4DA8A

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 8-bromoguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
231
structure length
231
Chain Sequence
b'SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
molecule tags Transferase
source organism Bacillus subtilis
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
total genus 80
structure length 231
sequence length 231
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4da8A00
5JPCA 1A9OA 4OJTA 4M7WA 1Q1GA 5F76A 4MCIA 4GMHA 4NY1A 1PR0A 2A0YA 4F2WA 1A69A 2HSWA 4YJKA 2Q7OE 4G8JA 4YNBA 4GLFA 4OGKA 1OV6A 5F7OA 2HWUA 3NM5A 3OF3A 3FOWA 3UAYA 3KHSA 2OC4A 5I3CA 2IQ5A 2AC7A 1U1GA 1JDVA 4R2XA 3TL6A 3DPSA 4NSNA 1CG6A 1G2OA 4G41A 4BMZA 1ULAA 4TXLA 1JYSA 4TXHA 4MCHA 1Y1SA 1WTAA 1Y1RA 1U1EA 1PR5A 4QEZA 1FXUA 3GGSA 1RYZA 2HRDA 4LDNA 4BN0A 1ZL2A 2I4TA 4G89A 2AI2A 1V45E 1LV8A 1YQQA 4GLJA 1K3FA 1V48A 4QASA 4OY3A 4PR3A 3DDOA 1PR6A 4MARA 2H8GA 1PW7A 5F73A 4FFSA 3FWPA 1SQ6A 1Z34A 2A8YA 1PK7A 1T8WA 1Y1QA 3BSFA 1QE5A 3OZCA 3FUCA 4D98A 1SJ9A 1TCUA 4TYMA 5B7QA 4UC0A 3K8QA 5B7PA 1Z5OA 3EEIA 1K9SA 5F7ZA 3GB9A 1JE0A 2ON6A 1B8NA 5F77A 4GKAA 1CB0A 4WKOA 2QSUA 1NW4A 3U40A 4DAOA 4P54A 1JE1A 4H1TA 4PNPA 2QTTA 5IFKA 1ODLA 4TXMA 1V4NA 3NBQA 1N3IA 1PWYE 4F3CA 1T8RA 4JWTA 1T0UA 3LBAA 5KB3A 1TGVA 1V3QE 1XE3A 3K8OE 1RR6A 4BMXA 1PR2A 1Z33A 1VMKA 4QATA 1RXCA 1SD1A 1RXYA 2XRFA 1U1DA 3NM4A 3NM6B 3OZEA 4OF4A 1PF7E 5F78A 1Z39A 5CYFA 1PR1A 5DK6A 3UAVA 1JDUA 1B8OA 1ECPA 4DA0A 5B7NA 3OZBA 1A9SA 1V2HE 4TXNA 1OTYA 2AI1A 4WKBA 4X24A 1YR3A 3DF9A 3PNPA 3ENZA 3SCZA 2OECA 3P0FA 1YBFA 1VHJA 4M3NA 1I80A 3OCCA 4QARA 2A0XA 1PBNA 1JDTA 1RSZA 4DANA 5EUBA 3OOEA 4TTAA 2B94A 2GUWA 3MMSA 1YQUA 4OGLA 1RFGE 1C3XA 4DA8A 1A9RA 3ODGA 3UAZA 4M1EA 3O6VA 5CXQA 1Y6RA 3E9ZA 4NS1A 4ECEA 1PR4A 3D1VA 1M73E 5IU6A 4TTIA 3UAWA 4F3KA 4IP0A 3KVRA 3EUFA 2P4SA 1RT9A 3OZDA 3T94A 3PHCA 1VHWA 2QPLA 1TCVA 1JDSA 4F1WA 5F7XA 4R31A 1LX7A 2I8AA 3LGSA 3DP9A 4E1VA 4TXJA 3KVVA 3EUEA 1ODJA 2AI3A 5EFOA 4YMLA 3MB8A 3OPVA 1PK9A 4K6OA 1Z38A 4U2KA 3LA8A 4L0MA 1Z5PA 3PHBE 4DA7A 2QTGA 1ULBA 4WKPA 4EARA 4QFBA 1TD1A 1U1CA 4YO8A 1TGYA 2OC9A 4RJ2A 1NC1A 4DAEA 3E9RA 1Z35A 4I2VA 1JP7A 3O4VA 3UAXA 4D8YA 4D8VA 3PNSA 3IEXA 4JOSA 4D8XA 3KUKA 3KU4A 1ODIA 1NC3A 2OXFA 1ZOSA 3F8WA 3FAZA 4L6IA 1U1FA 3DJFA 2RJ3A 5C80A 5CCEA 5FAKA 1Z5NA 1Y1TA 1Y6QA 3OOHA 1V41E 3BGSA 1A9PA 5B7GA 4LNHA 4TS3A 1RXSA 4DABA 3FB1A 5CYGA 1OUMA 3UT6A 1RXUA 3EMVA 4EB8A 4TS9A 1K27A 1OU4A 1LVUA 4OEHA 1OVGA 2BSXA 4L5CA 1RCTE 2PGAA 5CCDA 3P0EA 3BL6A 1Z37A 5ETJA 1JPVA 4DA6A 2QDKA 4TTJA 1PKEA 1ODKA 4BMYA 1VFNA 1A9TA 3FNQA 4L5AA 4QAQA 5K1ZA 2ISCA 3C74A 4WKCA 3INYA 5CXSA 1T8SA 5EPUA 1JDZA 1T8YA 1OTXA 3ONVA 1SD2A 5F7JA 4DARA 3E0QA 1A9QA 4LNAA 3BJEA 1Z36A 2A0WA 4LZWA 4R2WA 3KVYA 3QPBA 4WKNA 4KN5A 2HN9A 4D9HA 4L5YA 4JP5A 3IOMA 4F2PA 1YRYE 4LKRA
chains in the Genus database with same CATH superfamily
3H1BA 3PVZA 4Y9RA 2VXYA 4YGXB 1A9OA 2O1WA 4MV7A 4OOFA 2XNCA 3D81A 4BFLA 4UHJA 2J5QA 4AZSA 2IEBA 2H16A 3PNMA 2P68A 1KR2A 4O4IA 2VHVA 3NZEA 1U9IC 3WMXA 1CUGA 3NEAA 2BFOA 1DIHA 3HUFA 3ZV6A 4JELA 4V2IA 4MCIA 2DQ4A 2AF3C 5FUVA 1CW2B 1ZINA 2HU5A 3GT7A 3BK2A 2AN4A 3HCRA 4MWGA 5JIBA 4X20A 2WJPA 3D8SA 3EOZA 1GTRA 2BEKA 1CTQA 2JFZA 1ATIA 2YWBA 3C70A 5MGNA 5B6JA 4X84A 1A69A 3CFYA 4FFLA 4MA0A 4WWHA 2VJPA 1HE8B 4HLUA 4YJKA 5DOVA 3KWJA 1J5EB 4PPNA 1DXHA 1J5PA 1QQ7A 3SF8A 5CCXA 1JKJB 2HWUA 3AUKA 4YN3A 1YCDA 1WCYA 3HKCB 4IXNA 4RVCA 4UZFA 3PR1A 4IHJB 1YI0A 4Z9BA 3DOFA 3PCXA 2JJYA 1XHEA 4UDXX 4X6UA 4IVPA 2QYSA 5H7XA 3TQTA 1WPGA 5FOVA 5A9RA 5JCJD 3RYHB 5L53A 2ATVA 2YASA 5FI3A 4EZBA 2IQ5A 8AT1A 5EVCA 3P7MA 3V46A 1U1GA 4O5OA 3SJUA 3ER8A 5CDGA 3QKSA 1ZVQA 4YPVA 1K2WA 2ECKA 2EJBA 3AF3A 5KNBH 2RI6A 1JDVA 3D7SA 2I2FA 2NV6A 3IQIX 4HH4A 2DETA 1L7PA 3IV6A 1KVQA 2ZJ2A 2CC2A 3M33A 3D5QA 1BJTA 4U2DA 3ZHXA 4BMZA 1MJ5A 4E94A 4R1PA 2QW1A 1H4SA 1TAUA 3E58A 5EE5B 2IIQA 5BWOA 4DVJA 5GZ6A 3GHHA 3QF4B 5C5IA 1GQFA 3E1KA 1PGOA 3F5MA 3KBOA 3QWAA 4LJ6A 4MRMB 2VQFB 4EQ6B 4U39A 3BKWA 1S4QA 2GBFA 4Q1EA 1CK4A 4G0PA 3A4IA 3ZZMA 3TR5A 5JJIA 3CLRC 2RJOA 3STHA 4A0SA 1E77A 1M74A 2R00C 1T8UA 1ZU5A 5JI3E 2AT1A 1NT4A 5E9QA 2WJIA 4DQDA 3QJYA 1T4BA 1QV7A 5FAXA 5K3AA 4U0JA 2IU4A 2WTXA 2B1IA 1TTPB 2PXAA 4H16A 2G82A 3H8SA 1OY1A 1W36C 2DE0X 2PT7A 2NZXA 4CPDA 4DE5A 4R83A 3QPWA 5CDHA 4KWIA 1P5HA 3CZPA 4MITA 3BDVA 1UQTA 4DL9A 1N0WA 3B82A 3KCQA 5EIBD 1XOIA 1ZC4A 2UUOA 3OJWA 3PTZA 3QBVA 1W88B 4QEKA 3OQ6A 3W78A 3NGLA 1ZP6A 1NZJA 2VP9A 2RC6A 1LXCA 3V00A 3I8SA 4BRUA 3DYVA 3LO8A 2CV0A 1S2IA 2VDPB 3WIUA 1H66A 5BT9A 2V45A 4OY3A 2IELA 3MTEA 4ZGGA 4UAJA 2PZ8A 1VJ5A 3GJ7A 1EXNA 3NTLA 4BO6A 2OV3A 3RS3A 3OICA 1RD4A 2H8GA 4RVDA 2NU8B 2ID8A 2W6JD 4QOGA 1VYUA 2OBYA 2XB9A 3L7IA 3O8CA 5AVWA 1IHUA 2WPDA 2W9XA 3DKRA 3NATA 4DM7A 3K9HA 3ZY6A 2RGWA 1ZM4A 1B6GA 3OJFA 4X9XA 2YXDA 4AKHA 5D3MA 3HJHA 1H65A 5SYMA 2VUSA 4JBWA 4QNRA 5DCWA 5F1KA 2H11A 4ZAWA 1BCSB 2GEBA 3OFND 1FUYB 2ZYRA 4GUDA 5LLSA 3ZBTA 5FUWA 2L18A 4IOJA 2CNOA 3IUBA 4TTVA 3B51X 3U3KA 3FLEA 5BMVA 2PN1A 4DLUA 3HUTA 3IXLA 3AH8A 1BYIA 