4DA9A

Crystal structure of putative short-chain dehydrogenase/reductase from sinorhizobium meliloti 1021
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
254
structure length
219
Chain Sequence
MMTQKARPVAIVTGGRRGIGLGIARALAASGFDIAITGIGDAEGVAPVIAELSGLGARVIFLRADLADLSSHQATVDAVVAEFGRIDCLVNNAGDDFLDLKPENFDTIVGVNLRGTVFFTQAVLKAMLASDARASRSIINITSVERLDYCMSKAGLAAFSQGLALRLAETGIAVFEVRPGIIRSRWGEPEDIGNIVAGLAGGQFGFATGSVIQADGGLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short-chain dehydrogenase/reductase
publication title Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
rcsb
source organism Sinorhizobium meliloti
molecule tags Oxidoreductase
total genus 69
structure length 219
sequence length 254
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4da9A00
3WB9A 1JDJA 4PG5A 3WLFA 4AFNA 4IIVA 1LSUA 3AY7A 4GPD1 1NVGA 4KP7A 1XU7A 1ZVMA 2H6EA 2Y1OA 3F9IA 3ZV5A 1YB4A 1HL3A 3I6QA 1P45A 4LN1A 4RPJA 1ZNQO 5JYDA 1HKUA 1ORRA 2HMWA 4W4TA 3LT4A 1E7SA 2IXAA 3PHIA 3DAFA 4YJFA 3U4HA 1LU9A 1Q1NA 4ALNA 4DYDA 4GH5A 2X86A 4K6CA 5C7OO 1NPDA 3WYCA 3DMYA 1PTJA 1EUZA 3D7LA 4D3FA 4NJMB 2EF1A 1GTMA 1HT0A 3DOJA 2EKPA 4D46A 2NU9A 5DBFA 1T1RA 2CZCA 2W2LD 2YHUA 3ZWMA 5IZCC 3H2SA 1GR0A 3IUPA 5A4DA 2P5UA 1NNUA 2JD0A 1H6CA 3PDJA 4NPCA 1QR6A 3VZQA 3QWIA 1Y5MA 2WE7A 3A4VA 4IDBA 5KCZA 1MLDA 1V3UA 2EEZA 3OMLA 4AJEA 3HDYA 1ISGA 1JLLA 2W2KA 4BO1A 3E9MA 3E82A 1E7RA 1U3TA 3OA0A 3GDOA 3K6JA 3EW7A 4IDCA 3JQ9A 9LDTA 2W4QA 3VVBA 3PJFA 4MVJH 5TF4A 3EYWA 4TROA 3MJ4A 1T1SA 2VT2A 5G0SA 1ISHA 5AXDA 4IXTA 2X8LA 2HK8A 2VRCD 3JQGB 4IQ8A 3RIHA 2CF5A 1EQUA 2VHWA 3ETEA 1RM4A 3DFZA 1DRUA 4E2YA 3ZWBA 4BGVA 2YFHA 4ZHSA 5B4UA 1ENZA 2WD7B 4IUYA 5EINA 3VH1A 3SJ7A 4L75A 2Z1NA 2IYPA 2EW2A 