4DA9A

Crystal structure of putative short-chain dehydrogenase/reductase from sinorhizobium meliloti 1021
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
219
Chain Sequence
b'MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASDARASRSIINITSVERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase
publication title Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 69
structure length 219
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4da9A00
3FHLA 1CF2O 4IMPA 1K3TA 1XWFA 2HMWA 4GSLA 3HB5X 1NTOA 2I6TA 1OMOA 2HKIA 3JQCA 1LC0A 1LDYA 1CQJA 1F0YA 1FF9A 4WEQA 1Q7CA 1G6KA 1K6JA 3NGXA 1I10A 4CMBA 3DDNA 1E6WA 2GZ2A 3UXYA 2YV2A 3MOGA 2NWQA 1ZK0A 1JW9B 1GL3A 2JKVA 4XYEA 2Q99A 2ZTVA 4NG5A 3ZWOA 3NAQA 1DRWA 3F5QA 1G0OA 1I33A 2BF7A 1QG6A 4RPHA 1ADBA 5G4LA 4CMIA 1Y5MA 3FN4A 3H9JA 1CDOA 1WZEA 2C5AA 4FGSA 3T7EA 3VH2A 4ONEA 4GX5A 1PZHA 1HDRA 1NAIA 1UJMA 3S55A 3FI9A 4RLSA 2VRCA 4FFOA 3ST7A 2ZTUA 4ALJA 1E1MA 1UDBA 1UZMA 2EERA 4PG5A 3OJOA 2NVUA 4DBZA 2AEJA 3ZNNA 3BTSA 3ZWNA 3U4IA 4TRNA 2QRKA 2W90A 1S7CA 4WASA 5I9MA 3JQGB 3S2GA 1OBFO 1OFGA 1KEPA 3RASA 3LSYA 3S8MA 2QQ5A 3F3SA 2W8ZA 2HK8A 4DYVA 2DTXA 3JQ6A 5CPFA 3WR5A 1EFKA 1YBMA 4KTTE 5L4NA 1NYTA 3HNPA 2ZB3A 3UCXA 5B4TA 4XYBA 3KETA 2JAHA 4EEXA 3BA1A 3GA0A 5EESA 3CTMA 1JTVA 1ML3A 3GPDG 1DDOA 4YRAA 1GZ6A 2R00C 4JXKA 4TKLA 4UEKA 4YT8A 5JCJD 1H5QA 1BG6A 5CPBA 2LDXA 2A4KA 1AXGA 1NFQA 3HHPA 1KYQA 4BO6A 1NVGA 3WDSA 2O3JA 3WYEA 2C0CA 3IUPA 2GLXA 2RBEA 2QIOA 2EW8A 1EBFA 1I01A 2I3GA 3H9EO 3TZHA 3BAZA 4NBTA 1E6EA 4RO0A 1EVZA 4XQEA 4YJGB 1NXQA 4KWIA 2GN9A 4TVBA 2SCUA 2XF8A 3W6UA 1NVMB 3DZBA 3QVWA 3DZJA 4FDAA 4QQRA 4BQRA 1QYVA 4TMFA 2VZ0A 3BHIA 4LVCA 5LDGA 2YHIB 3GVPA 5JCXA 1QLJA 2HU2A 2NU7A 4U0JA 2H9IA 4QO7A 1VM6A 1MUUA 3LC2O 1B3RA 4L0QA 4RLHA 4YWJA 3H8VA 4TKMA 2GNAA 4DRYA 5CEEA 1ONNA 2HJRA 4BO4A 1NFRA 4RORA 4TROA 3JQBA 3JQGA 2LDBA 1WMAA 1E7SA 1EDOA 4E2YA 3LLSA 3H7AA 5KJ6A 3DR3A 1YONA 3ZZNA 5GZ3A 2VYVD 2VRBA 3EZLA 4C7KA 1E7RA 5IZCC 3ZWXA 2YUTA 2D0IA 1OZAA 1VKNA 3F5SA 1O5IA 4H7PA 1YB4A 2PGJA 4E4YA 1U2DA 3BMCB 3BZUA 5CG1A 2DTEA 5F5NA 3KZVA 5G0UA 5EN4A 4J0FA 4J2OA 2VCYA 4A2CA 4RF2A 1DC6A 1SAYA 3B1JA 4DVJA 3H2ZA 5G0WA 4ESOA 3ZW9A 4U6SA 4PLPA 3WNVA 4ITUA 1ZEJA 3RBVA 5L7TA 4CM3A 4PVDA 4DLLA 1Y5RA 4YJGA 4YAKA 1NPTO 5F1OA 1E7QA 3E1KA 1VSVA 2VUUA 3NT2A 3I9MA 1JKJA 4H3VA 4FC6A 1PR9A 3AUSA 3D0OA 4JBIA 4MIEA 1LJ8A 1YB5A 3GQVA 1B26A 1YWGO 3MJCA 1JU9A 3ICCA 5ADHA 2YHIA 1ZKMA 4KDFA 4XYGA 2ZTLA 5B37A 4R3NA 1I8TA 2B5WA 1BTOA 3CEAA 1QP8A 2GN4A 2PH5A 3NEPX 3TZ6A 3FCOA 4CLRA 1M6HA 3QIVA 5U4QA 5BSGA 4A7PA 1AHIA 1JDJA 3R6DA 4QTZA 4FOOA 3X2EA 4BNWA 1ZXBA 1LDEA 3F47A 1D1TA 4YR9A 3WGYA 4PG4A 1XLTA 4OXNA 2HCTA 4B7UA 4RVHA 3WGOA 3FTNA 2J6IA 2Q2WA 4Z0TA 1QRRA 3HFGA 4IDEA 1T2CA 1UXGA 4JP3A 4IJWA 4OJNA 2OGUA 5IJZA 3O9ZA 5JXWA 1P44A 3BMCA 4E3ZA 1VL8A 3KO8A 3N7UA 2QRLA 3OH8A 4CM8B 3KEOA 4TWRA 1LBEA 3FBGA 4MOWA 1HYEA 3OMLA 1YBAA 4CM9D 4BNFA 4RPGA 5GZ6A 3FNFA 1HDOA 4CODB 3IAHA 2NV6A 3HZZA 4JN6B 4PG6A 4YAJA 1PZEA 1VI2A 4MIOA 2IRWA 2VHXA 1YL7A 3MCVA 4E32A 5JLAA 3K9QO 3DHNA 3RUEA 3PQDA 3WGIA 3I83A 3VH4A 1F06A 4R5HA 2C2XA 1MG0A 3JCZA 3QWHA 1GAEO 1XCBA 2O3UA 2C7VA 2VWQA 4RVFA 1PSDA 3AUTA 5H83A 3RQSA 3L07A 1EBUA 2O48X 1TA4A 4R9SA 1AE1A 4CMJA 2RAFA 4HWKA 4UUPA 5AOVA 4U0KA 4IJUA 4EI2A 5CDTA 2DAPA 4J4BA 3O38A 2UAGA 5B4VA 4OQYA 5C5IA 1LRJA 1DC4A 4JBGA 3VKUA 1KY4A 4YAEA 2O4CA 1TEHA 2OOSA 4MVJA 4NR0A 3ZWPA 2YDXA 3I4CA 3E9NA 1UXHA 1TI7A 1N8KA 1QORA 2AQ8A 1QV6A 2DLDA 4IIUA 4DUPA 3QVSA 3KXDA 3VPHA 1H6BA 1MFZA 3PQEA 4NI5A 3QWBA 1PJ4A 2X0RA 1PWXA 4HP8A 3JD1A 4ZRNA 4UUOA 3DZGA 4DA9A 4N5LA 3OQ1A 3HN2A 1ZK3A 2VYND 4NU6A 1SEPA 3V2HA 1T24A 3CIFA 5DBFA 3JTMA 1YB1A 1O95A 2DUWA 3L4SO 2O7SA 4AJ2A 3LC7O 4HY3A 4XDYA 3EYWA 3SJUA 4J4TA 3QVXA 1DHRA 2NU6A 3ETDA 4MP3A 1ADCA 3KVOA 1Y7TA 2ZYAA 3QE3A 4MPDA 3ZNPA 3UOGA 4EJ0A 3SLGA 5F1PA 4DPKA 2PNFA 1Z73A 4GQAA 4LW8A 1PU2A 3LZ6A 2DQ4A 1GFSA 1UUFA 1K89A 1T2FA 2ZB4A 2YDYA 3WQRA 4B4WA 2WE7A 2Y0CA 4NK4A 3SJ7A 2VWPA 2EP5A 1Q0HA 1UR5A 1C0KA 2X22A 3DHYA 1Z6ZA 4L75A 1LRKA 1NAHA 1YRLA 3OJEA 1PZGA 4W82A 5L4LA 1P0CA 1TT7A 2R00A 4PG7A 3AFMA 1AHHA 3E6AA 1MXHA 4PLYA 4PVCA 2G1UA 4OQZA 4E5NA 2NUAA 2YW9A 4AJIA 1V3UA 3QWFA 4ALMA 3K73O 2EG9A 2EP7A 1NWCA 2P4QA 3ORFA 4I5FA 4RZHA 1N7HA 4UEJA 3GEDA 1PS8A 4BGUA 4DGSA 3SC6A 3OJFA 1BXZA 3PIDA 4NBWA 1P77A 4CV3A 2C82A 1U4SA 2V7PA 3ONEA 4Z3DA 4M54A 2IZZA 3Q0EA 1ID1A 3HN7A 5U1PA 1ZNQO 1KVRA 2JCXA 2QYSA 3OSUA 1GU7A 2FY8A 1DOHA 4U8GA 1Y1PA 4L8VA 4YYZA 1R4MA 3WFIA 3ZCXA 5ER6A 2C20A 4GVLA 3PXXA 3ANLA 3PYLA 1XEAA 1XYGA 3W8DA 5DF1A 3KSDO 3RD5A 3GGPA 4WKGA 3WSVA 5KVQA 1ISJA 4YQYA 2PTGA 4KDEA 4R1UA 3HQ4O 4I1IA 3ZWYA 4YT4A 5ENVA 1DLJA 4BKRA 5K9ZA 4RPKA 3R3SA 4YBZA 1ZO8A 5B12A 1NM5A 5DOVA 5DZSA 4FJ0A 3VVCA 2XXBA 2EW2A 3K30A 1DC5A 3QWAA 3JQAB 4WLOA 3EVNA 3PI7A 4LMRA 4ZQEA 2R2GA 5B1YA 2WDZA 4I5EA 4EITA 2HRZA 3GG2A 1PX0A 3KYBA 4KUGA 3INGA 3M6IA 4YJFB 3QW2A 4CQLB 4CLOB 1DIBA 3KTDA 2BFAA 2PZKA 4R1SA 4K26A 4FIZA 3DB2A 3GRKA 3CUKA 1MV8A 3SXPA 3AI3A 4NZ9A 2GN8A 4HFJA 3KEQA 4ZVVA 1GZ3A 3AY6A 1GDHA 3GHYA 