4DA9A

Crystal structure of putative short-chain dehydrogenase/reductase from sinorhizobium meliloti 1021
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
219
Chain Sequence
MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASDARASRSIINITSVERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase
publication title Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
total genus 69
structure length 219
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4da9A00
1MX3A 3GVCA 3HJAA 4BUCA 4CMHA 5T67A 1P1HA 3W8FA 3NX4A 3AW9A 3VKUA 3WIDA 3OIFA 5DP2A 5EPOA 1CQJA 2YYYA 4CM8A 4CV2A 3EC7A 3RUHA 3VH1A 3DFZA 3GHHA 1H5QA 3MJ4A 3DHYA 4RDHA 3QIVA 4XRRA 4A27A 3OJEA 2J3KA 4G2NA 3AOGA 4WCFB 3F9IA 3S55A 2BKAA 3OHSX 1PEDA 3OQ1A 1DIRA 2Q3EA 4XGNA 4LW8A 1F12A 1X7GA 4R1SA 3ZHBA 1WNTA 4WASA 3PFWO 3L6EA 2C5EA 3S2IA 1WXDA 4L0QA 2GLXA 4XA8A 1H94A 1G1AA 4B4UA 1U8XX 4YCAA 3OSUA 1U5AA 4KQWA 4W4TA 1HSZA 3ZGYA 4J16A 4RVFA 1R0LA 4IZIA 4A03A 4ZVVA 3QVTA 4PLWA 3GZNA 4FOSA 5KNLA 4IS2A 4FGWA 3ASUA 4J6FA 4RZHA 5TT0A 1TXGA 2CF5A 3RU7A 3UFXA 1E3LA 3JQDA 4JBIA 4GSLA 5COBA 4H15A 2FR8A 3ZWPA 3NTOA 2ZQZA 3VH3A 4BV9A 1UZMA 2TMGA 4BVAA 1NPDA 4CMBA 3DAFA 2J5RA 1MC4A 2O3JA 1TVEA 2WYWA 4R3WA 1FMCA 1Q2XA 1A5ZA 1NP3A 4JBHA 4MIYA 4AJIA 1Q0HA 3LC1O 4BNXA 5I7EA 5FWNA 1UJMA 2FR0A 3KEOA 4WE3A 1R6DA 3KYDA 3T4XA 3PGJA 4DYVA 1D1SA 4NK4A 1SZJG 2Y1FA 4L8VA 1TT7A 3OIGA 1FDTA 1AUPA 5FYDA 4YJFA 2BFMA 3TNLA 1HE4A 3DZHA 2ZIZA 3UCEA 2GERA 4N5LA 5B37A 1DFGA 3JD1A 3WGQA 3P2YA 2PGJA 3WQRA 2DFVA 1WW8A 1KVUA 4OQZA 2VOEA 3HUDA 4IGEA 3Q0EA 1P1JA 3D3WA 3FSRA 4BGUA 1GD1O 1E5LA 2BGKA 4J1QA 3WMXA 2O48X 1I5RA 1NPTO 5DULA 3H3FA 3HQ4O 3GN2A 1Z82A 5IDXA 2PA3A 1ISFA 2X5KO 3PLNA 3TRIA 1XR3A 4J0EA 1GV1A 4CLDA 2HAEA 5AQ1A 4P22A 1XA0A 1PQUA 3RSHA 1B3BA 3M1AA 3ZU2A 1HETA 4II2A 4YJGB 3ZWYA 3H65A 3PZRA 1Z7EA 1GV0A 4O5OA 5IDYA 4W9NC 5KJ6A 1XEAA 3DONA 3L07A 2HUNA 2PFGA 4OO3A 2HO5A 5JPIA 2O23A 2D1YA 1KEVA 2QQ5A 4QSMA 1IUKA 4Y67A 1EE9A 2HQ1A 1HWYA 2NSDA 3PTZA 2JFHA 2O3RA 3SC6A 4EBFA 5JYDA 1DHTA 2VHZA 3B1JA 4W9NA 4MOWA 4K28A 3DR3A 1YH3A 3RBZA 2VUSA 2YDXA 4CM9D 3GEGA 4FFMA 1ZSNA 4NH4A 3KV3O 4S3MA 1VLLA 2B5VA 5EQDA 1PTJA 1U4OA 3WGGA 3INTA 1EK5A 4BO7A 2V7PA 1RWBA 3C1TA 3L9XA 1Q0QA 1S6YA 2GZ1A 1IPFA 1WMAA 4IJUA 1SO8A 3BMCA 2ZJ0A 3GHYA 4GAEA 3IQDB 1R66A 5CHEA 2ZB3A 1L7DA 4PLCA 3IDSA 1ZNQO 5I7SA 4HNHA 4Z9YA 4ALNA 1DIHA 2ZB4A 3EK2A 3MZ0A 3K2BA 1E3EA 4BNIA 3OH8A 1LA2A 4AJPA 4DC1A 2YQ4A 2VNSA 1Y8QB 5A05A 1PS0A 1IHXA 3G49A 2JAHA 1HYEA 1I3MA 4ALKA 1V3UA 3KLPX 4PG6A 4R9RA 3NT4A 2ZB7A 3OQBA 3WSVA 2YHIA 4OIMA 4RORA 1E77A 1KY4A 1P9LA 1P45A 4J4HA 1NASA 5KVCA 4AJ2A 1DRVA 4DWVA 2X9NA 1GCUA 3PHIA 1ISHA 1N8KA 4FOOA 4DLBA 3OFSA 3CPSA 2YFQA 4PG8A 5KVSA 5G4LA 2Y1CA 4NJMA 3LF1A 1I10A 1WPQA 1RYEA 3DZFA 3JQGA 2DBVO 4PZDA 4GSKA 1UAYA 1XU9A 2FHSA 1U8FO 4MP3A 3JYOA 5F5LA 1MGOA 3JQ8A 1PS8A 4M55A 4W82A 3ZV4A 3W8EA 2QRKA 3O8QA 2R2GA 5TF4A 3W4KA 5A4DA 3QLJA 3WGZA 3WR5A 4N5NA 2CSUA 4IDEA 4YYZA 4ZGWA 5A02A 3WYBA 1ZJZA 3QQPA 2Q4BA 1I2ZA 1N7GA 2IZZA 1ISGA 4J2OA 2VUTA 5KCZA 4FQ8A 2PKRA 4NZ9A 5DN9A 1C1XB 1FDUA 1UXJA 1XWFA 1DPGA 1F17A 1MXHA 2ZYAA 3IAHA 4WOKA 4BGIA 1K6IA 3AM4A 2I67A 3AU9A 1LDEA 4IDDA 1IZ9A 1ADFA 4AFNA 3LLSA 4R41A 3DBRB 4OSOA 3L4BA 4DRYA 1BDMA 1XCBA 2AEFA 1SMKA 3QP9A 1GZ3A 1YB4A 3W6ZA 3ENNA 4BKOA 1J4AA 4RDIA 4BS9A 4E5PA 4L9RA 1TLTA 5ENVA 1W4ZA 2W2KB 1PQWA 4FFOA 4PLYA 4B7UA 1FXSA 1NHWA 4Q3NA 1N7HA 4PRKA 4D79A 2B0JA 5IXYA 1NQTA 1I2BA 4QUKA 4R16A 3I9OA 3QVWA 4I9NA 4FB5A 5KVVA 1L1FA 4CQMB 1Y7TA 1OAAA 3SC4A 2OGUA 5IDQA 2DBRA 4QO8A 2H1SA 1PS9A 2P2SA 1MUUA 4CM4A 4DPMA 5H81A 3VTFA 4CLRB 1LLCA 5F3RA 2UAGA 5I7FA 3H2SA 1H0KA 3U9LA 4CQLB 1P0FA 4XEHA 4MIEA 4U0JA 1UAGA 1FK8A 3VKVA 3A28A 4GGPA 3W1VA 2D3TA 2D5CA 4A0SA 4RLSA 1P77A 3VZRA 1O94A 5JDIC 4ZHSA 3ZHYA 2OUIA 2C5AA 5TNXA 2C7GA 2FY8A 1QV6A 2OFPA 4BNYA 3B1KA 2VRCA 4DIBA 3UVEA 2D2IA 4X54A 2NUAA 1VJ1A 3TZKA 1BVUA 4TRMA 4K1LA 4PG4A 5G4KA 3OICA 2VNAA 1DRWA 4C7KA 2UVDA 2CF6A 5KOIA 1NHGA 4PLVA 4NU5A 3UGKA 2FPGA 5A06A 1ZEJA 5JCJA 3V1TC 2NTVA 3IKTA 5L4SA 3RBVA 3CEAA 4NJOA 3C7CB 2EIHA 4TRJA 4PLZA 5FI3A 4WCDA 2WYUA 3NJ4A 2IXAA 2C2XA 2IXBA 4CMEA 4IXTA 4NFHA 1Y6JA 3R1IA 1Z74A 3RC9A 1F06A 1QLJA 1GPDG 4F46A 2I99A 1U7HA 4RF2A 3AFMA 3U0BA 3H9UA 4GLLA 2DAPA 4M49A 4L75A 5BSEA 1NPYA 1HLDA 1I30A 1C14A 1KEUA 4EGFA 3EDMA 4MVJM 5IXSA 4RLHA 3ONEA 3PQEA 3C7DB 3KO8A 5C7IO 3LZ6A 4UEOA 1DAOA 3KHUA 3NT5A 5JNLA 1E6EA 3UW3A 5TX7A 3RVDA 5ER6A 4MKRA 2IDZA 3FNHA 3I9NA 1KERA 3I4CA 5DCWA 4OGWA 1PR3A 2ZTLA 3ETEA 1DLIA 3PQDA 1ZJYA 2EJWA 3PWSA 4PG5A 3UICA 3FCOA 2A92A 2JHFA 1T2CA 2UYYA 2B37A 3DB2A 4CM1A 3RQSA 3K8ZA 1UXIA 4NBVA 1B14A 3DMTA 3V2UA 3WNQA 1PJQA 4NR0A 4ZQEA 4YJHA 3E6AA 3AK4A 4F3YA 1B26A 4FW8A 2Q1WA 5K6AC 1KIFA 1X1EA 1RM3A 3LT4A 4MP6A 4NHEA 4Z0PA 2GN6A 3RI3A 1B3RA 1YOVB 4J7XA 4P4NA 3V2GA 3ABIA 2VT2A 2XF8A 3H2ZA 5U1PA 5JAIA 3FN4A 2NWQA 4NG5A 3RKUA 4YTEA 1BXGA 3U4IA 4EEXA 4TSKA 4MVJE 5A03A 3WXBA 2DVMA 5JDCC 3UOGA 7MDHA 1DB3A 4LCJA 1A7AA 3WYCA 1EDOA 5H83A 3JQ7A 4BGVA 1NQOA 3UCFA 1IPEA 3TDKA 4E5MA 4GH5A 1TEHA 4WECA 2I9PA 