4JJGA 4YRMA 4P84A 4YRQA 1VE6A 1B8NA 1YBMA 3ZCPA 4RMIA 4BQQA 1AHNA 2ORYA 4J49A 5CDFE 3WO1A 1XTBA 4XQGA 5CK4A 4UM8B 4YJ3F 3P52A 4DSZA 3O3CA 3QZUA 5CDTA 1C9MA 1DX9A 3FTFA 3EVNA 1H6CA 2P0AA 1W46A 2HEIA 1QQ6A 1T9GS 3RYCA 2ZJ3A 4KPUA 2VHEA 3I32A 3KXPA 1EFTA 2FZWA 3CRZA 3CO5A 4RCVA 2IWHA 4M7OA 1G63A 5F7XA 5FJJA 2J08A 5LQSA 4AWBA 4JLAA 1WSAA 3ELWA 4RE6A 5CP8A 2WW8A 3K6RA 4AICA 2IU3A 4HGZA 1NVMB 1SUWA 4RVOA 4PGHA 1PWYE 5C0OE 4YRAA 4IKEA 1XNJA 4YPFA 1C14A 2QP3A 2HM7A 1TPZA 2HQSA 4ER0A 4KUHA 4PGFA 4OXXA 3E22A 4GQIA 2ZUVA 3DA8A 2Q9UA 2IYYA 1GPMA 2O14A 3CTPA 2EJWA 3JVUA 2WMDA 4CKXA 3I5XA 2H4HA 2W42A 1EFVA 5F2EA 2I6TA 2ZRPA 2FPPB 3Q5GA 5A4AA 3TNLA 1KGSA 4KB5A 1FMLA 1T36A 1EBBA 3QVSA 2QMOA 4MTCA 4QLAA 4JUAA 4MQEB 2V98A 2EWWA 2ZSHA 3CU5A 2AMLA 1T10A 5CX1B 4C4TA 3ZDFA 2HSGA 4A26A 2B2XA 1KFBB 1KY2A 3IAXA 4K9RA 2A14A 4PYRA 4Q93A 4KR3A 2PTGA 5IDQA 3WIBA 4EYGA 5H3CA 1CUIA 2DSNA 1PF7E 5ABPA 1F48A 1RAEA 2QSZA 4JQCA 4YAJA 4GFDA 4WLVA 2X0EA 2AEMA 2Q0SA 4E2XA 3CWQA 4EF5A 1WPQA 1PFKA 1P8JA 3ZHBA 1IXRC 3HCAA 5JJCA 4QPCA 3QSGA 2R4TA 2C4HA 4G5QA 5C1DA 1N2CB 3FIJA 5C8VA 2JI6A 3L06A 4BNNA 1ULUA 3T7JA 3U3RA 5KQSA 3ZQUA 1W2HA 1LJLA 1HA3A 2OCXA 4Q9KA 3K5WA 1MD9A 2CXHA 5GIOE 2C92A 3V32A 5BQXA 1FFBA 3GCWA 4BEVA 1W85B 2NUPA 5FQOA 4AN4A 1G20E 1T8PA 3GOQA 5BYJA 1XPOA 1X1AA 3UK0A 2BGWA 3EZ9A 3W0LB 2QX8A 4D45A 1DKOA 1UUFA 1PJZA 3WKEA 2OWEA 5IBQA 3GRRA 1NYQA 3GPCA 5J4HA 1PNTA 2HIGA 4H4DA 5GOTA 2OZKA 2O50A 3VZQA 1P73A 4A5OA 4CQLB 1WQ3A 3GDHA 1FFYA 1HORA 1CB7A 1R15A 1ZN9A 1EHIA 3OTQA 2DR2A 4OQLA 4ARZB 4KQCA 1CVRA 2F64A 4JD5A 3GQBA 2HBRA 2Q3FA 1Q1QA 2VF2A 4LVUA 2V8OA 5H82A 4B0OA 2BSQA 5HF5A 3SY8A 2IV3A 4XYBA 1PP4A 4UUBA 3P8ZA 1CFZA 1SA0A 2NUAB 5JH7B 2GXUA 2QN6A 3OE7D 2DPXA 3WBBA 4B35A 5JMPA 4MSUA 4ZAXA 3EBOA 3D4OA 3H0KA 3LQFA 4IQGA 4J76A 1NR5A 2P2GA 2PX6A 1A2BA 4G8DA 4M9CA 4K9QA 4NQRA 4O3FA 4OXKA 5DGTA 1Q7CA 2FSSA 3RW9A 3SFVA 3RBZA 4LI3X 3DVAB 1VG9B 1I01A 4S1PA 1SC6A 1Z26A 3HZZA 2YMQA 3ZXYA 4F56A 3U19A 4D9GA 1IRIA 4QDXA 4PLGA 2ECFA 1BD4A 1P2FA 1LLFA 1QFMA 5IU6A 4R8RA 2C3OA 3OG9A 4RY0A 4QUGA 2VPYA 2ZZNA 1NU6A 2YH2A 1HFKA 2IL1A 2P9QA 3W8EA 3B85A 1H9BA 2H07A 3HMKA 4MW2A 4RH0A 4D4GA 3CZ9A 2FKAA 2YWJA 1JW9B 3G8AA 3DCJA 4L72A 2WYHA 4UPEA 3JYLA 4LEIA 4ZI7A 2R7KA 3JD0A 1SC3A 3UPTA 2NUAA 3I1FA 4L8WB 1NOIA 2F67A 1M2KA 3QUAA 4I9GA 4B85A 3WLOA 4KYTA 3O1JC 1ZI6A 2VHZA 2X58A 1EQUA 3EUFA 4R0MA 3K7EA 4MV0A 5DTIA 2PGDA 1KAQA 5FR1A 3BEDA 1P62B 2HSEA 4V0MA 2X6TA 1XEWX 2Q3EA 4OJKA 4A5SA 2A5JA 3RVDA 1IM2A 1WUHS 5LYJF 2HJRA 1DTWA 4RHEA 3R5JA 4OGGA 3MLBA 4DQKA 4Q3KA 3H0CA 1BA2A 5AXDA 1F5NA 3DWEX 3S2FA 3NW9A 2VHWA 1LA2A 3OF5A 1Z08A 3QVGB 4YJ3B 1G21B 3H5RA 5LNK1 5AI6A 5BOVA 4AJEA 5L9AA 2B92A 3ABIA 2I62A 3I5AA 1GSOA 4PYNA 4C6TA 4ILEA 1ES9A 2TMGA 1T2FA 1X7XA 3B7GA 2ZZMA 4G84A 3ZCXA 1Y7HA 2B82A 4L5BA 3WJ2A 5JATA 3OP1A 1NI3A 3TNFA 1XZNA 4HKTA 4PXAA 4XR9A 3ETNA 3OPVA 1E92A 4KUEA 1NVVR 4LMBA 3UFBA 2E3JA 3FPGA 2Y2VA 1UPTA 4MLZA 1UZLA 2ZLBA 5K0NA 1YCGA 2WHYA 3K0CA 1L9KA 2M2IA 2CXNA 3EDCA 1BDMA 1Z8FA 3F9RA 3P5SA 5EMMA 3WHKA 1CBUA 3WK8A 2B2NA 1UBEA 2UXBB 1GVHA 2Q21A 3QJGA 3GFOA 1O6GA 4MI6A 4CU5A 3DMFA 3FXAA 3M9XA 3A9RA 4S0XA 3QX3A 5CNKA 2RK3A 5A5GA 5CJ2A 4PIMA 1QYIA 3KEOA 3MT8A 1N6HA 4ER5A 1B15A 4ZC8A 3BX1A 3QEMA 1VKNA 3AHCA 3I76A 3D0QA 4KIUA 4LYFA 1ZMRA 2DU8A 4UMVA 3HU1A 4MJ3A 1UJBA 4ZTBA 6NULA 2DR3A 2UZ1A 2VNSA 2FNAA 4HH0A 3G1WA 4EEXA 5JCZA 3I73A 3TGPA 1FPQA 1Z6ZA 2PFKA 3H5TA 3GPLA 5HZMA 1EH5A 4LFCB 2ONYA 1K75A 3DCIA 1MB2A 1L7QA 2O4CA 3A36A 5EJMA 1R88A 4YJ2B 1SBCA 1UOPA 4BZQA 3PWSA 4QM7A 5IC5A 2XWPA 4X1YA 1A9ZA 4CDGA 1JHMA 1QG6A 3OKFA 1JU3A 2VBFA 5CEFA 3WK7A 2G9QA 4MUGA 4S1TA 1PNVA 3VV3A 4ZI3A 5HW0A 2JGNA 1UODA 4NU6A 5SYAA 3HBNA 2ORVA 3LSYA 1JHZA 4BRZA 3IAFA 1TCAA 4U4AA 2P6OA 2ZB3A 1QPZA 3SC2A 1GXSA 1CZHA 1D8TA 1NC3A 1EGVB 1G8HA 2GJKA 3MRVA 1POWA 5T6BA 1E6CA 1ZITA 4TVKA 3WLTA 5FADA 1CQXA 1P4AA 4DDMA 2I65A 2MINB 3GU3A 1X38A 3DD1A 3G0IA 4FXPA 2QLLA 3A10A 2VNJA 2QTVA 2ZBRA 3FUUA 3VHRA 4HNVA 4W9NA 1RLMA 3ZVKA 1JDBB 1NRJB 1SOVA 2XZPA 1SQFA 3EZLA 2MSLA 4XIYA 4ZQFA 3M3HA 2Q9AA 4BP9A 5DHQA 4GMGA 4E5UA 1A9PA 4FD3A 4MLDA 4OQYA 4C3UA 3QHPA 5T67A 3F3MA 4OLBA 1J22A 3FB1A 3H4VA 2YDXA 4LCEA 1XMVA 1RM4A 1A8SA 3WRXC 4KX3A 4N1AA 4O4HA 2CJFA 2YW2A 3JSXA 2VTVA 2OYCA 5AVTA 1U8UA 2IU0A 4PRYA 4FSXA 4MH0R 4HXYA 5FXMA 3EMVA 2GRJA 3GC6A 1QRRA 3N8DA 1A4RA 2W71A 3PITA 1V9SA 5GMOA 3FWYA 5ILGA 4P9NA 3T1TA 1LRJA 3THXB 3MN1A 1V25A 3CLVA 1S3GA 4AI6A 2QXYA 2ZWAA 3FLBA 3F5QA 1A8IA 3ULKA 3ABOB 1U9IA 4HQRA 1MVOA 4U5XA 4BWFB 5JBNA 5GGYA 2JLAA 2GN6A 2PGAA 1X92A 3TLGA 3S6JA 3VGPA 5B6IA 3DUWA 2P9EA 2YUIA 3WRXA 2BT4A 2WHEA 4UQPA 1N8KA 4GX0A 4IL5A 1V5EA 5BV0A 1NVVQ 2OSBA 2ZJBA 4OK3A 3U0BA 2YWDA 1D2GA 4NZMA 5IAKA 4OHXA 5GONB 3C4JA 3IDFA 4HWPA 1X39A 3KR9A 5SY9A 3E3MA 3AKCA 2CNWA 3A06A 1U0LA 3AESA 2GN9A 1A9TA 3HACA 1DBSA 4PO8A 4QAQA 5K3CA 5KOHA 1R74A 2WF6A 2FQXA 1MNQA 4GS5A 4LDZA 3SVLA 3FSRA 4LRXA 2XA1A 3ZJTA 2Y4OA 1ORHA 2QTBA 2B1RA 2VPXA 1W4ZA 1Z13A 3K0CC 1QP0A 4L27A 4ZGWA 4BJ6A 3T3GA 4DCGA 4AKEA 4E14A 3UGJA 2WWXA 2QN7A 2ZBUA 1QVRA 3CZRA 