2AN5A 6AT1A 1GUYA 1SEPA 1PJ4A 5ALWA 1T10A 4M4SA 3H84A 2BRUC 2WSBA 1EDZA 4J16A 2XUJA 2ZRDA 4LX8A 3SFZA 3WYNA 4UQPA 4KXVA 2GWHA 2XMZA 1P4HA 1T5DX 3EEOA 1XWWA 1KOFA 4LF9B 3WXMA 3LPNA 5GIPE 3CJTA 3PPWA 2E6KA 3QEOA 1GN9A 4ZC8A 2ZK7A 5K8JB 2OGSA 1FDWA 1JTVA 2RAFA 3S99A 10MHA 1WSDA 1QHEA 2LE0A 1E92A 1UFKA 2PUBA 5EG5A 1XZBA 5AVKA 4C4PA 1D4OA 4R16A 2DLCX 1Y1PA 3MPOA 3HMKA 1IUKA 4C88A 1KXJA 1C1DB 1JG7A 2XVYA 5DCUA 3K7EA 4CETA 5CTJA 4G97A 4RJKA 4GP7A 4TSKA 1QRTA 1BKYA 2ACVA 4JI4B 4I1UA 2ZUWA 3FF1A 5TR9A 4UFPA 3JALA 2Y9PB 1ISGA 1LDGA 2XGSA 3JSXA 4HUQA 3B52X 3L0OA 3Q3VA 1GNPA 5EXSA 2WB4A 5JDIC 2GFHA 3UBTA 1SOMA 1U2EA 4TRJA 1DRKA 3H1PA 3HN7A 3NG1A 1JKJB 3ILVA 1QV9A 2JHAA 4DJFC 1R6XA 4ZQGA 4ZAVA 1D2RA 1G9XA 3BRCA 5CVUA 2WKPA 1ZR4A 2FX2A 3INGA 1P0QA 1ADGA 1NMZA 3TE7A 4N5IX 4LI3X 5JYCA 3D8SA 3G5UA 2ZRIA 3ZIUA 1LSUA 1F2TA 1JU4A 3HJRA 4QM7A 2IPMA 1MQ9A 2P8JA 3M7IA 3DE4X 4V39A 1A0OA 4EG0A 1GFZA 1JR6A 2DR3A 4TQGA 1W0JD 2MTBA 2CL5A 4J9VA 4HYTA 4OQPA 5I4KA 5CEFA 4HYYA 2JKZA 4BVLA 3KZ1E 2BMJA 2R4QA 3VDNB 5LN1A 3QXXA 4QECA 1RJDA 3R5TA 1KVRA 4OUKX 1GQRA 4G8JA 4I4IA 4V2IA 3T95A 4Z4FA 2KLHA 1G0NA 1VIAA 2AFIE 3A4IA 3P20A 4UAVA 3RJ5A 3ZS8A 3GUZA 2PN1A 3GUYA 3I2FA 1AQLA 3JQRA 1IVNA 3L3BA 5FDFA 2EOAA 1HTWA 2P75A 3EWAA 1HX7A 4A0HA 3WNQA 1H93A 3ORQA 4DZZA 4CIBA 5HQ3B 2QY6A 2AD5A 1GKKA 3F78A 2AN3A 4AMUA 4JLBA 2H0RA 3RGGA 2I1QA 2AZMA 5K2OA 4NCXA 4YV0A 1E2UA 3AW8A 4KMOA 4X6YA 3HWX1 4ZK2A 1JYFA 3B38A 2QQGA 1CZNA 1FB5A 4G37A 5KSPA 3G82C 2P9QA 1DINA 2JIRA 1Z0ZA 3DBRB 1KRHA 3PHJA 2XUIA 1WSBA 3DO6A 3EIEA 1ZYUA 1K08A 3I8XA 3QIAA 4BYGA 2OD7A 4EJMA 5EWMB 4UVIA 2NZ8A 1H0HA 2VDLB 4GR9A 2EKZA 4LXYA 2PZKA 3GJRA 4QX6A 5F78A 4RKEA 2OP0A 3ZE6A 4DB4A 3LWDA 3ITEA 4O2AF 1CY4A 3ON5A 2CFTA 4S12A 1YB2A 1CTQA 1N2CB 3D5TA 4ND2A 5B2FA 5FUYA 3RSGA 3T34A 4C7XA 3ILYA 1SZCA 4I6EA 3UMFA 3HBAA 2BUAA 3IKTA 1E3MA 2XUDA 3NDJA 4KE9A 2ZBVA 3DEKA 4HAZA 2CMGA 3AG6A 1P39A 5AO9A 1WJGA 4H7HA 4MITA 3DFUA 5A4KA 2PTGA 4MLCA 1JQJC 3C45A 3A6HA 2RB4A 1OLOA 5WRFA 8ABPA 5FBWB 5LL6P 2JJ2A 5IAOA 1CUVA 2AFHA 1MAAA 2G71A 4MV8A 1NLZA 3IRUA 3D8RA 4BMNA 5IYZF 3ZD6A 1NNUA 1TYEB 1VC2A 2VP4A 4N5NA 4RQTA 2Z5LA 3B85A 1SR8A 5EFOA 2FG5A 2JB9A 4HXEB 1NP3A 2K7ZA 2Q5HA 5COQA 5H3HA 4U5QA 1O9BA 2UZ3A 2ZU6A 1V5FA 3CPSA 3GBSA 1E3WA 3ZD7A 1CQWA 3BXXA 1AKQA 2NO0A 2QJRA 1TCCA 4MMZB 4OLFA 4UBOA 1DAGA 3LKDA 1SKYB 3PT5A 2P1ZA 2CLFB 3DMDA 3NXKA 4W63A 5F7ZA 1ISMA 4PLZA 3KOZA 1P9WA 3L7MA 4QXMA 5DOVA 2OMKA 2COKA 2MWMA 4UBNA 5BUZA 1QHGA 3I62A 2FPOA 3QFHA 4YJFB 1EX6A 4YRGA 1G3UA 2W00A 4N48A 2OCPA 2FE1A 5GIOE 4DZTA 1QHYA 1F48A 3HO6A 3WB9A 4XB2A 5EUQB 2R44A 1IONA 4H59A 5TMDA 1VGVA 3CH7A 2HY7A 2Z30A 3T1QA 2PD3A 3TLMA 1GARA 2V98A 2RJ3A 4HS4A 1R16A 4MYUA 2GHTA 3SBDA 1Y6RA 2QR3A 3R0QA 3SZMA 2CLSA 3OOEA 2ZUUA 5C18A 3ANMA 4ZZ1A 2OAGA 1Q91A 2R62A 2O4UX 4MCAA 3CE6A 2HSEA 5IX8A 1P5JA 2X5XA 4KUEA 4KJZA 4BIMA 4EKGA 2JH8A 2Q0HA 2OK8A 2Q4BA 4Q03A 5LDDC 3ASZA 2DFLA 2FQXA 1SCDA 3IXMA 3AVPA 3PLAE 1E1CA 1L5FA 1GTL1 1YMQA 1G2QA 1XDWA 4IJ6A 4J94A 4JIGA 4AIIA 1CPYA 3GY0A 2O1EA 5K0TA 4RVSA 2WF9A 4EJ0A 5EXXA 3NGMA 1RE1A 5CFLA 2XGGA 2YV5A 4QGFA 1K06A 4JELA 1F51E 4Q12A 2KBFA 1RHQA 4AMYA 2NU9A 3FRIA 1N8NA 3MT8A 1DAEA 4JJZA 3ZQKA 3FUUA 1H42A 1KA9H 4CL2A 3D02A 1JLLA 2P3SA 4YQZA 1EXDA 2ZR9A 2RGCA 3BD7A 2RGUA 3LFUA 3DLTA 2AG0A 1YIOA 2O3QA 1SD2A 2J48A 1J09A 3D3EA 4MW7A 1E98A 2EWVA 2WQZA 2I4TA 3HU2A 3TPZA 1WW3A 3W8NA 2J67A 3OO1A 4EZBA 1Q1GA 1TGYA 1W2HA 2JFWA 3KEFA 4JJKA 4N9WA 1LI7A 4DMFA 4ID9A 4J1NA 3UK1A 2B2CA 2I29A 2P69A 3EFBA 1ZS9A 3JPYA 2ZM5A 3MTDA 1AG9A 5JBQA 1IYZA 1DCKA 3AJDA 4YP9A 1RXEA 3TG8A 2QXUA 4RJLA 4UAJA 3KG2A 2IHTA 2GD6A 1YAJA 2H29A 2YFKA 4DILA 1XVUA 2YWRA 2P3OA 3U13A 3V80A 4UDXX 5KOHB 2N46A 4JI7B 3W2HA 4TKMA 4FD3A 1Q0SA 1RYEA 1UBRS 4HSEA 3MRSA 3E9NA 3ETLA 4HADA 5AW2A 1QAMA 1Y9JA 2IWRA 4ZTUB 3ZTTA 2OBMA 5HF6A 2XMQA 2HJHA 3DKIA 3ER6A 4M7PA 4NPCA 2JHCA 4IH4A 1WCYA 3R7DA 2VRWA 1XI2A 1P7ZA 2WM8A 1I2ZA 3I8SA 4I4NA 3DOIA 4EYKA 1OA1A 2ZJ0A 5JOQA 2FG7C 1EX7A 2AC2A 2FPXA 1MB3A 2AJTA 5ALQA 1D4AA 1XNQB 2C2HA 2D13A 2GPNA 2XW6A 3GEDA 4OHOA 5ES3A 3HY6A 1BEEA 1U8UA 3S1AB 4CDGA 2PGOA 5I8WA 4Y2PA 3G68A 4OCZA 5HMLA 4BASA 4GSYA 5LU9A 4FFMA 4TKZA 4ZHQF 3C87A 4MPTA 4ZU1X 1ZOPA 4K81B 2D5CA 4HRXA 2C2WA 5KUTA 5K0SA 1LQ2A 5EZQA 3HP4A 1J5EB 3ENWA 4QGHA 2GD1O 1G0OA 3QI7A 3EQ2A 2IS4A 1W0CA 1RPJA 3LGAA 1PS8A 3TXXA 1CY8A 3ZHTA 5MHTA 1GPAA 3G85A 3BJEA 5H3CA 3H75A 3X3HA 2BKEA 1SELA 