2G5CA 2QG4A 1C1DA 5DDIP 3TFOA 3RU9A 1YRLA 5T8KC 3S2IA 3ULKA 3KO8A 2XXBA 4JLWA 3WMWA 1YE3A 3B1JA 3JD2A 4PFJA 4WGGA 3P2YA 4WK6A 5T64A 4CODB 1EE2A 3JD3A 4E0BA 3ROPA 1B8VA 1NASA 3KLMX 4IBOA 4MDHA 2Y99A 3V1YA 2VHXA 2FWMX 3BHMA 3DTTA 4LW8A 1NWHA 2PGLA 4PZCA 1W4ZA 1PL6A 4RQUA 1DJNA 4Y6PA 4CUKA 1LQTA 3LYLA 4KUHA 2NUAA 4HX5A 3WJAA 1ZO8A 4IGFA 5U9CA 4Q3BA 2ZTMA 3FD8A 5DCUA 5EIOA 3WGTA 1ADBA 3IDSA 1S6YA 2BH9A 2YFQA 4ZJUA 4CQMB 1KETA 1WNTA 3BTOA 4J16A 1OMOA 1JAYA 4JCOA 3KB6A 4JNKA 5CG1A 1QG6A 1PJ3A 3G79A 4I5EA 3HUDA 1ZJYA 1YOVB 1ULSA 2Q4EA 4JXKA 3OJFA 5ICMA 3FI9A 1NR7A 3FCOA 1R66A 2UYYA 1GYQA 3V1UA 4JROA 2C7VA 3ZCXA 3L4BC 5B4VA 2BFMA 5CG2A 1XDWA 2ZTLA 4UUNA 5TT0A 1J6UA 2E82A 4DMLA 1GV0A 2PZKA 2VHZA 3MWEB 4YTEA 2WD7A 3WOHA 1IZ0A 2Y05A 4WOJA 3LZ6A 2ZYAA 1CYDA 4CMIA 4KUEA 2XF8A 2PR2A 4XJSA 2HRZA 1M75A 4RVSA 1M6HA 5TS3A 4H3VA 5KVCA 1V0JA 1A72A 3K8ZA 5DT9A 3Q2IA 2DQ4A 5H83A 1XWFA 5DF1A 3HDQA 4NBVA 1RYDA 4PIVA 4J1SA 1VJTA 3QQPA 3HB5X 5TT1A 1UDCA 4C7KA 1MC4A 3GMSA 4E31A 5B4TA 4XIJA 1QMGA 4WCFC 1GPDG 4GGOA 4D41A 1GYRA 1P0CA 4JJGA 4I9HA 1HLDA 2PK3A 5H82A 3TL2A 3PTZA 1FF9A 5GY7A 4BNYA 1OC4A 1YO6A 5JAIA 1UP7A 2E37A 3BYZA 2F1KA 1UXJA 4BKUA 4PZEA 3SJUA 3W4IA 2RHRA 1P31A 2FSVA 2VN8A 3TRIA 3CEAA 4CM9A 4EITA 2HQ1A 5CEEA 4DC1A 1U28A 1D3AA 4ITUA 4ROSA 5COBA 4M1QA 4GBJA 1LEHA 1DO8A 1FDVA 3BTVA 4BKOA 3RFXA 3OSUA 3WSVA 4IS3A 1XEAA 1I2ZA 7MDHA 5IDQA 1IL0A 5IZCA 3OH8A 4YQZA 2J5QA 4E2XA 3TZCA 1F17A 4XKJA 3ST7A 3CMMA 4WLFA 2ILTA 1YB1A 4IJUA 4Z9XA 3U9LA 3UICA 3WG9A 3FPLA 4Q3CA 3WMXA 1WMAA 1RYEA 3WJ7A 2B83A 4B4VA 1NHGA 4D7AA 2HCTA 3KSDO 4P4LA 5TLSA 4UUOA 3D0OA 5CEFA 1YBVA 2VHVA 5C3MA 3ZV6A 3MZ0A 1ARZA 4J1NA 4G81A 4EGFA 4BO6A 1HWYA 1R4NB 1E7MA 1WVGA 5DZSA 2UV8A 4BNMA 