4AG3A 2NNLD 1EE9A 2P2SA 4O59O 3T4EA 4B7CA 5A3JA 3C1OA 3D64A 1P74A 2UUOA 1GCUA 1EFLA 4XEHA 1U3TA 4E2XA 1KETA 2QRJA 3AU9A 1EVIA 4BGIA 3ZW8A 3VTFA 5COBA 3M2PA 2W4QA 1O94A 5BNFA 1JQBA 1JLLA 3GVCA 1DFIA 2OBYA 1HDCA 2ZTMA 4B8WA 3P2YA 1GYQA 3VHRA 5TLSA 1N9GB 4E30A 1E3WB 3U4CA 2Z95A 2I5PO 4FW8A 4Z3KA 1WLYA 1C0PA 4IIVA 2CY0A 3OEWA 2VRCD 2NVWA 2C54A 1E92A 4CV1A 4D41A 5A04A 2C7GA 3R3JA 1ZSYA 4CLDA 3JQ8B 1W6UA 3OA2A 3K2EA 4R54A 1KEWA 1TLTA 1Q1NA 3E9QA 4F45A 3M1LA 3JQAA 2Q2QA 4H15A 1H2HA 1ISIA 4LVUA 3UN1A 3U5TA 4WLEA 3VZRA 5A1TA 1ZK1A 2B35A 1LLCA 2D4AA 2O2SA 3FNEA 4FQ8A 1M6WA 3ULKA 4YJFA 4YCAA 4BO9A 5DCYA 3PYMA 4CLOA 2Q1UA 5CEFA 2O7QA 5L4SA 1CWUA 3FR7A 4N5MA 2HSDA 4U7WA 1A9YA 1DFGA 3EHEA 2E82A 5FFFA 3ITDA 3H9QA 4HBGA 1A72A 2P9CA 1LDMA 2Q50A 1LSJA 2W2KB 4Y6RA 4Z9XA 1ZZEA 2DFDA 3JV7A 1LU9A 2FPPA 3WGHA 2CDAA 3FPLA 1BGVA 4PLZA 4WE3A 1T4DA 1OC4A 4OM8A 1I3KA 4B79A 2UUPA 2ZB7A 4IDBA 1VJ0A 4BHTA 4J16A 5GZ1A 2VWHA 4BMNA 4R9RA 4DTIA 3PIIA 1P1HA 4WOJA 4R5MA 3VZQA 4BNGA 2Y05A 4D79A 4PLWA 1N9GA 1E3WA 4ALIA 4BO7A 2CNBA 5T64A 3I9KA 1T1RA 2E49A 2Q45A 2IZ1A 5ES3A 4J43A 2CVOA 1QYXA 4IUYA 3NTOA 4DLAA 1J6UA 5HA5A 3UCEA 5JY1A 3JQ8A 3WS7A 3BIOA 1O0SA 1X1EA 2XPCA 3HFSA 3WQSB 2FR8A 2DKNA 3OQBA 4AJOA 1EZ4A 3RKUA 1I3LA 2UDPA 1UP7A 1OI7A 3RVDA 4E0BA 3GDGA 3ZDFA 1LEHA 4IS3A 1YL6A 3BMOA 1U8XX 1ZCJA 2V65A 4MVJP 3VPGA 1DFHA 4Y98A 1DAOA 5CHEA 1YGYA 4JNKA 1XHLA 3VDQA 3ZV3A 3NKLA 2QG4A 3I23A 3DTTA 1WW8A 5G2OA 1EMDA 1X7GA 5IDQA 4PLCA 4A03A 2X9GA 2WD7B 4BNZA 4BNJA 3FR8A 3D3EA 4FFLA 2DT5A 3NX4A 2HMSA 3ZV5A 3PYXA 4KUEA 1B8PA 4MIYA 5AXDA 1ZEMA 5GY7A 2X7HA 4TRMA 1V3VA 4FCCA 4J7UA 3KSUA 3PHGA 2FSSA 1V6AA 2H6EA 4B3IA 3DBHB 4AJ4A 1NBOA 1PZFA 2WSBA 2CF6A 1FDVA 2JHGA 3C7AA 1DJQA 1HKUA 2B4TO 1YXMA 1H94A 2AQKA 1KVQA 4CMHA 2A94A 1NQOA 3K8ZA 3C8MA 3SEFA 2CUKA 3GZNB 4R3WA 3VPSA 5AVOA 1GV0A 1U3UA 3RROA 1NNUA 2V6BA 1M66A 1IY8A 5JFOA 5TS3A 5CDSA 4GX2A 1I2CA 3GFGA 4MVJF 2ZJ1A 1L7DA 3H5RA 3OM9A 4MINA 3H4VA 4HADA 1X13A 5G0TA 3U9LA 3CMMA 3ZV6A 1PJLA 1Y8RA 5JE8A 1TVEA 1MG5A 3N74A 1U3WA 2C59A 2GO1A 2PD4A 3ZHZA 5I9NA 2DBZA 3GN1A 4BS9A 1R4NB 1B0AA 1YS4A 4GMGA 3W8FA 2O4UX 3EW7A 4X54A 3GAFA 2X1HA 4W7IA 3T4XA 1PTJA 3IIEA 4B3HA 1XG5A 2X86A 5EPOA 3KHUA 4B4VA 4L4RA 3MTJA 5MGBA 5EQFA 3A28A 1GQ2A 2P5YA 5IN4A 3HWRA 5K6AC 3AI2A 4OOEA 3W4JA 2ZCUA 3GEMA 4JGBA 4XJSA 4RZIA 5LC1A 3ROQA 2P4HX 1PQUA 2WD7A 1FK8A 3I52A 3GN2A 2NADA 3IJPA 1XQ6A 3OHSX 3QVOA 4FGWA 4I9NA 4D3FA 2JJYA 4ND1A 5THQA 3EAGA 4WCFB 3PPIA 5EL0A 1WMBA 4BO8A 1R15A 4WLUA 1T25A 2O3QA 3O03A 1Y8QB 4KZPA 3OICA 5JPIA 4HXYA 5L9AA 5TJ9A 3ZHBA 3LF2A 1H6CA 1U5CA 3OECA 3RFXA 3DBHA 4NFYA 5A9SB 5DOZA 2Y1EA 4R69A 5ILGA 3E5MA 1E1NA 2X0IA 3BYZA 1ZH8A 3DAFA 4D43A 4MVJH 4BNKA 4BO2A 4CLXA 3GT0A 2BLLA 5DN9A 4DL9A 2GF2A 4IQ8A 2RIRA 3ETGA 2CMDA 3GZNA 1Z7EA 4ZQHA 3D5QA 4DWVA 3BXXA 3EC7A 5ICMA 1ISGA 4U5QA 3CE6A 3HSKA 5IXYA 3DOJA 5JW6A 4GL4A 3PGXA 4E31A 3DOOA 3DMTC 3O26A 5JC1A 2VOEA 1ZMTA 4BNLA 3S1LA 1KEUA 3RIHA 1TB4A 2XXJA 1HE2A 3JD2A 4BO3A 1R4NA 5DP2A 4S3MA 3ZH2A 4AJNA 2QX7A 4FOSA 5ER9A 1GTMA 3RSHA 2Y99A 1PL7A 1R16A 3AOEA 4GMFA 3QVTA 2EV9A 5ENDA 5BSHA 1RPNA 1YJ8A 4QEDA 2BGMA 2EKQA 4NQZA 3OJLA 4O5OA 2P91A 4K6CA 4CMEA 4MVJD 5L7WA 1NASA 1E3EA 2EGHA 1ONOA 1LLQA 4BUCA 1FJHA 3AM5A 1UXIA 4W9NA 3UGKA 2X5OA 1P1RA 5KKCA 1P33A 3FNGA 3FWNA 4L74A 2WM3A 1HXHA 4I08A 3A1NA 2AG5A 4HFNA 1BXGB 4J6FA 2E4AA 3GDFA 4D44A 1U3VA 3D4OA 5DCWA 2OO5A 1WZIA 4WCFA 1DRVA 4RPLA 5IN5A 4RPJA 5L7YA 4OAQA 1Y8QA 3BTVA 4WLVA 4ND5A 4RVSA 3GUYA 4J90A 1BW9B 2DVMA 3F4LA 5KWEA 1ZXLA 2QHXA 5A9SA 2GZ1A 2Y0DA 5A03A 4GLOA 1EDZA 2WTBA 1P1IA 3WMXA 3JQDA 4HV4A 1C1XB 5A5EA 4PN3A 3NYWA 3AJRA 3NRCA 1I2BA 1SEVA 4CLRB 4DMLA 1YL5A 1PS9A 5IFLA 4JQCA 4PG8A 2CDBA 1DC3A 5JMPA 3GVIA 1B16A 2FRDA 4YEDA 4XR4A 1EK5A 4J49A 4OXKA 3ROPA 1EE2A 2OUIA 1AXEA 3RAJA 1ZIDA 4NPCA 3B1FA 2VWGA 3TZQA 1XGKA 1UAGA 3VTZA 3ICPA 4IDDA 4QXMA 4JK3A 1U7TA 5JYEA 4NFSA 4XB2A 1MC4A 4J91A 3LT1A 1WDLA 4URFA 3PVZA 1RYDA 1X0XA 4H16A 1IOLA 1HE3A 2HDHA 2YQ4A 2CSUA 3F4BA 4G81A 3C7DB 1KY5A 2FHSA 3DAGA 5F5LA 1ZUD1 4Q3BA 3K5PA 5JY6A 1K0UA 1SNYA 2Q1TA 3DBLB 4O1MA 1BXGA 1E5QA 1QXSA 3WYBA 4BKOA 4RVGA 4ZJUA 3FTPA 2X23A 1W8DA 4CM1A 1YQXA 2NLOA 2VOJA 1DEHA 2YQ5A 1GUYA 3DFUA 3UFXA 4M89A 3MTGA 5TF4A 5KJ1A 3PJFA 3HDJA 2B36A 4J1SA 1ORRA 1BW9A 3RFVA 4CV0A 3A4VA 4IBOA 4FB5A 1P45A 1Y81A 2Z1NA 3AU8A 3FBTA 4XYLA 4IS2A 3RI3A 1B8UA 1C1XA 2P9EA 4E5KA 1Y6JA 2YJZA 2DBVO 1LTHR 1SCUA 1V8BA 4WGGA 5DCUA 2G17A 4UVHA 4GSKA 5A06A 3CZRA 4P4LA 2P9GA 2X4GA 4A5OA 3WYCA 5JO0A 2AE2A 5TGDA 2OZPA 4TZTA 2QYTA 1B14A 2WEKA 2YY7A 2D2IA 1ADGA 3AM3A 4ND4A 3DOCA 1Q7BA 4NJOA 3EK2A 3MWEB 3P2OA 1P31A 3HUDA 3IMFA 3LU1A 4AJHA 3EDMA 1LSOA 1HYHA 2X9NA 4LCJA 3WOHA 3ON5A 3IC5A 1E3IA 4EJMA 5I7SA 1J0XO 4R01A 2PGLA 2YV3A 5ICSA 3GPIA 3PDJA 2J3IA 5DDIP 4EYEA 5I7FA 2AEMA 1XDWA 4B4UA 3DBLA 3QP9A 4ZQBA 1GEGA 1LDGA 5F21A 3OFSA 3DFZA 4QO8A 3B1KA 1Q2XA 4BVAA 2AG8A 4G5HA 1HETA 5JDCC 4CL3A 1BVRA 3OIFA 5EERA 1B2LA 5T8KC 1IPEA 2EWMA 2JD1A 2WWRA 3RUCA 1RM0A 2BELA 3HG7A 4YAIA 2IZ0A 3ZWWA 3G1UA 4BNVA 4J1NA 1EEHA 4II3A 1LLDA 1F12A 