3MUOA 1M34B 3BFKA 5YASA 1FNCA 4L78A 3DHWC 3LOUA 2Y0EA 3IR7A 3QVGB 1QP4A 1I6LA 5HIJA 4EVQA 5CDGA 4LZNA 4OXRA 4UU8A 5JW6A 1GXSB 2I67A 1SKQA 1JH9A 4G0MA 4B46A 2X13A 1QCZA 2D1QA 2PU5A 3BFVA 4Q7MB 4H6VA 3VC7A 2FKNA 2EL7A 3OU2A 1SHTX 4EQ6A 1Y4ZA 5LXTB 2F3PA 3B6EA 2AQIA 3BL6A 1CRLA 1MC5A 2HOQA 1EQ2A 1YCGA 1QC5B 2Y0CA 3VJMA 5ESWA 4XWKA 5HOQA 1VCMA 3RDPA 4R9UC 1XXHA 1FP4B 2BSXA 2FDRA 3KYJB 4Q3KA 1GR0A 2O0LA 3URMA 3G1UA 4DA0A 3P97A 3JQ7A 3UATA 3TGPA 3ZIDA 1HY3A 3DXYA 3JATB 2VXYA 1O89A 4B6PA 4CMJA 5JCXA 5K03A 1G7TA 3TL6A 4BKPA 3M34A 4B4DA 2G7MC 3PYMA 2QMUA 2OHOA 2Y1DA 1NUSA 2ATIA 1EBUA 3PLRA 4YRNA 1O57A 3D3JA 4HDMA 3OIYA 1K8XB 1PT5A 2FEOA 4HDAA 1AKNA 4R8RA 3WNDA 2DTXA 1WRBA 3LY5A 4M8SA 3UGTA 1A50B 2VT7A 4E5PA 4PO3X 3OZGA 4BYMA 2X42A 4P4SA 4YJKA 3GZNB 5LDGA 3ZLTA 1ZUWA 1XFDA 2J85A 2LZ0A 2DM6A 3RFVA 1BKSB 1JFVA 4G1BA 5IJZA 4JHXA 1KYIA 4QTZA 4O0LA 2CXOA 4MNTA 4S05A 1XAJA 1THGA 3KTFA 3K53A 3L41A 4H6WA 4M55A 1IEQA 2VP9A 2Z8YA 5A0FA 3Q5DA 4PO8A 3ZPXA 4NS4A 1TQ4A 1N5DA 3SR3A 1EVJA 2YYYA 2ZBRA 2W58A 2ZRJA 4L8GA 4WCFB 1ZMBA 4UBKA 1M1ZA 1RAEA 2PZ8A 2XNCA 3B9RA 1DG9A 3I6ZA 3P4YA 4RULA 3D59A 1T9CA 4CCSA 2UZ1A 3G8BA 2PH1A 4RETA 5I3CA 2W6IA 4A5OA 1R10A 2PD4A 3KSZO 1QTIA 2HIGA 4HDOB 4IDBA 1VIYA 2CYAA 2QX9A 1K88A 2IHYA 1H3FA 4Z4IA 1YS7A 1HLGA 1XA3A 4TTRA 3E58A 4II7A 5IARA 5E8RA 3CXUA 4ZICA 5IF9A 1P44A 5M3BA 1XCBA 2IDKA 4ASUD 4I19A 3F4LA 2XXBA 1RZUA 2I33A 2Z9CA 1B8UA 2ZSAA 1M1XB 4PWYA 3NT2A 3DG9A 1E7QA 3EAQA 2WD7B 4BU0A 4H1WA 3V8RA 5B3KA 4YXFA 2R8EA 3QX9A 2P40A 1P1RA 4TS3A 4V1CI 1KI8A 3ZNPA 1RYFA 3OZ7A 3WGQA 1E2HA 3CINA 4Z4GA 3S8EA 1WD7A 3ASVA 4QT4A 3ACCA 4MLPA 4BLRA 1U7WA 2YXBA 4IDPA 2GAOA 4AD8A 1VHJA 1LLQA 2P90A 2I71A 1RXSA 2Q6LA 1AV7A 2R8XA 1A77A 1OYYA 1ZO8A 4CM9A 4BMDA 3GDHA 4CKWA 3D2AA 5LQUA 1JIKA 2GUGA 3R75A 3ESZA 3EQ6A 3AL3A 1W4BA 4LZJA 3G7SA 3QEMB 2G5TA 3VHRA 1C41A 1UBUS 1Z3IX 4RESA 3FGNA 1NQ5A 3KUCA 2HXYA 5FEMA 1KO5A 3V97A 2XZPA 1ADCA 5H59A 3A10A 1HO3A 4OXYA 1M73E 5K4AA 1MRZA 5EJ2A 3O8NA 1V45E 2R86A 2XWPA 1JILA 4JFAA 1RLUA 3G0CA 5ELLA 5EMKA 3K1YA 2FZLA 3K6KA 4P32A 4I3HA 1T5SA 2RKWA 4L08A 5E6RB 3WFIA 3UMYA 1ZN9A 3ZKWB 2J6CA 4OX9B 2B1IA 1HNNA 4UMVA 4NP6A 4EHFA 2NN3C 1IN5A 3UW1A 1PJRA 3LVQE 1Z5NA 5LBTA 4LWPA 1SM4A 2ALJA 2FOLA 3CQ9A 2IBTA 4MP3A 1U0GA 4U7PB 3UYLA 3AEYA 2A1TR 2C29D 2NSHA 3N6VA 1M10A 3N2GB 4MS3B 3UXEA 4AF6A 4M2LA 1O94C 5CHYA 2R66A 2NO5A 4QICA 3MTEA 4N47A 4XPIB 3VSBA 1ZRNA 2PRKA 3AHCA 1Y1LA 5FPTA 1JFTA 2W11A 3USZA 1PL7A 4Z9XA 2J4DA 3QQ5A 3FPHA 5LR6A 4LY9A 2CSXA 2P6OA 2FZWA 1XN4A 2IIPA 2PPVA 1EGAA 3U0VA 1WNFA 3I0ZA 4M89A 1ZU5A 1BEZA 1NUQA 2O0KA 3EAFA 4CUJA 2VJBA 2X9GA 3O4JA 4GIBA 3A1FA 2R4TA 5A5GA 2WB2A 4G36A 3AWDA 2DH6A 3M6UA 1JWBB 5EXDA 2BFNA 4NF2A 4B76A 3AKCA 2R6HA 2QENA 3BG5A 4C5BA 9LDTA 1NATA 1CRQA 1WU7A 3P0FA 4JR2A 4BXOB 3A6KA 3TSZA 5BP7A 4C87A 3W1WA 1O2DA 1CUWA 4HXGA 2DWCA 5K3CA 2YZGA 1MDFA 1RHMA 3MJ4A 2FUEA 1RP1A 4ROSA 4YECA 1P80A 1DC4A 1K4KA 1NW6A 4I81A 4TZ0A 3GEIA 4TN1A 2QNRA 1ESCA 3Q7RA 3WLIA 4BB6A 2C5EA 5E7QA 1E9AA 1S0UA 1DKQA 3JQ8A 2D2FA 3O31A 1JSXA 3R0VA 4GQAA 5CYFA 4XE5A 3VC1A 3GPDG 4TYWA 2ZW9A 3KKNA 2ZDQA 1X3SA 3C7CB 4GVPA 1EFVB 1FLNA 1PYGA 3R5FA 4I66A 1DC7A 1YRAA 1JIUA 5ABPA 2CBGA 3FBWA 4F56A 5E3JA 5AW6A 5REQB 2IYFA 3HXOA 2UXCB 2GJ8A 4OOEA 3T7DA 5E0OA 1T9BA 5ALMA 2J9XB 3LPDA 1E64A 1CB0A 2JD0A 1UBTS 2OORA 2V45A 4LZZA 4WNIA 5F4BA 5JZ9A 3STHA 1T4GA 3P9RA 4LNHA 3RRNA 3RHZA 2GYVA 4NENA 2P2CA 4UU0A 1A82A 4QOIA 3ROTA 3PGJA 1KAHA 1SBQA 3D7RA 4MRAA 1S2DA 4TV8A 2VHWA 1WXFA 3K0FA 4ZVTA 1UZUA 2FEPA 2RBKA 3OC6A 3QFSA 3H9GA 4M7OA 5TPZD 4C14A 3E9EA 5K9ZA 5D85A 4O1MA 3DR5A 1QZUA 4BNKA 2AR0A 3EIXA 1M1YB 1VKJA 3F5MA 2FEMA 4WZAE 5IAJA 4KI7A 4OUDB 2HBYA 2Y3IA 4NYMQ 3VGJA 3CRZA 3FNEA 4JLKA 3GLFE 1TAGA 3AZOA 2JI4A 1SGWA 1WB6A 5HCUA 4JWTA 2VJMB 3KD2A 1IBSA 4DLVA 1BA3A 1W88A 1WX1A 1PJAA 5LKAA 4RW0A 3B6KA 1N6HA 2O5CA 1E79A 1YVRA 4QNNA 3NEAA 1FIUA 1ADYA 2JGFA 1YZNA 3LUCA 5FLEX 4UOEA 1Z73A 1D7OA 3C16C 2CVFA 1M76A 3CT6A 3FNFA 3WOHA 3CTPA 3NHSA 3QKWA 5JXIA 3V32A 1B93A 1ABEA 4RHFA 2DUNA 2D2IA 4YJHA 2FFBA 2GWRA 2QMOA 2Z57A 2EGHA 3JRNA 4LW8A 2CK3A 3BDAA 3T3GA 5CCDA 3TUIC 2QD3A 1G2PA 4TUYF 5IXSA 3GLIA 3PQ7A 4ZK6A 3H5OA 2NVUB 5KBYA 1F38A 4PYKA 3CIOA 2A9OA 3P96A 2FZ4A 1VJ1A 2RHGB 2PRIA 4UDOA 5ECWA 5T57A 5JJBA 4NHOA 5DI9A 2AR7A 1W581 3PLNA 5C7OO 6ADHA 4WFJA 3UK6A 5HS4A 3WL5A 4PGMA 2I0FA 2JBAA 4PS1A 4C05A 1ZX1A 2QN1A 3U3DA 3VYVA 3A9TA 4JJAA 1T6XA 