4ZQIA 4EOGA 5BVHB 1LLQA 3AZPA 2NNWB 3CKKA 3IDOA 3GPIA 4OHPA 4DNFA 2FFRA 3UJ3X 5E4FA 5JJ5A 5IS2A 1OLUB 1ZRSA 3PP8A 1T1SA 3ZJVA 3MT0A 5J40A 3OIFA 5FL3A 1SEPA 2C82A 2FQYA 2MYUA 3R3JA 3SXUB 5E0KB 2QP4A 3ZGYA 3AUAA 2CCKA 2IHVA 2HHLA 5ELLA 2CHUA 4RJTA 4KMSA 4EQ6A 2C20A 5IYZF 4DGSA 5D6OA 2F3TA 2FN9A 3L0CA 4Y1RB 1FLDA 1OHHA 5CNJA 1H2ZA 4WI1A 4CTJA 2GD6A 1VPLA 2H1VA 2WY2D 4UMDA 1GR0A 5HA5A 1OTHA 5DWDA 4OYRA 3TD2A 2RHBA 3BXEA 1GAWA 1Y4SA 1NG9A 2O8FB 3OLQA 3R0VA 1L5GB 1PUIA 3JAKA 4CHTA 5A1JA 5GIPE 2NVWA 3H11A 5JZBA 1PR0A 2B1GA 2QVGA 1R0LA 2R1VB 1UK9A 2JK1A 3C5HA 4GNKA 4N39A 5DM1A 4F2WA 2W4QA 2LDXA 3S2IA 1QQAA 1Q0TA 4V0LA 5EZYF 3L8GA 4MK4A 4MJLA 3UJ6A 5JSQA 3DDWA 1IHPA 2GEFA 5F7OA 1OWOA 1UM8A 3D2CA 1NVFA 2QD5A 5DULA 3UBMA 5BR8B 1X77A 3Q1LA 3V1YA 4B6FA 3FNFA 1RP7A 1GCGA 4X97A 1VL0A 3T1NA 2FPSA 1ONNA 5IN4A 5JTUA 4PQEA 1BSVA 1OT3A 3JQPA 3VR4A 4CMCA 1NYLA 5I3CA 1JIKA 1MXFA 4QDOA 5GJWC 3SXJA 5ALTA 3DL0A 3S99A 3PNKA 1W47A 1QIDA 4BNMA 1WVMA 2RHDA 2IS2A 5HJ7A 3CVOA 1L8AA 4HQKA 2AX3A 3QVLA 5A9SA 5LUAA 1VKJA 2D0DA 4WIAA 2EGGA 3PGMA 4G41A 4BFWA 3ZIDA 4FM9A 1GAEO 1RKQA 2C4WA 4NZZA 4CNQA 3RVPA 1SG9A 4CLRA 1L8OA 3O94A 4FDMA 4XX0A 2PZGA 3P2JA 1LF0A 1KOLA 4JIGA 4OHRA 3U09A 5M29A 2YV2A 3AU9A 5HZGA 2O3QA 2IS6A 2A5LA 2YQ5A 3LUKA 3MFQA 4BYGA 4KDEA 1NONA 2VI5A 3DTTA 3M5CA 1J2RA 4MOWA 3ZY5A 1ELOA 3T95A 4MPTA 5J5CA 5BYKA 3JQ7A 3DUFB 3B1KA 3L1HA 2QZSA 2M9MA 3WLJA 1KGDA 1U9JA 4RGBA 4KXQA 4QBGB 4RDIA 5HYVA 3SHQA 2XD4A 4FKBA 4FYXA 4EI2A 4GR4A 5KAMA 2I7DA 3C1UA 3A8TA 3OTGA 1HSZA 1U7HA 5K4AA 4U7TB 2XVYA 3GMIA 1PT8A 1ETHA 2A0FA 4NFSA 1HTWA 1U0GA 1GYPA 3IHLA 1HBJA 2RAPA 3MFYA 1J00A 4NU5A 4XX0B 1VFPA 4BP8A 1JTEA 2GZAA 3KB2A 3H65A 5J1TB 3TLKA 4LHEA 3GWZA 4LTDA 4CMIA 3ASUA 5JAPA 3K6SB 4WHMA 2GSWA 3DV2A 5G02A 4JA2A 4WZBB 4DR5B 3OZRA 4C01A 3WLEA 1KZ9A 4NFLA 1OFIA 3BMOB 4W5JA 1EZ4A 2IBMA 2PYZA 5A7HA 4AYXA 3FBGA 1WF6A 4XDHA 2HJVA 3C4VA 4YP9A 2C29D 4TWIA 3EHEA 1YOVA 2WR8A 4JJ7A 4X93A 5FBQB 5DM60 4EY7A 2QTAA 1OI4A 1VCIA 2M1ZA 4KTVE 1JEJA 1ETUA 4HB2A 4ZVPA 3MYYA 2Q6KA 2E48A 3AV3A 5KTOA 1HNXB 1ZAYA 1MAWA 2DERA 3K05A 2C4TA 4ER7A 1GSHA 2AN1A 4C7BA 2ZZKA 4RLSA 2K5UA 5FPYA 1DLJA 1UBUS 1M6VB 2PZMA 3VTFA 2G6TA 4JBYA 3ZTWA 4R9RA 4RD1A 3BH0A 5K0LA 4LJRA 1SJ9A 1K6MA 1ECFA 1TQDA 4GUAA 1J24A 3NDBB 5HOQA 4MGYR 1DX4A 2E9SA 3IVXA 5JMWA 2X8JA 1SXJB 3F8TA 3E1GA 5DTQA 2ZAOA 3S7ZA 4YT8A 5BR4A 4UFNA 4F93B 4UAGA 3UAGA 3ER9A 2OFXA 3C5CA 3SQLA 4CGZA 4AS2A 1FFWA 1QGUB 3OAAA 5BSKA 5IXJA 3KB6A 4KUGA 1MPTA 1M6YA 1TT5B 3TXYA 4JVOA 1G8AA 1N6IA 1TU0A 1HE2A 1N5RA 3FOCA 5TPWA 3R74A 4DCJA 4WKOA 5KZMB 3GLIB 1ND5A 3U5ZB 2EL7A 3O9MA 4HAZA 1NBEA 1E3JA 2BUAA 4UEQA 3EMBA 1KEEB 3I05A 3MD9A 4MCAA 2GSDA 1SCUB 3H17A 1FUIA 4DCVA 2DJIA 5F9MA 4FOSA 2A6PA 4BO2A 1EA7A 3P9QA 2FN7A 5CU7A 3TNJA 3TVYA 1B23P 1HKHA 2BHNA 3D4NA 4JFRA 5AW4A 2PWYA 4FMDB 4A6EA 2X9GA 2NMVA 3FLMA 2JFQA 2Q1YA 1DBVO 4B4OA 4IRUB 4F12A 3O0TA 1OLUA 1T0UA 1TADA 2R11A 2SKCA 3R7AA 3FKSA 1EZZA 4IIDA 2BFDA 2XUIA 2QZ9A 4I1RA 4MVJE 1PFWA 2VN8A 1KPHA 3R0QA 3DOJA 4RA9A 2FMTA 3ZWXA 3QTLA 4J0KA 3VZPA 4RIGA 4QOEA 4ENQA 3S5JA 4I5DA 1CEYA 2XZOA 2FUKA 2OBMA 3R5TA 4CQJA 3G8BA 4JWKA 3JD1A 5JBQA 2NTVA 2J46A 2UYOA 2F1OA 2XNHA 4IH4A 2P4EA 2AMFA 5KKAA 1AM4D 1QK3A 2FRVA 3PEFA 1SKYE 4TKUB 1ISSA 1QGYA 3TQOA 4EBFA 4EW6A 5LMNB 4BX2A 2GJSA 2QMZA 2RG1A 3L4EA 3CLRD 3P9PA 5JJLA 3PDUA 1NI5A 2WNSA 2ZDHA 3LUBA 1REQA 1D0IA 1X80A 1RHMA 2FYTA 3REGA 3ZXSA 4BO7A 3MJEA 3NM4A 3M5WA 1QJ4A 1E5XA 3N0VA 4NMHA 2I3AA 16PKA 2HNKA 2IGBA 4JV5B 4G97A 1VSBA 2PU5A 4HJRA 4DXDA 3D5TA 3DEIA 5KQMA 3CX3A 4OIFA 1L5HB 4ZOCA 2FLVA 5J63A 4BLUA 4F4FA 4IRMA 4N9QA 4HAYA 4CWAA 3CPJB 3AY0A 3R9IA 2NO4A 3UXEA 2C88A 1Y0BA 2Y0DA 3QE9Y 3SEAA 2RI1A 3PPIA 5LA6F 2GA9A 4N54A 3K71B 1PQYA 1MT0A 4BNZA 3AVWA 5DI3A 1A7KA 3D0OA 3BS4A 4IXMA 821PA 1ECPA 5AUOB 1D3AA 1HWYA 2CLFB 2JLBA 3PSHA 1T29A 3T7KA 3C8MA 4MRAA 2GUGA 4TSFA 5EAIA 1YRBA 1DKUA 3EIQA 3OX2A 5DHRA 2R8RA 1N1DA 2JGJA 3DTVA 1VIDA 1SHZA 1JHDA 1AN0A 4WJKB 3DW1X 4C4XA 3ILVA 4NZPA 2IHYA 1P74A 3PNPA 4K6MA 4Y1FA 4BQSA 1XCJA 1ABEA 2EP7A 2ZT8A 3C3AA 4OG2A 4YAGA 1KAEA 2I6GA 4K7JA 5IPFA 2MINA 3CH7A 1R6BX 3E9DA 4JNCA 3UW1A 4IICA 2D0OB 4XIGS 3IHKA 3OUUA 1MO2A 3MC1A 2FGJA 4P4SA 4JLDA 4ZODA 5I9BA 3WIOA 2OCDA 4J0GA 1ZIDA 1HNWB 4W5NA 4PW0A 3UXMA 4G1VA 3X1ZA 2NACA 5IJ9A 2AOVA 5AKZA 4AZ3A 5DGXA 5JAUA 1YZUA 2X14A 5I4CA 2Z6VA 3ROKA 5A5EA 2DFVA 3V4LA 4FHDA 4HUJA 2F4NA 4Q00A 5LQRA 2QNRA 3IP3A 1ZRNA 5KBYA 4OGLA 1KDPA 1I0LA 4QPNA 3QPDA 4IOMA 4BZWA 1GFWA 2D4AA 3G0OA 2WABA 3O4GA 1P7WA 4PBRA 4YMIA 2MCFA 4B8WA 4QEDA 3ZWCA 4CQMA 2O0HA 5FOTA 5JR3A 5EIFA 4M36A 1LPNA 3BIOA 4M8SA 2YZNA 4MQFA 1QB8A 1LWNA 4OXYA 1Y6RA 3B5JA 2AFVA 2HPZA 3ZK8A 2PKCA 1OLSB 1A96A 4OJYA 2QSYA 1MOPA 1E59A 1Z3IX 1UC8A 4UNIA 3SEFA 1PR4A 1FNDA 2Y6VA 2IXFA 4AAYA 3S1AB 3TX6A 5KOIA 4JGIA 4UFPA 4ZT5A 3TLJA 3QEMB 1RJWA 3RKRA 1J4AA 3U44B 1CZLA 1JZQA 2DZDA 3ZCTA 1HNNA 1DHTA 2DQYA 3LE8A 1M2VA 2HMVA 3M6AA 2Q9BA 3DE5X 1RZRA 1GA6A 4A6DA 2CJYA 4WK2B 2ID4A 3BHJA 1RBZA 3FCXA 5D1HA 3T5MA 4EY6A 4AP6A 2AC2A 3D4BA 3JWIA 1ZJYA 4K26A 4AECA 4EG6A 3B36A 1TTTA 