2Y68A 3VH3A 4CM4A 4R68A 4WLNA 3Q6IA 1NP3A 1Z7BA 4J1TA 4O0LA 1TT5A 1U5AA 5ITVA 1YE3A 2B4QA 2AA3A 2DC1A 1SPXA 4L4XA 2ZCVA 5C7IO 3AI1A 4QFDA 5FF9A 2EIHA 1U7HA 4EZBA 1IHXA 1XR3A 3P7MA 3UICA 2RCYA 3ZGYA 5K0ZA 3JQAD 2HMVA 4JCOA 1AGNA 3M1AA 2CF5A 4N5NA 3WSWA 1RM3A 4GBJA 3U4DA 5JSFA 4XIYA 1LA2A 1A4UA 5K6AA 3QSGA 4Q3NA 3I4FA 4BKQA 4FFNA 2X0NA 1IUKA 1YDEA 2B37A 4GGOA 4RDIA 4E6PA 4GKVA 5KJCA 2EGGA 3VAZA 4IM7A 1JWAB 1G0NA 4CQMB 1E77A 1YOVB 1A71A 1NVTA 4QUKA 2HJSA 3MJSA 5FI5A 3VH1A 3TL3A 1JVBA 4BNTA 4ND2A 3Q2KA 5TT0A 3WBBA 4I9UA 4ZHSA 3JQ9C 1R4MB 1T1SA 3E9MA 3NTRA 5G0VA 1E1KA 1HF3A 4FSHA 4J3FA 1JA9A 2W98A 4DQXA 1RM4A 4IGEA 1IPFA 4TQGA 4MP8A 3JQ7B 4DBVO 1K6XA 4UEOA 3R0IA 2P68A 2WE8A 4RF5A 3TQHA 3GH3A 3ZV4A 4ZA2A 3KBOA 2NU8A 1HZZA 1I5RA 1LNQA 2HQ1A 1M67A 2E6UX 1KVTA 3RC2A 3WTCA 5JDIC 3MWDB 4XDZA 1UXKA 1QYWA 4CMCA 4DIFA 4D45A 5BQFA 3OEYA 5COAA 1O89A 5BNTA 1BVUA 3I6IA 1ENYA 4II2A 4J7CA 3MEQA 1UH5A 5I8WA 2HMUA 4IGFA 1FDWA 5KOIA 3NT4A 2PLAA 2FR0A 2XAAA 1GPDG 3GUCA 4RVUA 3V1TC 1KERA 1LUAA 4E5PA 3ABIA 2VHWA 3C85A 3LLVA 3TZCA 3VZPA 4ZICA 1IYZA 1EVYA 2VTDA 3LK7A 1GD1O 2GD1O 1UDAA 1B8VA 2J5RA 3JQFC 3PHIA 1M76A 4E12A 4ND3A 1A7AA 3D1LA 5ILOA 4BNXA 4FD3A 1D4FA 2JCVA 3GHHA 4JX8A 2B0JA 2IEDA 5MDHA 5JS6A 3ANNA 3U49A 2GPTA 1ZK2A 3NJ4A 2Q1WA 2W2LA 4OKIA 1F17A 5KJFA 3G0OA 4WUVA 3ZU4A 3S2IA 1PR3A 4CQMA 3ZHXA 1YOVA 3K31A 1BSVA 5HWSA 1R6DA 4I5DA 3WXBA 5HBRA 3RC7A 3L77A 1SO8A 3UKOA 3OQ6A 2X6TA 3LT4A 3GDOA 4CPDA 1KC3A 5AQ1A 1UAYA 3QRWA 2NTJA 4BV9A 3KYDA 3EUWA 4JLWA 4OIMA 3AM4A 3Q1LA 3T7CA 4DC0A 5CEJA 3JQ7A 4XQCA 3DC2A 4IXTA 5T67A 5JMWA 4E13A 3SX2A 5CDUA 5EINA 4B3JA 4J1QA 4KTVE 3OF2A 2VZ9A 4CMKA 1I3NA 3P19A 3UVEA 5JYDA 2RHRA 2Y67A 3RUDA 3ETEA 1ZMOA 2BFOA 5KKAA 4ID9A 1PJ3A 4CLHA 4EUHA 5DT9A 2PZJA 5IZCA 1IULA 4XJTA 4LRSB 1DPGA 2VNSA 1Q0LA 1G1AA 3WWYA 4HX5A 4YRBA 3JD0A 2GASA 4BO1A 4KOAA 4NMHA 3ZU5A 4B4OA 3I9OA 3PLRA 1K6IA 4BO0A 4AJ1A 2IXAA 2G76A 3RUFA 4EDFA 3WGQA 4M49A 1B3BA 4N18A 4PLHA 3N58A 3WGTA 4BMSA 4MVJM 4N54A 5CP8A 1VRWA 4B7XA 3EZYA 1GQYA 4XIJA 5HRUA 1IHYA 4LN1A 3IUSA 4TRRA 1MGOA 3WBFA 1DLIA 1DIAA 1HRDA 2D59A 1NPDA 3HDYA 1UP6A 1PWZA 3RUAA 1GZ4A 2Q4BA 4KUHA 1R0LA 3WQQA 3KYCB 4MKZA 4QECA 4Z0PA 4UVGA 3JD3A 1T2DA 1S6YA 2WYVA 2Q49A 2OL4A 4XYMA 4BKUA 4EW6A 3CZMA 3NJ8A 4NDNE 1N2SA 1N92A 2Y1DA 1WWKA 3PHLA 4G2NA 4OXYA 1R37A 4CR7A 1HDYA 2ZYDA 3Q11A 2OMEA 5HS4A 1JAYA 2UV8A 5J23A 1U8FO 1Z82A 4GWGA 5L51A 1NHWA 3DEYX 2C5EA 4BOYA 2VUTA 4IY1A 4O63O 3I6QA 3ROKA 1OAAA 3KSZO 1MX3A 3ONDA 3D4PA 4NBUA 1I2ZA 1U28A 2X0JA 4OSOA 1IB6A 2AMFA 1E3SA 1XSEA 3U4HA 4DIBA 2AXQA 5KIAA 1ULSA 2NM0A 1NX6A 2Y1FA 3BMOB 4AJKA 4M8SA 2G82A 4GAEA 3IKTA 2WYWA 3RU7A 5A9RA 3L9XA 3K92A 1A5ZA 5IAAA 3WIEA 3V5NA 5A3VA 3GY0A 1I24A 1C1DA 2VNAA 2IYPA 3JSAA 3GOHA 1GUFA 1J5PA 4FJ1A 1K2WA 4RCVA 2J3HA 1E1LA 3DZFA 4RV9A 4UREA 4BO5A 4C7JA 3IOYA 1H93A 2HRBA 3DQPA 1NQAO 4PGFA 1VL6A 3QJ5A 1BDMA 3IS3A 4LISA 3JQBC 1EUZA 1A4IA 1NQTA 5T8KA 5IDWA 3H5AA 1P1KA 4JP2A 1PGNA 2OP0A 2R6JA 3LDHA 1ZJZA 3KYCA 4PLGA 5JAMA 1B7GO 5I7VA 3PWSA 4Q39A 2DFVA 4G65A 3ZU3A 1KBZA 2VTEA 1M75A 2Y93A 1LC3A 4BB5A 1LRLA 3TDKA 2OHXA 3LC1O 4M86A 4PRLA 4DLBA 3DZHA 1NR1A 4FC7A 2OFPA 1JWBB 1J4AA 1MA0A 5DULA 1E0DA 4Y9DA 4YAGA 2IE0A 5BR7A 1JVSA 2Y0EA 3AWDA 4MJLA 5DP1A 4CV2A 2HAEA 1R0SA 4FS3A 1PJCA 2H5LA 4GX0A 4INAA 4QX6A 4D42A 2A9FA 2DTDA 3A14A 1GY8A 3ZWBA 1KVSA 5FI3A 1Y8RB 2FP4A 3HE3A 1X14A 2FSVA 4RDHA 4YA6A 2PD3A 2OBNA 4YT5A 1Z74A 3IP1A 3KOUA 1HSZA 5DBIA 4C4OA 1C14A 4DMMA 3OA0A 5L95A 4NBRA 4OMUA 4GWKA 4ROSA 3AOGA 2RH8A 2AEFA 3W8EA 3KLPX 3WFJA 1WVGA 2EXXA 1IZ9A 4CR8A 1XA0A 1SMKA 4Z0HO 3HJAA 1AUPA 4A0SA 1QMGA 2AE1A 4UUNA 4Q3AA 2VQ3A 4ALKA 4AVYA 3TFQA 5CAEA 1PS0A 5TJHA 1E7MA 1UXJA 2G5CA 2HMTA 2Q3EA 2V6FA 5C3MA 1IL0A 1FDSA 2CVQA 3HB4X 2VZ8A 5TSDA 2D8AA 3U09A 1YJQA 3IP3A 4EGFA 2Y66A 3ONFA 5JAQA 3PZRA 5C7LO 4NFHA 3GNQA 4BMVA 4P8RA 4CUZA 2WMDA 2JHFA 3S2EA 1HLDA 2POQX 4E2WA 3TNLA 4M55A 4DPLA 1YQDA 3L9WA 4FN4A 3U3XA 4J9VA 3K2BA 4PZCA 1LDNA 1X1TA 4ZRMA 3ZU2A 4CUJA 2Y1CA 1N1GA 1ISHA 3C1TA 3OBBA 1UDCA 3DTYA 3HADA 4J7XA 4D3SA 3QQPA 4XGIA 1BHSA 3ITKA 1YO6A 3PGJA 4AFNA 1L1FA 1HDXA 1YBVA 2QW8A 1HE4A 3RBZA 3Q2IA 5CDYA 1OOEA 3UHAA 4F46A 3MJEA 1RM5A 4W7HA 3NDJA 1UZNA 2ILTA 3W1VA 1D8AA 2BH9A 4IZIA 2D5CA 3SC4A 1D7OA 4OO3A 1V9LA 1WNTA 4I8XA 4UVIA 2HK9A 3F46A 1H6AA 4DQVA 4KQXA 3ADOA 1VJTA 2PH3A 1CERA 4KP7A 3VC7A 2YFHA 3GK3A 3D7LA 3TSCA 3L0DA 4RF3A 4IJVA 4DYDA 3C7CB 3GNTA 3CKYA 3GGGA 2DU8A 4AJEA 1HWYA 1V3TA 4XWYA 1W4ZA 2BRUA 4XX0A 1RJWA 5TQVA 1E3JA 3HDQA 3RJ9A 3WX0A 3P5SA 3TPCA 1J49A 2FMUA 1PEDA 1V35A 4KQWA 1DSSG 1E6UA 3V8BA 4RQTA 1V0JA 1MC5A 2ZYGA 3CH6A 4JJIA 4DREA 1MP0A 1LXCA 1WDKA 2B69A 2FPGA 3AW9A 1X0VA 5TIIA 2EKPA 3Q9UA 1CEQA 2IODA 3TF5A 1WDMA 3O4RA 3TL2A 4PLVA 2PFGA 4OH1A 1A7KA 1PQPA 2HO5A 3VDRA 4E21A 1P3DA 5JAIA 2J3KA 4ZD6A 4YT2A 3Q3CA 2I99A 3DBRA 3FPCA 1GUZA 3LVFO 5T5QA 1EQ2A 3PWKA 3WLEA 3AFNA 1HLPA 3PFFA 3DO5A 1ARZA 3MJVA 4K6FA 1VKOA 1YH3A 1MFPA 1WP4A 2BKAA 4L9RA 1PGQA 4K28A 3IQDB 4IDFA 4R41A 3WMWA 4Y8VA 3EVTA 1XKQA 3UAGA 5JBIA 3L6OO 4YB8A 4WNIA 2BI8A 3NTQA 3RWBA 