2P9CA 1WPGA 1ZVVA 4X93A 5GGYA 2P0YA 1LW7A 2QUBA 4YXWA 2C9DA 4OHWA 1QZTA 2FN9A 3NHWA 5KYKA 3AU9A 3L4BA 4WNYA 4Z8XA 3LPMA 1GA1A 4EVRA 1SPXA 3FNIA 2YZNA 5E6UB 5F7JA 4HNGA 4IXDA 3E70C 3ZH2A 3PTZA 5CFOA 4JGGA 4PZUA 4WK0B 3FGOA 2IOFK 4KP7A 3TAUA 4RAQA 4CM6A 4Q15A 1RE0A 1XEAA 3UJ8A 1GHTA 5DTQA 1NBWB 4X44A 3WGOA 3RNOA 2OZLA 5C31A 3RAJA 4CT0A 1WY7A 3X1JA 4ZXFA 3RYFA 3KYCA 3PUJA 4HPWA 2VNHA 4DBLE 4D9FA 1WPRA 3PFIA 3I9KA 4LJAA 5FOXA 2MSDB 1KL7A 1JQBA 3OZFA 1SA0A 3PYXA 4HOYA 5KREA 1MX1A 1UMDA 3B6MA 3LWNA 4OF4A 3DM9B 2R6CA 3LHKA 4ZMBA 2JBHA 4PN3A 1KDPA 3OPYA 1JR3A 1U65A 4Z9YA 5THXA 1MPTA 3DZIA 1HI9A 1CR1A 1S2MA 3AERB 3LZ6A 2WUEA 2PKYX 1GPJA 5JCOA 3T3HA 3ZXSA 1JSCA 1V8ZA 1M8PA 4BAZA 1V8DA 2H2WA 3UHFA 1KRWA 4B2YA 2SKDA 2CJPA 4BNVA 1YJ5A 3JWHA 4G8CA 4FDVA 2JGEA 4H7JA 3R9IA 4GRAA 1EM8A 5JMPA 4E5SA 4RLFA 4EB3A 4YFVA 4XLTA 1MD9A 4N41A 4DM3A 3NVAA 4LYDA 3OEED 1UEXC 5A2GA 4DKXA 2VXCA 1ZD8A 3IKVA 3FHCB 3BMCB 5FEUA 3ZHYA 3B2NA 3DD1A 1J33A 2YCBA 4KSBA 5E6SB 1BYIA 3SHTA 4RA9A 1Z5WA 5IN5A 1EJBA 1V43A 1UEIA 3BE4A 3DKVA 4NEGA 3UJAA 1BCSB 3L5KA 3GP5A 2R1ZA 3E8XA 1PVDA 1T34A 1YRHA 4AWBA 1B0UA 3T5BA 5DM0A 1XWIA 3JR7A 3E4CA 3SEAA 4A8TA 4RGVA 1LPNA 5ECDA 2WILA 3W3AH 1SCUB 3L82B 1FX1A 2BBWA 2F3TA 3MCUA 4GEKA 3RVKA 2RGDA 1EP3B 1G20B 2OUIA 2PVCA 3MSXA 2MU1A 3N8IA 4EABA 4A10A 5EGNA 3O47A 1GUAA 1L9KA 2VJQA 2EKQA 3ETNA 3LP8A 4BOYA 3WQSB 3P9KA 2DSNA 2PV7A 4IDQA 1Z26A 3F97A 2FMTA 2EZ8A 1HH4A 2YUIA 3FH0A 3BFXA 5THKA 3O1LA 3AUSA 3L7CA 2VJNA 1TEHA 1TKCA 4XIIA 3G0BA 2RHBA 4RD0A 4BZZA 2QE7D 3FY4A 3QK7A 4V02A 2H54A 3UK0A 4EGAA 3L8FA 3O9ZA 3C7AA 2QAIA 3SC2B 1I33A 1UFRA 5IABA 3GRZA 1Z07A 2H85A 3BDVA 1T6NA 4AUEA 3A32A 1RQ2A 3OEYA 4HDQB 4ZODA 1W94A 1Z2DA 2YVKA 3KO8A 3NHUA 4XVUA 4X41A 4QUIA 2FPGB 2J9YB 5A7GA 2A8YA 5AJUA 6LDHA 5IM4A 2CDRA 2CJWA 4FMPA 1G21A 3K9HA 4U2EA 4F3CA 3NKLA 1FK8A 4NARA 1Y8RB 3ID6C 2CXNA 1ZVMA 2W7TA 4JLJA 4MVJD 3ZZTA 1ZNWA 4FXOA 3PI6A 1HQDA 3I04A 5BYAA 1XXLA 4LJRA 3DVRX 3K5IA 4P2GA 5DEOA 1KMQA 2FLKA 3EVGA 1ODLA 2OZKA 3KQKA 1OVMA 2GRUA 1QNLA 3DBHB 1EWKA 2GVNA 1X0VA 3CVJA 3DTVA 4IGIA 4XIGS 1L1FA 4P1ZA 4GSLA 1FNSA 2Z0MA 5H81A 3A6ZA 1S2GA 1EZ4A 3HJHA 3HYNA 5I7RA 1R0WA 2KMLA 1QK3A 3O1HB 1HRDA 1Z37A 2IGBA 3WJ1A 3WYBA 1TMYA 3K09A 3PE3A 3PICA 1Z5UA 1XTUA 1ABBA 4IRXA 3U26A 5LP6F 3TLYA 1SVMA 3D9QX 1O6BA 4NBKA 4G0UA 4RGYA 3R8CA 3OSUA 4CYMA 1U28A 1H3NA 1DPFA 5EMLA 3FTEA 1I01A 2ODNA 4BBAA 3AIKA 2YOGA 3A9CA 3O8BA 4MV6A 3GCDA 5AXDA 3FUCA 4AF7A 3GPLA 1B8VA 2F8LA 2P6MA 2Y4OA 4GD3Q 5JAUA 1FS5A 2MINB 3GCWA 2OE2A 4PIMA 5CT9A 3SF8B 3IUPA 4EI7A 4UNSA 1KDVA 3AETB 4WY5A 4NONA 2OQ2A 2C9OA 4UUBA 4MV5A 3EK2A 2FPPB 2UUAB 4Y1EA 4GX1A 2JAXA 3QVKA 3IVXA 1RWPA 3LT0A 3R7SA 1DG3A 4L5BA 1KEEB 3IO3A 2ZVDA 3HB0A 4DA9A 1KY5A 2WIGA 4DNFA 1XEWX 3WIVA 4S1PA 1JEOA 4K6KA 3K30A 1AHHA 3RD5A 5A0VA 2B7LA 5FR1A 1HXHA 5A4IS 1TK3A 5CGZA 1RAAA 4GX2A 2BKVA 1U2RA 4F93B 4UM9B 1H66A 1R50A 2BFEA 4NU5A 4RD3A 2FWIA 4X61A 2YJNA 3JQAD 4RKRA 2ZBEA 5L3SB 2XXJA 3CLSD 1QCCA 2QN3A 5BYBA 2RHTA 2VNJA 3ESXA 5FOVA 2VDKB 1CR4A 4I50B 4ZAZA 1N5RA 4E03A 1E3IA 4K8RB 4MR9A 2DFTA 3NHKA 5EYPB 2PQ6A 4PAQA 4XSHA 4EKEA 2A3RA 4PNZA 3OIDA 1USGA 1P7CA 1Z2EA 3I76A 3SDSA 4A92A 2UYHA 2KWIA 1SWWA 5DYYA 2C57A 4I4TA 1R27A 1ZRSA 3D6AA 4P38A 2WJ4A 5ENZA 1A97A 1O58A 3EHEA 1U0RA 3OZTA 2ONJA 2C4VA 1I1QB 1HDIA 1KR2A 1T24A 1ZD1A 2FFJA 2FPSA 2JAOA 2QVYX 3PEEA 2RONA 2H3EA 1NVWQ 2VATA 3BWXA 3N8NA 4CLEA 1VL1A 2FK7A 3COVA 4NATA 1CS0B 3T9CA 3RYCA 2C95A 1VMKA 3L0ZA 3IOYA 3V4ZA 5CDUA 4HG2A 2Y1OA 2HF8A 3FPAA 2DGDA 1RRMA 4QDKA 4FI3F 4JP8A 4YRMA 4W7HA 1Z0JA 2Z95A 4BX9A 1UIMA 2JHGA 5HEKA 4KJXA 5FNZA 1JL3A 4LJ7A 4DMRA 2H1HA 3LV8A 3OCUA 2IEDA 5E0KB 5FYDA 4BVFA 4BECA 1FFWA 4BGDA 2EG9A 1DIHA 4YUVA 1LF0A 1V4VA 3CONA 1C7IA 4HQFA 5L3VA 3O8DA 2DPYA 2EV9A 3DOHA 5JMWA 3BXOA 4RACA 2HZBA 1ZN2A 1JKMA 3NFYA 3VJLA 4NAHA 3P2EA 5ESXA 4X62B 3HFGA 3ICPA 3NKFA 1XNRB 2WAMA 2XQJA 4DADA 3TBHA 1LC0A 4DMGA 5CA1A 2OQVA 1ODSA 1EJ6A 4JYMA 4YHBA 5TGTA 5L3QA 4JV5B 1NVXQ 3IXLA 2PRJA 1N3IA 2IYOA 3E9CA 3PFFA 4G0PA 2AEJA 3KSMA 5HGJA 5JZOA 4QPJC 3WR5A 4X95A 4UVDA 5SYNA 1KVQA 1KMHB 1X9HA 2LRHA 5GONB 3RYIB 1H9CA 4KDRA 3GUVA 2HQRA 4F92B 2OK7A 3C3CA 1YZVA 3LU1A 2FHPA 4LY6A 2EIHA 5FTJA 4ER6A 2DHDA 3RBAA 3FZYA 3CYFA 5JC1A 1TVCA 7MHTA 3K9NA 2O8CB 5TC4A 3NBZC 2OXRA 4KQCA 1W75A 4HZUA 5CFPA 4KPEC 3FM9A 2RHWA 1NR5A 4FFPA 3CW8X 1SXJE 1W2GA 1YQEA 5LWHA 2X0RA 1DO8A 4QUJA 1ISRA 1Z74A 4DG9A 1WXXA 4ZQIA 