2QRJA 1YWGO 1ADFA 5LDHA 3OQBA 3SEFA 5G0VA 4B3HA 3GNTA 3WSWA 4GAEA 1E6UA 3BHIA 5JC8A 4WEOA 3WQQA 5F1KA 4J49A 2AE1A 4RO0A 3SLGA 1Y7TA 2Y0DA 2Z1MA 3L6DA 3MJTA 5DULA 5FF9A 4CLHA 3M2PA 2RH4A 1S7CA 1UDBA 2J8ZA 2C54A 1EVIA 2EKLA 1PR9A 1U8FO 3PGXA 4ALLA 4H16A 4OOEA 1PGPA 3ZGYA 1SC6A 5T8KA 3ZDFA 2ZB3A 3PJGA 4PG8A 4E21A 3PEFA 2D0IA 4YPOA 1U8XX 4AG3A 3WQSB 4OXYA 4WOKA 1UH5A 4CLXA 3WLEA 4M89A 1ZXLA 4WLEA 3UCEA 1PZHA 4GL4A 1EBFA 1M76A 3ZW9A 2WTBA 1U4OA 1ZK1A 1CDOA 2EP7A 4B7CA 4KDFA 3PWSA 5G0WA 4YJHB 1B26A 2X0NA 4B8ZA 1HDCA 4WECA 3ZU4A 5BT9A 3KEQA 1X1TA 3PQDA 4GX0A 1PR3A 3O8QA 4M54A 1T2FA 2FRDA 2Q3EA 1LUAA 2PLAA 4WE3A 4DQVA 5GZ6A 3BMCB 1C0PA 4YACA 1Z7BA 3ZW8A 4CLOB 5MDHA 3D3WB 3BA1A 1PIWA 3ROQA 3LC1O 1FXSA 4L73A 3H9GA 2RHCA 2ZCUA 3L07A 3GG2A 3RROA 1XR3A 1TI7A 3GVCA 2PFGA 4E4YA 2WDZA 3NTRA 1U4SA 1VL0A 2WM3A 1DXYA 1PJSA 1A9YA 1FDSA 1ZK2A 3DQPA 3HWRA 2JCVA 2UDPA 3L4BA 4GX1A 2VQ3A 3F1LA 2DUUA 5T67A 3PWKA 2BKAA 3U3XA 5HWSA 3LT1A 5JSFA 1VRWA 4DIOA 4FQ8A 4B8WA 3PZRA 3SBOA 2X22A 2EXXA 3CIFA 1DIHA 2C5EA 3V8BA 1J4AA 3GVXA 4A27A 4CUJA 5JY6A 1U7TA 2PNFA 2E4AA 4BMSA 2AG8A 2BF7A 1G0OA 3MCVA 2QHXA 3H9EO 3PJDA 4TRRA 1EZ4A 3DL2A 3AM3A 5G4KB 5A5FA 5L40A 3JQDA 2FP4A 5AXCA 3VPXA 3WBBA 4DRYA 1BG6A 3JD1A 4HFNA 4PG4A 4R1TA 3C8MA 3ZWYA 3QVSA 4DVJA 2DKNA 3GF4A 4WCFA 3H9JA 4R1NA 3S55A 4P22A 5HRUA 2AEFA 5I7FA 2CVZA 1P1RA 3OJLA 3NDIA 2WWRA 3PP8A 5FEUA 2ZB7A 1C1XA 1MG5A 3S2EA 2CFCA 4BO5A 5EESA 4D43A 4CR8A 5JNLA 1BW9A 4IQGA 4D79A 1PL8A 1YL7A 3DBHB 1LSOA 3F6YA 4K28A 3ZWWA 4NG5A 3RCBA 3C7CB 3EC7A 1K6IA 3JYOA 4PRLA 4YCAA 5T6BA 1WDLA 2QX7A 5IF3A 1LSSA 4RVUA 1F0YA 3ZU2A 1IB6A 1XQ1A 1AXEA 4KTVE 4CM7A 2Y0CA 3NT4A 1I3MA 3Q0EA 3AOGA 3OEWA 2X6TA 3KETA 4R5HA 4MP3A 3QW2A 4GI2A 