3UCFA 4FBGA 3CXRA 4Z9FA 1B15A 5KVVA 1HL3A 4WECA 4EUFA 1Q7GA 3F1KA 3GEGA 1D3AA 1VPDA 3R1IA 3DZIA 4XQGA 2QZ9A 2Q2VA 1BDBA 2GR9A 3HDHA 4BNMA 3WTBA 2TMGA 1E7WA 3B6ZA 1TXGA 2DPHA 1H2BA 5C7OO 1NR7A 5KTKA 2PV7A 3DBVO 3TOXA 3IDSA 1VLLA 5BT9A 5I8ZA 2NQTA 5EJ2A 2F00A 3U62A 3GR6A 4BNIA 4FFPA 5ITWA 2BD0A 4EBFA 4XCVA 3UF0A 4TZKA 3JQEA 1FMCA 3C3XA 4WOKA 2G0TA 4Q3DA 3UW3A 3BHMA 4M87A 5C37A 4MP6A 4P38A 4E33A 3V2GA 3DXFA 4GGPA 2GERA 1WPQA 4D3DA 4OYRA 3PJDA 4Z9YA 4FFMA 1CETA 3L4BC 3DL2A 4KWHA 1N5DA 4BQPA 3TZKA 1H9BA 4RQUA 5H82A 1HYGA 2DUUA 3FF4A 4N7RA 3PLNA 5JNLA 4QT0A 2UVDA 3OJ0A 5L53A 4LRTB 4YXFA 2DPGA 2Y1GA 4YJHB 1QR6A 3AY7A 1PJTA 1PJBA 3D5TA 4J2HA 4K1LA 4YQZA 2J3JA 2OP1A 3U0BA 3ANMA 1PJ2A 3PTZA 3AK4A 2JL1A 1ENZA 2W2LD 1ZK4A 1YKFA 3L6EA 3DONA 4NH4A 3ZI0A 4NNJA 4CQMD 1HDZA 3WJAA 3DHEA 4A73A 3GF4A 4CMAA 4EEZA 1ADFA 3PJGA 4GVXA 3CMCO 3GVHA 4Y6PA 3WICA 3G79A 1E3LA 1JN0A 4IQ0A 3TN7A 4BB6A 4FPXA 4E5MA 3RC1A 2V6MA 1LLUA 1U9JA 2OORA 1PL6A 2I66A 3W6ZA 1LX6A 3H3JA 4IZHA 4S1VA 4CM4B 1PQWA 1DIRA 1P0FA 1KC1A 1ENPA 1HZJA 2Q46A 1TT5B 1ZSNA 3STHA 3IJRA 1UZLA 4Y6SA 2I3AA 4ZQGA 4MDHA 5JO9A 4DIOA 4BV8A 2PZLA 2X5KO 3BTUA 4BNHA 1E7YA 2IDZA 3AUAA 3E5RA 1M2WA 2NQ8A 1F8GA 1SOWA 2PY6A 4HNHA 4WK6A 3GAZA 1Z45A 1I0ZA 3I9JA 1EK6A 2FN7A 4E2ZA 4R51A 9LDBA 3QV1A 4J0EA 2ZATA 1XU9A 4R1TA 1ZVMA 4L4SA 2FWMX 2H63A 3GMDA 3VPXA 1GR0A 2FZWA 1QYDA 4YJHA 1ZW1A 2Z5LA 2FOIA 5IG2A 3ENNA 3H6KA 4Q3CA 5A02A 4IDAA 3BTOA 3E82A 1X15A 4XGNA 4YDRA 5EIOA 3INTA 1O9BA 4P4NA 3JD4A 4IINA 5G0SA 3RC9A 1JAXA 4JBHA 1QYCA 3ZNOA 5KNLA 3PRJA 2JD0A 4IJKA 5CG2A 7ADHA 4JIGA 9LDTA 6LDHA 2GDZA 1ZJYA 2I65A 3SLKA 2BHLA 3ZN2A 1PIWA 3MOIA 4XKJA 2O50A 4ALNA 2YHUA 4NHEA 4YACA 4BL5A 3GNSA 3QWIA 1T2EA 3OP4A 1DB3A 4I5GA 1YQGA 1F14A 4W99A 1Y9AA 4FR5A 5T57A 1H6DA 3GG9A 3GVXA 5AXCA 2X8LA 1ENOA 2PZMA 3NDRA 4W6ZA 3WNQA 4EJ6A 2BI7A 1I32A 2C2YA 3DAPA 4XRRA 4OOFA 3E8XA 5LDHA 2CD9A 2OXIA 4P4GA 4XR9A 3PJEA 4AJJA 4R1NA 1ZFNA 4TRJA 4CUKA 3LF1A 4PZDA 4CJXA 4ILKA 4XGKA 2EEZA 1ZSVA 5KJEA 4GH5A 4LSWA 4MO2A 3H3FA 2JFFA 1NHGA 3RBXA 3QLJA 4CLEA 1PGPA 1K5HA 1HT0A 1F8FA 1H0KA 2I76A 1ISMA 4UVEA 2VN8A 2CVZA 1KEVA 4E5YA 1GEEA 3BMNB 1O8CA 1CJCA 5F3RA 3I9NA 3A9WA 1CRWG 2C29D 4L76A 1FXSA 2YFQA 3M2TA 3X2FA 1AN9A 2EJVA 3GGOA 2GGSA 2NSDA 3OETA 1WAMA 2DM6A 1QV7A 1SB9A 3GFBA 1XIVA 1DIHA 2DBQA 1MB4A 3GZ4A 5JCJA 3NUGA 3CPSA 4R4JA 3KYDB 3PHHA 1ISFA 4UULA 3E48A 3OIGA 3CINA 4A26A 2A35A 2YV1A 4CM8A 4IPTA 1Y9EA 3TJRA 1ONPA 2RH4A 1NPYA 1W0CA 3INRA 2GRAA 3LT0A 1C0IA 2PA3A 3G1TA 5TC4A 4B8ZA 3V1UA 1GV1A 2FZEA 4LGVA 3LYLA 1XU7A 5TT1A 3ZWAA 1YDWA 4DPMA 3DMTA 5A9TA 4UAGA 4BNUA 4DQUA 1PJQA 3I1JA 3ZNQA 2VUSA 3FRJA 4WCDA 1E5LA 5BNIA 1KIFA 1I3MA 1ZBQA 4OKNA 5IZ4A 3I5MA 3VKVA 3QY9A 3DMYA 3ZWCA 1RKXA 2HK7A 1JKIA 3FD8A 1A9ZA 3A06A 2EF1A 3W4KA 1R12A 4JROA 3MJTA 1A27A 2JD2A 3CSDA 4Q3EA 5I9LA 4J9UE 1HE5A 2HUNA 4WLFA 3WIDA 4BNYA 4D46A 4Q9NA 2ZB8A 3ENKA 2CZCA 2UYYA 4RF4A 4UUMA 2NU9A 1R0KA 3EGOA 3F1LA 2VYVA 1DO8A 3I3OA 1RYEA 1VSUA 4IXWA 1SB8A 2FPIA 3BMNA 4UVDA 3BHJA 1C0LA 3D3WB 1LQUA 4XZ3A 3V1YA 1DHTA 1PGJA 2J8ZA 3E03A 3C1AA 3SBOA 4AJPA 1SC6A 4ALLA 1D1SA 3DZKA 3KRTA 5L45A 2O3SA 2E48A 3ZHYA 2EKLA 3W4IA 1FDUA 2WD8A 5IDXA 5L40A 2H1SA 4PRKA 3WJ7A 1VE9A 2VT3A 2WYUA 1U4OA 4AL4A 1JKFA 3TWOA 1KOLA 5G4KB 4CM6A 5DNAA 3D4NA 4PLTA 5COQA 1GADO 2GZ3A 1LSSA 3FNHA 3L4BA 1PL8A 1BWSA 2AQHA 4YTEA 2B4RO 4D7AA 5U9CA 2ZQYA 1Q0QA 1LDBA 5HS6A 4Z6KA 2J5KA 5HM8A 1VJ1A 1KS9A 3S2FA 3H9UA 4M1QA 2D1YA 3F9IA 2PK3A 2J5QA 1QSGA 4F3YA 1U2GA 1H9AA 2GCGA 4W4TA 5IF3A 2CFCA 4BGVA 3ROMA 5EMHA 2I67A 4PZEA 5TX7A 4A10A 1BMDA 3LQFA 4MKXA 3TRIA 2C07A 1EQUA 4YPOA 4HNGA 3G17A 1T4BA 3WGZA 1C1DB 4TVOA 2O3RA 3RKRA 1DRUA 1RWBA 4YRDA 2ZIZA 3PZBA 5CDGA 4K9DA 3GMSA 4RL6A 1L7EA 2O3TA 3D3WA 3KB6A 3G3EA 4MVJG 3PHJA 4MVJE 4P22A 1YVEI 1PGOA 3KUXA 3QA9A 4BIIA 5KCZA 2X9VA 3WG9A 5EQDA 1P1JA 5KVCA 1GPJA 2JCYA 4CM9A 3AY3A 4IDGA 5TRTA 5BSFA 2ZK7A 4GI2A 3NT5A 1X7HA 3AOEC 2B83A 3SVTA 1HTBA 3F6YA 1EVJA 3GC6A 3I9LA 5G4KA 4CMEC 4WPGA 5B4UA 3LT2A 2VHVA 4FJ2A 3B70A 2PWZA 4XQ9A 2ET6A 5A5FA 3PQFA 4W9NC 2YYYA 2HLPA 2ZKLA 2AW5A 4LK3A 3WWZA 4EUEA 1QKIA 4MVJI 4OGWA 5FYDA 6ADHA 3H2SA 3COSA 4OSPA 4WEOA 1LQTA 4HKTA 2IEBA 3TFOA 5BSEA 4Y67A 3UH1A 3VOSA 1I36A 2PGDA 2Y1OA 3TOZA 3ASVA 2D3TA 3RUIA 1QLHA 3RUHA 4WCFC 3ADPA 1GCOA 2GN6A 4HFRA 2DBRA 2GUGA 2JAPA 4DC1A 4PFJA 4FFRA 3O8QB 1XQ1A 3B20A 3E18A 1KVUA 2Z1MA 1U1IA 1IE3A 5GMOA 1W73A 3G49A 4QFCA 5HTOA 5L3ZA 2P5UA 4CMGA 4NJMB 3JYOA 3GLQA 4ZQFA 1VC2A 5JDCA 5JC8A 4XRGA 8LDHA 3AUUA 3IKVA 4CL8A 4AICA 2VHYA 3C24A 4CQLA 5H81A 4A27A 4BKPA 5IXSA 5IDYA 4AJLA 1HDGO 1EUCA 1BXKA 4IQGA 8ADHA 1OC2A 2O23A 5AXAA 2FR1A 2IXBA 3EY4A 3NV9A 1SOVA 2QZZA 3PEFA 4LMPA 4ZU3A 2WJPA 3KM0A 2B5VA 2EHDA 3RCBA 5AYVA 4LSMA 2AHRA 2EJWA 3VVBA 1I30A 2X58A 1SBYA 1HSOA 2NTNA 2RHCA 2VYNA 5T6BA 4RJTA 5A05A 4PLFA 3PWZA 1SZJG 2NTVA 2VHZA 3FSRA 2I9PA 1PJSA 5CFZA 4O6VA 3PK0A 2JFHA 2ZQZA 3EMKA 4GX1A 4NU5A 4RVDA 2Q4EA 3V2UA 5FEUA 4GKBA 4PCVA 4U6QA 3NGLA 2IYOA 1P1FA 1P9LA 4I9HA 2VT2A 4GLLA 3IL2A 2Q1SA 4LCEA 5F1KA 4DXHA 4XD2A 4IMRA 1FDTA 4NBVA 4BNNA 3QHAA 