1E9CA 1ZH2A 2IXAA 2OILA 3B53X 1H9CA 1CWUA 1NHWA 1SEVA 4G2TA 4F1WA 2ZBGA 3FYDA 4JLNA 1ECLA 3WWDA 1KS2A 5KX5B 4WOJA 3KKNA 5FUMA 4MUIA 1X14A 4PFKA 1GTL1 1YE3A 1ZR4A 1HI9A 1E5VA 1T0JB 1NYTA 4RANA 1HFEL 1QNLA 2X4DA 2GAIA 1SVUA 7AT1A 5IBRA 3A9WA 4D74A 5EP3A 4F8EA 1ZUIA 4L4YA 3M5PA 3DOOA 3ND9A 4O0LA 3CUKA 4EUSA 3X1JA 3IQZA 2IUTA 4TLMB 4F9EA 2JLXA 1ZVVA 1QCDA 2Q3MA 4JENA 4TV8F 4UU7A 4BV8A 2ZWOA 3O8OB 1GOTA 1XZCA 3N5KA 3OOJA 1H1TA 1R3DA 4MQBA 1UMCB 4Y6LA 5D85A 1SKQA 2YCBA 1XDGA 3QX7A 4AT1A 4M9XA 3Q3HA 3BHMA 1R5JA 4ARSA 5A02A 5HX7A 3KQNA 3SR4A 3UFXB 3UJDA 4ASUD 4X1KA 4A6XA 5CFLA 4GVPA 1DMSA 1OU0A 3A1EA 2A9VA 1YZFA 2JDIA 5ALQA 3R8CA 1XO1A 2CJPA 3ZLJA 3W5HA 3FMOB 1E2DA 2HWYA 3LNTA 4M88A 4OP2A 3ZGOA 4AX8A 1P7PA 4DIBA 1ZWLA 2IBTA 4LHXA 3B5IA 5DBOA 5TMDA 2X0FA 2FZGA 1FTWA 4HEA6 3BULA 3KQTA 3ZNPA 2V54A 5KTSA 5LQDA 3GRYA 1DL5A 2YVAA 3IUMA 4QTTB 1NTOA 1TFRA 1I51A 4FJ1A 1FW8A 1KFEB 4R2HA 5CVDA 3NEJA 4BJHB 1Q14A 5I7HA 1DQSA 2GF9A 3N76A 3QFTA 4LDJA 1E9BA 1NFRA 3MTJA 3H5VA 1GGEA 4C43A 2P2CA 4RL4A 1S1MA 4JU9A 2Z8YA 4W82A 4GMFA 2VRCD 1F2VA 1OWNA 2WOJA 2Y4NA 4A2CA 3TLZA 3DAPA 3A6ZA 5FUQA 1R3UA 1E3IA 1ZNQO 2BFWA 5MFPA 4M98A 1UWKA 4NU8X 2XYRA 2HA7A 5HQJA 2OXTA 4Y2SA 5L3SA 3QA9A 5AKKA 4B81A 4ZT2A 5CCEA 2OBBA 5GQSA 4LF8B 1IEVA 1VLHA 3OO1A 3TEJA 3TPCA 3TPZA 2X0IA 3NWJA 4ZYUA 3AV0B 2CVFA 4X7RA 3VPXA 2BI4A 4URVR 2ZYIA 1TYCA 4UE3S 4ZCMA 4DXHA 4I55A 1V6SA 2J45A 3HGMA 1YCFA 1RYFA 2VK4A 3TDMA 4BU1A 4U9UA 2R8XA 3AM4A 4B3RB 4C3VA 4ZZ0A 1BS1A 1TM5E 3DXZA 3OE7A 4FMDF 4YAKA 4PANA 1T4GA 4EGSA 2EL9A 4TMKA 4WBNA 4JBGA 4QDJA 2QQ0A 4MDYA 2YV1A 2B5WA 4REMA 3LX4A 1UP4A 2J6CA 2SNIE 1DO8A 2O2HA 5GAJA 3KB8A 1T5SA 1P7CA 1ZGJA 3ZTYA 2YC4C 4X64B 5LP6F 3PK0A 3W3AA 2HT1A 1I32A 2GWHA 4WOBA 3ZNOA 4ZCIA 4RTJA 3FYCA 5KC8A 3GFTA 1IXSB 2Z43A 2BC9A 1E2UA 4LJKA 1KZ7B 2VVTA 3E4DA 3I9LA 4TQ9A 4P31A 5BPHA 3M6XA 5B64A 2Q8PA 4ZZ3A 3GDFA 3A1TA 8LDHA 1DZIA 4MUFA 1PKEA 1P4RA 2R48A 2VUUA 4KQGA 4EG3A 3KZXA 1J8DA 1T36B 5DFAA 2C7OA 2G77B 4GKJB 4RTMA 1P6XA 2MR6A 3JALA 3CLKA 2XNDA 1TA0A 4P82A 5F2NA 3D59A 4FP9A 1T8SA 3B1JA 3EQZA 3QMVA 3QWBA 4IEFB 2BHRA 1CSEE 2XDYA 4LKOA 3WA7A 4BV9A 3V5NA 2AOWA 5DBIA 4AC9A 2R2AA 3BA1A 4IX9A 1XPJA 1JX6A 2VTEA 1FTGA 4MKRA 3C3DA 4I1VA 3RUHA 3HVJA 3WADA 1MDBA 2B7BA 1DEXA 4EKEA 1T9HA 1YQXA 3TPFA 2H1SA 1LH0A 3EC1A 5FA8A 2IOFA 2Q45A 3HADA 5AXBA 1V8ZA 4P4SB 1FSPA 2O9JA 4QXRA 1KO7A 4IDFA 1MQSA 3OCVA 4M55A 3CM0A 1J0DA 2ZR0A 4OFBA 1GU0A 1V1JA 1FSFA 1U7DA 1GGFA 2IYOA 4S2EA 4C06A 3OBBA 4IUDS 2WM2A 2GJ4A 2G4CA 2ZTVA 3WISA 3SG0A 1IY2A 2X9LA 3HO1A 2QEQA 1RP1A 4HZGA 3G2HA 3E03A 1V96A 3IAUA 1HDCA 1UEJA 2ACVA 1HRKA 2FN8A 3PQ2A 2PMEA 1QAQA 4P53A 1LC0A 1GZHB 4B4VA 4J7UA 1RAGA 4L4SA 1NRIA 3GHYA 1RBYA 4E13A 1LF5A 3E9CA 1G18A 1QLWA 4EFLA 2NN3C 5BMVB 4D4KA 3QVTA 2Q5CA 3FJ1A 1U7PA 3LOPA 1NFQA 1QVVA 3GLRA 1L7RA 1MJFA 4D3ZA 2W2TA 2HWWA 3WGZA 2FUNB 5EPOA 2BGLA 4PAGA 4BLVA 1TMYA 2P2SA 2H51A 3K92A 3VYRB 5IJZA 4NAVA 1X2BA 4UCFA 3U31A 1I7NA 4HMOA 1Q6ZA 6ABPA 1H4TA 2H2FA 1G6Q1 3FUWA 5HIMA 3WGUA 1E7YA 2V1XA 4DT1B 1C1XB 3FVWA 4RZHA 3Q6IA 4FNMA 5G3ZA 4HYQA 4Q1DA 1GZDA 2FGKA 1ZSYA 2JAQA 5I5EA 5CPFA 1O3YA 4Q1FA 4P4GA 1I1QB 3HY3A 3JYHA 3O9ZA 1Z29A 3CX8A 3AB8A 3TSWA 4DYDA 2A3NA 5DRYA 4Q37A 3VC1A 2PZFA 5K6RA 5ECDA 3R5HA 1FP6A 1Y5NA 1F5SA 2OC4A 5ADVA 2AC7A 1JSLA 1CV2A 4C0JA 3CUUA 4PVCA 1JTFA 1QIIA 4GAEA 4QGGA 5ECWA 5H80A 13PKA 1J8MF 2FPKA 3HK2A 2WQZA 5TNXA 1JR6A 2FMHA 1QH8B 2ADFA 2QPOA 3AVQA 4L28A 3PSAA 4X3PA 4IJ6A 3F5DA 4LSZA 2JZNA 3D6VA 5EE1A 3SM9A 3D8RA 4JFAA 1U7ZA 2OQIA 4QO7A 1FW6A 2JGIA 2ZIFA 2J48A 3YASA 3MWFA 1XMQB 5ECYA 2D5LA 4KHZA 5CBKA 1JAXA 9ATCA 5JAZA 1B6TA 5EPEA 5HQ3B 2XB2A 4DR6B 4TS1A 4O2BA 2GYYA 2Z2IA 4Q21A 1BMDA 2R8OA 1E8NA 1V1MB 3SGLA 4QUBA 1RWWA 3GZ4A 3I9FA 1OBVA 1CZOA 1IG0A 1YE5A 5BP7A 5BUQA 2A1UB 4IZIA 4QEZA 5K2OA 4HTFB 1ISFA 1CNMA 2ZSBA 2JAPA 1I9GA 5C81A 4HX9A 4QDTA 1NZFA 1U0EA 4IDEA 1JB1A 2GYVA 4K1LA 2X86A 3RM3A 2B8EA 3DLIA 4ZVSA 4BP1A 2FF5A 3RROA 1XQ9A 4ITVA 4OGFA 1VDZA 1OYVA 1Z68A 4IBOA 4KPFC 2WLTA 2K2QB 4FSDA 3T7IA 1XYGA 2PK3A 4IVNA 3DEJA 1H2EA 1V47A 3LX5A 1XD9A 4M99A 4Q3CA 4R2JA 3L1VA 4LZPA 4W7HA 1JVNA 1IY9A 3UA4A 1XJ5A 2J32A 4YVFA 4C3ZA 5REQB 1G2QA 1Q15A 1YQQA 3FSEA 3KQHA 4Z2AA 4KRFA 2G9UA 1K3FA 3P9YA 4Q34A 2K87A 4FYJA 4YPOA 1DWOA 4UFOA 3H2GA 3H7IA 3IP8A 4KC0A 1WCXA 4IH1A 2GPTA 1GKKA 1GZVA 1M6VA 2ID7A 3AFHA 4LZNA 4RVGA 1P5RA 2BF4A 1IVNA 4BIMA 3UQZA 4TYNA 3PHLA 4B2LA 3DDNA 4DLYA 1BG6A 5TS3A 2A0KA 3RYHA 4ESVA 1XJ0A 2JI4A 4BIIA 4C0AC 5FO0A 1U81A 1RBMA 4C7OB 3E5NA 1M0EA 2AFHE 5CK5A 1F38A 1VI2A 1Y8CA 4Q4HB 3P0JA 3FUCA 4DQVA 1DDOA 1G5QA 3LECA 1ZM3A 4HY3A 3ELBA 1U28C 3KFVA 4EDFA 2WPNA 1MH1A 2HB6A 3PV0A 3E9YA 1EJ6A 1Q20A 1Z82A 4KR6A 3ENVA 1ZGBA 3RRFA 2JBHA 1NVWQ 1XRQA 3EDRA 3GH1A 4RHYA 3BYZA 3NC1C 1U2EA 2J3LA 3NNDA 5ICSA 3CLSC 4H1HA 4PS0A 4EFDA 1JE0A 2GI4A 1AF4A 3OEEA 5AMXA 1TE2A 2FPIA 4DNXA 4IDQA 4TVSA 4D1YA 4LSGA 4ZMSA 5IYZA 1E3EA 2GCNA 4PINA 4RACA 1BYUA 2W7TA 1SH7A 4O4IB 3VHXB 3P2OA 2VWQA 5IT0A 4LOAA 4XLLA 5F9FA 4I9NA 5KJFA 5LKAA 3GVIA 1E8MA 5HF8A 1YR7A 2LVBA 5NLLA 1K0FA 1H4QA 3LQQA 