2IRWA 3K6JA 4IXWA 3AOEC 2D4AA 4UUPA 1C0LA 1EEHA 2PGDA 5JO9A 2NNLD 2XOXA 3GGPA 4JROA 2D5AA 4R3NA 1T26A 3RIHA 3OJ0A 5BSGA 4F45A 4XJSA 3ROMA 4CR6A 3IJPA 4II3A 1LUAA 3F1LA 3FRJA 2RIRA 3K92A 3HADA 1N9GB 3TFQA 1NAHA 4D45A 3GVPA 4CLHA 1UDBA 3B70A 4GGOA 1H6BA 3GA0A 3WQSB 4YXFA 5EQFA 2NU8A 2VQ3A 1JAXA 3D4NA 3PXXA 4HFJA 1LDYA 1LNQA 4A73A 4Z9FA 1DXYA 2QZZA 3OP4A 3TF5A 4CMAA 3ONDA 1HL3A 1PJ4A 1G0OA 1LEHA 5JO0A 1FDSA 2C0CA 4E2ZA 2HMVA 3ZV6A 5F21A 3EAGA 2IEBA 1P1IA 1AGNA 1K6XA 3PI7A 3PRJA 4YT8A 4E2YA 3WGTA 4UVHA 1YGYA 5A9SB 5ICSA 4PVCA 2EXXA 1R4MB 4HUJA 1NWHA 2Q49A 2X1HA 3VZQA 1BDBA 5A5EA 1UDAA 3MTJA 3F4LA 5COAA 3G1UA 1A9YA 2Y99A 4KUEA 5KTKA 4Z6KA 5C5IA 1P1KA 2VZ0A 2X0RA 3MJVA 4FSHA 3OJFA 1Y8RA 4DPLA 2I66A 3QY9A 3LU1A 3ROKA 1P1FA 2RHRA 3G79A 4IIUA 3BMQB 3WICA 1XHLA 4Z3KA 2HCTA 3ZNOA 2NV6A 1U2GA 1VKNA 1V9LA 3C7AA 2EKQA 2JCVA 1J49A 1MLDA 1BWSA 4TVOA 5JMPA 2FN7A 1VL0A 2J8ZA 3TZQA 2E6UX 4CJXA 2Y66A 1ENOA 1N92A 1ONOA 3EYWA 2A4KA 1JVBA 4Q3AA 5EERA 2X8LA 2GO1A 4FFNA 2AHRA 5L7WA 3WBBA 4DMLA 4Y8VA 4R54A 4CUZA 4OHUA 1W8DA 4CQMD 5KJCA 1CJCA 3K5PA 3DEYX 2GN4A 2O2YA 3F3SA 1D8AA 3OBBA 2NTJA 2RCYA 1JW9B 1T2AA 3WFIA 1HE2A 3GZNB 3CIFA 3FHLA 2HKIA 2VCYA 1X1TA 5IN4A 3ZU4A 3ZWCA 3AU8A 3O03A 4ONEA 1VJ0A 4J9UE 5G0UA 4JGBA 2O3QA 4DL9A 1Z75A 3H6KA 1LXCA 1PU2A 4Q3BA 3OM9A 3PYMA 1VRWA 4MVJD 4GVXA 1XYGA 2YV3A 3BMNA 3IIEA 3RD5A 1LQTA 4EJ6A 4MVJH 5L40A 5BT9A 1EDZA 1LC3A 5DF1A 2AG5A 2FPIA 5BNIA 1HDCA 1TT5B 4IGFA 1M67A 1SBYA 2GD1O 3DAGA 3IUPA 3KYDB 3ANLA 1I0ZA 5DCUA 1AN9A 3M1LA 4EJ0A 4B7CA 4IDAA 3GF4A 1BGVA 3A06A 4IS3A 3C8MA 4J1NA 1U28A 4YA6A 3VAZA 3ZU3A 2PR2A 2Q1TA 4YACA 2PH3A 3OA0A 5CPBA 4R69A 3V1YA 4GWKA 2EG9A 2ZCUA 2DTDA 4L4RA 1U3WA 4DREA 1LLQA 3DBHB 4FFRA 5JAQA 4UREA 2C2YA 3BYZA 4BNJA 3ZWXA 1E7MA 1PGOA 4HNGA 5G0VA 3OIDA 2Y93A 3GMSA 1IOLA 1A4UA 2EKLA 2JL1A 5KJEA 3W4JA 3TQHA 3NDIA 3I52A 1DBVO 4JLWA 3CMCO 2CD9A 4AJHA 2Y1OA 1GAEO 3VPSA 3DOCA 3W4IA 3LT0A 3U4HA 1E3WA 3H5RA 4FN4A 3FPCA 3S8MA 1R37A 1I2CA 2EHDA 1AE1A 3ZWWA 3SLGA 1ZKMA 3GFBA 3TWOA 3BHIA 1DJNA 5ITWA 1ENPA 1YDEA 4BIIA 2CNBA 2HMWA 1DJQA 3BTOA 1WDLA 3TZ6A 2X0JA 5T8KC 3E48A 1YO6A 2OO5A 3GT0A 4BNMA 4E5YA 3VH4A 1JN0A 1LSOA 1XELA 1EFKA 3LVFO 1RM0A 2HJSA 2Y1EA 3GVXA 1LU9A 5ENDA 3ZW8A 3D64A 1RKXA 4N5MA 1QYDA 2CMDA 1CERA 3JQFC 1Z73A 5T8KA 2QW8A 2RBEA 3X2EA 5ADHA 4UVGA 4FJ2A 1D7OA 5IDWA 2X58A 5F1KA 1PX0A 2NVUB 1SCUA 4LN1A 4YAKA 5A5FA 1UP4A 5DT9A 3VVBA 1EQ2A 4BNLA 1ULSA 2YUTA 2ZCVA 1I33A 4WPGA 1PZGA 4BO5A 1QORA 2WJPA 4JJFA 2PZLA 4RO0A 3MJEA 3I9MA 2VN8A 1M6WA 3BHJA 5HBRA 5K9ZA 3KUXA 3AUAA 3AM3A 3SBOA 1F0YA 2HMUA 2BLLA 3ADPA 4YAJA 2JCXA 4YWJA 3KTDA 4JJGA 5DBFA 4FDAA 2VZ8A 3Q2IA 2VHYA 1P44A 3KXDA 1O89A 4ALIA 5U4QA 1O0SA 2YHIB 1YRLA 3E82A 5L7YA 4B4WA 4RPJA 2E48A 2H9IA 2RAFA 1O8CA 2Z95A 3DHEA 4MVJF 2PKQP 3DAPA 3MCVA 4Y6SA 3F6YA 4PCVA 2DUUA 3H5AA 4NJMB 2GRAA 4BMVA 5JY1A 5B4VA 3JQGB 4U6SA 1SC6A 2BELA 3MJTA 1BW9A 2NVWA 3DOJA 1PJ3A 5G0WA 3NDRA 5GZ6A 2C54A 1WDKA 4ALLA 2OHXA 3JQ8B 2WSBA 3WGHA 4JP2A 4R68A 2P5YA 3CXRA 1C1DB 1GL3A 3O8QB 1YBMA 4DPKA 3QWBA 5A3JA 1KVTA 1NR7A 1YKFA 3D5QA 2PY6A 5L45A 4E32A 2JKVA 3KYBA 4DXHA 3I9KA 1DOHA 1KVQA 2CFCA 3OMLA 5DOZA 4OOFA 3UF0A 3JD4A 3T7EA 4LISA 3INRA 1EK6A 1QRRA 3GPIA 3H4VA 4JBGA 4CM3A 4CLOB 4J1SA 4YJDA 5HM8A 2DU8A 2ZK7A 4JJIA 1PJTA 1H9AA 3F47A 4BKPA 1C0KA 2PNFA 3VVCA 4DBVO 4E2WA 2VTDA 3BXXA 4L4XA 1JDJA 2PGLA 5L95A 1R0KA 4MKZA 5LC1A 4EYEA 1YONA 1JWAB 1E3SA 3DZJA 3UN1A 1IY8A 4CM5A 1C0PA 3UXYA 4NI5A 4IJWA 1NFRA 2IZ0A 3H9QA 4Q3EA 1X13A 3D3EA 1SOWA 4N7RA 3EMKA 2EEZA 3IC5A 3Q11A 3GFGA 4KOAA 4R9SA 1DIGA 4TZTA 1EZ4A 1XLTA 1HE5A 5BSHA 1O9BA 3PIDA 4RPKA 4CM4B 5KWEA 5HS4A 2G0TA 4YT5A 3V2HA 5J23A 2HK7A 4I5EA 3D4OA 1SPXA 1UR5A 2J5KA 4NFYA 1HZZA 2PTGA 4UEJA 4I9HA 1PR9A 4UUMA 4M87A 4PG7A 4M1QA 3WWZA 1U2DA 4D3DA 4PZEA 1DC6A 4LRTB 4XJTA 3WGYA 1G0NA 5AYVA 1T1RA 2I65A 3IP1A 4IMPA 1SEVA 5CDUA 2WD7B 4GVLA 3K73O 2QRLA 2V6MA 5G4KB 1GTMA 1ZCJA 4MPDA 1BXZA 3DDNA 2DPGA 3DO5A 4XCVA 1LC0A 3RBXA 1SNYA 5TQVA 5BNTA 4YAEA 5U9CA 2F1KA 3OJOA 4GI2A 4A26A 1ZK2A 1HT0A 4UVDA 2Q50A 2NVBA 2X7HA 2A94A 1J0XO 1DFIA 4K6FA 1LSJA 5IFLA 3FTPA 4WJZA 1YL7A 2Z5LA 3PYXA 3TJRA 4ZQGA 3C3XA 5C37A 2YY7A 1D4FA 1QXSA 4B3IA 1X7HA 2EERA 3BTSA 3NDJA 3E03A 1P3DA 1VSVA 2Q2QA 5CPFA 4YRBA 2EGHA 4RVDA 2VWQA 4NU6A 3P19A 1JAYA 1X15A 4INAA 3TZCA 2X4GA 1EBUA 2F00A 4HFMA 1TI7A 4RJTA 2B4TO 5T64A 1GU7A 3ONFA 1ULUA 4NPCA 5IJZA 1PQPA 3D0OA 4WCFC 2G1UA 4CR7A 1GQ2A 1QR6A 3E5MA 1MFZA 1MFPA 3GR6A 1CEQA 3WDSA 3PYLA 4B4VA 4U0KA 1IZ0A 1VSUA 4U8GA 4G5HA 4I9UA 2JAPA 3PFFA 4WLEA 2NLOA 4KZPA 1W73A 4QQRA 4BL5A 1V35A 4E13A 5FEUA 4CMGA 4JQCA 1R15A 1Q7BA 3F5SA 3PHHA 1NVMB 5B4UA 3PP8A 4Z0HO 4YJHB 5JAZA 2EP7A 4PLGA 2ET6A 3KBOA 1QYCA 3ZWMA 3PIIA 3DWFA 2AE1A 2R6JA 3COSA 5A9RA 2PK3A 1ZK0A 3ZNQA 1P1RA 2Q45A 4GWGA 1YBAA 3RJ9A 2YQ5A 3L0DA 4DA9A 3D4PA 4K26A 3V1UA 4HV4A 4CM7A 2X5OA 3RFTA 1YXMA 5C7OO 5JCXA 4BMSA 3RFVA 5EN4A 4Z9XA 4BO3A 3AY7A 3JQ7B 1G6KA 3DTYA 4NK5A 1E1KA 5CFZA 3KETA 2P9CA 3U4CA 4TVBA 5JC1A 3DBVO 3MTGA 2DFDA 4R01A 2WDZA 4GKVA 4RF3A 1KOLA 1I36A 5I8WA 9LDBA 4PGFA 3HNPA 1KC3A 