2PKQP 3WB9A 4XB1A 3RFTA 1O6ZA 1BRMA 2BFMA 4WJZA 3OIDA 1WXDA 1ULUA 2X5JO 1VL0A 3RU9A 2NACA 3O8QA 3GRPA 2GYYA 1DXYA 1T2AA 4J4HA 3PDUA 1C3VA 3K96A 1XELA 4NJMA 5TNXA 3BMQB 3H5NA 3ASUA 1CQIA 3JQ9A 4IDCA 1DIGA 1NQ5A 4JJFA 5FWNA 5LCXA 2BFPA 3JYLA 4QSMA 4NIMA 3H65A 4CR6A 2ZJ0A 2GSDA 5DBGA 4YVFA 4D0RA 4TSKA 1EUDA 1HEUA 3KLMX 4L73A 4F6LA 3PFWO 5A4DA 3KV3O 3Q9NA 3ZWVA 3WGGA 2TMDA 3JYNA 5JDIA 3H9GA 4JJGA 1CYDA 1LI4A 1IZ0A 1DBVO 1CIVA 3VPFA 2YZ7A 1GYPA 3MJ4A 4RGBA 4WNCA 4CM5A 2W2KA 5AXBA 1GYRA 1N7GA 2CDCA 3JYPA 2AQIA 5KVSA 2PD6A 2V6GA 1DJNA 2D5AA 3L6DA 4OHUA 4PIVA 4CMIB 1R66A 4HFMA 3RJ5A 5I7EA 4D0SA 2E37A 4GPD1 1LSUA 2O2YA 4ZGWA 3DBRB 4MKRA 3JQFA 4HUJA 3VZSA 3K6JA 5JAZA 2PKQO 1DAPA 4BGEA 7MDHA 3WLFA 1N1EA 2A92A 2PKRA 1Z75A 4F6CA 2BGLA 2BMAA 1T26A 2NVUB 4CM7A 1MXFA 3DWFA 4OL9A 3PP8A 4NK5A 4ZN6A 2F1KA 5THKA 3NDIA 2NVBA 1MLDA 1X7DA 4YJDA 1NWHA 2BGKA 3ZWMA 2XOXA 1GQQA 1NFFA 3MZ0A 2PR2A 4KMSA 2JFGA 3UUWA 3FWZA 3JYQA 4XA8A 4R16A 1UP4A 3BMQA
chains in the Genus database with same CATH superfamily
3ZHTA 3FHLA 1T8WA 3HKDB 4FXPA 3UJPA 2OLEA 4TMZA 4G85A 4CKWA 1E3DA 1HO3A 1RLJA 2CE2X 4IIDA 4QPDA 4V0LA 2HMWA 5AK5A 3TDNA 5CDFE 4Z99A 1NTOA 2HKIA 2I6TA 2JH8A 3D0QA 3JQCA 4CU2A 3ZDAA 2YVAA 1XAJA 3GJ0A 3UYLA 2DUJA 4WEQA 2VNJA 2YC2C 2ZSFA 1K6JA 1KAMA 4R9NA 1IEXA 4LYAA 1I10A 2HWYA 2YY6A 4PZ9A 4YN3A 1XJ5A 4K9KA 3UK1A 3UYKA 3B5JA 1IMOA 2YV2A 1CZRA 1FYFA 1NMEA 1OFUA 1ZK0A 2Y6VA 1KMMA 4C7OB 1YT5A 2CYCA 3VSAA 3GMTA 4XYEA 1MJFA 3LPDA 5ALGA 2Q99A 1MB3A 1C5KA 3F5QA 1G0OA 2QT1A 2Y1WA 2IHKA 1Z68A 1P60A 4MQLA 4TYPA 3LX8A 4JOQA 2GHIA 1OR8A 2JLZA 1N5KA 1XXLA 1UIRA 4LXYA 5GM1A 5TQ2B 4UTOA 2Z30A 1HY3A 1LTKA 3ZCVA 1SKMA 1CDOA 3CLHA 2J0QA 3PNOA 2EZTA 3SZLA 1PK9A 2WDPA 4NJEA 4BMCA 3V7YA 1BMFD 5CXXA 1CEEA 3ST7A 3S55A 4E5DA 2YWJA 2ZTUA 2QVCA 2AR7A 2EERA 4PG5A 3UXEA 3RRBA 1NW5A 2HA7A 3EODA 2I8AA 1Q92A 4UDXX 3BTSA 3ZWNA 2ACVA 1SCJA 2ZJOA 4IH1A 4V2IA 1Z6TA 1E9CA 1PNRA 1JFFB 4NCKA 2NXEA 2FFHA 2VF4X 3AHFA 1KEPA 3S8MA 2C7QA 4IXDA 2RK3A 2QQ5A 1RQLA 2PRSA 2GVDC 2DY0A 3HKCB 4TLLB 4OFBA 3U16A 4I6JA 1ODCA 1D2HA 1L5RA 5CPFA 5KU7A 3HKDA 1XZKA 2G0NA 1YC2A 4KTTE 2OHHA 3EUFA 4HWOA 2SNIE 1Q3HA 3HNPA 3TBHA 3UCXA 5B4TA 2GEUA 2Q6TA 4DSOA 3KETA 2JAHA 3FSJX 4EY7A 2B3TA 3UEOA 3GA0A 2XE8A 2QT9A 1KZ1A 1I5OA 5CU7A 4G56A 2J32A 2AKEA 4S1WA 3O4FA 1DDOA 2QXTA 2ZWVA 4NHOA 1T2VA 1QHFA 1TQDA 1ZQ9A 1UWLA 3VBEA 1D7AA 4HUTA 1ZH2A 1H5QA 1LVHA 5CPBA 3RFCA 1XJ0A 2INGX 2JLBA 2O0JA 4C7OA 4RW0A 4XGRA 1NF3A 4PCAA 3VSBA 3LK6A 3HGMA 4NECA 4EHHA 1NVGA 1RMYA 2WG1A 5C1PA 4DHEA 2FU5C 2IIBA 2RBEA 2AKAB 3K20A 3QUSA 2W4MA 3THYA 3KQKA 1EBFA 2I3GA 4M9RA 4PPFA 1MAAA 1KARA 3JWHA 1KAEA 2ZSIA 3AR3A 2E2WA 3LUAA 4NBTA 2QMHA 3TZHA 3V8MA 2D06A 4TMWA 3GUZA 3ONNA 4MV3A 5SYMA 3WL6A 1KK2A 4U00A 1WM1A 4XTCS 5TQ2A 4KDRA 4QBKA 3W6UA 3T38A 1NVMB 1YZGA 3QVWA 4QQRA 4DUGA 1QYVA 2Q6IA 3JVVA 2QGFA 2EAUA 4EGQA 2VZ0A 2ZZMA 3BHIA 4LVCA 1HOXA 1V26A 1RXSA 1KF0A 1IJFA 1QLJA 1ONSA 2RSLA 1N2HA 5AJWA 3IIKA 3HC7A 2H9IA 2K6GA 4YECA 4LFAB 1EVEA 2VA9A 3GQBB 3CWZA 3EMVA 4TKMA 3EBLA 3SGLA 1A98A 4X41A 4D9IA 1ONNA 3VKGA 2ECFA 1NFRA 2G06A 1WQ1R 5KNDH 1A9SA 4LOHA 1KZ9A 1Q14A 3H7AA 4JNCA 4N0QA 4AWBA 2FRXA 1G63A 1YONA 4EFNA 1HI9A 5GZ3A 4MPRA 4MV7A 1M10A 3VO8A 4PYMA 4G0VA 4P3XA 3WZ2A 3EZLA 2FDCA 1DKNA 2CDRA 4OMDA 4HDNB 1I7LA 1NM5C 1NN5A 1TADA 2YTZA 4DCSA 4OHCA 1NOJA 1BX1A 2D0IA 4G0OA 4V38A 5CNKA 2A2ZA 1VKNA 3QFHA 1YB4A 1JHVA 2GPNA 2XKBA 3N76A 3A37A 3BZUA 3OZTA 4CCAA 2DTEA 2M6KA 3KZVA 5G0UA 4J0FA 3MD9A 1OLXA 2V7QA 1UKZA 2WG0A 4MXDA 3N2ZB 3TNYA 1NLZA 3VR2D 5K99A 3HL4A 3IMEA 4XFJA 3B1JA 3JXEA 3NHYA 2BSQA 3L46A 1G6Q1 5G0WA 4LOAA 2BV3A 3IKJA 5J2TB 2UUBB 5ALDA 4BNDA 3LE8A 1N2BA 1WJGA 3HS3A 4PLPA 4U6SA 1KZ4A 1ZGAA 3EFOB 3RK0A 3WNVA 1BJTA 2JFUA 4CM3A 4WWHA 3G85A 4FONA 3C15C 1WSWA 2J3DA 1Y5RA 3GLTA 4FDVA 1NPTO 4V2UA 3E1KA 1WUJS 3HH8A 2B30A 1LPBB 2FZVA 3I9MA 1BOFA 4H3VA 4H7IA 3PC7A 3WMRA 2AN1A 1MVOA 1EX1A 2MJLA 4JBIA 4MUGA 3TB6A 2ZE5A 2OYCA 1TUBB 1HT1E 1LJ8A 3MJCA 1YWGO 2OFXA 3N2YA 5TEVA 2I2CA 5JXJA 2ZJZA 3DE2X 2J45A 3KKNA 4XYGA 1ZKMA 3ZX5A 4BMZA 5ADHA 5HOQA 3OC6A 3FUXA 1PI3A 1ZYUA 2VFAA 3P2IA 5ICFA 1DAIA 4X1KB 1BTOA 4TTSA 5B1SA 3HFRA 5IULC 1QP8A 1WKVA 3FW1A 1VCOA 5DM70 3EXFB 3FCOA 4JDPA 1FFCA 1VG9B 4PGMA 2Y3IA 1L7VC 2Z4SA 4RIIA 2X7JA 3U09A 1AHIA 3NJRA 4P32A 4CFZA 1RFGE 1CY6A 1YK0A 1ZZGA 1ZHOA 5BSTA 2Q7DA 2PRKA 4QTZA 1S8NA 3HKEB 2ZEJA 1ZIPA 2GCPA 4G1EB 3X2EA 1W35A 1ZXBA 3O1LA 4ARUA 1E5TA 1D1TA 4O2LA 4BNHA 2ONCA 3H2JA 5JAPA 4OXNA 2O2CA 2AFIE 2I4NA 4GEKA 4HDNA 3WGOA 4DDHA 3FTNA 4E94A 4EHJA 2J6IA 1D0IA 3D6TB 3HO1A 3IEKA 3HFGA 3NBKA 1Z62A 1UXGA 4QNMA 4JP3A 4IJWA 2OECA 1IOZA 2OD2A 2OGUA 2HRCA 4OJNA 4EHNA 3KQUA 2O8BB 1XQYA 5HXAA 1BD3A 1SHLA 2X13A 3KXIA 3CF0A 1DELA 3KO8A 1PUJA 4BJ6A 2DQSA 1YJAA 2W00A 3OH8A 4KR6A 1Q1EA 1X8KA 3BBPA 4AWXA 2QW0X 5BV0A 4YS6A 1KI3A 5BSUA 1AUVA 4Q3OA 4C03A 3OMLA 1NNLA 2I8CA 2QMQA 4RH1A 3TINA 2XITA 2QJWA 5J2TA 2WFMA 4RPGA 3PVSA 3NVMB 1SVOA 3AF0A 3EFOA 2FMIA 1UMCB 1TAGA 1UFVA 2ZYIA 7REQA 3K5WA 4CODB 4QEZA 2NV6A 3HZZA 1Y8CA 1NC1A 4Q9LA 2C9OA 4PG6A 1EU1A 1VI2A 