1A5SB 4UNQA 1RRVA 3DVSX 4I14A 3CBGA 5DEIA 4ZGBA 3AF1A 1XL1A 3C4QA 5CFPA 2PEZA 5EMNA 5CMLA 2GEUA 4MDEA 1LPOA 4JJ8A 3NOQA 5C35A 3ACDA 5A0VA 3TE6A 3GLFE 2PJRA 5LC1A 3LPMA 3K72B 3FFAA 1W49A 5T41A 1SCDA 4OO3A 1L7XA 1JEAA 4M83A 1OA1A 4PHCA 2GBCA 2YN0A 3GOHA 5TVGA 3MB5A 3TIGA 2UYYA 4PX5A 5KIAA 4RV5A 1IHDA 5IM5A 4J7AA 4WACA 5ICFA 3FZNA 1T3GA 3CF2A 1H0SA 2HK6A 3L9WA 2D3TA 2QRUA 1GNRA 3EOAI 5FTLA 2FEPA 2J4CA 1I2DA 3FZGA 3ELDA 4YRTA 4H0FA 4CLXA 3GN2A 5EJIA 2H1WA 2Q29A 4KQ1A 4MW5A 4YWJA 1DUSA 1TMKA 2W2LA 1NBIA 4OAPA 3GUYA 4UVIA 3BC1A 3FDIA 2E4UA 2BI8A 1DX6A 1RIIA 3O1LA 4A8HA 1D2HA 3AHHA 3TZQA 3TVDA 3C41J 4QOIA 2HXSA 1EESA 1LVHA 4QGAA 3EIXA 3NPMA 4ISCA 4QRIA 5KTPA 3PFKA 2B69A 1BMFA 4GP7A 4I6GA 4OF4A 4WE3A 4PHGA 2REBA 3U3OA 2G9VA 2VFAA 3IKTA 4DQLA 3PPYA 1KK3A 1O9GA 3L7LA 1ZUWA 5DLEA 1H85A 5CFRA 3WLRA 5K3EA 4LWZA 3M6VA 4NU0A 2VAMA 4OCZA 3U7HB 2D8AA 1U0SY 1BNCA 5FWXA 4UNNA 1UR5A 2BMAA 3A2KA 3V42A 3DV9A 3VOBA 2O1SA 1EHCA 1HTTA 3TZEA 4CMBA 1YVUA 1Q0UA 2JANA 2JI7A 2A5GA 2O5VA 3HU2A 4DUGA 1T1IA 4QYMA 2VWHA 5K8JB 4M49A 1CQZA 4DA0A 1S8AA 5H4HA 4PRZA 4GXRA 5DP1A 1SUEA 4NDNE 4RVHA 3C7DB 4BKUA 5JS1A 4O1IA 3UJBA 5CEEA 1O7JA 4JJ4A 1YFKA 3JQBC 4FCTA 1ZK2A 1YQEA 2YWRA 3D3WB 3H5AA 4H3SA 4WOCA 4AY5A 3AW8A 4B17A 4EIWA 4WKBA 4X24A 1YR3A 2XCIA 2ZEJA 5C34B 1T5DX 2ORIA 2P8JA 5EEGA 3REOA 4K28A 5AESA 4X8OA 1GDDA 4WADA 1CUWA 1UBHS 4TMFA 4D9KA 2BLNA 1G4AE 1K08A 5B55A 3VOAA 2C7VA 4M3NA 1FU7A 2QRGA 4NBKA 3BE8A 4Z0PA 3O95A 4KDFA 3ZGLA 3DF7A 2R1TB 2Z9DA 1N9KA 3OMWA 5DI9A 2FSPA 1NF2A 2ILVA 4WNYA 3TLMA 1KNQA 1D7OA 2JJ2A 2Q41A 3OQHA 1RJ9A 2ZBVA 3PC3A 4MW1A 4DM4A 1UDBA 1JLLA 1P1BA 2J3KA 3OKPA 5A6VA 5KJ1A 2DTDA 4N7RA 4WH0A 3ANYB 4HS9A 1OBHA 3USCS 2FPGA 4I55F 1WCWA 4GLLA 4J16A 1F51E 4XM1A 3C6XA 1MORA 4BNKA 4JJIA 4ZAVA 4E3WA 3MTAA 4OD0A 1HKUA 2KM1A 1JJ7A 4YRNA 1QHHB 3AESB 5GV8A 1YFZA 4P7GA 2J3IA 1SURA 4EZEA 4QJ4A 3OZUA 3SX2A 3VNAA 4X45A 1TLTA 1E9FA 4R98A 1QZZA 2FP3A 5FI1B 3IOEA 3WGHA 2KI5A 3LUAA 2CE7A 1QNFA 5TARA 4EI8A 2XI4A 4AZ0B 3HKBA 4UOZA 4KP7A 2O8CB 3W5DA 1MW9X 4MZDA 4RLQA 1LS1A 4EI7A 3CVWA 2ZAGA 1EUYA 4JP8A 3L1UA 1J2UA 2VTBB 3VZCA 1GV1A 3N8KA 4BGVA 3QRWA 1WSDA 3C1AA 3ZOKA 3VC2A 4Y6SA 2UVPA 4KE9A 4C4SA 2FPUA 4DJTA 3I4FA 4FHFA 1YKGA 3MWEB 4BO1A 3OPNA 3KWFA 3BUSA 1YJQA 3PPWA 4L4ZA 2ESRA 2Z6UA 3ZU2A 2QMUA 1X7WB 3RYIB 3CB2A 2BGUA 1CJSA 3D6AA 3T6KA 3OMLA 2YX1A 2ZSEA 3PEEA 1XVAA 1SVKA 3R0ZA 3LHFA 4NTZA 2IYPA 3W9SA 4BCDA 4HPJB 4I9HA 4HAXA 1UBKS 4DC1A 2I8AA 1YC5A 2VXOA 3CX7A 3LK7A 4C7XA 3L01A 5IVIA 4L0CA 2B99A 2JHFA 1AS0A 5BNWA 4M7PA 4ZO8A 3KO8A 3R0JA 2JAOA 2WSMA 5K9ZA 5CCBA 1Q3HA 3FOEC 3QVJA 2SCUA 1RHUA 1KQNA 2OK8A 1A5TA 1B6RA 1XZKA 2ZRGA 3PNQA 3QA3E 5LYJA 5A5VA 1P1KA 1WUJS 2ASVA 3JQAA 4HFRA 2XMSA 4A0HA 3Q0EA 4QLBA 2YWHA 1CUFA 1SUDA 1YRHA 1H1LA 1FRQA 1XLVA 1VL1A 1BKSB 2PX3A 2WICA 2WI8A 1N7GA 3C6ZA 3II6X 2QZ4A 2H6EA 3SDBA 3UWMA 2C04A 5KVQA 2OGUA 4BFVA 5AJUA 1XCOA 1Y3IA 1HO3A 3CNLA 4JI1B 4HAVA 1MAAA 4QQRA 3PC7A 2QM8A 4K6FA 3AY3A 1RJDA 4KAJA 4AYTA 4C04A 3QEOA 3OTHA 4DT1A 3C6QA 1EFPA 4KH0A 1JQEA 4Q47A 1NC1A 5BSWA 2NQTA 4YROA 1IEQA 3T61A 4M87A 3FI0A 2YZ2A 3U3DA 2O0MA 1J0EA 3DW3X 4NZ9A 4B5LA 1P91A 1V5IA 3CV3A 1E3WA 5FPHA 3RS7A 4CLDA 5T4FA 6LDHA 4EHKA 4UEWA 5EJ9A 2D06A 3H5IA 2XYVA 4NOLA 2GLUA 1TJPB 1K9VF 4OHCA 3FPKA 5CAEA 1DWUA 4K86A 1MAUA 2XYGA 3SR3A 4B46A 2AE2A 3KT0A 1OC2A 1EFLA 1UJ4A 1Y48E 1EA5A 2HSDA 3IPYA 4U7JA 1KEWA 2ZYVX 2N9UA 2Q7XA 2APJA 4D8YA 3FRIA 4MUBA 2QTNA 1XKLA 4L8FA 4MQMA 3ESXA 3QYAA 1TVMA 4DV5B 2XX3A 1FYXA 1X1CA 4E2YA 1Z9BA 1R8JA 2XQGA 4R1NA 5LZ4A 4CKEB 5E1MA 1MAVA 2OCLA 4FR5A 2AHOA 1XWIA 5JZSA 5JVDF 3BWMA 1ODIA 3FHCB 3CF6R 4JSRA 3RU9A 1ZOSA 3B3AA 1T13A 3PDJA 4XTCS 3AUJB 3IILA 2YHIB 4ZDWA 3VU9B 2X4LA 1V7CA 4P3PA 3B1YA 1QQTA 3JCZA 5TMPA 2BKLA 4W1SA 3PRKE 4ONEA 3MGCA 3FPBA 4DCTA 2PSJA 4U2GA 2FX2A 5FBLB 1L6IA 2GCOB 1ZGZA 5AJTA 5FYDA 1FUEA 1C8BA 1PGNA 1DWPA 2BGRA 3B2QA 2IYWA 5ARDA 2NVUB 4RZ3A 4BMVA 1O08A 3I53A 5K8UA 5LDGA 1N7HA 1NDUA 1U2TA 3ASYA 4RSHA 5A04A 2V6JA 2ZWVA 2NZ2A 1K98A 2PX2A 2X0KA 5CT4A 3VR5H 5GJVC 2O8VA 5AVUA 5HZKA 5LP1A 2BZGA 1OA0A 1XRPA 2F1JA 5DHSA 2IUUA 3X2EA 4LX8A 1UINA 4R5MA 4GX1A 1QFJA 4KVAA 1N0IA 3AUSA 5KNCA 4YP0A 3U7GA 1WABA 1N77A 2CL7X 3F4LA 1GG2A 2Q28A 1N2HA 3VPAA 1C5KA 5TLSA 4U7PB 4W8GA 3LY8A 3W6OA 3AVPA 2YBEA 1X0VA 3D31A 4TQUS 1QCZA 4RORA 3VO1A 2JFHA 4LOLA 4C7KA 3AVOA 3SU8A 4CG3A 4BECA 4FWIB 1F8XA 3B1ZA 4OMUA 4TRJA 1Q0HA 3RYFA 121PA 4G5HA 3BL6A 4H15A 4H77A 3DYIA 4J4HA 3PRJA 2CDBA 3A4YA 4CIYA 4AMGA 1NN1A 1QVAA 2QDKA 4EUHA 3CWCA 3FTCA 2H1OA 2K2WA 1S3IA 5DSXA 1AV6A 1U2DA 2R8ZA 2H8KA 2Y92A 1DT5A 1N2JA 1S2MA 5ERGB 4E33A 4B31A 3BTVA 1FYWA 3HJAA 1TMOA 1D5WA 1P8AA 2XNSA 3IB3A 3KSAC 1CRQA 4IIBA 3PR3A 2D3WA 4FGZA 2Q7DA 1T8YA 4D5GA 2JRCA 2EJCA 2RONA 4UEKA 2F3UA 4XM0A 2XUGA 1KDVA 4AZTA 4DTCA 2LV8A 4PHHA 5U4XA 1NG1A 3ROZA 1AKUA 2OVFA 4ZI7F 2RMKA 1G8YA 3PNBA 4O2LA 1OLXB 1M8GA 4HDRB 4NATA 2GZ3A 4PVDA 5AO9A 5I7VA 2HQOA 3IRUA 3TCXB 3CKMA 4C7MA 1R6DA 1NMQA 4M0DA 5FT9A 2X1VA 3ZWOA 2XTZA 4C76A 1L5WA 1VMIA 2CLDX 2G17A 4N3AA 2NUTB 2H57A 4KN5A 3AF2A 3SICE 5ENZA 