4RPKA 4ZVVA 4BNXA 1DFHA 5KOIA 3CZMA 4FFNA 4IJWA 4BKPA 1U1IA 4GGPA 1UP4A 3DXFA 2NTJA 2X5KO 4Y8VA 2X7HA 4LCJA 1RWBA 5AXAA 1MP0A 4IY1A 3SX2A 1GQ2A 1U3WA 2VYND 3O9ZA 3CUKA 3Q2KA 4Y9DA 1MXHA 5G4LA 4D3DA 1CERA 1Y9AA 4B79A 4QEDA 1ISJA 1I3NA 1KVQA 1W0CA 2CVQA 2O23A 5ENVA 5ILOA 4FIZA 4A7PA 1X7HA 1JW9B 2O4CA 3GGPA 4B7UA 1PJ2A 1A9ZA 3DFUA 3I4CA 3WX0A 3ZHBA 1Y9EA 1VKNA 4OOFA 4N5MA 4RF2A 3BXXA 2DTXA 1UXKA 4KUGA 4MVJM 5ILGA 5L7TA 4FB5A 4DIFA 3IAHA 1EK6A 2VWHA 1DC3A 2Q1TA 4FDAA 4RVDA 3HZZA 3JQAD 2GO1A 2JFFA 3LF1A 1CIVA 2QZZA 4R51A 3ZWXA 2OO5A 1H6AA 3GR6A 5F1PA 4UUMA 3LC7O 2FPIA 4XEHA 4CM3A 5I7SA 5KJFA 1SAYA 2BGMA 2O3UA 1JQBA 4MVJD 5AOVA 4AJ1A 4BNWA 4PLZA 2X5JO 4NH4A 2NU8A 3G17A 1H2HA 2D59A 3S2GA 1WWKA 2NVUB 1Y8RB 1LNQA 1NM5A 2YYYA 4I5GA 3ZV3A 2YDXA 1ZUD1 2FPPA 2ZYDA 4RDHA 4CM4A 2I9PA 1AGNA 4JBHA 4TRNA 1MX3A 4IZIA 1ZEJA 3DZFA 4WNIA 4RJTA 3WS7A 1R0LA 2G0TA 2J6IA 1O0SA 2X5OA 3JYNA 3UUWA 1AUPA 4UUPA 2O2YA 4TWRA 3H65A 4R54A 5LDGA 3WDSA 3KV3O 2I6TA 1X7DA 4LSWA 3FTPA 3TOZA 2B4TO 3IJPA 1QYVA 2I67A 1KY5A 2HJRA 4R9SA 4QO8A 4MVJE 4R16A 3ANMA 1BVRA 1OFGA 1IPEA 5JCJA 5B12A 2NVWA 1LLQA 3H9QA 4TRMA 2QYSA 3B1FA 2RBEA 2P9EA 1DAOA 2QIOA 1NTOA 2ZTUA 1EUCA 3NDJA 3WNQA 1R37A 3JQFA 1IY8A 1FK8A 1KVUA 4HKTA 5BSEA 3M1AA 1HZZA 3I83A 3RUIA 1OOEA 2WD8A 3I52A 3VAZA 2V6FA 2PZJA 3HG7A 4XYGA 2EGHA 4K9DA 2VZ8A 3I6IA 3PHGA 2YV1A 3U62A 2FY8A 2DTDA 2ZTVA 3R3JA 5A9TA 1VI2A 1IULA 1EEHA 1GYPA 1XKQA 4S1VA 4Y6SA 2ZATA 3WFIA 1UXIA 2RH8A 4CM8A 2NACA 2JCXA 1T4DA 2NTNA 4R5MA 1N9GB 4UVIA 4MINA 4NHEA 1BXZA 2A9FA 4H7PA 1T2AA 2P5YA 2ZJ0A 4YJGA 3VOSA 2I5PO 3FF4A 3D5TA 1SPXA 2Y1FA 4GWKA 2EHDA 1DC4A 4IMPA 4DA9A 5KJ6A 2CDCA 4DL9A 1QLJA 4J7XA 5TIIA 2NADA 3QV1A 4YJFB 4E12A 3PXXA 3JQ8B 2WYUA 3E48A 