2ZJ7A 4OQNA 1LV7A 1XOIA 4QBHA 3VQTA 4E32A 1YFJA 3RUEA 1A96A 2F3RA 3DDCA 3UWPA 2BSXA 2BDUA 1TUBA 4HCJA 4M1EA 2A57A 3BXGA 1FFHA 1O97D 1QQ5A 2X1MA 2P2ZA 3D6FA 3N5CA 2NU6B 2OGZA 4TV8B 1MG0A 2GARA 2BVNA 3SS7X 1GAEO 3ICWA 3F2VA 4DZTA 3TBKA 1PSDA 5FNVF 1WETA 3DV0B 1QM5A 5CB8A 4FM9A 2FZGA 1CE8B 1RYBA 4BFXA 1TA4A 4R9SA 1G9TA 1SWWA 3PUZA 2ZBEA 3I37X 3ZH9B 1X8LA 2CL5A 1JXQA 3Q3HA 3SYRA 5AOVA 1Z3CA 4MQBA 4EJSC 2A0WA 5I4IA 3NAMA 1XCJA 4J4BA 1CS0A 5FUWA 2H59A 2JGFA 5FWXB 3LGSA 1ZGGA 4O4HF 3O38A 4KDCA 3RNLA 1HX7A 5B4VA 3TI7A 1UWVA 4OAOA 1W0JA 3IT0A 1ZISA 2C4MA 3QEMA 3UWMA 1DJLA 4R98A 2Q0HA 3IB6A 4K1XA 4M1YA 4NR0A 1O5OA 4K9MA 4GSYA 4PBSA 3JQPA 2GNOA 2TS1A 3BUSA 4H77A 4LJLA 1UXHA 2C96A 5CFPA 5HMLA 2O8BA 2DLDA 4TL8A 3H4MA 2XUPA 3UZUA 3QVSA 4IVNA 2C77A 4KHZA 5BNWA 4FFBB 3PQEA 1E59A 2XGJA 3UMSA 1PJ4A 2WU0A 2X0RA 1PWXA 4GC5A 2FCRA 4FFVA 3QU9A 4CDGA 2CDNA 3IXMA 1JT2A 4GW3A 4JITA 1UMCA 4I9FA 3DT6A 3ACBA 4NU6A 5CXUA 1SEPA 2XMPA 4IHJF 4M88A 3R2JA 2QN1A 4QXRA 4BB0A 4WBNF 5BW5A 5CFNA 3LPMA 1G21B 5FTNA 2O7SA 1V16B 3QVJA 2WBLC 2GZMA 4RK4A 4XDYA 5ES4B 1CK4A 5IC5A 3W7BA 2DB3A 3NH9A 3SJUA 4J4TA 3DCYA 4WACA 3V7UA 4C01A 3DPIA 3QVXA 4TV8A 3V55A 2NU6A 2B6HA 4CNBA 1ZAYA 2IYSA 1KMCA 1Y7TA 3QE3A 2RE8A 4I99A 1NUUA 3CLTD 4HAWA 4KV9A 4MPDA 4LHWA 1MO5A 4ZEOA 1H3FA 3HR7A 4M38A 1NJ5A 4A23A 2HXSA 3ESCA 4LW8A 5LQRA 2P90A 2JI9A 3K9HA 3SX0A 2GN1A 1RBZA 3GGDA 3CXUA 2XRYA 2ZB4A 2YDYA 1NMZA 2PJZA 4B4WA 1Z0ZA 3RDPA 1CUJA 5ARDA 5TPWB 3J81A 1DC7A 4HBZA 5AM5A 3CEJA 2FX3A 1G8YA 1UR5A 3O47A 2VATA 4JHLA 4L75A 1Z6ZA 4WINA 1NAHA 4X3OA 3WKCA 1ULTA 4A8HA 3A58B 3OJEA 1G8MA 1PZGA 3IHTA 4W82A 4BX9A 3ZGZA 3RYIB 4J0QA 3ZDBA 3MW8A 1AHHA 3DHVA 1MXHA 1FFAA 1NLYA 2XVZA 3JR7A 4PVCA 3SS8A 3WFZA 1H2EA 2YYSA 1QFYA 4LE2A 4DLSA 1XQVA 2IZ5A 2OFWA 1KYIA 2YW9A 3O8OB 4LC1A 3TTTA 3OMWA 2WM2A 2HJGA 1FFYA 3R6WA 2XUKA 2W48A 1YHNA 2EP7A 1NWCA 2P4QA 4I5FA 3PRYA 5LA6F 1YVUA 3GEDA 1UC9A 3FYHA 3WB1A 2WJYA 1UAAA 3PF9A 4XWWA 1P77A 1YR3A 2C82A 1JL3A 3N3BC 4UTZA 4TPKA 2V7PA 1UEIA 3ADKA 4PXAA 1FDOA 4M54A 1BEUB 3K2QA 4WI1A 3E9DA 3FYCA 3Q0EA 4JUCA 1FRZA 1ID1A 3H05A 2X2PA 5U1PA 2G40A 3TTWA 2OCDA 3IBFA 3NHAA 1AMNA 3OSUA 1NJ1A 2JCXA 2XGOA 3ED5A 4KO2S 4YO8A 4F4HA 2CT8A 1JJ7A 2QTZA 1GJRA 5CTJA 4U8GA 4OMFG 4CHTA 1Z3IX 1Z34A 4Z2YA 3ZCXA 2R7LA 5E2AA 5ER6A 1AQ6A 1G21A 2RHLA 4RZ2A 4MEBA 3ANLA 1DKOA 4OGLA 1XYGA 1V16A 3WWDA 2AMLA 3GGPA 4CZ2A 2ZUSA 4ZYLA 4DV4B 2J07A 1TEXA 1ISRA 2OY0A 3SXUB 4OCZA 1MIOB 2GEBA 2AWNA 2H2FA 4MICA 4GYJA 3PG5A 3RRYA 4D4GA 1GDTA 2VNHA 3KWLA 4W1QA 4YLEA 3F71A 2WKSA 3JQQA 2Q3DA 1W25A 1QHHB 3G2NA 2H16A 4NEGA 4MJXA 5AFSA 2GTIA 1YBHA 5ENVA 1O87A 1AUOA 4KMRA 5FKJA 1JXAA 2H4XA 4IO0A 1OZGA 1ECJA 5DLYA 4XM0A 3SK0A 3V1KA 1BIFA 4BWGA 3WLRA 5B12A 3LCUA 1SOMA 2V03A 4UBJA 2NOAA 2OSVA 2D2EA 2XXBA 1DC5A 1QFZA 1CY0A 3JQAB 3EVNA 3K4HA 3R09A 4LMRA 4OGFA 4RESA 4WLOA 1U81A 2IT1A 1Z7YA 4OHYA 1W85B 4PO3X 2F55A 1SKQA 3ZEIA 3DAHA 3GG2A 3RYIA 3KYBA 1Z56C 3M4XA 5J4KA 2YJGA 4B40A 4CQLB 4GM4A 4XUGB 3OAAA 2HB6A 4EX6A 4LOIA 1TKCA 2VP0A 4TV9F 1TKAA 3DB2A 1OYYA 3O8OA 1J7JA 3CUKA 2P27A 1P3Y1 1KY3A 4NZ9A 2AK3A 1GFZA 2GN8A 1BVYF 2KWIA 3HA3A 4HFJA 4RJKA 4ZVVA 1SU7A 4RETA 5CIYA 4KLCA 2C7RA 2IDJA 1WBDA 4A36A 4EK9A 1EE9A 4MDYA 3GUHA 3DH0A 3D64A 1N5IA 3K8OE 2UUOA 5FV7A 4H4DA 2C4TA 1U3TA 4P0TA 3VOTA 3AU9A 4WFQA 2QJOA 2F1HA 1M2FA 2ONKA 5COBA 3ZW8A 5I7AA 3M2PA 1SK8A 1O94A 4LXHA 4EY8A 4HOYA 2ZPAA 5DSTA 1GUBA 1DG9A 1U6KA 2HY7A 4PNEA 1DO2A 5K4GA 2ZTMA 5SY6A 3SZMA 2YVQA 4QU5A 1M8GA 1SU8A 1RQGA 3AYZB 3NATA 3FCEA 4O8CA 1E3WB 1GL9B 1XU4A 1YZUA 3H9CA 4ZAXA 1MIOA 5HCIA 2I5PO 1BHJA 4XAQA 1XVAA 1LBTA 3IUNA 4PE5B 4B83A 4ZJZA 4DR5B 4FS8A 5AKHA 4A1FA 2CY0A 3O1HB 5T4FA 3V7FA 2DFPA 4FILA 4OJQA 5LWHA 4UCWA 2PS1A 2XCLA 4CLDA 2VAVA 4Z4IA 1TE2A 1W6UA 2IHUA 1FL9A 4PCLA 2ONYA 5HKOA 1CIJA 1Y3IA 4F45A 2I91A 3B36A 3JQAA 4H15A 4EYSA 3U5TA 4L0CA 5DVZA 5HF8A 2P6MA 2QZJA 4JB8A 1W85A 1PV2A 2B35A 1LLCA 4MULA 4WXYB 1E96A 3BF7A 3UTCA 3V97A 1R50A 2BE7A 2ROQA 4C08A 4XI9A 4YCAA 5AVTA 1Y7HA 2AD1A 3AEYA 3U48A 3R3VA 2Q1UA 4HZUB 3BFXA 5IAGA 3OM8A 1GR1A 3IBSA 4QXOA 1VIVA 3DG9A 2XCOA 4LRYA 4MDEA 4FZ5A 1ZOLA 1C80A 1ORHA 4RE6A 3S68A 2EL7A 2I6XA 1A9YA 1TRKA 2VJMA 1AZLA 3R5TA 3TLMA 5FFFA 2PSHA 1BKDR 4YFVA 1LDMA 2Q50A 2W2KB 1K8XB 1U6IA 3B3QA 3CYFA 2V7BA 3I4LA 1L8AA 3A10A 4NKRA 4KX5A 2DFDA 3ABQB 1LU9A 1X7ZB 2QVGA 4LIPD 1EJ2A 2PUFA 4I50F 2NUPB 2AZ4A 4D25A 1IH8A 3MTDA 2PH7A 4HAYA 2XKKA 5IU6A 3AJEA 2UUPA 5EPEA 2W2PA 2RGYA 2ZB7A 4IDBA 1VJ0A 4BPRA 1EJ0A 2E4ZA 1CU1A 2EFEB 5H02A 1ESMA 5GZ1A 2VWHA 3DLBA 2YOHA 4R9RA 3L06A 3V3KA 1Z0SA 3BSSA 4R5MA 4DV1B 3FZEA 4Y2VA 2Q3JA 4HWSA 4D79A 1GPAA 1TQ2A 3AUKA 4PLWA 4ZCIA 3TAHA 4DUGD 3E1GA 1E3WA 4BYMA 3OX2A 5IT9A 1VSBA 1GPKA 1XO1A 4M36A 3LKDA 3R3HA 5FBKA 1M8JA 1IN4A 4M9UA 3FMFA 4AMVA 1FXWF 5EYPB 4IHQA 4FZVA 4QUGA 1UPBA 3PXDA 1QVZA 1YDMA 4IUYA 3OO1A 1AKQA 3NHRA 1RHJA 3C0KA 3I12A 3K2IA 5CFLA 1DX6A 2JGRA 4UCFA 3BIOA 1X1EA 2QZSA 2XPCA 3C5HA 3HFSA 3HY3A 1JU3A 1XAHA 2FR8A 1TTQB 4HI0E 2KQUA 4H7JA 4PYOA 4M1KA 4JI4B 1WL8A 4FMDF 1I3LA 3KU1A 3SHTA 2IA5A 2OQVA 1BEEA 1LZKA 