1AKTA 3ZHOA 2QUIA 1KMCA 4KGDA 1ZISA 3VKUA 1ZAKA 2XUQA 5C4GB 1V11A 4EJSB 5L4LA 3CZAA 1JNYA 1SVSA 2HBZA 3CLSD 3LDAA 3ESQA 2PT6A 3O1HB 1LCIA 3ZNNA 1PV4A 1KPIA 3U4HA 1U5CA 1OCEA 5C32A 2GN4A 1XQ6A 1U3FA 2XGMA 2B20A 3ND7A 5AHKA 2P4UA 3HZRA 4YONB 3SIPA 3W06A 4QODA 3I04A 2JS7A 3OC6A 5DWQA 4I66A 4ZMRA 1CF4A 1NXWA 3UHFA 3ZBPA 4I5GA 1KI7A 2CDRA 2B3TA 1LSJA 2BE9A 2ZIVB 3DV0A 4OMFG 2QENA 3L93A 1NE7A 3AR3A 2WKSA 4BNHA 3I2JA 1KI8A 3GJQA 1RRMA 2HSZA 4O8CA 4PR0A 3DTYA 3X3HA 3B9BA 1C9EA 2BUBA 2C77A 1U6JA 2JRLA 3CTMA 4IMJB 5GV7A 3TB4A 4TYYA 4WVLA 1WVGA 2A0YA 3EVFA 4N5IX 2NV2B 4D7AA 3I3SR 1P81A 2NADA 3B3QA 4WDQA 4D4JA 3KM0A 3QXXA 2N3ZA 4R4JA 4PAQA 2E6KA 4S1WA 3PCTA 5F5NA 3NHKA 1G8JA 1T5IA 3D6NB 3ML1A 4Q66C 1SKMA 3SDSA 4BBPA 3PUYA 1MQ9A 3RT9A 5G40A 4IO0A 1ZK0A 2JB9A 3QENA 1U3TA 3WLSA 5CLJA 4LHSA 5JD6A 5B3AA 1YASA 5KJCA 4RJJA 1GKLA 1IUOA 3ZCSA 3RUAA 4D96A 3G79A 1FBTA 2MT9A 3B89A 2ZCUA 2GCOA 5AICA 5EWJA 3M6WA 1NBAA 3EULA 1EFVB 1TMGE 4R2XA 4EATA 3RC7A 1TUIA 3BGDA 2H0AA 2R5FA 2DPYA 2YZMA 2O4UX 2Q5LA 3BIFA 2JPDA 3NBXX 2JLUA 3V8EA 4MGIR 2WUDA 3HJRA 2YHIA 4J07A 3PDIA 3W4IA 2P91A 4J1QA 5J9FA 4JQZA 3AEKB 1LPMA 1KYTA 1EX7A 2O2YA 3E27A 4E15A 1BQ3A 2VPIA 2Z9CA 3C6BA 1N2XA 1EFHA 1TQ8A 2PKQO 3CEAA 1UBRS 2CMDA 2FEOA 4P6VF 1JKMA 3FYUA 1LI5A 3MS2A 4J6FA 5TE9A 2ZIAA 2E49A 4DDKA 5B5SA 1RQ7A 3N6XA 3IVGA 3P0RA 1SXQA 5SYNA 2R60A 5C8DA 2H1CA 5AW0A 3CLUC 3HKEB 1HGXA 4WUVA 3AT1A 1S4MA 4KPUB 2HHJA 3GGSA 2HCTA 3EWAA 3G49A 3QTBA 4IQ4A 4TLDA 3HCWA 3UJAA 4UVGA 4Y9TA 5JECA 5JJKA 1OJ7A 2HRDA 3W5VA 2AR7A 3KOXA 1NOJA 3BTUA 1U31A 1F2UB 1VSTA 1AUPA 2DSTA 2XLBA 3PUZA 1CUBA 1JH8A 1QZUA 2OOKA 2YRFA 3QHQA 4G24A 1CERA 3RJZA 4CYMA 4PV7A 2EZ9A 4TYQA 1QTRA 4OLFA 4XWAA 4KDCA 1DBQA 4R84A 2IE8A 4JLJA 4RD6A 1SM4A 1WA5A 3R41A 5KJ6A 2AHRA 1WV1A 1HH4A 1LQUA 2VRBA 4MWTA 2VLBA 1G6OA 2WWHA 4YJFA 2GZ2A 2F55A 3EG5A 1GDTA 5AKIA 2QAGA 1KMHB 1KARA 4DBVO 3U7IA 3CMCO 4HBZA 3VU8A 1CIJA 2JIZA 3TIXB 3Q11A 4BV2A 2GB4A 1FP2A 3CVUA 1PBTA 2HIMA 4L4RA 1N4DA 1WNTA 3GG9A 4DJAA 2PUJA 5F23A 2Q3HA 2BR3A 1CY1A 5HIAA 1DLIA 1W5SA 3CLHA 4IDNA 1ZOIA 1E7QA 2E4YA 1XD2A 2V9PA 4GBMA 3RJ5A 1C0KA 1DP4A 3R5FA 5EE3A 4HV4A 4G67A 4IILA 3SX0A 2FJPA 1D6NA 4NEQA 3BSFA 1I3KA 2BUCA 1QE5A 4FFWA 1X7DA 2G1KA 4G2NA 3UH0A 1RRPA 1XZDA 2D1FA 2ZIWB 1YJ8A 4D98A 4LHVA 3I9NA 5J2UB 1E5QA 3NHMA 1N2OA 2CFSA 3KPJA 4B73A 4D79A 3H3XA 1Y6JA 4JYCA 2F9FA 4DWJA 4F6LA 3G0HA 3B8HA 3O5AA 4FFNA 3K8QA 1V4BA 3EGXA 3KZ1E 1IM8A 1IXZA 4JZKA 2COEA 4LJYA 3T3IA 5KC9A 5LD2C 1UBGA 2F48A 2DECA 3IAEA 4OL9A 5GVRA 3REQA 5YASA 3SXPA 1IIRA 1O5TA 3IPCA 2CB9A 1FC0A 2JAHA 1U04A 3OZWA 1CUDA 1P9LA 2GPYA 3PQ7A 3QBEA 1JQKA 3BB1A 2QRLA 2CLMB 3HYRA 2I2AA 1ZM7A 3R2JA 4FD2A 3JAMA 3EK2A 3FH0A 3ET5A 5IABA 2TMDA 3WY9A 2WZCA 3D6MA 2XE8A 2M6SA 3P32A 4I4CA 2PKRA 3KKKA 1U2QA 1S3SA 1TL7C 2NYUA 4DLBA 4LVNA 1B00A 3NUZA 1MJNA 2AVNA 4MWOA 2AA3A 2I7VA 3P4XA 2A5DA 4OQPA 1H2HA 3A6PC 2BKAA 2IC5A 1Z6YA 1AGXA 1TO6A 3EY9A 3GAAA 4YP6A 3DM5A 5GWXA 4EZIA 5JFOA 4PC3A 1YZNA 4E51A 2H7CA 3I6MA 3JQGB 3VYTB 3QM1A 4RH3A 1O6CA 5FNZA 1MEOA 3O2QB 2ZU0C 4WY5A 1UQUA 4IF4A 2Q5EA 4QFCA 1I6LA 3BSYA 4Q7EA 3AB3A 4QYXA 3HNOA 2RHRA 2OTCA 2C0QA 3UK1A 5I5GA 3HXQA 2F62A 1IQRA 3EZ6A 1U99A 3DDUA 3F8SA 7YASA 2ZRQA 3W3AD 3KYJB 3MJHA 1RWOA 3IP6A 3R3UA 1U2PA 1G17A 3AFNA 4XGRA 3U61B 3CVYA 4LYJA 3P9CA 2VOEA 3EYWA 3SEQA 3EPLA 2ZK7A 3BCRA 2OHVA 2BPOA 1GU1A 3HA7A 4U0KA 3T5TA 4O8ZA 2WF7A 1YBAA 4E5SA 1RXCA 3REFA 4Z0NA 3E3AA 4YJGB 3T7AA 2WF9A 1KQ3A 3UBTA 4BLOA 4CEJA 2A9OA 2JNWA 5TJ9A 2XECA 1DS6A 3CZQA 4RQAA 2ODEA 2NTNA 2CJXA 4S35A 3SF8B 3AMVA 3V48A 4PSVA 1UWCA 2YV4A 4YAFA 4B09A 4CKZA 5IBCA 4AIIA 3CUTA 5JSFA 4RJIA 1MX9A 1O57A 3ZCUA 1T9DA 3V7YA 1MCZA 3HCDA 3N5CA 1W4BA 1WQ4A 2O5RA 5CD1A 4FDVA 1V5GA 3W4KA 1ITZA 3FOAA 4UPVA 1ZVJA 3Q0IA 1T8TA 3AHGA 2JEYA 1YB4A 4Z7OB 5CDFA 3MLAA 5JE8A 1T0HB 3OECA 3UV6A 3GFSA 5E4YA 2CHFA 4MW4A 2N46A 3G17A 4W7SA 4GZMA 3Q41A 2WTEA 3BZBA 2C2MA 4EHNA 3LPCA 2D13A 2PSEA 2I2CA 2VAVA 4HH3C 3ZC3A 1EEHA 3ZDXB 5BSEA 3NP9A 5L3RA 3RK1A 5ULLA 3EIFA 4PC6A 3WSWA 1ZN7A 2WTUA 5TPWB 4ARIA 5AVRA 1Q91A 2ACEA 3IMCA 1JF8A 2DH5A 3M4ZA 4O0MA 2VH1A 1Z2EA 2NTYC 4O25A 5M2QA 1E9SA 1ACJA 1C0LA 1TK2A 1X9HA 2DUNA 3PUXA 3K31A 4BFUA 4JXXA 3DMYA 3TRKA 3P94A 5KYYB 4TRMA 4LMPA 4I4TB 5HDQA 1W581 4PG8A 1P4GA 2Y66A 2XPCA 3ZWYA 2CWDA 4YCMA 3B7PA 2FEXA 3PF9A 4NE2A 4RABA 5B2ZA 3NHJA 1LJUA 1C7IA 4RTRA 2O8BA 1NIJA 1EVYA 3A25A 3B6EA 1NJ5A 1G16A 2BGGA 4JLKA 4HWKA 4X94A 1NVXQ 1XELA 4LK3A 3OOEA 5G4KA 4CM8A 5GONF 5KYXB 3GP8A 2EF0A 2OLEA 1IRXA 3KUCA 5EIHA 5C7IO 2CF6A 4IUYA 1HZZC 1R0YA 1NGSA 1Y4AE 1NE2A 3A32A 1BXGB 2RHJA 3HVUA 3LCUA 4LY3A 4OKSA 1SOAA 4DQXA 1C30A 3H2SA 4Q4JA 4ZEMA 2JLCA 1K06A 1K66A 3ORYA 4KX5A 4WCFC 3UJ9A 2I6QA 5BOSB 1TYAE 4Q12A 4BCCA 1HE5A 2WYWA 4DJJA 4GC9A 3LWBA 4II7A 1M1XB 4WZBA 3ND5A 4WNAA 3CGWA 2PYIA 3NAMA 5COAA 1KZYC 4DN6A 4ZVTA 1JR3E 3E9MA 1B74A 1Z7GA 5EC8A 2XDQA 4GI7A 2DOKA 4CFYA 1PQWA 2P6MA 4HNSA 2DBZA 4ZT4A 1ARZA 1W35A 2Y99A 4D4LA 5KEIA 4COOA 4DJFC 4OB7A 2NW6A 2OQ2A 3IBGA 5CXXA 2NWQA 1NSFA 4F8JA 1V8FA 4U9HS 1O9BA 4ZJYA 4C5BA 1O0BA 1WZIA 