2WM3A 4ENVA 3WIBA 2O8BB 4M0PA 2J9FB 4M88A 2E4ZA 4RLSA 1U9ZA 3T1OA 2O2SA 5JALA 1K0UA 1ND6A 5FTNA 5KYUB 3GLHA 2UUPA 4WESB 1VBFA 2CDCA 3KYDB 4RK6A 1T2VA 5DB4A 5FOUA 1MB4A 2IYLD 3EXFB 1R6TA 5B1DA 4K2AA 3OM8A 2E5WA 1M2KA 2RHMA 3VNAA 2QIPA 1OSNA 4RFLA 3AZPA 1USWA 1RCUA 2HU2A 5BVHB 3BRWA 3WGLA 1G8KA 2FK8A 2IYUA 4QU0A 3RS8A 3ZNQA 1CCWA 4YCAA 2Y0PA 4TS9A 5D5QA 3UTCA 1A7UA 3LUKA 3W7VA 1TYDE 4CMCA 2O8EA 2WVHA 1L3CA 2GCIA 3LMKA 4ZV7A 1LLCA 4QBHA 3GLTA 5FWXA 1AMOA 3VYWA 3SXUB 4YP5A 4YAOA 5CVCA 2Z3ZA 3AIMA 3LOPA 4LJLA 3QX3A 4DR1B 1SBZA 4KRFA 1BHO1 1TVKB 4HR7A 4K9RA 1C7JA 1ZQ1A 1PE0A 1W96A 4W5WA 4CV2A 3OQOA 2J9RA 2QTLA 1RRGA 1MR3F 4ZPJA 1NPTO 1XZDA 1SVUA 4LHWA 3PJDA 1JDVA 4JSRA 2B4RO 3U56A 2FPIA 1MMFB 2CLOB 5F73A 5KPJA 3IDZA 3VHLB 3KSUA 1L8QA 1EWRA 1VGQA 4GPD1 2OLJA 5F33A 4YUYA 3P9NA 3LHFA 1E7YA 1HDRA 5KYVA 5K2MA 4XWOA 1ZMOA 4DV5B 2IYAA 5K01A 3KQWA 5CB6A 1Z4MA 3RASA 1PQUA 4JKYA 4MKXA 2XCUA 3KLPX 4GUDA 3ZLBA 2YIDA 4FJ0A 2J3IA 3ZHRA 3ISJA 2D5BA 1JQEA 4WKOA 2BTQB 4G41A 2WNIA 1NBMD 4NFHA 4ZO6A 4K9PA 1YDGA 3MWDA 4KIFA 2X22A 3NHZA 1ZAYA 1K97A 1B23P 4DY6A 1KDYA 2B4AA 3ETHA 4AI6A 2JGIA 3GRVA 3EC7A 3PCTA 3ZU3A 3G2QA 1JDJA 2P0AA 3P9PA 4I4LA 4JX9A 1LPPA 2AG8A 2H4FA 4RM3A 4FT2A 2XEXA 4N18A 3RTBA 3ZY2A 4B85A 3ZGLA 1YS6A 5BT9A 4HNTA 4ZOLA 1N2JA 2XMBA 5TQ0B 4GHWA 1NQXA 3KX2A 3MOGA 1YJAA 3RVRA 4F2GA 2P27A 6CHYA 1CJMA 1AJEA 2WIBA 5DHPA 2Q41A 1EXNA 4B3GA 2PIDA 3KD3A 4UE2A 2HDOA 3PP8A 4R81A 3GAFA 5ALZA 5LLSA 3RVMA 3S1SA 4HUTA 1LUAA 1QH1B 3PU6A 1ITZA 3ML1A 3BKWA 5CAEA 1K75A 4A8JC 4ZPXA 1IDOA 4ZYLA 2GBLC 3H1EA 4ZCSA 3EG9B 3VTAA 2EZUA 2IBMA 4IQFA 4DEVA 3LXMA 5HKLA 3DZJA 4JT8A 2FWMX 4RIIA 2OY0A 1XMPA 2CBZA 3M82A 4PC1A 1NJ8A 3UXMA 2XI4A 1KBOA 4EUNA 5EIBC 1DEOA 4GX5A 3KNZA 4Q93A 1U3TA 3K70C 3L5OA 3WDKA 2CUNA 3MIZA 4UNPA 3COZA 2VUIB 2WINI 3CZQA 3EJWA 1A7JA 2HMTA 4FC6A 1RM4A 3UUFA 4D5EA 2XBMA 3K5HA 5U9CA 5K0LA 2GO1A 1FFHA 3E1GA 3H8SA 4JVNA 1VL6A 1I0IA 1TCVA 4JEHA 1P2TA 1JFFB 1XTKA 5TJ9A 4A0FA 3HEAA 2XITA 4ZV4A 2IDJA 3EBPA 1C0PA 2GKGA 3DVAB 1HZJA 3C14C 3PNSA 1DWQA 4TLBA 1R8SA 2C4NA 1M2EA 3LP6A 1A4IA 1IBMB 2D7CA 4CQLB 3MT7A 3OF5A 4JT4A 1QHFA 3DMRA 5B4TA 1QM5A 3HZHA 3AFOA 1BMFD 1YFZA 3DDCA 4LGYA 5IKOA 3ADCA 3DBIA 3HSKA 2WKRA 4KFTA 4QYSA 2X8JB 4XARA 2NADA 2P9BA 4OBEA 1YUBA 2QM8A 4G9GA 1UBCA 4GP6A 4LF8B 1N9ZA 4BQQA 3L2OB 4E2ZA 3U4QB 2H1FA 3KCNA 1D1QA 4YCNA 1EVQA 2X2PA 5A03A 3SD7A 5LD2B 1SBYA 3PRHA 5M5BA 4US0R 2I2XB 2C1XA 2V9ZA 3OETA 1EH5A 4Z4EA 1JDBB 2A67A 2ZBDA 3Q8KA 1NOJA 2JF0A 3PJRA 5CNKA 5DYWA 2RI0A 3D0KA 3FVWA 1MU0A 2JIZD 1PJ8A 3QY0A 1FDVA 3F7OA 3HUEA 4IIXA 2JA2A 5E4JA 4PV7A 4U3JA 4X94A 4AMZA 2I3DA 3M9WA 3O4HA 5HS6A 2F4NA 1GCAA 2RMKA 2QLTA 3QOWA 4ZDWA 1EVIA 1UOOA 2CMFA 2VJKA 3FX2A 5B4VA 4PTLA 2VUUA 3F46A 5IH3A 1YASA 3L7IA 4EUHA 1OH7A 2IHNA 2D54A 2IHZA 3NCTA 5BSFA 2FETA 3H97A 4TL6A 4GKJB 2PUDA 3L8YA 4UDYX 3TINA 1NDHA 3G3EA 4TXJA 1U3GA 4NYJQ 2BHRA 1B6GA 3A1WA 3BRQA 2YW2A 1EM6A 5AUQA 5AQEA 5TY0A 1CETA 4S1NA 3WP0A 2ACKA 4UD6A 4D0NA 3REFA 2ZZMA 3ZOZA 1GQ2A 5BN1A 3K2QA 3SSMA 4JB8A 5FUVA 3ZDXB 3ZVMA 3PA6A 3EGCA 2FCAA 3HXLA 1PEKE 3I32A 3OFND 3A9RA 3UCEA 3QXCA 4IF4A 2GKSA 4DWVA 2VNAA 4GSKA 1Q5PA 2A1IA 1C3OB 4BP8A 5HQ3A 4ZEMA 1GDTA 2WWFA 4PO9A 3NC4A 3I2JA 1UPFA 2NU6B 1OBFO 5CFMA 5DYGA 1WMAA 1UT5A 1YZLA 1ZIXA 2CCJA 3FPLA 1Y1QA 2HUPA 3MWGA 1PJLA 4R9VA 2REOA 3O91A 3V8EA 4D25A 4L5AA 1XEFA 3QG1A 3CRNA 3DBRA 2ODWA 2H92A 1XR3A 2OZPA 3GFRA 1W1UA 3IEKA 4JC0A 4FOLA 5H02A 4LDAA 1QGOA 3ITKA 5KTNA 3ZEIA 5EWMA 2ETXA 2X0EA 4FYWA 2JK0A 4L9AA 4DLBA 2VTKA 4KQEA 2MOKA 1G5TA 2Y0BA 4H60A 4B3FX 3T0FA 16PKA 4D9MA 4NYMR 4MUJA 5JDCA 3K0CC 1MEEA 2YVUA 2WJHA 1L5GB 3T52A 4INPA 4M49A 4QYMA 2SKCA 1U8FO 6REQB 2ZQ5A 5CURA 4UASA 4JEMA 1CLUA 3E5NA 5FWAA 4MZDA 5GVRA 5F77A 4BWFB 4DJEC 2ORIA 3MJEA 2AS0A 3FLAA 3KKPA 3SDZA 2WM2A 3STVA 4LF4B 5E1MA 4YLGA 1Q0PA 3HKCB 2D00A 3C1OA 3VKWA 4B82A 1OZAA 5KHAA 1KY4A 3KR2A 4XUCA 1NYQA 4BZQA 4O8CA 1T9DA 1CJTC 2C9MA 2BMWA 3LNCA 2ID8A 2PWZA 3IAFA 1C7EA 2J7PA 4W7SA 5C37A 4DRYA 2JLXA 3TIIA 1QU3A 2X19A 3BCSA 5KSWB 2FP3A 2X7XA 3MOSA 4L74A 2RJOA 3SLKA 2CNDA 2ONKA 1SZJG 4MQ4A 2W4MA 3P0JA 2Q0QA 4LYJA 3U3XA 1HE8B 1ZXLA 4L8LA 3O8QA 1FSPA 1L7PA 4EPXA 1L7BA 2BZSA 3NALA 5I7UA 1C81A 2JS7A 1ZJ6A 1F0YA 3O7WA 3L7LA 3BSFA 2IW3A 4TXNA 1TJYA 2IKSA 1E20A 3EPRA 1ECGA 1JR2A 3A4YA 3IV6A 3OQIB 4JUIA 1A9SA 1BDIA 4ESHA 2HDNB 1NF2A 3IMFA 4ZAYA 3QKRA 1JV2B 2O6LA 2O2HA 5FL7D 2GM9A 4ECEA 5F1OA 