4DTIA 4FD3A 2J6IA 2B4QA 2OZPA 5IZ4A 4WLFA 1PGQA 5JSFA 2X86A 3KVOA 2ILTA 2YV2A 4WLUA 5ITVA 2AQHA 3WYEA 3OJLA 2ZYGA 3RUCA 3E8XA 3K30A 2XXBA 3HN2A 4L74A 4RQTA 3IKVA 3TPCA 1VE9A 4KUHA 2VHXA 3PJEA 1O95A 4RGBA 4BNWA 1VL8A 2HLPA 3E9QA 2FPPA 1LDNA 2V65A 3MWEB 4JX8A 1HKUA 1CDOA 2ZTMA 2HMSA 3F1KA 3GC6A 3GG2A 3M2TA 3QWFA 1HE3A 3KYCB 5JC8A 2BD0A 3JCZA 1JLLA 1ZSYA 3QVXA 1NVTA 4LRSB 1O5IA 4FCCA 2VWGA 4JCOA 4DC0A 4ZQFA 1EUCA 4OKIA 4XRGA 2GSDA 1ML3A 3EVTA 2NACA 2OL4A 2OOSA 4GX5A 4BKRA 4ND5A 3ZDFA 3EZLA 4WLVA 1E7QA 2YW9A 1ZFNA 4O1MA 1R12A 1ZO8A 3GY0A 1DDOA 4GKBA 4E5NA 1T2EA 1NM5A 4F6LA 2Z1MA 3Q3CA 1Y8RB 4BNHA 1XQ1A 3NUGA 1ZW1A 4ND2A 5JDIA 4TROA 4J0FA 3RU9A 2CVOA 3KEQA 4WEQA 2FZEA 5GMOA 3IP3A 1PIWA 1HDYA 2EP5A 1QYXA 3NT2A 2O3SA 2DKNA 4U7WA 4A2CA 1NYTA 2BFPA 3I3OA 2BI7A 5HA5A 1DAPA 2GZ2A 4GBJA 1ONPA 3QE3A 2BHLA 4B3HA 4D46A 4WNCA 3SXPA 3L4SO 2NU9A 1XKQA 4XYMA 2DTEA 5JW6A 4BQPA 4YAGA 1EBFA 3FF4A 3QWIA 4ID9A 1XDWA 1E92A 3PWKA 2HK9A 3CTMA 4R5HA 3E9MA 4RPLA 4GQAA 1SAYA 3V8BA 4HKTA 4OSPA 3FTNA 1LQUA 3CUKA 3CINA 5I9LA 1VM6A 1XIVA 3PWZA 4YR9A 4E3ZA 1X0VA 4EUHA 2NU7A 3OQ6A 3HDHA 4F6CA 2EW8A 3OA2A 3JQEA 3T7CA 3BTVA 2PD6A 3G3EA 4LMRA 5TS3A 2CDCA 4E2XA 2GDZA 4CLXA 2A35A 1T1SA 2Y67A 3N7UA 3D5TA 4TRRA 1Y8QA 3EGOA 3E5RA 1OZAA 1ISJA 1HSOA 1P74A 1FDVA 2Y05A 4RF4A 2NTNA 1K3TA 3DXFA 2V6BA 2VRCD 3PJFA 4RPHA 1PL8A 3W8DA 3WGOA 2C59A 3X2FA 4AICA 5B12A 4YDRA 2PD3A 4M86A 2J3HA 1VC2A 1TB4A 3S2EA 1FDWA 4PVDA 3CKYA 2PV7A 1HDXA 3PEFA 3CE6A 2E4AA 3JD2A 2BMAA 5DZSA 5JCJD 3DQPA 4U6QA 1LI4A 5HTOA 3CSDA 1A9ZA 5KJ1A 4FBGA 1E5QA 3RAJA 4YT2A 2G82A 2WE8A 4IBOA 5K6AA 1U3TA 3NYWA 4I1IA 3HDQA 3B20A 1MV8A 3HHPA 1E6UA 1SEPA 4EUEA 1CIVA 4J4BA 3MOGA 2X23A 4FR5A 1LSUA 5JDCA 4YQYA 1GQYA 4IDGA 1B16A 1JTVA 3DZKA 5EIOA 4BV8A 1UZNA 2QZ9A 1NR1A 1KEWA 3K31A 4MIOA 1NNUA 3AUSA 4HBGA 1PJ2A 3FWZA 2B36A 4UUNA 2PD4A 4GLOA 1C1XA 1V8BA 3AOEA 2P91A 4DQVA 4MKXA 1Q7CA 4CM6A 3U49A 4J4TA 1WAMA 3HG7A 5MGBA 3ROPA 5BR7A 5JMWA 2DTXA 4YPOA 1E3WB 3DBRA 1QP8A 2CVZA 4IIVA 5JS6A 3ZV3A 4GMGA 3MWDB 2V6GA 1SOVA 2IODA 2O7QA 4URFA 4XD2A 3HFSA 3P2OA 2NU6A 2BI8A 4IJKA 1ISIA 1HDOA 1XQ6A 2AW5A 4JIGA 2H5LA 3PJGA 4YAIA 2AG8A 4Y9DA 3TOZA 4CMCA 3GQVA 2AE2A 3I83A 4P4LA 4IMRA 4PLHA 5EL0A 3TN7A 3GDGA 5TRTA 1RPNA 3DZGA 3HSKA 2BFOA 4H16A 1YBVA 4DQXA 1E0DA 1U3VA 2FSSA 1PSDA 4JN6B 4XYBA 5L7TA 2WYVA 4DIOA 3WTCA 4E30A 1Y5MA 4Q3CA 2FR1A 4XIYA 5A3VA 2P4HX 3H8VA 4CLRA 1BG6A 3B1FA 5B1YA 2WWRA 3DZIA 4AJEA 1F8FA 3JQ6A 3UUWA 4BMNA 1E1LA 4RVHA 4XQGA 4CM8B 3OEWA 5CG2A 1K5HA 1H2BA 8ADHA 4XDZA 2C20A 4NNJA 3RROA 4O0LA 1ZVMA 2GGSA 1N5DA 2YJZA 3AFNA 5I8ZA 1GUYA 3GNQA 2OXIA 3G1TA 3VH2A 5ICMA 3TFOA 2FSVA 4G81A 5LCXA 3GLQA 3WGIA 1KBZA 3H9JA 1WLYA 5THQA 3WS7A 1U1IA 3UKOA 3WIEA 5AVOA 3KSUA 1PJLA 3GUCA 1ADCA 2FRDA 2J3IA 1JKIA 3NJ8A 1JVSA 1DSSG 2DBQA 3NKLA 1I01A 1LRKA 5A04A 4ND3A 3GK3A 4XB1A 4ZJUA 1HDZA 1NQAO 1WP4A 2ZB8A 4IDCA 2UDPA 5A1TA 1DRUA 1I3NA 2W2LA 1AXGA 5ILOA 3BAZA 3K96A 4MVJP 4XDYA 1BW9B 5L4LA 1K0UA 4QX6A 1LBEA 1ZBQA 4DYDA 4OH1A 1ZK1A 3WLEA 2VTEA 3ZW9A 9LDTA 1A7KA 1IL0A 2FOIA 1K6JA 3MJSA 4E6PA 3JQAA 4IJVA 2EV9A 4KUGA 5JXWA 3ZV5A 3Q6IA 3NTQA 4ILKA 4J43A 1CWUA 1YJQA 3BTUA 3NGXA 2DLDA 1GADO 2G76A 1GUZA 3UCXA 1KVSA 2H6EA 1SB9A 1CF2O 4HFRA 4XX0A 3Q9NA 2DPHA 3LSYA 4HP8A 5JLAA 3A14A 3VHRA 3F4BA 2X9GA 5ES3A 4YJFB 2XPCA 2HJRA 1PZEA 3LT2A 3KZVA 2YV1A 5DOVA 4FJ0A 3GRKA 4BNFA 2Y0EA 4BNKA 1GYRA 1ZEMA 4FFLA 3PHGA 1O6ZA 1C0IA 5GZ3A 3Q1LA 3WMWA 3QSGA 5CDGA 4DUPA 3FPLA 3D3WB 5MDHA 3CMMA 4Q9NA 3PHJA 2QRJA 3L77A 3WX0A 2P9EA 3O9ZA 2FMUA 1T4DA 1GYPA 4WLOA 1DIAA 1X0XA 4ZQBA 3E1KA 5KVQA 3RUAA 5L53A 2D8AA 1LLDA 4GPD1 2JD1A 4H7PA 4EUFA 1B15A 6ADHA 4PFJA 4DLAA 5JBIA 5COQA 3ZI0A 4KQXA 2IZ1A 4NBWA 5C3MA 5CEJA 1H6AA 3AY3A 1GDHA 4IM7A 3RC7A 2QG4A 1R4NA 3H5NA 3N58A 3P5SA 5KKCA 1ORRA 3PK0A 4D3SA 4ZA2A 2RHCA 4N54A 2GF2A 2X22A 3BIOA 3GOHA 1HXHA 4YRAA 3F5QA 3H9EO 5JAMA 2OP0A 3GAFA 2JFGA 1NWCA 2A9FA 1JKFA 1IE3A 2GYYA 2AEMA 1JKJA 3ADOA 4GX0A 4LMPA 4IINA 2EWMA 4XGIA 3I1JA 1WZEA 2VYVA 4DGSA 2CVQA 3BMCB 2I3GA 1U9JA 3UHAA 2C82A 1AHHA 2O3UA 4UVIA 4E31A 1F14A 5A9SA 3Q9UA 2HK8A 5AXCA 4XR4A 3WSWA 4BKUA 1M76A 4QFDA 1R4MA 1U3UA 1E7SA 1V0JA 1E3JA 2H63A 4MO2A 5KKAA 3JQFA 1GFSA 1NAIA 4IQGA 4RL6A 3ST7A 3HFGA 3NTRA 2BF7A 3KOUA 2E37A 4P38A 3G17A 3GN1A 3ZCXA 1NQ5A 3ZWVA 4O63O 2HDHA 2VOJA 1J5PA 3DBLA 3ETDA 1YB5A 4MVJI 4OJNA 4XIJA 3HB5X 3EW7A 3U09A 4BO1A 3BMQA 3O26A 3ANMA 3VZPA 5BQFA 3QWHA 4D0RA 2G17A 5DBIA 4E5KA 2P5UA 1DC5A 3IL2A 2WEKA 1I8TA 2C07A 3AUTA 4QFCA 5CDYA 4HWKA 5BSFA 1QSGA 3CH6A 4QO7A 1V3TA 1N2SA 3I9LA 5JYEA 4NQZA 3LDHA 2NADA 4Y98A 1BSVA 4A7PA 4BNNA 2VWPA 3VDQA 4QECA 1DC3A 4J90A 5F1PA 4K6CA 3ULKA 4D43A 1V6AA 4RQUA 1RJWA 3ENKA 3RJ5A 1DO8A 1PL7A 5T57A 3WFJA 5CP8A 3BMOA 3VPHA 2IYPA 2VYVD 1T2DA 4FFPA 2WTBA 3SJ7A 3OECA 2C7VA 5GZ1A 1X7DA 4MP8A 5ILGA 3QW2A 3B6ZA 5TSDA 1I32A 3RC2A 4D42A 1DLJA 3ZN2A 1QKIA 1ID1A 4EI2A 3U62A 3WJ7A 4I08A 5G0TA 5EJ2A 4HFNA 4ZU3A 1ENZA 4AJLA 2R00C 1BVRA 2AQ8A 4J3FA 4C4OA 5ER9A 7ADHA 1WZIA 2FZWA 5KJFA 4A10A 4CM9A 1VL6A 4TMFA 3WB9A 5CG1A 1TT5A 4CMIA 4MJLA 2I5PO 3GRPA 