3VO9A 4WOPA 4AWXA 1VB5A 4OPMA 3AM1A 2W2OA 1Y63A 2ATEA 2E0IA 3L8HA 3K0HA 4MWCA 5EXEA 4RWEA 1JDSA 5JNTA 5FOSA 2J7KA 4TYWA 3THRA 4RHTA 4PG6A 4D4IA 2Q8NA 2I4LA 1Y82A 2WIFA 1ADCA 3HB5X 4EEZA 2J4DA 2YJTD 1MZVA 2ZB7A 1IN7A 4OXQA 5T4HA 4DKJA 4XFDA 3DAFA 2XRMA 4E5VA 1KK0A 3R5SA 3LCMA 1OX5A 3GGCA 4CLOA 1EM6A 4XGNA 3WNCA 3CEJA 3L7MA 5A9SB 4G5RA 4BVJA 3C3JA 1NV9A 3AEQB 3ONNA 4IEEA 3ZDQA 2AI3A 1O94D 4K81B 4BRWA 3U4QB 3WHPA 1W0KA 3BT7A 1TEZA 4PZUA 1GNLA 3T3NA 4UUOA 2VA9A 1DBRA 3GNLA 5DSTA 3ND6A 1UBTS 1DJNA 1MP0A 3I23A 4PZAA 4ZQHA 3U1VA 1WIWA 4L0MA 4V02A 4NV3A 5JNUA 1IPEA 1M75A 4JB0A 3X1DA 2GBLA 3G2IA 1G98A 3TZHA 3CONA 4UOEA 1QIMA 1LSUA 1OZFA 3OVMA 3TKLA 3IEMA 4XI9A 2BFFA 5DNYB 2ZS8A 4J2OA 3PL1A 2Y1KA 5HS6A 1XRJA 2FZEA 5B1YA 4JCCA 4KBFA 1U0FA 2WWYA 5FR2A 2GJ8A 2RBKA 1KZ4A 4E2WA 4PYMA 4U8HA 3KFXA 3L5OA 3B3JA 4KREA 2H85A 4RJ2A 4ZP1A 5ADHA 1ZL0A 3HR8A 1ZHHA 3BQNB 4S0ZA 2V6FA 1X6VA 1V39A 1RM0A 3ITKA 3BH7A 4WINA 3WQBA 1YJAA 1C9NA 5CDSA 3A31A 3I58A 2XOEA 4DG8A 2BFFB 1S02A 1Z83A 1B14A 3BXXA 4HNAA 1JP7A 1B4DA 2XMBA 1Z6XA 3F9CA 3VX4A 3SMQA 3L0OA 3LBFA 1Z4QA 2OORA 3O4VA 4I2NA 4CUJA 4EK9A 2C98A 5KNBA 4Z4QA 3OE1A 3IQHX 1FLAA 2ASEA 2VK8A 5CLHA 3VAYA 5J59A 2FG6C 1YQGA 2YJ4A 3HHEA 3EQ8A 3IIMA 3WNVA 4GT1A 4URXR 1LQ2A 1NJSA 4K9KA 1J8VA 1S8NA 1ONPA 2BCGY 2PA0A 4M89A 2VR1A 4O59O 3GNQA 3DYBA 2QXTA 1ADGA 3ANLA 4NBLA 3U7RA 4DLZA 4N48A 4QUDA 1Z4JA 1BWRA 1KAMA 2I71A 3PGKA 1UMDA 1DDGA 1YZ3A 2VNHA 4MVJH 1OFGA 4G56A 3GEHA 4EKGA 1WHSB 2EIXA 1G5IA 4ZD6A 2R6R1 1VKRA 3Q12A 2O3TA 4BN4A 1U98A 5BVHA 5IF3A 2JCXA 4OIMA 3PFWO 3AFMA 3D2AA 2OXCA 1STOA 4K87A 3ZWKA 4C78A 5JRJA 2VSOA 4Q3NA 4TM8A 4N40A 2Z58A 3CUYA 3FSGA 1QV6A 4TUYF 5AH0A 1RXSA 2I03A 4DABA 2P79A 3P20A 5CTJA 1BX3A 3LL7A 2O0KA 2P3QA 4UREA 4FFDA 4XQ9A 2M6KA 1M72A 1YS6A 3U9TA 1F20A 1NASA 2ZIZA 1TZCA 1VYVA 3H8WA 3COZA 2WHQA 1HLGA 1N75A 1RXUA 2NYVA 2VJLA 4FDLA 1COZA 1O8BA 1QDUA 4XVHA 3VM6A 1PE0A 2I55A 3E5RA 4XRGA 3AGQA 5ITVA 1IEWA 1GGKA 1I8TA 4BVLA 2EHJA 5U1PA 3HDYA 4CN9A 2ATCA 2IHTA 2O48X 3CNNA 3UATA 1EX9A 3GVXA 4G1BA 1J06A 4IHKA 4R9NA 3VDNB 5I47A 1NJ8A 4XD2A 1XDZA 2RHHA 3KL4A 2BH9A 1DQRA 2E1PA 2W6PA 4CV1A 3U39A 1LBIA 1ILWA 2FUG1 1YMUA 1KEPA 1P80A 2YQZA 3LUFA 5HVNA 3PQ8A 2H52A 3UICA 3OCZA 3AJ8A 2LKCA 1JG2A 1E94E 1VRWA 2DHEA 3WRWA 3WX0A 2ZM5A 3OZGA 3T7DA 2Y1GA 1OX4B 3C3EA 1P19A 1XXHE 4PZPA 3ZQKA 2GD2A 4G09A 3ZLUA 1GZ7A 3EZ2A 1A8QA 1XMXA 2BFBA 3RH0A 3UMGA 2C2OA 3W5BA 2HC9A 5LB4A 4C07A 1AURA 2ZYHA 4GOJA 1L4LA 2GHIA 3GEEA 3UWPA 3K0SA 3GLSA 3EG9B 3A3PA 4PZ0A 2AYXA 4ZVNA 5TVKA 4EPYA 1IWOA 2R3SA 4I4TA 3SE7A 3FHLA 1S2GA 2NU6B 1OIWA 4RVNA 4FYVA 4JCOA 4L2IA 3UXYA 3PQ6A 3S28A 4D56A 1KI6B 4B87A 4Q3LA 1V1RA 4LNAA 4MYRA 1CHDA 3BJZA 4O08A 3IBSA 4U3JA 4WCDA 1Z36A 4D44A 3GZTB 2H7XA 5GM2A 1Y9JA 4WA7A 3ZYCA 4Z1OA 1Z7YA 1MOSA 5KYNA 1BX1A 4IS2A 3QELB 1CZNA 3QOYA 3A1CA 4OU4A 3MPOA 3HZHA 4AU1A 4G0XA 1O0SA 1F6DA 2VF8A 3WGKA 3INTA 3RKUA 2HU8A 3JAWA 2OYSA 2RGEA 2NX2A 1A2OA 5TEVA 1AZLA 2UXDB 2FWAA 4D6PA 2XCUA 1JEOA 1MG5A 1SHJA 1VJ0A 2ZG6A 4WFQA 4XB1A 4K6HA 3ZGZA 1MFPA 1N2ZA 4G5FA 1GG8A 3S8EA 1QUEA 1TTQB 1NN0A 2VBIA 1FK8A 4K88A 4IJ5A 3HEBA 4EITA 4YJ2A 4JSTA 1NLMA 3I61A 4RTPA 2X9NA 4H6VA 4P38A 2A9QA 4DPMA 1A0OA 2Z4SA 2ZROA 2IQIA 3HCEA 4PQGA 2W70A 4CG0A 2J9RA 2OGWA 3T3HA 1GV0A 3KJFA 4MKHA 1P33A 5HDBB 2AMVA 3NOOA 1JYFA 2XAUA 4FC7A 1KU6A 2O05A 3TQQA 1HY3A 3ITEA 3EQ6A 1CS4C 2XCOA 3G3EA 4BO4A 2WE8A 3HCFA 2C9ZA 1PT7A 5THQA 4ABYA 1E64A 2VHXA 4MMYB 3FGPA 2V9ZA 3A6HA 1UP6A 4KRXA 1YRQA 4MUHA 5BPFA 5CFNA 1YVDA 5K5EA 3NM5A 4JUBA 5IT4A 3MXTA 5JSKA 4EUEA 2HYIC 4H7EA 3C8UA 2SHKA 2WAYA 4AP5A 4KE8A 3SQWA 2EFYA 2W5UA 3WGJA 2F9LA 4JT4A 3AOEC 1B76A 2HCRA 3AONB 1XLUA 3QU9A 3NGXA 1AZWA 1Z5VA 3D6JA 3A6GA 3DTVD 4Z9AA 2DC1A 3O8RA 1A95A 5CHYA 4JHLA 1IULA 1YL7A 1XLTC 3ZY2A 3KSBC 4OLAA 2Z2XA 4P3KA 2F1KA 4YUZA 4MUJA 1CG6A 4TXLA 1L3IA 2XB6A 3DT6A 4NENB 5E4TA 3J7AC 3M81A 4QKQA 5L3SB 5L4NA 1E6EA 3ILXA 4RM2A 1R9JA 3IUPA 4AN1A 4CR7A 3CNHA 1M8PA 3I2YX 4TXHA 4X7PA 2PBLA 4V3BA 5F64A 3RWOA 4CCAA 1COWD 1FE8A 3B6IA 3JR3A 2D5BA 4GPIB 3FTPA 4XFJA 3HRKA 2JFUA 5IAEA 1UBSB 2BGIA 3ZZNA 3DE4X 1Q84A 2FW6A 1K6IA 4PGGA 2VUIB 3D1JA 3AJEA 4J94A 5FNVF 3U0VA 1WZ2A 2RGYA 2OCAA 3IKVA 4E31A 3K6KA 3R44A 2VZ0A 4GKVA 1RYZA 3H1GA 3Q7SA 1GL6A 2Z30A 3MOIA 1DQYA 1AO3A 3IE1A 3NC0C 4M1WA 5L3VA 5JW6A 1VA4A 2CUKA 3N2KB 4JT8A 3D5EA 1A8PA 3GLHA 4FMPA 3EA5A 1LTQA 2B78A 4GZLA 4V1CB 3B13B 1KZHA 1ZBDA 1QAMA 3DVAA 4RX1A 3AL3A 3TTWA 1HTBA 5LXTF 4H0NA 5AI4A 1L5OA 1RHKA 4POAA 3NDRA 4UM7A 2NPFA 2DVMA 4R05A 3IQFA 3MWDB 4D3XA 9GPBA 3FBTA 1Z0AA 2QKYA 4NEHB 1OXXK 5E6UB 4JXZA 2PGIA 2IODA 3LDFA 1UKAA 3GEBA 3PGJA 2FCAA 4BE9A 3W5AA 1I7SB 2ILTA 2XCRB 4RXTA 3BCHA 2ZWMA 1E2FA 2XKKA 2OHJA 4V0RA 1IQ0A 4YMHA 5ADWA 5CDUA 5CFMA 2X4IA 2JL1A 1H0RA 3C85A 4DCMA 1OKKA 1ONBA 1Z0DA 3NR2A 4MR9B 3RU3A 4DHWA 1MIOB 2A3RA 1RE0A 1EK6A 2G4LA 1ECGA 2F3SA 2HAEA 1K9SA 2D2XA 2Q46A 2RAFA 2XWSA 3CRQA 1RKUA 2CYAA 3EEIA 2Q62A 3E82A 5E6RB 2ZKLA 3G6WA 3UNXA 2J8ZA 1UM9A 4JLOA 4DUGD 4NP6A 4ISBA 3RFXA 4HDKA 4W9RA 2EX4A 5CT5A 1BQ4A 2CFTA 2BBWA 1JMVA 1RJFA 4J9VA 