3MOGA 1BXGA 4OYRA 1YQGA 4EUHA 3IL2A 5A9SA 3R6DA 4D0RA 4FGSA 4DPLA 4OKIA 5IDYA 1PJQA 3TSCA 3B6ZA 1X7GA 3Q9UA 3NDRA 3NX4A 5ITVA 3UH1A 1UP6A 3N7UA 1ZSNA 4BB5A 5K6AA 1GZ6A 3RASA 1KS9A 3INGA 1Q2XA 3A06A 2I65A 3DONA 2GRAA 1U2DA 4U8GA 4B3JA 1KVSA 2WMDA 4O59O 2W2KB 3TJRA 1JVBA 1OBFO 3K92A 1ZKMA 3PQFA 3G3EA 2D4AA 2BI7A 1F8FA 3HFSA 2R00A 1E1LA 5EL0A 1N5DA 1KEWA 3RUHA 4CQMD 2CVOA 3WYBA 5AYVA 3K31A 4BO0A 3D4NA 1XU9A 4GLOA 4NFSA 1CJCA 3ITDA 4H15A 1NHWA 4GKBA 4LMRA 5L95A 4J1TA 4UVEA 2J3IA 2Y1DA 1U2GA 4CQLA 4WPGA 1ENPA 1IZ9A 3KOUA 4RZHA 3AUUA 4YQYA 1P1HA 4GSLA 5HS4A 5F5NA 4RZIA 2O50A 1YVEI 1C1DB 1I2CA 1P9LA 3PWZA 3VDRA 5IJZA 1HEUA 4Q3DA 2JCYA 3PHLA 1XLTA 4JK3A 3C24A 4ZQEA 2OXIA 2JJYA 4BO3A 3F1KA 3IQDB 4UEKA 5BR7A 5C5IA 4U5QA 2QRLA 2QZ9A 2GZ2A 2V65A 2O4UX 5FWNA 3JQ8A 5L51A 4AJIA 3ZNQA 2NWQA 3RAJA 4XYLA 1GEEA 1R4MA 1UJMA 3DHEA 4RVGA 3CKYA 1NR1A 3QWFA 4OXKA 1Y5RA 4YRBA 2IEDA 4EI2A 3LU1A 2QW8A 4X54A 2YY7A 4MPDA 3BTUA 1DEHA 1E1KA 4UREA 4XYEA 4EBFA 3OETA 3X2FA 4CLRA 1PZGA 3GY0A 1SB8A 2OGUA 3ANLA 1LC3A 4A03A 1KYQA 4GMGA 1PWZA 1ISIA 4ND3A 4EJ6A 5L9AA 3GRKA 1T25A 3AJRA 4OO3A 3V1TC 1QYDA 2H1SA 3GEGA 1H9AA 1XIVA 3IMFA 4PVDA 2HU2A 1Z82A 4O6VA 1AHIA 1VL6A 2X58A 1Q0LA 4Z0PA 4PZDA 4HV4A 5TX7A 1LC0A 3VTZA 1EFLA 3GVPA 2NM0A 1XG5A 3LT2A 3ROMA 2POQX 3GG9A 3CXRA 4Q3NA 1A7KA 3RWBA 2B4RO 3PGJA 1NBOA 4ND4A 4Z3DA 3GK3A 4NU6A 3DHNA 4CMIB 1N7GA 3AFMA 1J0XO 2FZWA 4JJIA 5L7YA 1ULUA 2F00A 3N74A 5BSHA 3PHHA 2DBVO 4FC7A 5JPIA 2RIRA 3OM9A 3H3JA 4D3SA 1NPTO 1JWBB 1ZCJA 1NQOA 4IS2A 5JS6A 1GEGA 2HMSA 1K2WA 3G1TA 1IHYA 2NNLD 4CMHA 5C7LO 2PZLA 1GFSA 3VPGA 2VOJA 2VTEA 1IE3A 2JKVA 3L9WA 1I5RA 3NYWA 1G6KA 4BGEA 4YT2A 2W98A 3JTMA 3PLRA 4BMVA 1VKOA 2OP0A 4P38A 4CLDA 1P33A 1MV8A 4NDNE 