4L76A 3KLMX 5AXBA 3ZNPA 2R00A 3ON5A 4WKGA 1OFGA 4XYEA 4B4OA 4ND4A 3AWDA 3FNEA 2AXQA 4D41A 1KS9A 2B5WA 1YB1A 4B7XA 4BO0A 1GEEA 5TJ9A 2SCUA 5L9AA 4AJ1A 1Q0LA 4W6ZA 4UAGA 3WG9A 3DBHA 3DHNA 3FBGA 1D3AA 1BHSA 1B7GO 3IS3A 4TKLA 2GUGA 2ZATA 2Q46A 3H7AA 1P0CA 3RUFA 4TWRA 2XAAA 1VJTA 2HU2A 3IUSA 4R1UA 3VOSA 2B4RO 4I5FA 2AMFA 3WQQA 1KEPA 4WK6A 1Q1NA 4YBZA 4BB6A 3AI1A 3WTBA 3LQFA 2AQIA 2VUUA 4LSWA 3O4RA 5FFFA 4CL3A 4CLEA 2PH5A 4ITUA 4CPDA 1E6WA 3WLFA 4E12A 3VZSA 2Y0CA 4OYRA 4RV9A 3NEPX 2Y1GA 3HE3A 4IPTA 4YRDA 2FWMX 3PLRA 4BO9A 2B83A 4GX1A 1AXEA 1EVYA 1QYWA 1QV7A 2Z1NA 5LDHA 4CMKA 5H82A 1MC5A 2X9VA 2V6FA 2CZCA 4DVJA 4CV1A 2PZKA 5T6BA 4BNZA 5LDGA 3U4DA 5F5NA 4EZBA 3RKRA 1YVEI 1IB6A 3C85A 4AL4A 2W98A 2YFHA 3NV9A 4NDNE 3A1NA 4AJJA 5IZCC 4A5OA 1BXKA 2GASA 3U3XA 4Y6PA 2BGMA 3KSDO 4FIZA 3LLVA 2WMDA 1U5CA 1YQXA 2JCYA 3BZUA 3H9GA 3RWBA 1H2HA 2NQTA 1B2LA 2VHWA 4Z0TA 2NVUA 4CL8A 1GUFA 4WGGA 8LDHA 5IZCA 1LLUA 4P8RA 1LJ8A 2GR9A 2IEDA 4NBRA 4DBZA 4I8XA 3HWRA 3L9WA 2IE0A 3ZU5A 1CYDA 1HDGO 3AI3A 3PHLA 4HX5A 1UDCA 4FJ1A 1K89A 4WCFA 1JA9A 3EHEA 5HS6A 4NMHA 4XWYA 2WE7A 3VC7A 4GX2A 1ZSVA 2OORA 1YL6A 4HY3A 4OQYA 2Y68A 3BHMA 5L3ZA 4RCVA 3FWNA 2X5JO 1VI2A 2VRBA 1T2FA 2J5QA 3BA1A 1YE3A 5AXAA 1U4SA 5IN5A 1B0AA 5F1OA 4D3FA 5JY6A 2GN8A 4B79A 3GAZA 4OXYA 1BXGB 4QXMA 3GGOA 3NAQA 4L4SA 4QEDA 1W6UA 5G0SA 4ALJA 1IYZA 3S2GA 5HWSA 1PL6A 4CV0A 1UZLA 1PZHA 2VHVA 2UV8A 4MDHA 4BKQA 3ZHXA 3GPDG 1OC4A 1E7RA 2QYSA 1NVGA 4LVUA 3R3SA 2Y1DA 4D44A 5TJHA 3QVSA 3GDOA 1C1DA 4YQZA 4M54A 1I24A 4KTTE 2YZ7A 4RF5A 1HF3A 2QHXA 1T25A 2Q2WA 4Q3DA 4ALMA 3I23A 3AM5A 3R3JA 4OMUA 1YQGA 3NGLA 1PGJA 4TQGA 3WOHA 5CEFA 2VWHA 1D1TA 4ROSA 3L4BC 1OBFO 3ZWBA 3DL2A 3GGGA 4UEKA 2HRBA 4CLOA 2Q1UA 4KP7A 2BGLA 1A72A 4LCEA 3SJUA 2CY0A 3FR8A 5DBGA 2AA3A 1M2WA 4XQ9A 1JWBB 4LSMA 4O59O 1P31A 1WDMA 2EW2A 3AJRA 1KYQA 1QG6A 1HLPA 2E49A 5EMHA 1NBOA 4W99A 1U7TA 1BMDA 2GCGA 3ORFA 3GH3A 4XR9A 4CUKA 1I3KA 3TL2A 3ZWOA 1EQUA 1UP6A 4BOYA 1T4BA 3WWYA 2I3AA 3QVOA 1GPJA 1B8UA 2QIOA 1JU9A 2XXJA 3IMFA 1NTOA 4FC6A 4YB8A 3SX2A 1KC1A 3VPFA 4FC7A 4BO2A 2LDXA 3EY4A 3HN7A 1HTBA 2GNAA 2D0IA 3VPXA 4JXKA 5TGDA 4J91A 1R16A 3CZRA 4BNGA 5I9NA 5BNFA 4M8SA 2O4CA 3PVZA 4QT0A 4KDEA 3KRTA 4J7UA 4KWHA 3LT1A 1ADBA 3QA9A 3RCBA 4YJGA 1NXQA 3I5MA 4J1TA 4M89A 1WMBA 3PQFA 1NFFA 2DBZA 1LRLA 4JNKA 4U5QA 2ZKLA 4WUVA 3WJAA 1LRJA 1CQIA 1YQDA 3Q2KA 2PLAA 1IHYA 2W8ZA 3G0OA 3M6IA 4PIVA 3PGXA 3QV1A 2RH8A 4AG3A 1RYDA 3PDJA 3ETGA 5L4NA 1ENYA 2WD7A 2POQX 4CMEC 2O2SA 1VKOA 4PN3A 3DZBA 5T5QA 3DOOA 5AXDA 1LSSA 2O4UX 4ESOA 4J49A 3JQCA 2B69A 4IDBA 3T4EA 5DCYA 1XSEA 1ZMOA 4OOEA 2J3JA 1PJBA 4MINA 4DQUA 3VPGA 1H6DA 4UULA 4LGVA 4AJKA 4EDFA 3GNSA 1I3LA 3QHAA 4NBUA 1ZK3A 1E3IA 3PDUA 4E21A 1OI7A 3EZYA 1MG0A 1PGNA 5DNAA 5DP1A 4E4YA 3FI9A 1Y81A 4GL4A 1Z45A 3JYLA 4EW6A 1E7WA 1GR0A 2YDYA 3JD3A 2VYNA 2HMTA 1HEUA 4RPGA 1ARZA 1HRDA 1HYHA 1ONNA 5JFOA 1A71A 3JQAB 1EVJA 3I9JA 3BMNB 5C7LO 3DMTC 3SLKA 1LDBA 3OEYA 1GCOA 4H3VA 3STHA 4NIMA 3MOIA 3MJCA 5TT1A 3ZZNA 1DHRA 2OBNA 1XG5A 3ITKA 3P7MA 2PZJA 3IJRA 1Z7BA 3ANNA 4BQRA 1BRMA 2QYTA 3I6QA 5I7VA 1PWZA 4TRNA 2P9GA 1MP0A 4DLLA 4GMFA 4BGEA 3HDYA 4AVYA 3C1OA 1R0SA 4MVJG 3ZWAA 1KVRA 1RM5A 4BO6A 3SVTA 3UH1A 2AEJA 2W90A 1PWXA 1Y9EA 3GVHA 3IOYA 3N74A 4Q39A 4R1TA 1QMGA 2CDBA 3ROQA 3HZZA 4YVFA 5IG2A 5TC4A 2W4QA 1LDMA 1F8GA 1ISMA 4JK3A 6LDHA 4J7CA 3ZNNA 3D1LA 3R0IA 2NQ8A 4KTVE 4R5MA 2O50A 4OL9A 1GZ4A 5EINA 1MA0A 3CZMA 3LF2A 4ZRNA 1ZXBA 3PJDA 3QWAA 3KM0A 2ZTUA 3SEFA 2DUWA 4IQ8A 1N1GA 1NX6A 2X0IA 4BO8A 1UXHA 1TA4A 1DC4A 2WM3A 4IY1A 1DFHA 4HADA 3K2EA 3JD0A 4C7JA 2VYND 3JV7A 4KWIA 4QTZA 4NFSA 3ZHZA 5THKA 4B8ZA 3EUWA 4IDFA 3JTMA 3DC2A 1FJHA 1E1MA 4AJ4A 1R4NB 4W7HA 1H6CA 1JQBA 2W2KA 3C1AA 2I76A 3DMYA 2JHGA 2Q2VA 2EJVA 1CRWG 3JYQA 3RUDA 1VPDA 4D7AA 3FR7A 3R6DA 1FF9A 3I4FA 5I9MA 4ZN6A 5B4TA 1Q7GA 2ZTVA 4CQMA 1QYVA 4O6VA 2CUKA 3M2PA 4NBTA 4XKJA 4BB5A 4XQEA 4R4JA 4EJMA 4PLFA 4IUYA 4LK3A 2YHUA 3GEMA 3KYCA 4CQLA 3AI2A 2BFAA 4BNVA 1KETA 3O38A 4OM8A 4JP3A 5HRUA 3E18A 1DEHA 3ZWNA 2X0NA 4CMJA 2TMDA 4L73A 5FF9A 1E7YA 1GZ6A 4MVJA 3S2FA 4BNTA 2HRZA 1ZMTA 3F46A 3GEDA 4I5DA 4WOJA 1Y1PA 3TOXA 4Z3DA 1S7CA 4EITA 4W7IA 3RUIA 1T24A 4OXKA 4XQCA 3A9WA 1H93A 1ZXLA 4IZHA 4AJNA 3V5NA 3QRWA 4TKMA 3DBLB 3INGA 1GYQA 1UXKA 5TLSA 4PLTA 1GY8A 2JD2A 3JYPA 1LDGA 1EFLA 2QX7A 1EUZA 3GMDA 2EF1A 3U5TA 2Q4EA 5AOVA 5CDSA 2DT5A 2C29D 4RVGA 1ZZEA 2O3TA 1C3VA 5GY7A 2PZMA 3LYLA 2HSDA 4J9VA 5G2OA 1EE2A 2CDAA 3VDRA 1A4IA 4FGSA 1H9BA 4KMSA 4ZD6A 2JJYA 2GPTA 4YT4A 4TZKA 1UH5A 5K0ZA 2X6TA 1PGPA 3K9QO 4K9DA 1LTHR 1XU7A 1UUFA 4PRLA 4EEZA 3ASVA 2DC1A 2Y0DA 4FS3A 3UAGA 2RH4A 3GVIA 4B8WA 3FBTA 2JD0A 3VTZA 3RASA 1X14A 3AUUA 3S1LA 1N1EA 3FNFA 1GEGA 3TZHA 5CEEA 3RC1A 2LDBA 4HXYA 3A4VA 3TSCA 1DIBA 4N18A 2IYOA 1GQQA 2UUPA 5A9TA 3FD8A 4CR8A 3BMOB 3L6DA 1EUDA 1RM4A 2B35A 3ICCA 3JSAA 3OF2A 2FP4A 4PZCA 4AJOA 4CODB 4D0SA 3NRCA 3D7LA 4ND1A 2O7SA 4J2HA 1J6UA 4BHTA 1PJCA 3JQ9C 4ZQHA 4RVSA 1K2WA 3DFUA 1HYGA 2BRUA 2EKPA 4CV3A 4ZICA 4XB2A 1YOVA 2BH9A 4WNIA 1BTOA 3WNVA 4B3JA 1OOEA 3HB4X 1YL5A 4XYLA 5CDTA 2NM0A 3OETA 5IAAA 