3PQ7A 4TUYF 2OZEA 3ZE0B 4HZUA 3H97A 4YRIA 4HEA1 3L7KA 1E9SA 1YD7A 2NZXA 4CEJB 1VLQA 1OKKA 4L07A 3KQPA 4I66A 2HLDA 1QKJA 1VBKA 4P84A 3TLJA 1IONA 2YXDA 1PD0A 4RIGA 1XHLA 1Y4SA 3RS7A 3AILA 2V7QD 5P8WA 3P9PA 1SUWA 5LD2B 3DE1X 1POWA 4QTXA 2NT4A 3QE9Y 4B33A 1R9NA 1X7ZA 3FR8A 3T61A 4PTYA 4EJMA 4BPBA 4QUBA 3NX4A 4ZCQA 4G4SP 3PYXA 1I9CA 4MIYA 5GY7A 1ZEMA 1Y34E 2R87A 4OA8A 1NBAA 4FCCA 5BSKA 2VF8A 1JHAA 2IV2X 3GFFA 2JIZA 5KTPA 1SKUA 2RK4A 3DBHB 4AJ4A 1NBOA 1PZFA 2A1UB 1WBBA 4TTIA 3LVBA 3H8JA 3PPXA 3IOBA 3UAOA 1ZKDA 1CRQA 4NESA 2X1VA 2PGIA 1EGQA 5JRDS 5EP2A 1WF3A 3Q7TA 3WZLA 5EYPA 2XBLA 3KELA 5AVOA 1GV0A 1FP7A 1RDFA 2L82A 3QI7A 1NNUA 3RROA 1XD2B 3PL5A 2V6BA 3HVIA 4LBVA 2VJYA 5TS3A 3S99A 121PA 3HXQA 4MGYR 1N57A 2CHVA 3OE1A 3VM6A 1I2CA 4MINA 2L19A 3H4VA 5G0TA 1X13A 3U9LA 3ZV6A 1T8RA 1L5KA 1PJLA 1Y8RA 2ALJA 1IU9A 1N4DA 1UM8A 2MIIA 1LKZA 3WK5A 2GAIA 2PT6A 1T3LA 4WJKB 3ZHZA 4F93B 2XYQA 3GN1A 2JANA 3FZGA 4GMGA 2ODQA 1R18A 2QTCA 5AJTA 3W8FA 4X54A 3WWOA 1GVNB 1XRRA 3I8OA 3KTFA 3MT8A 4KIGA 1TU0A 1U9IC 2H1RA 3PU6A 1PTJA 3IIEA 2EBFX 3FUUA 2FETA 3LFTA 3KHUA 2WMNB 4D92A 4CIYA 4CEJA 1IEQA 3IELA 5DBOA 1Y4UA 4FD2A 5EQFA 1KRHA 4PC6A 3A28A 2NO5A 3OOJA 2VKTA 3NHWA 3RTCA 5HYVA 2F9FA 1TYCA 5FBVB 2Y8EA 1L4HA 2C57A 2ZCUA 2YR0A 3GEMA 4G4SO 2XBUA 4KWTA 1FFBA 2P4HX 1PQUA 3IJPA 1BE0A 4D3FA 4FGWA 1XQ6A 2WFLB 4RGQA 3EAGA 1Q22A 2W71A 3I0ZA 2FDXA 2GF0A 2GYWA 3K05A 3O03A 4IFTA 2VF7A 4KZPA 3ZQ6A 2OCBA 2IVFA 1IM2A 3ECSA 2FE1A 2QRZA 1XZBA 1G6HA 1Q7RA 3EXG2 4HXYA 1HH4A 3B3AA 4O29A 3Q8XB 3ZHBA 3OECA 2QA5A 4LJ9A 3DBHA 4DY4A 3GLIE 4MR9A 1JUDA 5DOZA 1P7ZA 2A1UA 5ILGA 1O5TA 2X0IA 1XCPA 3SC2B 4CTKA 4IOKA 4ZAGA 1ZM9A 5CA0A 4BO2A 4CGZA 2BLLA 4PAWA 3GWGA 4MUYA 4GMKA 4R9VA 1GG5A 4DL9A 1JEQB 4DV5B 2GF2A 2P3SA 2QL7A 3F5FA 4IQ8A 1XXHE 1TM5E 3FCCA 4KLZA 4MAFA 4ZQHA 3D5QA 4DW8A 4CT0A 1ZBDA 1RYFA 2B20A 3BXXA 3EC7A 3QLTA 3RS5A 1II0A 4HWPA 4U5QA 4ND6A 2ZCJA 4D0NA 2QTVB 1SKYE 4HQ6A 3ANSA 4QTTB 3D7RA 3BXFA 5DTEA 5TGTA 4DG8A 1ZC3A 5JC1A 3GB9A 1DEXA 1JBQA 2F1JA 3NHMA 4XWAA 3RIHA 4ARBA 2Z83A 1TB4A 2JIOA 2WTUA 1KI7A 2OKCA 1DQSA 5D51S 5K6RA 2IDKA 1Q1QA 2QX7A 4FOSA 4B6PA 1PL7A 4WZ6A 4I2NA 2AOXA 2GBIA 1TL7C 2EV9A 1EKXA 3KQTA 4KLNA 5BSHA 2BGMA 1W0JD 1P18A 2NNWB 4O5OA 4K6CA 2ZDQA 5CW2A 5JSHA 5KWSA 5L7WA 1WSDA 2RHDA 1FJHA 3AM5A 3CR3C 1UXIA 1F0PA 4JVMA 5EC8A 1MO3A 3Q98A 4E5VA 3ZXUB 3TR6A 1MIHA 3A1NA 5CDHA 4MGIR 4RH3A 3GDFA 1IQRA 3AF2A 4XH9B 3I34X 4Q4JB 1U3VA 1FX0A 1TQ6A 1O96B 3D4OA 2SBTA 2WFLA 2XNJA 1JSRA 3FDIA 1U3GA 1RJ9A 3K9LA 1UBOS 1DRVA 4B3XA 3BREA 2WWYA 2QLMA 4OAQA 4K0KB 2GKSA 1YSCA 2JFNA 3WGVA 3UANA 3F4LA 4ROTA 3KJNA 1ZUWA 1L5QA 2I0FA 1BJRE 4RD3A 1XTJA 2PGAA 3QBVA 4OXIA 3WYGA 3SC2A 1P1IA 4JJ4A 3JQDA 3RB8A 5KYNA 1LY1A 2WIKA 1C1XB 2PJDA 2WOJA 2YINC 3RREA 3TAXA 2NP6A 3CRRA 3GMIA 3KB8A 4O8ZA 4JYCA 3NRCA 1IBCA 1SEVA 4K6HA 4PC3A 3VNAA 1D09A 5IFLA 1PS9A 4HQ0A 1X74A 2FG5A 4UXIA 1H42A 2CDBA 5JMPA 3FVRA 2CVFA 2V3VA 1YHZA 4G07A 3ZCTA 4BLPA 1ZVKA 4BFLA 1EE2A 2QTVA 3HDVA 4L5YA 2JA2A 5DGXA 1XMPA 1K7FB 1H2YA 4P0PB 1QZZA 3QTBA 2GTHA 4C3UA 4EIWA 3R77A 1UAGA 3VTZA 3ICPA 1ORIA 2Z08A 3G2HA 2LD4A 2SKDA 1YR2A 4W1SA 2WTMA 2FEXA 5JYEA 1QDEA 4MUNA 1DE0A 3KLNA 4IGAA 2XF2A 2GILA 4XB2A 1MC4A 4N4AA 5KNCA 3LT1A 2TSYB 3LOPA 3PR3A 3PVZA 5KC8A 1W5SA 1FP4B 3QYJA 3P71T 3T9EA 1HE3A 2YQ4A 3T0IA 2OMKA 2RH9B 4ZVQA 3EDYA 3M4YA 1ZUD1 2L18A 3M7IA 5JY6A 1W7AA 3RARA 2Q1TA 1XL0A 1E5QA 4Z86A 4RVGA 4K5QA 3V6LA 4Q4JA 2ZIWB 3FFTA 2N42A 1O96A 3FVTA 2GZHA 1ICIA 1NVXQ 3QBJA 3BD9A 1GIAA 4KRGA 4Y9TA 5IHPA 3ORYA 1YQXA 2P1RA 1LWNA 1DEHA 2VOJA 1JHUA 5EMLA 4BRZA 4BVJA 4C0QC 3UFXA 3U3DA 4BWFB 5KTRA 4JT4A 5KJ1A 1J2YA 4CDMA 5CM2Z 2JBWA 3GRCA 1PEYA 3BN3A 3I62A 4CTNA 1Q5PA 4RSMA 3QLUA 5ILQA 4Z4HA 2PUCA 5TQ0A 1P45A 3W2HA 4BX3A 1WCWA 1O9GA 3RI3A 1C1XA 3MGAA 4N41A 4WGGA 2DBVO 1LTHR 5DCUA 1RAEA 3HNRA 2FWBA 4YHBA 4F3TA 3FCYA 4GBGA 3EWAA 7MHTA 3KXLA 1KDTA 2HA4A 4P4LA 5IKOA 1R5JA 3SNKA 3OPMA 3H11B 3R3UA 3CVUA 2AE2A 3ENVA 3LBHA 3USES 2OZPA 4TZTA 2Z5FA 4FYKA 2QYTA 3ZVRA 1B14A 2FUG6 2OSBA 5E6RB 1ZAKA 3AEQB 4JJ6A 2WEKA 1QHEA 4KKXB 5FJIA 3WRXC 3ZC3A 5BYKA 4LJRA 4PNZA 3WLJA 2HREA 5IMSA 4D4JA 2P8SA 5FPTA 5CM8B 1KJNA 1O97C 2P9FA 2QT0A 3MWEB 2H92A 1G38A 1IBSA 2A9KA 1XFDA 1N2IA 4E4RA 1CDDA 4FINA 1LSOA 2R6FA 1EP9A 4LCJA 2ENWA 4ZALA 3IC5A 1E3IA 2FTKE 3OAAD 2GLTA 4M7PA 5BV2P 4OBBA 1J0XO 4US2R 4GXNA 4XD7A 1XQXA 2RHWA 2RKBA 5DNWA 5CDYA 4RDXA 4CIAA 4LF8B 4EB3A 2CSXA 2YV3A 1VA5A 2RGEA 3BAFA 4WBNB 2IEYA 3CVJA 4YQEA 4EYEA 3LY9A 4I6EA 4ENTA 3QP9A 3O0TA 2PRJA 4NRDA 1MH9A 2WJJA 3QJGA 1GA4A 1L7NA 2OZVA 2V7TA 2X3UA 1Q2XA 3C5VA 5FUVA 3SR0A 4EZIA 3OPYI 1NVBA 1JB1A 4B6OA 5ELXA 4MA0A 3ZD8A 1KL7A 4J0KA 2AG8A 4OQMA 2QG6A 3V1LA 3AVQA 2NO1A 2BMDA 4TXMA 4J0GA 2VDOB 4MQUA 4W5WA 5EERA 2XB8A 1O94D 3GEIA 4KBFA 4QVGA 2A84A 1SBNE 5M3BA 1S3GA 5AOAA 1RWQA 3A3NA 1Q77A 4QQFA 1L5ZA 1N34B 2NU8B 3WNBA 1SQSA 5E38A 1EEHA 2L17A 4II3A 3WLOA 1F12A 2Y68A 3H42B 1HL7A 5EA2A 1SXGA 3VH3A 5CMLA 2EDAA 1D2NA 1CJMA 3MT7A 2BTEA 1G3MA 3L7DA 4O0LA 5CLGA 4ZI5A 2IU0A 4U8HA 1YE3A 1UIMA 4EATA 3FYUC 1AG9A 1EZZA 1V3QE 1QO0A 