2B5OA 1XHLA 1J8VA 1ZKDA 5TXGA 2CHGA 2HK6A 5DEIA 1XD8A 2AXPA 3GEEA 2JPDA 1V6SA 2H2DA 3NORA 1P2GA 4KQGA 3T7IA 3TVYA 2Y4NA 3X1KA 3T9AA 4N12A 2C84A 5IW8A 4E22A 1WXWA 1NNSA 3ZU4A 2ZJ8A 1GO2A 3OQVA 4QOSA 3ROQA 1M1NB 1PK9A 5EGSA 3UY4A 3YASA 4ZMSA 9LDBA 3Q98A 1I13A 3GD7A 3O2JA 3OTQA 4YRSA 1AF7A 2IKQA 1F8UA 3KBOA 4WLOA 4R71A 4HDRA 2Y77A 4AN4A 3DUFB 1N6RA 1EGQA 3AUYA 4P53A 1K7CA 2HLHA 3N0VA 5CM2Z 1SIOA 3NVKI 2EP7A 2FEXA 3CB2A 2RD2A 1PAUA 1Z7YA 5LLDA 3DAHA 3NNNA 2TS1A 3INYA 4X24A 2C31A 3H0EA 3UOWA 2O8FB 3G8DA 2R8YA 3RK4A 4BVAA 5T8KC 5CB4A 1YUMA 5ADUS 5J4KA 5JMOA 4REOA 1FX0B 5F9MA 4IRUB 1I7PA 1B6RA 1IHDA 1CKEA 3QNWA 1IQUA 2WLSA 4Q3DA 4MO2A 1VKOA 3G2JA 4IGEA 3BMOB 2CMHA 2EZ9A 3RVJA 4YBZA 4LK2A 5IDVA 1TT5B 3S6JA 2ZATA 3B13B 1Z7WA 1L7NA 5DBOA 3HA2A 1UJMA 2QVXX 3FNHA 5TJHA 2YICA 4PYIA 4MI9A 2V7UA 2BYTA 3DGFC 1STOA 1N4DA 3F5DA 3N3BC 4KQXA 3WLAA 1JNXX 2JD2A 2VDVE 2FR8A 3GDGA 5EPUA 2PJZA 2HMVA 4GPAA 4OGKA 1QH8B 3OMXA 4TKUB 3ND9A 1Z4OA 1GKLA 2R7NA 3B82A 3C5WP 3DV0B 4WI1A 2ZEJA 1Q21A 3G2PA 2O6HA 1CY0A 3P0RA 3CVXA 4DDTA 1O0CA 2NO9A 3EZGA 1R0LA 1QVWA 3N2KA 3N74A 4NEHB 4D0LB 1HA3A 3GFOA 4DY4A 3NTVA 1L7QA 5KOHA 1N34B 4BN4A 1D6SA 3WA6A 4YLEA 1ZGCA 4C01A 1K66A 4R6WA 5ILOA 4OHYA 3VVCA 1UINA 1TFRA 3BULA 1CNFA 3N2IA 5AW4A 1L3IA 3MMPA 3C3MA 2DUWA 4O4IA 1U8XX 4C7OB 2ZI3A 3E03A 3HNOA 5AJZA 1N4AA 3FHTA 2ZANA 3TKYA 1L5ZA 1E4EA 4Y6GB 4FHGA 3RC2A 4OLAA 4OHUA 4DLNA 1DQYA 5J23A 2NZXA 3EFHA 4FHFA 1J9EA 1RBQA 1S8AA 2ZOSA 4DAOA 1ZCBA 1TI7A 1WMBA 1SUFA 2CEKA 2SKEA 1A9YA 4HNQA 3B51X 2DLNA 4MR8B 5CJJA 5AJYA 1H2EA 4RF3A 3S1AA 4Q1EA 1NC3A 1FXSA 1UBEA 1E4VA 1JJVA 1AK2A 1OROA 2ZLBA 4QYWA 1JPJA 5AJHA 2QRMA 4DXHA 1EIWA 3RC3A 5DSXA 2XV1A 3TQFA 1VG1A 1DJQA 3IP1A 3PXAA 2WBLC 1V5IA 2QY9A 1IEVA 5AM2A 4RJJA 1RD4A 3ZXIA 4FYKA 4Z3OA 2C94A 1J1ZA 2BFDB 1JDNA 2V6IA 2OLKA 3FBGA 3HYCA 1HE3A 3GRKA 3EYWA 3PR1A 3K05A 3M89A 4RZ3A 5GJCA 2A88A 2VQDA 5JZBA 1JBEA 1Y5NA 3E5MA 5HYVA 1MF7A 2J30A 3QVGA 4HLUC 1W8DA 4YJ2F 1HQKA 1UMKA 1YI0A 1R3UA 2HUNA 2AR9A 2IUFA 2NXJA 2O3UA 5EMMA 1GXSA 3HSSA 1E9VA 3WLMA 1LS1A 2I8AA 3DOUA 3IPRA 3PEUA 4YMSA 5L3ZA 3TKAA 4B9AA 3FSGA 3BICA 4BTLA 3N9IA 3I4LA 3OKCA 4ZANA 2PX3A 2YN2A 1EUDB 4L0MA 4TS1A 1ND5A 2DFPA 1BA2A 2WKSA 4OMUA 2GPSA 3CVOA 3LPCA 3NKVA 1PX0A 2ZJAA 1EINA 1N2ZA 3NOXA 4LBZA 1QC5A 4J0IA 1F6BA 3ZDRA 3KL4A 4MGIR 5KQRA 2B8TA 4NESA 1SIWA 5EZSA 1FP4A 3E3OA 1PJTA 2WFZA 1YRLA 5HWSA 3KKLA 3RC8A 3JAKB 5F1PA 5BV8A 1IU9A 1UWCA 2H4JA 3IESA 4XQEA 5KVVA 2YH2A 1UP6A 2D4AA 1EDEA 4FE4A 2DQSA 4II2A 4F84A 1A5BB 5B7GA 5JZVA 1QTNA 3JATA 3L8DA 4X1IB 1L4MA 1OWPA 1Q84A 1Q1NA 1VXOA 2QT1A 3K8QA 2ODBA 2JGDA 1FP6A 1Y7IA 4I55B 2Q1SA 2VQEB 4N8DA 1IWBB 2E87A 3CN7A 3OPMA 2X4LA 1Q17A 4FR2A 3DWEX 1U7ZA 3QA3E 3C4QA 2PCLA 3FCUB 4FUTA 1OZHA 1W5SA 1OB2A 2P5SA 2O7SA 1K9SA 3CUWA 4UVGA 4IV5A 1FMJA 2JATA 4RHEA 4UXJA 1N9GB 1P5HA 4BFVA 1ZM2A 3GZNA 4ZIRA 5JD4A 1U6IA 2W0SA 4RQAA 1QJ4A 2PH7A 2RIRA 1WXHA 4OHPA 3SEZA 2QR5A 4ETWA 1E61A 2A33A 4PBTA 2MYTA 4Y8VA 2Q7XA 1V7PC 2JDIA 4TLDA 4M83A 3WQHA 5LYJA 1VYTA 1PHRA 1PDVA 1B6TA 2I5PO 2R7LA 3D0QA 1J8MF 1KIFA 3Q7QA 2YWCA 3WB2A 3Q41A 3M6LA 2BDEA 4N0PA 2AC7A 4BV2A 3MINB 2WSIA 3IAEA 4EA7A 4WCFA 1A8IA 2VCYA 2D8AA 2BBTA 1BFKA 2GEVA 1V3QE 5HX7A 5G1NA 1IWPB 1I24A 3D2BA 3P9QA 3AOGA 3TAHA 4JVMA 1LD3A 5JPDA 3A4TA 3V9AA 3FWZA 3AF6A 3WMFA 3SN6A 1FYXA 3T5DA 1ZRHA 2QPTA 3S2FA 1NU6A 4Q3NA 1N57A 2IP1A 3GCXA 4B6JA 4F7WA 1EFAA 2X4GA 2FPMA 4X3OA 3MBKA 3H7IA 3ZZ1A 3R5KA 1FPMA 1NY5A 5DLDA 4ZJUA 621PA 3RJZA 4QU9A 1WCIA 3B89A 3QGMA 5GJVC 1E3TA 2IYQA 2BRUA 2XE6A 5A0TA 2VWQA 4EI9A 1JHUA 5BNTA 1R88A 1CQXA 5KTOA 3ZDBA 3AF4A 3O8OA 1XPUA 2R96A 3L1VA 1OIXA 4U6QA 3DM5A 3GRRA 4KO8A 3TQCA 1ZDMA 5GZ1A 1KERA 3TOSA 1NZJA 2HCBA 5JVDB 3MUNA 3ODPA 5EP1A 1B8PA 1JU3A 1OC2A 3ES9A 4QIHA 1EB9A 2EZTA 3M6IA 3U9LA 2X76A 3G0DA 4FN4A 3I5UA 4JAVC 4AJ4A 1VL8A 4BPBA 3P2IA 4LOKA 2Q5OA 1B0PA 1SOVA 1TTPB 1PYOA 2IXFA 3UGJA 4Q18A 5KNLA 4BNDA 1H2HA 2A5FA 4JODA 4CKBA 3UC5A 5LZ9A 3QE4A 3VR1A 4DM7A 1UPXA 1IN4A 3B5EA 3QJ5A 3ZDZB 1WD5A 2GB4A 2ISCA 4OJMX 3VZSA 1B6SA 1ENYA 4MW2A 1NM5C 1T8SA 5F98A 3AKDA 1CJKC 3E9MA 3SYMA 2RGBA 1CQZA 2I3AA 1GSHA 1UR5A 1LPSA 4FOOA 1Y1SA 3MRXA 1OF1A 4L16A 4WOBA 3MGAA 1VPEA 4FDMA 1IPFA 3IMGA 1OD6A 3IFSA 3JVVA 4G0XA 4O5OA 3WSWA 4EW1A 3QW2A 1E60A 1I2BA 2Q2OA 4B2PA 4BZXA 4OIMA 4RK0A 2IUYA 2WPNA 4FCCA 5BRNA 4D46A 2H48A 4KVGA 4L72A 3RVQA 5HDQA 3THXA 4KQHA 1Z33A 4ETIA 4DDVA 3ZU5A 3L7KA 1IQ0A 4QUBA 