2OP1A 4S1VA 3JQ9A 1PZFA 4CMIB 2G5CA 1P33A 1Y9AA 1SB8A 4DIFA 4IQ0A 1PJSA 2P4QA 3DTTA 4R51A 4P4GA 4E0BA 1ADGA 2ZJ1A 1YWGO 3ICPA 1IULA 2GN9A 4FPXA 4OXNA 2UUOA 2OBYA 3HDJA 2AQKA 2Q1SA 2GZ3A 3AY6A 3RFXA 4R1NA 1AHIA 1YJ8A 5TIIA 2E82A 1ZK4A 3I6IA 4Y6RA 3H3JA 3PPIA 1UXGA 1ZIDA 1W0CA 2W2LD 3ITDA 3PZBA 3C24A 4XZ3A 1WWKA 2DM6A 3FNGA 3KB6A 3LC7O 2WD8A 4I5GA 2D59A 4OAQA 5JE8A 3TL3A 1L7EA 1OMOA 1E1NA 1Z6ZA 3ZH2A 4DMMA 2EGGA 3QJ5A 2Q99A 1YDWA 3JQBC 3W6UA 3LC2O 1OC2A 1WVGA 2I6TA 3KSZO 3MEQA 3GZ4A 2VT3A 1A27A 1HDRA 1MXFA 1N9GA 3LK7A 4OKNA 3JQAD 1Y5RA 5CAEA 2PKQO 1MB4A 3GG9A 4UUOA 3GDFA 3RUEA 1ZUD1 3GNTA 1LX6A 2PWZA 3JQBA 3JYNA 1M6HA 1NFQA 1YS4A 3L6OO 5EESA 4ZRMA 4LVCA 4UVEA 4KDFA 1MG5A 4XGKA 3WBFA 1XGKA 2ZYDA 1CETA 4G65A 1EVZA 1B8VA 3E9NA 4BNUA 4RVUA 2JFFA 1ZH8A 3EVNA 4XYGA 1EMDA 1V3VA 2ZQYA 5FI5A 2P68A 5KIAA 2VZ9A 1EVIA 1KY5A 4WLNA 4E33A 4WEOA 5L51A 5DDIP 4RZIA 4PLPA 1UP7A 1M66A 4CUJA 1B8PA 1QLHA 1HZJA 1M75A 3GUYA 4YEDA 2DQ4A 5IF3A 2OMEA 4BO4A
chains in the Genus database with same CATH superfamily
4OJQA 2VK1A 2OQ2A 2XB2A 1B4DA 2A4MA 2VA8A 4BUCA 4CMHA 1CVLA 1LS6A 2AFHB 2FPXA 5CW2A 1V1RB 5D85A 3R7FA 5KNDH 3NX4A 3NXKA 3AW9A 3UV3A 3VKUA 3WIDA 3AQIA 3OIFA 3OIWA 1QIIA 3OZBA 5DP2A 3U31A 2JRLA 5EZYB 3HKBA 1FVHA 2AC2A 4HWTA 1ORTA 1BKDR 2YYYA 3LW8A 3SQMA 1O0BA 1ATIA 3DFZA 1Q5PA 4IICA 2J09A 2JW5A 2C88A 3GJXC 1OXXK 2B4KA 2YIJA 1K6MA 1ZG3A 3IIMA 3MS4A 2FWNA 2P9YA 2VF5X 3DHYA 2F3RA 3QIVA 4RDHA 1SU8A 2NZVG 1GTJ1 2ZW9A 4P92A 3RV3A 3ZLJA 4TWBA 3OJEA 4GT1A 3UKJA 2J3KA 4A27A 4ENRA 3TKLA 5JAHA 1QX3A 3DKKA 1USUA 3S55A 3L01A 3NYIA 2ZIGA 3RARA 5CT9A 4D92A 3LDUA 1M5RA 1DL5A 1MDBA 1ORIA 3MTDA 3UJAA 3E27A 4S1PA 1ABBA 1SHZA 1THZA 4EF4A 1KARA 3R44A 3CLUD 4JKOA 5DLDA 4OP1A 2D1FA 2DUMA 4WASA 3ZWDA 2DWUA 4JBNA 1UZAA 4PTYA 1Y4SA 4RJJA 3K5IA 4W9MC 2UUAB 1A8SA 1AA9A 3AH8A 4XA8A 1G1AA 2AF3C 2GJSA 2R47A 1G8SA 3O4JA 4B4UA 2OQVA 1AMUA 4W4TA 1SGWA 3OX1A 1HSZA 1K8ZB 2PKWA 2R8XA 4TSFD 3QBTA 4TPKA 4B32A 5KHOC 4ZVVA 3WL4A 4G1FA 3GZNA 3KKNA 3VNUA 2YASA 2DBYA 3UXMA 4DGQA 4DHWA 1SUWA 1XNGA 1E0SA 3R5JA 3F78A 4RZHA 5TT0A 1CDDA 1P5FA 2HIGA 1DEOA 1VGVA 2ROQA 3JQDA 3C4VA 3UFXA 1QVZA 3NAZA 1RRVA 1GKKA 4H15A 3S70A 1KYIA 2FR8A 4Z4FA 4G89A 1KJ8A 2O2ZA 3AP1A 2C3MA 5TV2A 4MV9A 1HA3A 2IDKA 3DAFA 2A0XA 4E14A 3ZGVA 2F1RA 4OXIA 3KQWA 3LBIA 3PC7A 5JXGA 4AY2A 1JV2B 2VPXA 5B1DA 3H5IA 4LJRA 2O7VA 3VO8A 2YN0A 3VU9A 1NP3A 2A9KA 1FYVA 2OBXA 4JBHA 4AJIA 5HQTA 4FIDA 2HXYA 1KQGA 3N2KA 1A9PA 4JLVA 5I7EA 3KPWA 3THSA 3C6XA 1OIVA 1UJMA 2FR0A 3STXA 2F43A 3SCZA 3LPMA 5DW0A 1J0AA 2HH9A 3BMXA 4FWIB 4WESA 5EHGA 3C5VA 2WU8A 4MW2A 3A0RB 2GXAA 1K7SN 5DTJA 1RMQA 3B3FA 3WLKX 5FYDA 4KREA 2LVBA 2QROA 2BIFA 2WMOB 5IM5A 4M1EA 2ZIZA 4QFMA 1UL1X 1UPXA 1XTRA 2FPPB 3PC4A 2Z8XA 3MW8A 4YUVA 2VUIB 4M0KA 3TSAA 4HPXB 1BMFD 5AIBA 2WVGA 4OXXA 2BSQA 4W5TA 5HOQA 3A04A 2IJGX 4EIWA 2DFVA 1WW8A 2GBLC 4OQZA 3QU2A 2P11A 1S3GA 1XTQA 3CX4A 2OHJA 3X1DA 1P1JA 2MYUA 3A6LA 1D09A 3VR3A 3C3KA 1E5LA 1CY1A 1G9TA 2PH1A 3V8NA 3WC4A 3LYUA 1I5RA 1NPTO 2ORVA 4YDSA 3B1WA 1Z82A 3EZXA 4BGDA 1DC7A 3DQQA 2X5KO 1YR7A 4RU1A 1XR3A 3TRIA 1Y6QA 4H9GA 4MR8B 5FD8A 2ASVA 3MGCA 3SE7A 4CLDA 3N0RA 3PT9A 3HYTA 1D7AA 1XA0A 1G8PA 4TT8A 4Z54A 3RSHA 4OQNA 3PEVA 1XPRA 1FTGA 3LGSA 4ZT5A 3H65A 3GRRA 3WLOA 5E4FA 2AYYA 5BXQC 1GV0A 4O5OA 5HG0A 3RVQA 1V9CA 3U1TA 3L07A 5CAEB 3KFVA 5LWQA 1X1BA 3G59A 4OO3A 5BN3A 3N87A 1H8ED 4CTJA 4AQDA 5A5DA 2Q5HA 4O2AB 1IUKA 2ZIAA 3PDWA 2NPOA 421PA 2HQ1A 4KR3A 3EFHA 2R87A 1ZOOA 3GXOA 4PYRA 3T41A 1KZGB 2H4YA 4Q4JA 1W87A 5K3CA 3AERA 1DHTA 4CGYA 4JJZA 1U94A 2WIJA 3E7XA 4RPCA 3U1VA 1M1NA 1MR3F 2HLDD 4K9PA 4QIHA 1V95A 3GEGA 3EIFA 5FNZA 4YP9A 2E55A 4C0XA 1TA9A 2XD4A 4E94A 2W83A 4ZZIA 2XXAB 3KLBA 4NH4A 2Z2XA 3SZGA 2J0UA 1Z5VA 4S3MA 1RTTA 1EM6A 1U4OA 1WQ4A 3KQQA 5LA6B 4KFCA 1NA5A 2V7PA 4UPDA 3C1TA 4QBFA 2PWPA 3I01A 3NWBA 4LRYA 3ISJA 3JPWA 2WJ3A 3C98A 4A5SA 1Y34E 3MT7A 4IRMA 5DO9A 5AW8A 3O83A 2AEEA 4GMDA 4GAEA 2F67A 3GJZA 3KZXA 1P4GA 4JLJA 3HO1A 1YHNA 3VZDA 2ZB3A 5FV7A 2LE0A 4L5YA 1L7DA 2PM8A 1WD7A 3IDSA 3O47A 3SQXA 3OHMA 4D5GA 4FI3F 2NO9A 4Q15A 2B2XA 1PR4A 1S2GA 2ZB4A 3WIOA 1Q91A 2PXCA 2JCBA 2ZXEA 3H1PA 4IIHA 4BNIA 2ZAMA 1WSWA 4FZ3A 4DC1A 2FU5C 1GTG1 2YQ4A 4FN5A 1Y8QB 3CKKA 1GCIA 5LOVB 4O4JA 3Q85A 4R1OA 2G06A 4U8HA 1GA1A 1IHXA 2DFPA 2GQ0A 4X6XA 1V5EA 3RK0A 3G49A 2VJPA 3GLFB 3GLUA 1NUAA 4OHXA 4X3PA 4ALKA 1V3UA 1ZGHA 1KYYA 2QP4A 4OUDB 3WSVA 1E77A 1QVWA 5E1OA 4JJKA 1PLKA 1XLUA 3GBVA 3TLMA 1GCUA 1BU8A 3B6JA 1AQYA 2MINB 4Y2XA 5DBHX 1PFKA 1VE3A 2MDTA 3RVLA 4DLBA 4Q1FA 3E7PA 5CYOA 1N78A 4WI1A 2VK8A 5G4LA 3W9UA 2Y27A 5JOQA 4DKJA 1RZUA 4NJMA 1I10A 3Q7QA 3TLGB 4A0FA 2IHYA 2PXAA 2Y1WA 3DZFA 1XK7A 4PZDA 4GSKA 3TIVA 4MW4A 3M6LA 3V3KA 3ZE0B 2FHSA 4UC0A 2NT4A 1MGOA 4GICA 3H9BA 3ELYA 1X9IA 3W8EA 4ZYUA 1PN3A 2PFKA 5K5EA 2D8MA 3L8EA 5T4FA 3O8QA 3O75A 4QYTA 4AQYB 2H52A 2QT9A 1QUFA 5AHWA 3Q8MA 4Y2RA 5A4DA 4LGYA 5CUQA 3WR5A 4MZDA 3BIWA 3KVRA 2XUQA 4IDEA 5C80A 3BCSA 1ZJZA 1XDZA 3QQPA 2IZZA 4TYWA 5HKKD 1ISGA 1U8YA 1J23A 3MLBA 3LW7A 2BGUA 4B35A 1X7WA 2PKRA 1ZCFA 3GGDA 4GNRA 4JSTA 