5HCIA 2J3JA 1F0KA 4I4TF 3FYUB 2XVMA 3PQFA 3L2OB 5JRDS 1F1BA 2MSNA 1ZH0A 2VDLB 2RAVA 3M82A 1NXXA 3L7JA 5ES4B 3RVJA 4H1TA 4E11A 3DO8A 1LBEA 1P1HA 4LDPA 2JEOA 4MQLA 2BM0A 1Q2XA 3LA6A 5JYBA 1WS6A 3VR6H 4G5GA 2NIPA 1M1UA 2ZVJA 1NDQA 4ETWA 4RHCA 1XKQA 3LY7A 1J56A 1T8RA 1FDOA 4K9SA 4M1OA 1K88A 4F3CA 2RB4A 5EE9A 1WCIB 2P6NA 4AY4A 3KETA 4B3SB 4E7PA 1ZOOA 4BTEA 1U7WA 2GKOA 1XVVA 1KNXA 3LLMA 3A3OA 3WLIA 4DLVA 1MN6A 3NONA 4AY2A 2AXEA 2XWJI 4HDOB 1AJEA 5F3RA 9LDTA 3OO0A 5H83A 3FF4A 4CCYA 1TU3A 4N0EA 4DW8A 1OBFO 3P45A 1ZOPA 4AG6A 1KQGA 3QKWA 4LQDA 3FOBA 3R8FA 5KNDD 4E6PA 2V59A 5F52A 2XNJA 4CEHB 1X1BA 3HM2A 4PSCA 4OYHA 5D3KA 1CDOA 4AYWA 4HNTA 3B6JA 4H7JA 3BRCA 1RI2A 2FPPA 3FDZB 1C7EA 3LP8A 1XQYA 3OEHD 2DKOA 3BDAA 4IYRA 1M7BA 4JK3A 3TOCA 4KXFB 2QY6A 1NBMD 1Z39A 5JY1A 4TUYA 3TOXA 3H0EA 2D2FA 1Z12A 4GOMD 1V4VA 2PZEA 2RAUA 4LHYA 3CPEA 2HOQA 1Z2PX 3DSRA 2WIKA 4WXYB 2CSUA 2VRNA 1W8DA 2C2ZA 4XGKA 2G1JA 3G23A 3ODPA 3V1NA 3VSEA 4F06A 1T6XA 3DMHA 4OKNA 4ZVLA 3QGMA 3E9EA 2HJSA 3D6HA 1K6XA 2PXCA 4ALLA 4K8OA 3IPLA 5BNIA 4B3DA 5DNCA 4B6GA 2EKPA 2VYNA 1W36D 3ZZTA 4MUNA 4MQ5A 1R5BA 2ICAA 1FXSA 3VVLA 1EWVA 3WIEA 1LW7A 3GMDA 1Q6YA 2X15A 3HA5A 1XU4A 3JATA 4INJA 5FUXA 1I24A 2H4WA 4MIKA 2UV8A 3GT0A 1G4HA 1HYHA 1YWGO 2PQ6A 4TKVB 4MW9A 2XV1A 2WK1A 3TD9A 1LK0A 1QIKA 4XLTA 3AKZA 2G6BA 2H08A 2IGTA 5C8YF 2R87A 4F7WA 1WSBA 3R7WA 5B1IA 1JT9A 1QKKA 1E5TA 1TM3E 3ESBA 3GR6A 2H4FA 3UC9A 1J23A 3ZXXA 1GP2A 1DGQA 4QGFA 4KV9A 4TV8B 5KTNA 2RHOA 3C7TA 3KSMA 3BZWA 3R75A 2AFHB 4CTOA 1J90A 3LP6A 3NT5A 4YTEA 1O89A 3G0CA 1M0TA 4MVJP 1P9NA 3BFPA 5E1DA 3VYUB 3OZ7A 4TZ6A 5DO9A 2BF7A 1E1RA 3ILHA 5E8JA 4ZT3A 1OOEA 4HP8A 2GM5A 4KITB 1QYRA 1KERA 4YDRA 1MO4A 2VHCA 2XUFA 3L7AA 4Q3BA 4DLRA 3PLAE 1L8LA 1XEWY 4JKYA 4JYZA 1XHLA 3I12A 3PGXA 1DIBA 2QE7A 4Y2YA 2H3HA 2WIJA 1HEIA 2ZQYA 4RS4A 5JXWA 2C3UA 3FETA 2FRDC 1K97A 2ZETA 1MGOA 4UZSA 5HIKA 3T3DA 4R7ZA 2IIPA 3LM8A 2JJ1A 3B8EA 3I2IA 3FPAA 2BJHA 3AG5A 2NSHA 3DTNA 4L08A 4K8RB 3D1VA 3EPHA 2HHHB 3MTBA 1P29A 3K70D 3AF0A 5ALFA 4W6QA 2FH5B 5ESXA 1Z0JA 1EVEA 3CVVA 4ZEWA 4AQ7A 4DVGA 2QN2A 4I8DA 1YAJA 4CQMB 2FZVA 5AHXA 4LY0A 4OSPA 3DL7A 1GL9B 2PUBA 4RV4A 3GGPA 2MHCA 1SPBS 3VYWA 1E1YA 1FRVA 3CZ5A 2P4SA 4KTTE 4PSUA 1JJVA 1USVA 2AUNA 2BY4A 2LCFA 5JSUA 1JJBA 1Z06A 1GIAA 6YASA 3MNFA 3VR3A 2JF0A 5DMHA 1NVDA 2Q3CA 1IOVA 3F1LA 4JBXA 4RZSA 1PG0A 3IAS6 4IEIA 1O6ZA 3ABQB 1VCOA 3E84A 4Y9UA 4BO3A 5LOVA 1IH8A 3EEOA 2MR5A 2HK9A 1NIPA 1D1PA 2H1LA 3DBVO 3DGFC 3NTVA 1YR9A 4LWQA 1NPTO 3I5UA 1VGVA 3TK1A 1V7ZA 3EGDB 1W94A 4GSKA 3KEMA 1GZ6A 1UMBB 4ZI5A 4CW7A 3V4RA 3DZGA 2EU8A 2J85A 4MVJG 4CKEA 3GLGB 4BMDA 3MJRA 2FJ0A 4LE0A 1QVWA 1ZI9A 3TSYA 5ALMA 4Z49A 3CUEF 4LXYA 2WVHA 2DUWA 4YFYA 1ODJA 1O94A 3VDRA 3COWA 1LDNA 3AXSA 2WJHA 4KI7A 4R8SA 5EQFA 3KXLA 3MB8A 2DPLA 3C39A 2B4AA 3GIWA 2F7SA 1XDDA 1XU7A 2L0XA 4BB0A 5A71A 3CIFA 4F11A 1QMPA 1FNNA 1EP9A 2PLRA 3KX2A 1ZH8A 4UM9D 4LF7B 3FCOA 3KQUA 1JKJA 1ZX1A 4Y3UA 3NHSA 1AK2A 1WDMA 1N5IA 3NHWA 1G2PA 1GFSA 1D2EA 2AK3A 2C1XA 3JQFC 2V7XA 5E9AA 4DSNA 5JXGA 3I62A 4FW8A 5LXTB 2FPLA 1N7JA 4BX9A 2CDNA 1TM2A 1P6UA 5WRFA 1CUZA 1O5IA 1PTKA 1TGYA 3AUXA 2FPXA 3MD0A 1NBME 3MXOA 1EVKA 4LGVA 5BW5A 3OUTA 1E2BA 3FUTA 1YRLA 4DOMA 2RFLA 3SYKA 3FLAA 3KXKA 1FSSA 4LYGA 1W19A 1Z2AA 2XAAA 4XQ0A 3FNBA 4NK5A 1DFGA 4LZJA 4OHVA 4Q6WA 4INZA 3AQ4A 3NEYA 3N05A 5M5BA 3PENA 5ILQA 4DRYA 3KOYA 4HYYA 3VKWA 2VDVE 3FMVA 1TRHA 4Q9NA 4WCFB 3IR6A 2FF7A 1RWPA 3KIPA 4C03A 5EMKA 1LTHR 3HL4A 1EQ2A 3LRTA 3E7DA 4IV8A 1WLSA 3LSTA 4EPRA 2HO5A 1LNZA 1O96B 4ZCLA 2FQWA 3CO0S 4ZXFA 3W5CA 5B4VA 3I92A 4NYJQ 5MN6A 4EJSC 3RS8A 1M8KA 1BDJA 1Q0SA 2Q6TA 4IIEA 4D8XA 3ZDAA 2H17A 4BZXA 5D5HA 3M4JA 5TRTA 4YH1A 4C14A 4FBMA 4EGJA 4WLEA 2WD9A 1GY8A 1KKMA 4FQ8A 2QBYA 4NCIA 2R751 4CT4B 5CYPA 4DF3A 2O07A 4G0QA 5H81A 1C3OA 1JU4A 2RJ3A 2KB0A 3IVCA 3MQ4A 3QLUC 3ZI4A 2A92A 3ZE7A 5BWMA 2PJUA 1XTZA 1X9IA 1J25A 1JHOA 2PL1A 2AR0A 1U63A 1Y6QA 2BH2A 2GESA 2ISSD 5IARA 1TYBE 3ISJA 3P9KA 2LD4A 1O95A 1IBSA 1Z4MA 3OJOA 1GPAA 1PWXA 4KPYA 4AJNA 1V7QA 4LNHA 3HWX1 3P26A 1Y9AA 5H70A 5J2UF 1T15A 3UG7A 3Q3EA 3K09A 2PFSA 4LJ5A 3Q7RA 4BQOA 2ZXFA 3IUSA 2RGUA 4ZIRB 1TAHA 2I2DA 5ALKA 4KQIA 2VTBA 1ZA2A 2DFTA 5TV2A 4HSEA 3DBIA 1Z8HA 1QHSA 3BWVA 3M8KA 2Y1OA 2PHZA 4HDNA 1DEKA 4YRZA 3HV2A 4JBLA 1W0CA 4KPEC 1WB6A 1OROA 1JEYB 4MB6A 4B9AA 3VUFA 4PZDA 1HPLA 3JZFA 4UU1A 3UAOA 2QPTA 3PXBA 1PFQA 4QJ5A 2XMRA 2HJGA 1RAHA 2EQAA 3BGVA 3OCXA 3N2LA 3EAFA 3JASB 4WXRA 3PBKA 1Z18A 5ARCA 1M10A 5IEBA 4B43A 2E5LB 3PD7A 1QHHA 4J43A 4NLLA 3TTSA 2HF8A 2X5JO 3TX2A 4ZJZA 3TOVA 2JD2A 2W83A 1NW7A 1ZXBA 2PJDA 3CYFA 3JYNA 5ETJA 3HFRA 3RAJA 3T0FA 3PNLA 3OPQA 3UCXA 3WL5A 2I6UA 3SC6A 1FRNA 5H5JA 5JAHA 3GROA 3AG6A 4YCAA 4UNPA 1PCXA 4RS3A 1DKNA 1MR3F 2HRZA 1VFNA 3DHYA 1X8XA 2AMJA 2PSDA 2Q6OA 3DEAA 3L41A 4C3OB 2R6FA 4YLYA 2R7AA 2GILA 3SXUA 3NHYA 4MB0A 2RDMA 1UFVA 3T7TA 3FDJA 5CA0A 2P77A 5C1OA 2GZDA 2KE5A 6PFKA 3EPJA 3ZWBA 4BL5A 1NLFA 1ADYA 2ATXA 2IYTA 2YXBA 3ONVA 2DBQA 3LWZA 3QXHA 4HRYA 1G7RA 1KU0A 4GW3A 1BHO1 3AIIA 4WLUA 1RCFA 1A9QA 5KNLA 4MTLA 3BH6A 3BQ9A 3F4BA 3K4PA