2WUFA 3QITA 1ZM7A 3GG9A 5C3MA 5DMXA 3P19A 3WWZA 2EIXA 3VHXA 3N2GA 3JD3A 1M0SA 2BBOA 1KBZA 3ANLA 3RUFA 4BZPA 3D4NA 4XPIA 4IW3B 4MS4B 4C0WA 9GPBA 4EX7A 5BVGB 3FCOA 3IT1A 3WL3A 4BEJA 4M21A 3RRJA 2HA5A 2NVOA 2FRVA 4LXGA 3WICA 3PFWO 5B2EA 2XA2A 2BKXA 2OQRA 1Q7EA 4R69A 1XD2B 5ERYA 2WHYA 3L6EA 3HXKA 3KEGA 2XUGA 1L0BA 4RCYA 4FDAA 2Z98A 1KH1A 5DLYA 2WNHA 4GBMA 1YR2A 3EVCA 4TTIA 3EXIB 3FYUC 3OCJA 4HMPA 2PGJA 4U8GA 3SYRA 1CJSA 6NULA 4UCXA 2IV2X 4BXOA 3FPFA 3B5JA 1KJZA 4AZ0B 4FEYA 3UMRA 4DSAA 2C7PA 2Q5QA 3DZGA 1WO8A 1ZINA 4IX1A 2XKKA 4QQNA 2PMWB 1WMEA 3LA8A 4NICA 1TUIA 4R83A 1OYWA 1Q16A 3Q9UA 1H2XA 5DNWA 1LNSA 4E1BA 1SQFA 1PR9A 4AMGA 1KFJB 3ADOA 4LA4A 5K5EA 4FYMA 3VJKA 2XSZA 3Q1LA 3RKRA 2ZP1A 1RT9A 4OQQA 2QX7A 1KOLA 1PUJA 4DBLC 4DRZA 4JVOA 1UC9A 4MUGA 4TRRA 3MJTA 3QF7A 3IQZA 4FS8A 4KDEA 3WLPA 1T43A 2H16A 4OP2A 2FA9A 4IWYA 3RHSA 3T7AA 1P33A 2BTOA 2GTPA 3K15A 3IUQA 1JHOA 1XTBA 3MUEA 3OX3A 4H7EA 3ZCVA 3D7KA 2Q5CA 3N59A 4F85A 5DYTA 3WNCA 4FBMA 3AR8A 3ENZA 5I7WA 1IVSA 3INRA 3OX4A 4WDRA 3A1EA 3AC0A 3CFYA 4YJ2B 1AN9A 5D00A 3UFXA 4E7PA 5JROA 3L4JA 3L18A 2DETA 2BN4A 2HFJA 3PKIA 4V0SA 5JAQA 2CUKA 2QPOA 3QXJA 1QVVA 2VSNA 5F52A 9ABPA 4YHHB 4E1AA 1WB5A 5TIIA 2BJHA 4AWAA 4O4HF 2VYQA 4OUDA 4YRPA 5GPBA 2NZVG 4F91B 5DNYB 1G19A 2GLXA 1GVHA 5DGDA 3SVZA 3VH2A 2A9RA 2JJ2D 3GGGA 4PSUA 5BN4B 2F3RA 5JSFA 1NP7A 5EKDA 1KMNA 1U4OA 2GASA 2ONYA 3L7YA 5F5XA 1TM1E 2HLNA 5KNBA 4TSRA 4E5VA 1NP6A 2CWDA 3CX6A 5K8CA 5BRJA 3ANSA 1EGMB 1EGHA 1ACJA 3VUFA 3GC6A 1MXFA 5GMOA 3ZNNA 5KWEA 4HHEA 4F72A 1P60A 5IUNC 2JI8A 3OEHA 5DNEA 3ICOA 3F71A 3U19A 1QHXA 5J2UF 3P0HA 4L2IA 5AM3A 1I7QB 1RW4A 3M5CA 4U2KA 4KKVA 2OYRA 1Y6QA 3HY4A 4UU7A 3TLXA 2G17A 2BD0A 5A3SA 1WR8A 1XCLA 3JPWA 4AJ2A 3DNFA 4P54A 3P9XA 2R6JA 1XL1A 1CUGA 1RVV1 3FR7A 3V8MA 1H8HA 4IGAA 2W70A 4TVOA 5DV9A 5H68A 1IXYA 4YLYA 1XAIA 1DIBA 3F7MA 4GMFA 5HQTA 2GVZC 1NN1A 2WEKA 1CNMA 3H5IA 3I05A 4NFLA 1WDKA 1PFWA 4N40A 5AW8A 4UATA 3LO8A 5EHXA 1BHSA 1JHZA 1I6KA 1WZNA 4NJMB 1SIBE 1JDTA 1O5OA 3FBTA 3VAZA 1S02A 4DDMA 4ZTBA 4ZCQA 3EBOA 4W8OA 3TNFA 3VU0A 4AYWA 1RLJA 1FY2A 4Z2YA 2J33A 2VHVA 3KVYA 4HH0A 1G5RA 1FP7A 2J6HA 4MAMA 3BGSA 1C7RA 3EDOA 4KC0A 4WASA 4CJXA 3C48A 5BV7A 5IVHA 4BQEA 1LV8A 2R751 1C2YA 2WP8J 2BV3A 4YRQA 2D5LA 5E6UA 1CF2O 2PBRA 1VM6A 2XHEA 1SBTA 1TYAE 1GSOA 4TT8A 3BGDA 3TD2A 3U39A 5JR3A 4FGJA 2ERXA 5ALLA 5EHQA 5K8TA 1WY5A 2ONCA 1G5PA 2XZLA 3D3NA 3DKPA 4PWZA 4W99A 1MVOA 3TDKA 3E9ZA 5C4MA 2G1PA 4EW2A 2O7NA 2R3SA 2P8SA 4O29A 4QLAA 3WB0A 4HT3B 4WY8A 3A11A 4UW9A 5KNCA 1R7RA 4BNUA 4OFZA 3ZDAA 4DMHA 1JI3A 1WULS 1E6WA 1RCFA 1JUDA 2PZBA 2K7FA 3CKLA 2JJ1A 3AGQA 4LMAA 3AERA 3IQEA 3JWEA 3W05A 4D56A 2QUZA 1RADA 3GF4A 3QM1A 3HGMA 5E1BA 1R4NB 5H83A 3NOOA 2NW6A 2CHEA 3D2LA 1F9AA 4MK4A 4RMJA 1HDCA 1ZZGA 1OXBB 4KO2S 1UJCA 2Q3LA 3QYAA 1FSZA 3OQHA 4LC1A 3N0TA 4Q16A 4TV9B 4ZI7B 2C5LA 1N0IA 2HJGA 3ZHQA 4DUPA 3PNBA 4EJFA 2BEWB 2FMHA 3ONEA 2ZXUA 1OW3B 1W29A 3WLLA 3COJA 3BMCA 3D3QA 4PLPA 1CULC 3NAQA 2NG1A 3K2BA 1KJ8A 4K9DA 5CVJA 3QBEA 5E6SA 3AVVA 3UK2A 3HHPA 2R00C 4FBGA 4NI5A 2O8DA 1JAXA 1CS4C 1K92A 4QBTA 2P4QA 2PAFA 2QIOA 2ZB4A 3IUMA 2ZITA 3PITA 5AKZA 1X1CA 5HUJA 4WTOA 4RD6A 3SOZA 3A3KA 1ODTC 2IIQA 3V7UA 2OBXA 5IKXA 2C78A 2PY6A 2ZI6A 4ZWNA 4K1LA 4U7DA 1Q57A 1A95A 1BVRA 3P2YA 5TS2A 3W77A 1TMGE 3U17A 4HN4B 1WHSA 2CJFA 2YIVX 5KWIA 1NKVA 1WUYA 2BHTA 2VZEA 4FSHA 4KXUA 4LPKA 2PUEA 4P4GA 1NURA 2REQA 3STWA 2X4IA 3GB9A 4Z0HO 1V4BA 5HK9A 2I4RA 3F73A 3K1JA 4U6NA 4JXZA 3AUXA 4L3OA 4GBJA 4GMDA 1DRJA 1QGUB 3KQUA 2ZTMA 3WK7A 5A5FA 4AQYB 2I6SA 3MGKA 2ZYGA 3TE6A 3NNSA 3DAYA 3FDFA 5CX1B 3DGEC 2FX3A 1Z82A 2H51A 3B3FA 3FPGA 3B36A 4QGAA 4QUHA 5DHAA 1LFAA 3TW8B 3MMXA 4TL9A 2FUCA 1QVAA 3ZNOA 1XZIA 4S1VA 4ZVPA 1MJNA 3PV0A 2ZTSA 4ZZ2A 3DEHA 2HRBA 3RVSA 4AM8A 3BEDA 4CG0A 2WTUA 5G0TA 2P77A 4B35A 2AJDA 4UTXA 1NUHA 2X77A 3IHWA 3JQAB 1PJBA 5AOVA 5EP3A 3S70A 1Y8RA 3IUJA 5G41A 4BB0A 5HIKA 1I7SB 2YVLA 1YKGA 4OQLA 4H2DA 1W6RA 4A1OA 3J7AC 3NDRA 1L3BA 5F9HA 4MWDA 3DE1X 4CMGA 1E2MA 2YINC 3BXPA 2J3DA 5TPWB 4WZBB 2QM7A 4D8TA 3QU4A 4C3VA 3W8RA 3P2KA 1D6JA 2C7VA 2OV4A 2DBQA 2OXIA 2E4UA 3CUEF 5TT0A 3TXAA 1UM9A 3WHKA 2D59A 4COKA 2Q3BA 1TXGA 1ZR2A 1JKFA 1PR0A 3DL2A 3F5QA 1N2BA 3EULA 1T8UA 3KELA 2PD6A 1P9RA 2RKOA 2PH3A 4Q1FA 4UCQA 1NVTA 1F8YA 4HQRA 4KOEC 1J42A 1W4AA 4TL8A 1ZCFA 1TCUA 1EJ2A 2R68A 1L9XA 1NSTA 2YMLA 5F12A 2ZIFA 3SBXA 4XFDA 3NC1C 5KWSA 3CLKA 4F3RA 1IZZA 1H6CA 1NIJA 3V33A 