3HVHA 4MUAA 4FUTA 4QRIA 3FYUA 2J4CA 1NATA 4TX1A 3ZE7A 5AVQA 3GLIB 3M5DA 1XWFA 1FC0A 3ZZMA 1F2TA 1TJYA 2VDOB 3K1YA 2ZXUA 1REQB 3IOEA 2ZRFA 4BGIA 3AM4A 2XDQA 3LECA 4UKDA 2NUBA 3K8OE 5A7FA 5K6TA 2I6SA 3AU9A 3A2KA 3SK0A 3HJCA 3ZGLA 1DELA 5LVAA 5JYBA 3LLSA 2JIMA 3DBRB 4DRYA 4ZMRA 1PJ8A 4MVYA 1XCBA 1SMKA 5AI8A 4FR0A 3N5KA 2OWDA 2COUA 3MJHA 2N0SA 3W6ZA 3ENNA 2CWDA 4G9GA 1G21A 5KYWA 4BS9A 1W52X 3CVOA 4YXWA 1TLTA 4YMGA 2G04A 4S1NA 2W2KB 1PQWA 4R8MA 2OBFA 3IULA 1SFRA 1QF7A 2AMYA 4XGQA 4B7UA 4Q3NA 1N7HA 5HCIA 1TC1A 1G5PA 4TMKA 4IHJA 5DTQA 5AVZA 4QUKA 3K70C 4R16A 4BBZA 3I9OA 4OX9Y 4JP5A 4FB5A 5KVVA 1K88A 3V80A 4B74A 1QAMA 2JJMA 4GYJA 4L2IA 1PFYA 1H2XA 1FNBA 4DS3A 4JI8B 3UM9A 1XL0A 2Y1XA 1OGJA 2DBRA 1KBQA 1FRVA 4JT8A 1TDJA 1Y5NA 4IJ6A 1MUUA 4WAUA 4EVRA 3Q3VA 4BASA 1GG9A 2ZSFA 3OX2A 4I14A 4LF5B 2Y0PA 3AUXA 4BLQA 1Q1GA 3EZ6A 3H2SA 1H0KA 3U9LA 4CQLB 1P0FA 2BBOA 2KBEA 4DAEA 1JT9A 4U0JA 4BVEA 2PGIA 5TGZA 4TZ0A 1F3OA 3VKVA 3A28A 4GGPA 5KVAA 3GD5A 1J7JA 2M2IA 4ZWNA 3X0DA 4WNYA 4DTCA 3Q3HA 5JDIC 2QTRA 2VKTA 4HB2A 2FY8A 3HZHA 3B1KA 4ECEA 2VRCA 2XJ4A 3ILYA 1DAMA 4X54A 5C1IA 1BVUA 4TRMA 4RTMA 2NXNA 4DCOA 2H1CA 3O93A 3NNNA 4C7KA 1DRWA 2JCGA 2CF6A 3H17A 4XSVA 3SJZA 5KOIA 1E3QA 2IY7A 3ND5A 1I1QB 2CYBA 2GD6A 2VCHA 2FPGA 3GUZA 3I9FA 3UGTA 3UGKA 4FHFA 3TXYA 5L4SA 2IYRA 1H85A 4NJOA 4NMMA 3J81A 1G2IA 1OPXA 3KVYA 4TTRA 2DPXA 2JGFA 4BZXA 5IMSA 1UJBA 2QMZA 2X15A 3WIVA 4YLGA 4IXTA 1Y8CA 2PVPA 1OAKA 1NE7A 1RYMA 4IO0A 5IHPA 1POXA 2RAVA 4TQAA 4JI4B 1H0HA 3QVGA 4MHOA 4B0PA 3BWYA 1AQLA 1Q16A 5TDHA 2AJTA 1H22A 1UT6A 1ZC4A 1ZD5A 2F2TA 4ETIA 5LP6C 3H9UA 5BYBA 1LV8A 5HOEA 4MEJA 4RA6B 2DAPA 1WUIS 4M49A 1MQ8B 2ACEA 2GZAA 4QEKA 1C14A 3BWVA 1Q50A 4Q19A 4JR0A 4N9QA 4MVJM 4PS0A 3MFYA 4FE7A 2DH5A 2VT7A 1ZICA 1JFRA 2GVZC 3ONEA 3C7DB 5EPUA 5C7IO 3LUPA 3IBYA 2YVAA 2DWCA 4TV9A 1JR3D 3KHUA 1W94A 5GM1A 4RLFA 2F7SA 3ODGA 3DMFA 2Z4TA 1RPAA 3X1ZA 1OXBB 4DLYA 4OGWA 1CUBA 3OF3A 1WXFA 4O4HB 5K8LA 1ZJYA 1A9OA 1X38A 1ZLXA 2EX0A 2IOQA 4K05A 1RJDA 1UWLA 4LHWA 4ME6A 4D56A 2WWFA 2A92A 4LZLA 4X71A 5SYAA 3L49A 4L5CA 3RYHB 1JQKA 4C6TA 4JNCA 2BUAA 3DB2A 2IBTA 3RQSA 1BGXT 4F8JA 1UXIA 4Z4HA 3B12A 1QFXA 3V2UA 1O94D 4UOZA 4UHBA 2HO4A 3FIUA 2DERA 1B26A 4FW8A 4QYSA 3G13A 1VE7A 4URVR 3L6BA 1AUQA 1X1EA 3LT4A 4MP6A 2RGGA 2J41A 2JDID 5EYPA 3WMFA 4Z5XA 1B3RA 2FGJA 1QK3A 1YDFA 1V39A 2QTVB 3VJMA 4YUZA 3ABIA 1BHQ1 4QHTA 2JG3A 4A6XA 3WDMA 3GRUA 1K08A 3HO8A 3FUTA 2AZDA 2QYHA 4CKCA 3T1NA 4MS4B 5C1BA 4MQUA 4UPEA 4WXHA 4TSKA 2FFRA 2GPJA 4RX1A 2DVMA 3UOGA 2B61A 5L3VA 3A2LA 4Z1MA 1FFHA 3DLAA 2V54A 4LCJA 3THYB 1JF8A 3AVUA 3S4YA 2ZZMA 1XZJA 1NGSA 2VBGA 1P5ZB 4BGVA 1BOFA 3TG8A 4HEA6 1JILA 1PR1A 2P1ZA 3H84A 3KKOA 2QD3A 3KZMA 1IAVA 4E5MA 3E0QA 4GH5A 2WF5A 3CVYA 1E2BA 3DCYA 4WECA 1BS2A 3ZDBA 5FAKA 2WBLC 3QITA 1T5OA 5EMKA 4UUPA 4LOKA 1EFPB 4JROA 1GPMA 4YCNA 2NSLA 4JWTA 1T26A 2B1JA 4TQ9A 3OJ0A 4KQHA 3C1UA 2QN2A 1S2LA 1CLEA 5J5VA 1YRWA 1CP2A 3QJGA 1NC1A 2PVSA 5LBIA 4CI9A 3K0SA 2QN3A 2K7ZA 2TECE 1G16A 1FA9A 4XJSA 4CR6A 4MVCA 4K6HA 4II3A 3OKCA 3F9RA 3GLGA 3R9KA 4L8WB 3G0DA 3GB9A 4IIXA 3QFHA 1G6HA 2FHPA 1Z9BA 1GRVA 3KUCA 1BOOA 4B48A 3ZZ1A 2HF2A 5KC8A 2DEUA 3DD1A 3GVPA 5FWYB 5FPHA 3ZW7A 3FMFA 3PUXA 2W6OA 3B70A 4CLHA 3MYRA 3WLJA 4WHMA 5B55A 4CETA 2ESRA 4LECA 4FYIA 5EQFA 4EJSB 2VQ3A 3D31A 1RZRD 4UM9B 1TPYA 1LNQA 4H7EA 3BOSA 4ZZ0A 4YRMA 2BFWA 4A73A 5AUOB 1U0OC 3LCMA 4FS8A 3H9CA 1QH1A 4KWEA 4OP2A 3VR6A 1ESDA 4TUYB 4ZAWA 3WLLA 5KQPA 2YWDA 2V8OA 1QIHA 1Y7IA 4QOHA 2A78A 1GLNA 4PSDA 3CEPB 3EAGA 1Y3IA 3O3MB 2CUZA 4BX0A 4X7MA 1A2OA 4QBHA 5SZHB 4AY5A 1K6XA 3PI7A 4YT8A 4I1UA 3W78A 4UVHA 5ICSA 4LQDA 4FFSA 3RAFC 4QRHA 5JARA 1R4MB 1L5VA 1NWHA 1UMCA 1XK6A 2O1WA 1E9DA 3M6AA 5TPZA 1HNXB 1UDAA 3MTJA 5KX5F 3F4LA 4C3ZA 1D04A 1R74A 1VJCA 1CIPA 4K7JA 1SRQA 1M2VB 5A1JA 1AGXA 2PCLA 4BN5A 1QU3A 3H1TA 2VZ0A 3MJVA 2CV0A 2JGLA 1GSIA 5DM1A 3MUEA 4ZCQA 4R8SA 4P4UA 1J8FA 3CZAA 3QY9A 1GA6A 3LU1A 1CUZA 2BM1A 3D4LA 4M2LA 1WD5A 3HKBB 4EFMA 1LB1B 1ABEA 3EFOA 2WW8A 3A3KA 2ETVA 2ZPTX 5EXXA 1VHWA 1O77A 4MV5A 4EKYA 3W05A 2ZPAA 1V9LA 2OZLA 5JAPA 2MSNA 1R3UA 2VQ6A 3I37X 4FD2A 4M1WA 4PR3A 4GOLD 2ZJFA 4FDLA 4YI3A 4G1VA 3GBPA 4KFTA 4DMCA 2PR7A 3MPUA 4UMVA 1UIRA 2E6UX 3LQ1A 3Q5GA 2GNOA 4N12A 3RREA 2C2GA 3HV2A 4NENA 1JVBA 4CKXA 3O8BA 4EGAA 1MZVA 4ZAFA 1AKQA 1V4VA 4FFNA 3IPXA 5E9QA 2PS1A 2PMBA 1WUYA 5AVVA 1E2PA 4L5JA 4E4RA 2YN4A 3O4VA 4U2GA 4D8WA 4R54A 2CNNA 3CLRC 4OHUA 1W8DA 4WN9B 2XHEA 3AEQA 3FVTA 3IVRA 3P2MA 2R8RA 4OHCA 4RUKA 2CXRA 1ZPDA 2JIDA 1GRRA 4PQGA 4YRNA 2GN4A 4OGGA 1D8AA 2I2BA 3FKSD 3OBBA 3ZC3A 5JZOA 5DM70 5FKJA 1JW9B 1LGYA 2XF2A 4I50B 4RTOA 3GZNB 2H16A 1K5DA 4E1AA 1VZ3A 1GUBA 2IHTA 3CIFA 1GPH1 3KU1A 3NCTA 3QPBA 1J25A 1X1TA 3TW8A 3UFXB 2PRJA 3OD5A 3RW9A 4J9UE 3KUDA 4JGBA 4X92A 5B2EA 1Z75A 1JKMA 1GZDA 1WUJS 3G0BA 1PU2A 1EWRA 2R65A 4LUCA 5K0TA 2HSGA 1PK8A 4HC4A 3MK31 5EJ4A 2GAFA 2VJOA 1H3NA 2O05A 3I0NA 4Y7DA 5E6RA 5L40A 3VU9B 5AVKA 1CR2A 1EDZA 1LC3A 5DF1A 2QI9C 1NVWQ 2IKSA 2AG5A 2QA5A 4HWGA 3N2KB 3N8IA 2MT9A 4QGBA 2CZQA 4RQAA 2JK1A 2GD1O 3RYFB 1N2XA 2PUBA 2F43B 1X3SA 