5KVSA 2YQ5A 3VVCA 3L0DA 4DUPA 1H6BA 1HDRA 3VH2A 3HN7A 1E3WA 1YDWA 1EVYA 1BDMA 2BFOA 1DLJA 4IDFA 2TMGA 3ROKA 3DHYA 2I66A 4AJ2A 4HWKA 2B37A 1LXCA 5DN9A 2DTEA 2W90A 2Y67A 1B2LA 1WDKA 1XA0A 2VNAA 3WWYA 1JTVA 5COQA 4OHUA 3PYLA 2UAGA 3MJEA 1OZAA 3A1NA 1R15A 4RDIA 2D8AA 3GHYA 3JQ7A 2BGLA 1MXFA 1BWSA 1SOVA 3GZNA 4DWVA 1A4UA 3DR3A 3ZN2A 4CJXA 5ICSA 1SCUA 1Y81A 1SEPA 3F3SA 4XDYA 2EKQA 1M6WA 4LRSB 4L4XA 3DZIA 1P1KA 3EVNA 1D1SA 1F06A 5THKA 4AJLA 1ZIDA 2X0IA 5A02A 1I30A 4NK5A 4BO2A 3TN7A 4XRGA 3VKUA 1D8AA 1LRKA 3T4EA 2IYOA 1PS9A 3ZWPA 1PJ4A 4P4GA 1KY4A 1E92A 3GOHA 1N2SA 1ZBQA 1R0SA 5L4SA 2OZPA 4MJLA 1XGKA 4NBTA 4F46A 1PEDA 2NU7A 1YXMA 4EYEA 3B1KA 1ENYA 4W6ZA 3W8EA 4YYZA 4ZRNA 3JQEA 2HMVA 5GZ1A 5A05A 4BMNA 4YB8A 1YONA 2VCYA 4ONEA 3AI2A 4BNLA 4BGUA 2NSDA 4DGSA 4Q39A 3IP3A 3W6UA 2ZIZA 3ONEA 5FFFA 3N58A 1ZK3A 2Q49A 1K5HA 1GCOA 3ZNNA 3RD5A 1Y6JA 4PLTA 1CWUA 1TXGA 4G5HA 4QFDA 4XQEA 1EVJA 3PFWO 4BNTA 3H6KA 3EK2A 1K3TA 2DU8A 3ZHZA 2BFAA 3WGYA 1E3EA 3CMCO 3OA2A 2IZ1A 4E32A 4BB6A 5JLAA 3C7DB 3O8QB 2HJSA 1K89A 3ZWVA 4KMSA 4EZBA 1ZK4A 5BNFA 2JFGA 4J0EA 1YH3A 1NYTA 3JYPA 5DP1A 5CDGA 1TEHA 5I9MA 3DBLA 4PLFA 4L76A 4LGVA 1ADGA 2AQ8A 4MKRA 4YRAA 2VZ9A 2DPHA 2Q1SA 5IZ4A 1A5ZA 5A04A 3STHA 4TZTA 2EW8A 1GD1O 2IODA 4FC6A 4Z9FA 5TC4A 1I33A 1RKXA 2GD1O 4NIMA 4LISA 2VOEA 1OAAA 5KWEA 3BMNB 3W8DA 4J9VA 3S2FA 1YJQA 2GCGA 1M67A 1LSJA 2C2XA 3A14A 3BHJA 4INAA 4PLVA 4CL3A 1DIBA 3DZGA 4AJOA 3HE3A 2DT5A 2Q1WA 4DTIA 2G76A 2FOIA 3VZPA 1E7WA 2A92A 5FI5A 3AUTA 3NTOA 3GNQA 4WASA 1GUZA 4AL4A 1DLIA 3OBBA 3QWAA 5JO0A 4XX0A 3WGHA 4DXHA 5B37A 2G17A 1GUYA 2VHYA 3I1JA 1DPGA 3VDQA 4J4BA 4L74A 4W7IA 4YT4A 1A27A 3FSRA 3M2TA 3U49A 2DUWA 4WCFB 1TT5A 2W2LA 1HDXA 2AG5A 4NJOA 6ADHA 2C2YA 3AU9A 