3H9EO 3LHSA 4BX0A 2OO3A 4NHEA 1R0CA 2PA3A 3REOA 5HE8A 3H1TA 3GU3A 3ZQ6A 3CUKA 1Y9AA 1ZN8A 4I5DA 3WYAA 1JG4A 1NFRA 2JEOA 3B60A 3LRPA 2BEUB 3EGXB 1EVKA 3LDHA 4CFZA 3EIWA 4R3UC 4F7DA 1E8DA 2HA2A 2V8OA 3M1YA 3MSCA 1LGYA 4HAUA 4EHHA 2Y05A 3PEWA 2G1KA 4RELA 3RTEA 1ZITA 4Y2GA 1IY9A 5JJIA 4LCEA 2FPPA 3FSRA 2LNDA 2A30A 2QN7A 1MVLA 3JQBA 8ADHA 5JS2A 1GYRA 2ZVQX 4YRCA 2ZBQA 3PUVA 4EPWA 3QTLA 3Q8LA 2E82A 3B1VA 4M1WA 1XJ5A 4ZEOA 5T67A 4QOHA 4LY0A 1M6VB 3EWSA 2ZDHA 1QDLB 2P0EA 2VDNB 3LL4A 4Z7NB 3GLQA 1D6NA 1SXJC 3K16A 3IUYA 3QKSA 4GI2A 4OHXA 4QUKA 3IQXA 2FOXA 2W6ID 2WIDA 2Z2JA 2VTBB 1AK1A 1MVNA 4PS0A 1LDMA 1TU4A 2WAOA 2Z2KA 2CCGA 2IXAA 1G63A 3L6UA 3R20A 1ZOLA 4MQBA 3VPXA 4F0JA 1OQAA 3FOAA 3NM4A 2WFLB 3KJFA 4GPEA 2E85A 5I51A 3LYLA 4IIUA 3O93A 3D4PA 3O7MA 5CEEA 5LIRA 4U2DA 1UQRA 1RZ3A 1PJSA 1DRVA 1XVVA 1ULZA 5C53B 3WISA 2HO4A 1GPUA 4V38A 5AP9A 1J5XA 3NHFA 1LZKA 2HJVA 3BXHA 3TTSA 3V2IA 2L42A 1PV4A 4RIGA 1RM5A 4ZU3A 4IDNA 1L7MA 4MPJA 3IBSA 4HQLA 5HILA 1PP4A 3ULKA 4BGEA 1JTFA 1TB4A 3IMCA 5KOIA 1GQFA 1WKCA 4OHCA 3V6LA 4HNUA 1RWKA 3PRKE 4GO1A 1EA5A 5P8WA 3MERA 4J75A 3I37X 4LEIA 2QTMA 2GK7A 2QRKA 2PUHA 2XECA 3ZE7A 1Y82A 5FAKA 5LLTA 3LTNC 1FFYA 4LF6B 2MHCA 1QG2A 3ZCUA 1CS0A 1W5FA 2NIPA 1MQSA 4CM9D 1X7ZB 4PN7A 1PDOA 3EW7A 1FRQA 4M46A 2PLWA 4I1RA 3UJNA 1GUFA 4EG6A 1O97D 3FMIA 4QJBA 3R3UA 4R1PA 3ZOKA 1Z38A 3SNKA 1Q0TA 5DX0A 1BWRA 5KJCA 5HM6A 4NV0A 2WU1A 1WL8A 3CJRA 2C5AA 1FQJA 2GSWA 3NHLA 2G0TA 4PYMA 3W5BA 3T7SA 2BMDA 5BNIA 3ELBA 3E53A 4KN9S 1CUIA 3D8NA 1OH8A 2C7RA 3KVOA 2GPAA 1WSAA 2C8LA 3EC1A 1P81A 2HXSA 1XZPA 2OXTA 4G4JA 2IXGA 4AO8A 1ZJ4A 3S8YA 2XDQB 2FQQA 4B31A 4MWGA 2P9JA 4WDQA 4C4ZA 1G1AA 3FOCA 1U31A 5J4VA 3DDNA 2Z1DA 3CSUA 5GZ6A 4FZVA 1CZUA 2PS9A 4DE5A 3SM9A 1ZI6A 1J1UA 2J45A 1KMHA 1R8XA 5GONA 4BVGA 4EHDA 5C80A 5CCEA 1JJIA 1J00A 4DNQA 3W5AA 4HEA1 2HFKA 1V37A 2RJNA 3ICVA 4QTTB 5FXMA 2B2NA 2VP3A 5L9AA 3O75A 3GMDA 3W2FA 5BO5A 5LP6C 5AI0A 4B3HA 4BX3A 1WDLA 4CBVA 4Z4HA 2VBCA 3Q5EA 4MW1A 5HBGA 4PC7A 4YJGA 1UPBA 1L6IA 4FFDA 1NT2A 3AR7A 4HWPA 4GM4A 1XAHA 2ZSIA 4IGKA 3TIGA 4A8HA 3L7OA 2I1WA 1ZKMA 4AQ7A 2UVPA 2FI1A 2HEGA 1OX4B 2R7MA 4JKIA 4JUDX 2CMKA 4CEJB 2OFPA 2H57A 3A8TA 2NPOA 4MRMB 2O8BA 3EVFA 1KY2A 2J9FA 2LIVA 4KPUB 1WQ1R 2PUJA 2G0NA 2FFHA 4S0XA 5JNVA 4AWXA 5JQWA 3OUTA 2I8CA 3F6RA 1GGVA 3QUBA 4MQEB 4WESA 4ALLA 2VQSA 2FQWA 1MFPA 2HZ7A 4C6TA 2GZ3A 3EXFA 2XRYA 4AW9A 3TDNA 4A27A 2JFHA 1VE3A 4PC3A 4XIFA 2EU8A 3UWSA 4Z54A 3CTMA 4OYLA 2NAFA 1KKUA 1BOFA 1RXIA 4FDLA 1DT3A 4IIJB 1EE2A 5CNJA 3RSQA 4JQZA 4GX0A 2I62A 4NWIA 3ADKA 2WWYA 1TVKA 4MDEA 2FRDC 3HR7A 4KR9A 4FWTA 2LXNA 3PUHA 4W5TA 1SULA 1ZISA 4RK5A 3SIXA 3VZRA 1L4HA 1OMOA 3H2KA 3NIBA 5K4HA 4UPDA 3HRKA 3R23A 4WPGA 4NFSA 4OK3A 4ID3A 1SVKA 1V5WA 2XE7A 3KKEA 1UKEA 2B1GA 1NNLA 1GILA 1QO7A 1KZ4A 3PC8C 3RSCA 1NMSA 1OUMA 1Z15A 1O6ZA 2BLNA 3BWBA 5J1TB 1JMVA 2QRUA 4BO5A 6YASA 4BJ5A 4X6XA 1IHXA 3SYNA 4AY3A 1E79D 1VLJA 5FLYA 4PG8A 1GZUA 4NBWA 4YEDA 4HLCA 2GJSA 2DR0A 5E9AA 4CIAA 2JFUA 4L4YA 3CH6A 5HJ2A 3W5UA 3VVLA 4E6PA 3ZGXA 3CVYA 4CTOA 3RS0A 4Q48A 3KLBA 4RXMA 4RVCA 4NKRA 1C0EA 1W5BA 2VF5X 3TMAA 3X1WA 3AU8A 4MVJP 4ECAA 1CEEA 5KYNA 3KM0A 2GESA 3IQFA 1KI2A 3FDJA 4LRYA 5EUMA 4BO8A 1ONBA 2I9PA 3MPUA 4IFBA 2CK3D 3OTGA 4MV9A 2OM6A 3E5HA 5AOCA 4X66B 4NMHA 2HPHA 1EWTA 3JCZA 4HNVA 1N2OA 1XA0A 1G7RA 2H7VA 4FI3C 3X2SA 3IHTA 4R7TA 4WECA 5LXTF 5FWYB 4YCBA 5D5PA 4G0OA 1IMJA 2P3QA 4ZJPA 4AG6A 2OHGA 2W6PA 2HMSA 2IOHA 2XQVA 1DTWB 4IH1A 1XD9A 3NIFB 1DL5A 2A0FA 3EOAI 4IDEA 4MUEA 4P0PB 3S2GA 1QH1A 2DYKA 4QDJA 3PPYA 5IVIA 4NCJA 3X43A 4F38A 1XNHA 2MJLA 2W6QA 3EG9A 4P86A 4ARAA 3M0EA 2K87A 4YXWD 1XDUA 3ASYA 2V8BA 3RRBA 4EHLA 3A70A 4D45A 4TS4A 4TZTA 1Q83A 1INLA 3MJHA 4GW3A 4MUMA 2I6XA 5DTIA 2VCHA 4S3MA 1U0SY 5F5NA 3R2JA 2A1TS 2E1PA 4L95C 4UUPA 1RYYA 1AUVA 3PHIA 4R1OA 1FCJA 3QFFA 3BA1A 1H2WA 2GCGA 3QE0A 2C0PA 4EHKA 3KEQA 4DHWA 1NGSA 1RQNA 2GN1A 5C8XA 5KDDA 1HRKA 3PC4A 3DT8A 4B71A 2JLAA 1C9YA 3VPCA 2ZJ2A 4DLSA 3OSZA 3T54A 4TZKA 3WIUA 2BAGA 3ITNA 1LI5A 3PGXA 3JR3A 4UEKA 4V24A 1MAVA 1J22A 1ENOA 2CVZA 3D7LA 3ZWAA 1IVYA 1XLTC 1TT7A 1EFPB 1Z13A 2CHUA 3JVUA 3UM9A 4JENA 3V46A 1JR3D 5E2IA 5K3FB 1CUSA 2EBFX 4G6ZA 4H16A 4UMDA 3IOMA 3INNA 3LQ4A 1VG9B 3JZFA 4HX5A 2H3HA 4MWZA 2ODPA 2PV0A 1DRUA 4NZOA 4P58A 3IVCA 4BNLA 2WSLA 3TH5A 3IBFA 2H7XA 4DBZA 1GPBA 1PF7E 1U7PA 5HZGA 1Y5IA 1P1FA 3DOCA 4DCOA 1V4NA 2ZJ1A 1C5KA 3T5GA 3TSCA 3X0DA 3ZR4B 1HNXB 1B0ZA 