4MS3A 1O0CA 1I0ZA 1AN9A 3OTQA 2PS0A 4B7CA 4EJ0A 2RHDA 4RKWA 2JFQA 4QHYA 4Y6QA 3MN1A 4AF8A 3A06A 4ZVQA 3C8MA 1WQ3A 4OX9B 4YA6A 1AV6A 2PR2A 4LWQA 4KE9A 1G41A 4R8VA 5K0FA 2OD7A 1VPLA 5D7BA 3ABZA 1R88A 4YACA 5CPBA 2QTGA 4Q1AA 3V1YA 1ZOLA 4YAUA 2EZ9A 2GM5A 1WXXA 4BBPA 1E5TA 3O1LA 2O8BA 1LLQA 1U9CA 2AXNA 2C2YA 3K9GA 4BNJA 4ED9A 1W36B 3D1VA 1M6YA 2IV7A 3RS9A 3TIXB 3V1MA 1Q1ZA 1PGOA 4HNGA 4NCNA 1K63A 4COOA 2JLCA 1A4UA 2K2QB 4HEA1 2VK2A 3FZNA 5AVYA 2YVQA 1VJ5A 2J67A 3DJYA 1WULS 3PUHA 3TQHA 1ZRNA 4CEIA 1CULC 1K75A 2ZT6A 2AHOA 3I52A 4JLWA 4B3CA 2CD9A 2Q6OA 4S1OA 3NBZC 2C4VA 2ZR9A 4NU8X 1IXSB 2NOAA 4F4FA 1M0WA 1UPFA 2L82A 4TXMA 2WPNA 3TUZC 2XT6A 3V9AA 5KQMA 1QDEA 3O84A 3FPCA 3KQHA 4BXOA 4UHKA 3MWKA 3WGNA 1AE1A 4F04A 2GF9A 1JZTA 3ZWWA 2OE2A 2WZQA 2BTQA 2YWFA 3E7WA 3ET5A 1E66A 3GFBA 1A8UA 1HL7A 4ZVSA 3SF8B 4RETA 1CNFA 1YDEA 3A1FA 2CNBA 2HMWA 2Z56A 5TGTA 1OLXB 1WDLA 3O3NB 3PUKA 2H1WA 3SHWA 3TZ6A 4DV4B 5GONF 3EEBA 4WXEA 1P2UA 5T8KC 2WM2A 2OO5A 3GT0A 4A9AA 2ZRJA 5F2OA 4N4AA 4Q4JB 5HYVA 3AERB 1TAQA 1OXTA 2EFEB 2EYQA 1SXJE 2WLTA 1RM0A 1YULA 2BC9A 2A0UA 1LU9A 1G18A 3VBCA 1IWOA 3HCOA 5ENDA 3T1VA 1L5QA 2R79A 1NXXA 4JC8A 1Y89A 2J0UB 2WKPA 4YUWA 1QYDA 3FPJA 3HXKA 4CU2A 3X2EA 5CLQA 4BV3A 1YRHA 3ZY6A 4KX3A 4LV6A 1PX0A 3QTTA 1T6YA 4G1MB 2O2GA 5A5FA 1OJ7A 5KBYA 5M34A 1FDOA 1ULSA 2YUTA 1G8HA 2DY0A 1PZGA 1W96A 2ZVQX 1WE2A 1GKUB 4KIWA 3ZY4A 2WJPA 4FMDF 4JJFA 4C0JA 4DM4A 4ZI2A 5KSOA 4LYHA 1G64A 3BHJA 4CCAA 1R0BA 3O82A 2ORYA 5KTTA 1MENA 1TF7A 2FSGA 3E3OA 2WJ4A 3KQLA 4UOQA 3EARA 4JI6B 5KPJA 1WVMA 2H17A 3EF3A 3AEZA 4MX8A 1SZDA 2JAOA 2PKEA 5DBFA 3VR0A 4RVNA 2JJ8A 3W5UA 1X6VA 2VPTA 2P3LA 2VZ8A 3TW6A 3WYDA 4ALIA 2BMVA 1JPJA 3IT3A 3AF0A 5U4QA 1O0SA 3IAS6 2P8JA 1YRLA 3E82A 3KZ1E 3ROZA 3KAPA 3R0JA 5F64A 1JLKA 3F7OA 4ARVA 3R76A 1V9SA 2FQ1A 2BEVA 1D2HA 3BGVA 3VJRA 5JV5A 2P7HA 4WKOA 1X9GA 2B1GA 1HE1C 5KMGB 1YRAA 4NJMB 1CUWA 2A3RA 3BIFA 4HDOB 5HHTA 4U6SA 5B7PA 1SC6A 4G6ZA 3Q6MA 3VNAA 1GSOA 1I4TD 1JWLA 2HU8A 5G0WA 2HPHA 2C54A 4C1NA 1XKTA 2YWCA 1UOPA 5E95A 1VG1A 5EFZA 3WGHA 1Q21A 5CNKA 2B3TA 3IV9A 1Z17A 4R84A 1EB8A 1FSZA 4EHAA 3IKJA 4PYNA 3O8QB 3T0GA 3KFLA 2GBGA 4UU8A 1ECGA 4FOLA 4QDUA 4PCAA 5EMNA 5I7WA 1NR7A 4NV1A 5L45A 3WISA 3LTEA 4E32A 4Q9JA 3VI4B 1XZMA 3DVRX 4H6WA 1D2AA 1X1SA 2V3CC 1DOHA 3SHFA 1X7WB 5DOZA 4OOFA 3UF0A 5T7BA 4F93B 3JD4A 3FYUB 3TAUA 2ZYIA 1F2TB 3H4VA 4H0CA 4XM0A 4N0QA 3W0LB 4CM3A 3SZUA 2ZT8A 4R1LA 3ROEA 2DU8A 1OTYA 5ERYA 4F4IA 5JH7F 3H2HA 2Y1KA 2XDQB 3F47A 3INNA 4M9UA 3VVCA 4BIMA 1NJSA 1SR8A 2ZANA 5JSUA 3AR7A 3ANTA 3MWGA 5KYNA 2PRSA 1JDJA 2PGLA 3MCAA 3T52A 1XZNA 1V2GA 2Q3MA 5DHQA 3VKGA 2C8JA 1G6OA 4O8CA 3A1EA 1YONA 1JG4A 1YK0A 2BOVA 3ICWA 4P5DA 3NP9A 1G21B 4HCJA 1K4MA 3ZLUA 5KYWB 4RE6A 3TX6A 3KL2A 1MQAA 2Z5VA 1IY8A 2HNKA 3SJAA 4CM5A 2JLBA 1IBRA 2WTXA 4Q9AA 4F71A 4R2WA 1JE1A 3H9QA 2OAGA 4IHJB 1XU4A 3H0KA 3EMKA 3LUHA 4AZVA 1CRZA 3NHMA 4CHTA 1OYOA 2POCA 4E1VA 3R6TA 1NN5A 4L2IB 3TXAA 3ZCVA 4EP1A 1EZ4A 2P0YA 2XNDD 3FMOB 4H7KA 5HUQA 2WTUA 5IPFA 1O9BA 5KWEA 4RH3A 2A14A 1U9ZA 3V2HA 2I78A 4I5EA 5FPPA 2XH8A 4I36A 1GN8A 3D4OA 2J5KA 2LNDA 4NS1A 4HLNA 5ECDA 2C1EA 4ZZ1A 5DSTA 5C8YF 1YVDA 4EW2A 2I1WA 1BCRA 4GM4A 4PG7A 3A11A 5E4TA 5CCEA 1GNRA 2CXPA 2DWQA 4P98A 3ZJVA 4FM9A 1XRNA 3A3PA 3WGYA 1G0NA 5AYVA 3HI6A 4GM1A 4O3FA 4L78A 5EFOA 3AETA 4A1OA 5CDUA 4TMZA 4QA9A 3K73O 2V6MA 3NWOA 1GTMA 1AM4D 3G0IA 3C5HA 3V8EA 4RK6A 2IVZA 3K32A 3DDNA 1NU8A 4QXRA 4ARIA 2H4WA 1MABB 1Y9DA 5B58T 4HSGA 5CVVA 3U3ZA 3A6HA 5U9CA 4GI2A 1VIAA 2ONYA 1ZK2A 1V11B 3I9V1 1HT0A 1T8WA 2AJBA 3TIGA 2V1UA 2A94A 5ICGA 1Q3HA 3VYSB 3BREA 4EB0A 1U0SY 2R84A 1YL7A 3TQCA 2Z5LA 3M1IA 2WT4A 4ZQGA 2BFFA 5C37A 1QO0A 4QUJA 2YY7A 3CCCA 5H7XA 2JFPA 1TRKA 4B3IA 1X7HA 5HRAA 2EERA 2QX6A 3DXYA 5LXTF 5K8IA 2B4AA 1VSVA 2Q2QA 2PTHA 1A96A 1R8XA 5CPFA 3VUEA 3ZY3A 1E2IA 1XRPA 4M3NA 3M70A 3PUWA 1JAYA 2ON6A 4JV5B 3RFFA 3V4OA 3OE7A 1KDVA 1EBUA 5B6JA 4BB9A 2OD9A 3IP8A 3GYBA 4NG4A 3SS9X 3HCDA 3A9CA 4KR6A 4NULA 4EO7A 4NEHB 2PKXA 2RG7A 3LCVB 3D0OA 4K88A 4CR7A 2BE9A 4EY7A 4ZHQB 1XVTA 5L8VA 1VCMA 1MFZA 3OX4A 1OWOA 1WZ2A 3HXLA 3PD7A 3P2EA 4O2LA 3QNUA 1W0JA 1K8RA 4D99A 1SKYB 1VSUA 1Y82A 4WLEA 3ZHOA 2JKZA 4XM1A 3U37A 2GM4A 4PZZA 1LV7A 1RKQA 1V35A 3NBUA 4BTLA 4E13A 2P77A 3JWPA 1B41A 3UXEA 4GC9A 3CZQA 5FEUA 1QG2A 4C6TB 4JQCA 2WB2A 9MHTA 1R15A 4INPA 2C9YA 4O1HA 3TLCA 4BUJA 2IOHA 3LNCA 3FUCA 2QRGA 1JFLA 2GYWA 4RK7A 1GKYA 1N1MA 2EP7A 3I72A 4PLGA 1JHXA 5JSKA 1P9WA 2B8TA 2JJ2A 3CR8A 3UMVA 3KBOA 1JEDA 3LUAA 1MAVA 2V1XA 1VMAA 5EYPB 2E4ZA 4OJKA 1GG5A 3PNVA 4FUQA 3MWLA 3T54A 3ZNQA 1YBAA 3RJ9A 1FIUA 3OT4A 3HCPA 5I3ZA 2VP3A 2GWRA 1CHDA 2VF4X 2J9RA 2WSIA 3D4PA 4CKCB 4HV4A 1YDMA 3FPFA 1VHQA 2YVLA 3A9RA 3CB2A 3LYHA 2IPLA 3PEWA 5ED0A 3KELA 4OVKA 5CR9A 1JR6A 4JVSB 5C7OO 2WHQA 1F2VA 1RQGA 4QXAA 1FOEB 1AGRA 3RFVA 4XVCA 4GI1A 4U7TB 5ED4A 1CY0A 4MV8A 1R6BX 2H18A 3A6GA 3EIWA 3L41A 1Y1SA 4H7FA 1E1KA 5CFZA 2BFCB 3KETA 3TOVA 3U4CA 4EPWA 8ATCA 4RYLA 3A8TA 5JC1A 1PKEA 3DBVO 4US0R 2DFDA 5GJVC 4IX9A 3SICE 2Z43A 5I8WA 1W9MA 2ALJA 1Q83A 3OFJA 4PO1A 3OLZA 4JOBA 5JD6A 