1W9MA 2WZBA 2RJNA 3H11A 4BJ1A 2G9NA 2P2CA 3AI1A 5ALYA 3SBXA 1PZXA 1VFNA 5FF9A 3KT0A 3GGSA 1IHXA 1NVVQ 3AEQA 4MV0A 3P7MA 3ZGYA 5K0ZA 4FYJA 3U3MA 3JQAD 5KQLA 4JCOA 4P5PA 4D8WA 3BIJA 2CF5A 3TIGA 1RM3A 3MWEA 4GBJA 5JSFA 2JGAA 1LA2A 5AUQA 3BK2A 1OU0A 4JT2A 3CLTC 2J09A 5AMXA 1XJWA 1H85A 4UE6A 2CJPA 3CLRD 1DBPA 1L7MA 4WV3A 3QM1A 1VXOA 4GGOA 3B6MA 4M0MA 4F5DA 2EFDB 1U7ZA 1P73A 1NJSA 4ZAVA 5JSQA 1JWAB 3KLBA 1G0NA 3EF1A 4V0QA 4AYTA 1JKMA 3HV0A 3EPPA 1CXZA 4IL5A 1E77A 4LOJA 1A71A 1NVTA 1FSSA 1WHSA 4HSGA 4G4GA 1HTWA 2ODNA 3HP7A 3DD1A 5L51A 3VH1A 4L6AA 5AVYA 6Q21A 1TZBA 3UT5A 4ND2A 2IU3A 5TT0A 3R23A 3FNQA 1R4MB 2FMKA 2ZBGA 4J6EA 4LYGA 4Q37A 4R7ZA 1EG7A 4U2EA 1HF3A 4FSHA 3TLGA 1RXWA 4J3FA 2AHOA 3T94A 1JJBA 2YZNA 2HQRA 1EK1A 3JQ7B 3R4CA 4PAQA 4UEOA 2I71A 1KO4A 2C4UA 4DQDA 3LP8A 3AG5A 1KTIA 1LBSA 1R4ZA 2CLSA 2IW1A 2JHPA 4QHTA 4DC9A 3KBOA 2NU8A 3MD0A 2E6UX 1GFWA 2IC5A 5JDIC 5KYGA 3ICQB 4XDZA 3ZHQA 1CJSA 1QYWA 1E5DA 2P6RA 5YASA 2YS6A 5JJIA 3T6KA 3OPVA 5COAA 2GJ8A 3W6PA 4YGYA 2ECQA 4IIEA 4ZC8A 3ZZUA 4BMPB 4LWQA 4QLAA 1OREA 1GNVA 4I3GA 4M0CA 2H7YA 3PFNA 4IDQA 4UM5A 3YASA 5KOIA 4S2UA 5JNWA 4HDMB 3PGKA 4N8SA 2O06A 3H2YA 3DEJA 1JEDA 4UAUA 5GONF 4CNQA 1LUAA 3BULA 4UM8B 1Z8FA 2VHWA 1N6KA 3OSZA 1S5PA 1Z5VA 2VSNA 4HJXA 5DTMA 4ZICA 5JLJA 1JHRA 3H86A 4GKJB 4RMGA 3TJZA 2GD1O 1XZHA 1L7BA 2W6OA 3PHIA 4UBKA 3P9XA 3P96A 1A7AA 5H16A 2XKAA 1Q16A 5B6IA 5ILOA 3OT1B 3QUCA 4MGHA 2I6GA 3SF0A 2FRVA 3ZVMA 3Q8LA 3MB5A 2J1LA 4JX8A 1U1DA 1QG4A 1CJTC 3ANNA 3F96A 1OKKD 1TZJA 3N2KB 2W2LA 4IO1A 1SQ0A 1F17A 4OKIA 2HLDD 1VXRA 4ZO9A 4WUVA 4ZVLA 3ZU4A 5LOVB 1PR3A 3W3ZB 1PWEA 4LVOA 5HWSA 1YQQA 1R6DA 3WXBA 1PT8A 6CHYA 8AT1A 4ZZ2A 4KQ9A 3AHCA 4M9XA 4ENWA 1OI3A 3BM5A 2XYGA 2Z3WA 3RC7A 5IEJA 1SO8A 4ZEMA 4CIBA 3OQ6A 4OHWA 2O1SA 2X6TA 1JLLB 3GDOA 1KC3A 4R31A 1G8SA 2IYLD 2ZETA 2NTJA 3EQ7A 4MLCA 5IF9A 5JZVA 3NBUA 1GSHA 4Y3UA 4Q12A 4ZI7F 5IP5A 1YS6A 1T36B 4DWJA 4JLWA 4YCNA 1GRRA 3T7CA 1ZNZA 2FLVA 1WB4A 2Q21A 3JQ7A 4DC0A 4ZHQF 1DEOA 2CV0A 2JIZD 2WU1A 2ZANA 2V7EA 3JVDA 4IXTA 2COKA 4YWHA 1M2VB 3SX2A 5CDUA 3VZDA 1O6CA 4LFCB 4PTLA 2P9YA 2AFVA 2GD2A 1DI0A 3E3OA 5A2GA 5FTMA 2G88A 1ZMOA 2BFOA 2COUA 3N0VA 3TTXA 4E7OA 1JECA 5B2ZA 4NMXB 4CLHA 3FPJA 4HGRA 2ZAGA 3EXG1 1SBTA 2AN5A 3QELB 2JRCA 1N7IA 4LRSB 2GJ9A 4XJTA 4BLOA 1HNNA 1ZOPA 2X2FA 5KSWB 3WWYA 1B93A 4HDMA 1FB5A 4YRBA 4EX7A 1DX9A 1I4WA 2GASA 2Z04A 4BO1A 4GR9A 3OFNA 2UXCB 3FKQA 1G5RA 1ZINA 3RC8A 5F4BA 3W6NA 3HYNA 3I9OA 3DEHA 3PLRA 3O0DA 2HUPA 2HRRA 4BO0A 4DCNA 2IUFA 5FOXA 5BSRA 2MU1A 5CVVA 1PR5A 3Q88A 3WLTA 1W88A 1I4TD 1WXIA 4IG4A 5HBGA 4N18A 4WXMA 3OTOB 2R5NA 4C0JA 3OT1A 3PDWA 4QGHA 1KFJB 1NQXA 4XB6B 4ARAA 1L7PA 3WGTA 1KBOA 4UHKA 2ZVJA 4X24A 2DPXA 1SQ5A 3DJFA 4MVJM 4PFSA 3FMGA 1VIMA 3IB3A 2JGKA 4QOSA 3N2KA 3CRVA 4KVFA 3S2UA 4XIJA 1ATIA 1IHYA 1F1JA 1NLMA 4TRRA 4DIMA 5LOVA 5A3QA 1WU8A 5KO2A 3RUAA 2QPAA 4OU4A 4ZVKA 3IFSA 2AOVA 1PWZA 4RY9A 1FRVA 2OM2A 4XUCA 4KUHA 3II6X 4E3WA 3PQCA 3LUBA 4MKZA 4QECA 2C9ZA 3HU1A 3GA5A 1UKVY 3WMEA 2AZXA 3L8MA 2SECE 2ZUUA 3UK0A 1F7UA 1T5TA 1VGVA 4KAJA 1T2DA 1S6YA 2WYVA 4QATA 1T36A 1JIXA 2Q49A 3C3PA 3C8ZA 1FW6A 1T8SA 2I62A 2RHMA 4PYLA 2DHEA 1WY7A 1IHUA 2VL7A 1GLNA 2HCBA 4NDNE 4TXJA 2ANBA 3AUYA 1JEYA 3O8DA 2M6RA 1M2VA 1N92A 2Y1DA 1UWCA 1CV2A 4RNCA 3DYIA 1R37A 2OXTA 1BYUA 3Q11A 2I7DA 1FYWA 2A7XA 1M72A 4KBYA 4X64B 2W6PA 4GWLA 4Q4DA 2W6IA 3T3OA 1SIWA 4OXXA 3M6MD 5A3SA 2V54A 1NVAA 1T9KA 2B92A 4YDQA 4XM1A 3DEYX 3QELA 5A4MS 5K3AA 5DYNA 4X91A 4ZT4A 1UBRS 4NWIA 3KSZO 3ZCRA 4QOGA 5JANA 2J0SA 2WA2A 3UA4A 3I53A 3RM3A 1U28A 5BOSB 1ZESA 2J9GA 2X0KA 4OQFA 3V9AA 4OSOA 3B48A 3R5KA 1YB7A 4FU0A 3ZHOA 1FU8A 1PHPA 1E3SA 1XSEA 2ZDGA 3AUJB 3C48A 3SF8B 4D3YA 2GKGA 3NHJA 3U4HA 2CV2A 1MO4A 2HA0A 4JUBA 3DMNA 2VTBB 1RAAA 2POCA 2Y1FA 4V0OA 5JNVA 5AIAA 2V98A 3U56A 1G7TA 5E4JA 5BYBA 3RU7A 1T5BA 4IW3B 3MJDA 3INYA 3EAFA 1TK9A 2Q62A 3DOEA 3OF5A 3V5NA 4R1MA 3ZI4A 3EZNA 1XEFA 2IYPA 2WIJA 3GOHA 1GUFA 4FJ1A 1W93A 2HBYA 4U2BA 5HFJA 4B47A 3DZFA 2P30A 4LVNA 4BWVA 4EO7A 2ZWOA 3AESB 4PGFA 3DQPA 1H8HA 4MQ5A 5BORA 4ZV4A 4JI8B 4JFAA 4AX8A 1BDMA 1Q83A 4A0QA 4LISA 3GJ6A 3R5JA 1A4IA 1L4EA 3CWQA 3DVAB 5T8KA 2Z9DA 1O3YA 3H5AA 3ROZA 1P1KA 1M8KA 4JP2A 4OHMA 3DE3X 1ZI6A 3O93A 3LDHA 2H8GA 4NV3A 3UAYA 1B7GO 3FMOB 5I7VA 4G65A 2VJOA 3I72A 1L8QA 5HCNA 3L7CA 2VTEA 4M8NE 3H6GA 2WF7A 2GWRA 5CB4F 2E87A 2Q5FA 2NPOA 4WX2B 1B0ZA 1KU0A 4HQLA 3OZFA 2VEDA 3SZOA 1KEEA 4PRLA 4ITRC 2QU8A 1P2UA 4MWZA 3DZHA 3ZCPA 1S8FA 4DLBA 4FC7A 2B4YA 2PXHA 4QWMA 1MA0A 2A14A 1JEEA 2IF0A 4YAGA 4PRYA 3AO0B 3WNDA 2G0AA 3AWDA 4N5IX 3KTAB 5DTRA 2AJ8A 2JH3A 2ZROA 3BVPA 4RLFA 1GPMA 5DP1A 5EGSA 4BCBA 2FB9A 1R0SA 4HPWA 4GX0A 5A3RA 3PTAA 2ZR8A 4D42A 2YWEA 2V6IA 3X1MA 1KVSA 4UM9D 3HGTA 4ZU6X 3HLKA 2JAXA 4MWBA 5CURA 5K0NA 2A0FA 4BMYA 5I8PA 4YA6A 3FRIA 1J0AA 2RK6A 4MLZA 2PXXA 3HU5A 5LLSA 3S5UA 1ESEA 3WYDA 1C14A 1IM8A 5BOSA 3R9XB 2ASVA 1PWHA 4NBRA 5HDBB 3DO6A 4OMUA 4L27A 3AOGA 3VI4B 4NNPA 1KQNA 1ZITA 1E9AA 2VTBA 3ZQKA 1YR7A 3GLVA 1AKEA 3PCTA 2IEAA 2C61A 2X77A 2ZI5A 1QAQA 2EXXA 1Z4MA 4C6RA 4G26A 4NOLA 3SWWA 4JV5B 4CFSA