2B83A 1I30A 1X7HA 2PMBA 1R4AA 1Q95A 4PO1A 4XSGA 4BP1A 1P4SA 4CHTA 1GPDG 2FQYA 2WWHA 3FFAA 3KOXA 4K40A 3HZOA 1ZOOA 3IPLA 2VCEA 5FUWA 4YAWA 1P9OA 3EVAA 3JVIA 4I9NA 4DWJA 3H5RA 5IS2A 2WW8A 3BERA 3HKBA 3ITDA 3G2LA 3OLZA 4ER7A 1SHLA 2F59A 2Q8PA 4Q82A 2RC6A 2YYSA 1R00A 3MN1A 3R8XA 4A2PA 4PYJA 5CB8A 2IP4A 4XDZA 4LHSA 5KHLB 2H6EA 1TA4A 2CD7A 2R1TB 3WRYA 2ZBUA 3BZWA 5AHKA 3T3NA 4QO8A 1QBGA 3NBUA 5B12A 5CB0A 2OL4A 1OXVA 3LKZA 3Q0EA 3R0ZA 5EMHA 5EQTA 4F71A 2ZB3A 2JRCA 4QGSA 5LMNB 1BHQ1 1NN3A 4IOJA 5LUAA 4RX1A 5K0ZA 5JY6A 3FNBA 1F0KA 2IUTA 1YHYA 1TLTA 1WF6A 3T9EA 1XZCA 1S5PA 4ZRNA 4H17A 3LP5A 3WSVA 1PGNA 4EY8A 2OA0A 3QUSA 4ZD6A 5JATA 5JRJA 2FMFA 4RKWA 4B7AA 3Q3EA 4LF7B 3OT1B 4Y9DA 2JG3A 4DJDC 2WPDA 1K1EA 3PQDA 3AWIA 1VMAA 3FF4A 5F1KA 2FOIA 2E5FA 4PPQA 3GAZA 2FDXA 4JI1B 4B33A 1BS9A 2Z6UA 3PHHA 2VK2A 4Y1RB 1R8QA 2BFBA 3CZ4A 4E4TA 3BIOA 4XI9A 1F1BA 2GJ4A 4NG5A 3RU9A 1GT6A 3ODGA 1C3OA 2QLMA 1T0IA 1T3ZA 1CLEA 3GRUA 3EEFA 3I34X 5EERA 2VXBA 3N58A 4CIXA 3ET5A 4Q9LA 1RWNA 4JNKA 2NU6A 1DT5A 3TRIA 2AG6A 1KFEB 1ZNQO 1NF9A 2VUTA 3TOCA 2I6GA 2KJQA 2HHAA 1PIWA 2FN7A 2X2FA 2RGYA 2GO7A 3NPAA 4Q3EA 5DNCA 4IEEA 4CNQA 1MHTA 2HK9A 2P62A 2VDOB 3DTVD 3WLHA 4ARIA 1RACA 2DH5A 3C3KA 3EXEB 4XVHA 1WEKA 3QEJA 5HKBA 3DBVO 3LBIA 3G89A 1L4UA 3OFVA 1E1NA 1JQ3A 1UF9A 1QFXA 1P7WA 4EHBA 1BE6A 1WW8A 4YY3B 3WIDA 2J5XA 3R40A 4DFDA 1AS3A 3THRA 1JT9A 2BFMA 2ZIZA 1NHGA 1UKAA 1A9TA 2EJBA 2I03A 4OFWA 1L7XA 1H85A 2G8LA 3ZW8A 3NBYC 4QASA 1JX6A 2FZVA 3HKCA 1IEWA 4KWIA 2NUTA 4L8VA 3UQZA 1XEXA 2QAGB 3ANNA 4NJOA 4BGVA 1SKUA 3IDAA 1PJCA 3QPVA 1V3UA 3TDMA 2XWBF 4C30A 4DLTA 5EXTA 1AKTA 2QD1A 2RHDA 4LFAB 4TTVA 1EAYA 2H9AA 3I1IA 4P5PA 3LCUA 4OU5A 3PGMA 1NVFA 5ICMA 1X1DA 3Q1KA 4LE2A 4E30A 3HPRA 3GIWA 1NQUA 4D3XA 5E2AA 3VR6H 1WQ4A 2AMFA 1QG0A 4WWHA 5ALNA 3L05A 3T3DA 2HPAA 4RD2A 4WK2B 5GVSA 1A9PA 1PWXA 2HD4A 3MHPA 4D43A 1YFKA 4LX0A 4DYVA 2CLDX 1UAAA 5C5IA 3C7KA 4PGFA 3PF8A 3DLPX 4B6RA 1VB3A 2ASEA 2ZAGA 5CIYA 5SZHB 2HO5A 5EXEA 3AEKB 1IZ9A 1TECE 2SBTA 4KYUA 4QGBA 1XNJA 2LD4A 3IEUA 4WACA 1CUXA 3CR7A 2AOUA 2B78A 3G5MA 5CLQA 1E2FA 3SR4A 1JEQA 5I9LA 1QHIA 4I1VA 3I64A 4AX4A 2DY0A 1I94B 2OBLA 1Q7TA 1WZIA 2C2MA 3B3GA 3KUXA 5HIAA 4U02A 4GP9A 4DDUA 1X14A 4E11A 1ISPA 5DGHA 1IOVA 3L1KA 1XZGA 5AD1A 3WK9A 5IC6A 3K6RA 3QFCA 5FA6A 4IG9A 1H4QA 1CQIB 3I5MA 1YDEA 4MB2A 4XQCA 2X5KO 4H9GA 1E32A 1XLVA 3GJSA 1N0WA 4LVCA 2Z2YA 3K72B 4D99A 4EO7A 5L4NA 3H9BA 2D0IA 4CM5A 2F43A 3LT1A 4GGMX 3DUFA 2CL6X 4L22A 4AUKA 3RVNA 4EELA 1PW5A 4L5YA 1U6KA 1JFSA 2P30A 3K4HA 1JFLA 4ZOAA 1NWCA 3WMRA 3HXMA 1Z29A 2C82A 2H08A 2Q0SA 3ZBPA 3U7GA 1SU4A 1ID1A 4P4UA 1UPTA 1H2ZA 1QMPA 1H2FA 2V4ZA 1FFGA 2ZJ4A 1FX0A 2OKGA 3E3NA 3ZK8A 2W9XA 5KSZA 1VJ0A 2NPIA 5DM2A 3T6KA 4WD3A 2A0UA 1EUCB 3D4LA 3A31A 2A1UB 3LJKA 4TKLA 3T12A 5MN4A 3U7FB 4AQDA 1LSJA 1PU2A 4X1YB 1TT5A 1KU6A 4F21A 3K71B 4R2KA 2XQIA 1QRSA 3RU3A 3F8SA 4AFNA 1SKMA 2KHZA 2YC2C 2BPOA 4KE6A 3AGPA 4ZOEA 3NBXX 2ZTLA 2PYDA 3DNMA 3MEQA 3PRJA 4EJSB 4KRXA 2V7VA 1GRVA 2AI3A 3TZHA 4CLOA 1H2BA 4TKUA 2A5YB 4AYTA 1H5UA 4F06A 3O9VA 3DV0A 3O1IC 4QFCA 2YZMA 4RNCA 4X3PA 2O9JA 3N0RA 5JQGB 4OKSA 5HZKA 4IXTA 3VPDA 2HWYA 4O4JA 1Z4NA 1W30A 4EHNA 5BWNA 4MJXA 2XCIA 4GXRA 3HSYA 5CPBA 2P79A 4OATA 1Z06A 3B2QA 4H7PA 3BSWA 1JLMA 3I2KA 5KYWA 3DLIA 1YOBA 3KOYA 3EPPA 2KW5A 4XWTA 3WZMA 4D0RA 1MB2A 1Y1RA 1L7OA 3ND5A 3Q0TA 3IULA 1E0KA 3ZDDA 4D0GA 2CFSA 2PLAA 2QUJA 3WWEA 3OQPA 1MCZA 2W4QA 3UWOA 3H3JA 3WWPA 4EEXA 1F6DA 3OMWA 4ZYXA 4CF6A 3MG9A 3PL1A 1QU2A 3KKZA 1QP7A 5TMBA 1VJ5A 2XMDA 5HVNA 4QDXA 1R5OA 4X64B 2QTTA 5CT8A 1VSVA 3STUA 3UA4A 5B57C 1GTSA 4KR7A 2AZXA 4PAOA 2B2XA 2OHVA 3OA0A 1E9EA 3HDHA 1G8FA 4HBZA 3NBKA 2AGVA 5E8JA 5LA6B 4BTVA 1LF5A 1BTOA 4BAUA 1RC1A 4L0DA 1JBQA 4GLJA 4C3UA 2ZCVA 3ZU6A 1KS2A 2G70A 4OOFA 3TRJA 1W48A 1E1RA 3LRTA 3UG7A 1CRWG 2WWGA 3O3OB 3HCEA 2BDTA 4NBSA 4JJFA 5JADA 3PUWA 4OHBA 4BMOB 1YL7A 4KWCA 2D2XA 2BFDA 3KKMA 3QNMA 4L4SA 4QSMA 1KGSA 1YZYA 3BRWD 5DOZA 3EFOA 4MVJM 1KDZA 3UC9A 3H4TA 5AI6A 1VYHA 1XX6A 1OAAA 1URPA 5DZSA 1E8MA 2V3WA 1PBTA 2H63A 1NSFA 3RTCA 3NH9A 4R4JA 4ME6A 1G41A 4QDTA 2Q3CA 3I39X 1IN1A 3MXOA 4QXRA 2XCTB 3G02A 3W4JA 3EASA 4PG7A 2EP5A 5BV1A 4WXMA 1PLJA 3LX5A 5AKEA 5LZ7A 1GTMA 1BXKA 2ZSHA 2IK8A 4XIYA 4KB5A 1G8HA 1FLAA 1Q7BA 3PJFA 2QTRA 3QXGA 1V11B 3A9VA 4BKQA 4ES6A 1ODJA 1E5QA 1TC1A 4BWYA 1KC1A 3GJTA 4X1IA 4CCWA 1LBQA 3C3XA 1RWXA 1PT6A 1N5JA 1KS9A 4I55A 1UKYA 3UB3A 2Q4TA 5E4YA 2XQFA