3GJ4A 1TK3A 5B30A 2J6IA 4KXQA 2B4QA 2YZ2A 2OUKA 3OPVA 3RSQA 2VDJA 1PGQA 2IHUA 3IUQA 4F3RA 1A4RA 5KDDA 2X86A 4MV0A 5EKTA 1VG9B 2EL7A 4TLBA 1FW8A 1V7ZA 2Q9BA 2ILTA 1ZWKA 3HFJA 3RE1A 3SU8A 4EY8A 1XMQB 4LQCA 4B2YA 2M1ZA 3A4MA 4OQDA 4QE3A 4KH0A 3O1HB 1A3CA 3HZOA 2I2FA 2XXBA 4RQTA 5BQPA 2RKWA 1QBGA 1J1ZA 3OZRA 4F9FA 3NMUF 2VHXA 4UHEA 2J3MA 5DX0A 4ZV4A 2VJMA 3L2OB 2VXYA 3PHCA 3ICVA 1KMMA 1U0BB 1SZPA 3E9QA 4O2RA 2ZP1A 4JX8A 4RHEA 2LCIA 1IZZA 3NPMA 2XMCA 5A2GA 4XVUA 2C00A 5AKYA 2VJCA 3GC6A 3GG2A 4WXPA 4DLVA 1HE3A 5JC8A 3LVQE 1FTYA 1S7GA 2WWWA 1QOPB 2VEDA 3DT6A 3CNNA 3QVXA 1NVTA 1UOEA 3LL4A 4JCOA 3ECSA 4NCXA 4DCMA 1ZU5A 3CUSA 1UMCB 3DCJA 2OL4A 3E0XA 3GQBA 1ACLA 2GXSA 2FQQA 4WLVA 1H8HD 1P19A 1RXSA 2R3SA 1E7QA 2HF7A 3FPBA 5FBKA 5JVDA 4JWKA 3V4FA 3OJCA 4ZAVA 1ZO8A 3F74A 4M60A 3VYVA 4JEIA 1T2EA 4NAUA 4Z99A 4B71A 4F6LA 1JLHA 2YJTD 4RSMA 1SUSA 3F2VA 3NUGA 4RMHA 5CXXA 4J0FA 3T94A 2CVOA 4W7SA 2O20A 5C8XA 5B5SA 3EFOB 5EIXA 4U2EA 4I4TA 3DR5A 5CA0F 1QCZA 1I4OA 1RVDA 3NT2A 4K8RB 1BE6A 1OPRA 2OHIA 2BI7A 2HMYB 1YR1A 2GZ2A 1UKCA 1ONPA 3ADCA 1PUXA 4HT3B 3WJ1A 4ND7A 4D46A 3PPWA 2IF0A 3ANSA 3MGGA 2IX9A 1TMOA 3DMNA 1ZA2A 3QWIA 4YXWD 1XXHE 2FH5B 1ZVVA 2XADA 2HK9A 3CTMA 3KDSE 4IR7A 3VISA 4Y2HA 1JH8A 1SAYA 2B1IA 2FVYA 3KEGA 4HKTA 3PC8A 1Y3BE 4OSPA 1LQUA 2FG5A 4GBGA 5I9LA 2Z0MA 4DMRA 5E7QA 4DM3A 1DTSA 4EYKA 3ZBPA 2V7BA 1XHFA 3BL6A 1X0VA 4AZWA 3WV5A 3FFXA 4FGLA 1JR4A 3R5TA 1H2YA 4EUHA 1IJKA 3ISTA 3KZKA 1UJ5A 4F6CA 3OA2A 5TS3A 2PD6A 3W2GA 3ZXSA 4AF6A 3VPCA 1KMHA 1P5JA 4XAQA 2A35A 3LWBA 3N7UA 3TW8B 3P0JA 3HB9A 4C9BA 1YQTA 3FW1A 5JNUA 2R6R1 2WU4A 3MTEA 1JDUA 3VO2A 4UTPA 3C41J 1FDVA 1NP6A 4RF4A 2DUNA 2O8DA 2VRCD 3IAXA 3W8DA 1TIPA 5A4KA 1CS0A 1LH0A 4FTWA 4M86A 2J3HA 2P2YA 2V7GA 3Q8XB 1FVFA 3CKYA 5E6RB 3TTYA 2GN0A 3JARB 5TARA 4HAUA 3QLEA 4HLUA 3ZQ6A 5EIWA 3U7FB 1NF8A 4LXXA 5BW5A 4U6QA 1PR2A 1IN1A 3T9DA 5HTOA 3QNMA 3CSDA 4KVGA 1A9ZA 4OG2A 3LUGA 1E5QA 1NY5A 4EB6A 3CLKA 5K6AA 4MS3B 3F6EX 3IAM6 2QRMA 4P53A 1WA5A 3UJ8A 1MO5A 5LB4A 3DOHA 1OILA 2HRCA 4KR9A 1MV8A 3BULA 2BDTA 3ILSA 5F7JA 1E6UA 4BQIA 1KEEA 1M1YE 2ATIA 1ZM4A 3RB8A 3ND7A 3W2TA 3MOGA 1BGWA 4L6CA 4OQLA 1FFSA 1OLUA 1EA5A 3QVMA 5FBHA 1LSUA 5CVDA 1Z2EA 4IDGA 4YQYA 1B16A 2WAAA 3Q8WA 2O8BB 2QZ9A 3WLSA 1ST2A 3F98A 4GOXA 1B0UA 1KEWA 1W75A 4OQMA 2V7UA 13PKA 3L8CA 1MJGM 3OZUA 3GPLA 3FWZA 1JJAA 2VBIA 4JC4A 4RIIA 4UUNA 2PD4A 3HCRA 3WGVA 4CEIB 3UMFA 4ND8A 4COKA 2AKYA 3P0EA 2ZJ2A 4QYXA 4DRZA 2CCJA 1AKYA 1WAMA 2P9BA 5EEGA 5A4MS 4WKCA 1IG3A 3TLYA 2CEAA 2PSJA 4YPOA 4BZPA 1SJ9A 1EZ1A 2O7NA 4MIKA 4M1TA 4BXOB 3DXZA 3LCRA 1T3GA 3D0KA 4KGXA 3G8AA 2GJ8A 3GZJA 4MYCA 2P75A 4O2BF 3K5HA 3HP7A 4FZJA 3F73A 4NEGA 2H5EA 2H5LA 4TMTA 3LLUA 2NW6A 1I9GA 1YRBA 4KR0A 5KC9A 4CMCA 2AE2A 3IHWA 2XCQA 2C8LA 2YXLA 4YO7A 3T38A 1E1CA 3F8WA 1VMEA 3GDGA 3E9DA 1NYLA 1RPNA 1SOAA 3DZGA 4QDXA 1AKVA 4PYJA 4A23A 1Z83A 2BFOA 4RY8A 4KIUA 4DQXA 4M9QA 2PYDA 3NONA 1V1MB 3GRFA 3NFYA 3H87A 4NEQA 4Z1MD 4QVGA 1NBME 2G08A 5HJ2A 4E30A 1XX6A 4Q3CA 5HQ3A 1UANA 1DT3A 4Y2UA 4KQIA 2YIVX 3DL0A 3ILXA 5T4EA 1ZH0A 1YE5A 1LK5A 2F3UA 3A1SA 3IQZA 2CMHA 1K3UB 4AJEA 2PL5A 1Z4JA 1BKYA 4P3NA 4QAJA 3VA7A 1XN4A 5DSZA 4BMNA 4CM8B 1XCGB 1K5HA 2AFVA 1H2BA 3H99A 4J0HA 4DG8A 5AUPB 8ADHA 5MN4A 1N0IA 2IYVA 4YWHA 2MYNA 2RFLA 1E2QA 5LYJA 3FHOA 4F4CA 4NJEA 3UK0A 3ZJ5A 1N5DA 2G1KA 4L7VA 4TWJA 5EP2A 4QNRA 3EXEA 5H1YA 5I8ZA 1GUYA 3QU9A 2CHQA 1U5BA 1KDZA 1ODKA 3G1TA 3VH2A 5ICMA 1P9OA 2FSVA 1CUXA 3L7JA 2H7YA 1XRJA 3A1CA 4U7JA 2JEOA 3EFBA 3P9QA 4XE5A 1L5LA 4LC1A 2Z6UA 2A0YA 3ZQKA 2XWSA 4JGGA 4BQSA 1GPLA 1PJLA 1YR8A 4XJXA 3KZNA 4KRGA 3M3HA 1DI0A 2ODWA 4YRTA 3TK1A 4YMTA 4Y3UA 3EZ9A 2R0QC 3NKLA 5EMJA 1I01A 3AP3A 2BEVB 4EQ6A 5A04A 2MTBA 5DM0A 1U1GA 3VR6D 2CNKA 4BJ3A 2P3QA 4PTLA 2FN4A 1DRUA 2W2LA 2OHHA 2PKYX 3MOSA 4EMUA 5CB0A 4MCIA 3OCYA 3DL4A 4IUBS 4I6JA 4PHCA 4XDYA 4ARZA 4F2GA 5CB6A 4HX9A 5LL6P 1K0UA 2E4UA 4QX6A 3EGEA 1VIMA 2GI4A 1TE2A 2XUHA 3WLEA 5TPZD 2VTEA 2F8SA 1A7KA 5I5GA 4MDEA 1K6JA 3U80A 1XDGA 1MJGA 3ET4A 1JNYA 4HQ6A 3TW0A 2WV7A 5JXWA 4IL5A 3IXQA 3DMHA 3ZV5A 1XDSA 3Q6IA 3NTQA 3TXXA 2RKBA 2XZOA 1L6RA 4MEAA 2BRUC 5IJ9B 1PT5A 4LY9A 2Z2IA 1T13A 3FDXA 4X8LA 4U5XA 1EWYA 1GADO 2DLDA 4MS1A 4RY9A 4X1OA 1KVSA 1ZN9A 4L3WA 3TRDA 4EUNA 4OJMX 1J21A 1SU4A 4UE6A 4XX0A 2DF8A 3Q9NA 4KQGA 2GETA 1S8OA 3OG9A 3ELBA 2QXYA 3IAUA 4G4JA 3UJ3X 4NATA 1RIFA 3PC6A 4TTJA 4YJFB 5EHZA 2P69A 2C5LA 2ZRCA 3FTEA 1VTKA 1L3CA 1EDEA 3W7BA 4CGZA 1PZEA 3RT9A 5LP6F 3LT2A 3CH5A 2YV1A 4K9MA 5LSAA 1DV1A 1E9EA 4QQ8A 3U3RA 4L0MA 2YJ4A 3QVVA 2BJWA 4ON9A 1LPBB 3QYFA 2DPYA 1K7EB 3B3QA 2EW1A 4QWWA 4FFLA 1TUBA 3GEPA 4E88A 4BZQA 4DCVA 4LYEA 5BSMA 4DUPA 4XDHA 2QNRA 3D3WB 5CRIA 3R40A 4Q9NA 1G1MA 4QREA 4F0JA 3PA6A 3L77A 1KPGA 3M4ZA 5HW0A 4EPTA 3FWKA 1TKBA 5TY0A 2ZIEA 3RO7A 3M6XA 4UUQA 3E1KA 3RUAA 1G2QA 2G9VA 1JSXA 4EHJA 2D8AA 1KPIA 1CUGA 2WKWA 4EUFA 4IQ4A 2FKAA 1B15A 1RYBA 2RHMA 3CLUC 4JOQA 2FUNB 2IELA 3HB0A 1U8EA 4PANA 1GGEA 5BMVF 4NBWA 1T3HA 2O7RA 5CEJA 2OGSA 4HOYA 821PA 2A5GA 2ENWA 3RC7A 3AVWA 1L8OA 3R7NA 2BFBA 3AJEA 3P5SA 3ZGNA 3M9LA 4KBGA 3G0CA 3P71T