1GL3A 4CL8A 4HP8A 2CNBA 1SB9A 3HN2A 3HSKA 1YGYA 2GNAA 1C1XB 1E7YA 3GFBA 2BFPA 4WLNA 1R0KA 5LC1A 1BW9B 5C7IO 1E77A 1JWAB 2EWMA 1CRWG 4XZ3A 1HTBA 2WEKA 5DNAA 1T24A 3AUAA 5KIAA 2V6BA 5KJ1A 1B0AA 4MIYA 1DB3A 3NJ8A 3TZKA 2YJZA 4BO4A 2EP5A 5TNXA 2B36A 5K0ZA 2VRCA 3B70A 1O94A 1HSZA 1H5QA 5A3JA 2AHRA 3S8MA 2ZKLA 3GZ4A 4GX5A 3C1TA 5K9ZA 4P4NA 4II3A 3BMNA 4FFPA 1XHLA 2D5AA 2GASA 4OKNA 2A35A 3QSGA 4TVOA 3RC2A 4M55A 3PHJA 4OL9A 4YEDA 1HDZA 4D0SA 2FR1A 4JGBA 4FS3A 2JAHA 3RQSA 1DOHA 2DVMA 4R1SA 2Y0EA 4R41A 5F21A 1MA0A 4D44A 1GDHA 3DOCA 1QP8A 3D1LA 1U3UA 1X13A 5JXWA 2RCYA 3UF0A 4UULA 1LRLA 3U4DA 5CDSA 5DBIA 4BNHA 1C3VA 2JAPA 3LLSA 4FN4A 3AK4A 1H2BA 2HRBA 3ZH2A 2VZ0A 1U5AA 1YBAA 3FRJA 2JHGA 1N1EA 2PH3A 3CE6A 3ABIA 1KVRA 5JAQA 4BNNA 3I4FA 3CSDA 2P2SA 3OQ1A 3BIOA 3GN1A 5JAZA 3VH4A 4NU5A 4BNVA 1HYGA 4LVUA 3IC5A 3A9WA 1E1MA 1ZEMA 1Z45A 3EUWA 1FDTA 4XR9A 1VJ1A 4AJHA 4CUZA 4D45A 4XD2A 1EK5A 3WR5A 4CMKA 3AI3A 1HDYA 1E7QA 4WLUA 4R1UA 3INTA 1W73A 3FWZA 3FHLA 3O26A 3SC6A 4G2NA 3H8VA 3HDHA 1ENOA 2AQHA 4YAJA 5KTKA 2OORA 1KEUA 1BVUA 4FJ2A 4HFRA 4B4WA 2OBYA 3AY6A 3QP9A 3JQ6A 3ZWCA 4MVJG 5CFZA 3KYDA 5L53A 1BHSA 4OGWA 1HDGO 4NNJA 4ND1A 3NEPX 2Q46A 1JKFA 4LMPA 3UCFA 2EERA 2D5CA 1ONPA 2CSUA 4WCDA 2EJVA 3ENKA 4F45A 1QYXA 4CM4B 1IUKA 1GU7A 3VHRA 1DRWA 1TVEA 4E3ZA 3GGGA 2IZ0A 1BRMA 3IOYA 1DIGA 1FJHA 4FR5A 2CF6A 3PYXA 4NK4A 1HZJA 1EUDA 3DZHA 1L1FA 3U4IA 1HE5A 3V2HA 1L7DA 1I3LA 3NUGA 1LTHR 1ZXBA 4J91A 3R0IA 4RPHA 5I9LA 3UFXA 4ZQBA 1VL8A 2H63A 4BV8A 1BGVA 2PWZA 1Q0QA 5AXBA 1Z74A 4DIBA 3DDNA 1DBVO 1M2WA 3WTCA 4GVLA 5CDYA 1VC2A 4K6FA 3ENNA 1ZK0A 1RPNA 2VWGA 1B8PA 2XPCA 3Q6IA 4RPGA 2PTGA 3O4RA 2GN9A 3I9JA 4CMBA 3QLJA 3GVIA 5TSDA 1TT7A 3DEYX 1B7GO 3RBVA 1QXSA 3GDGA 3QVTA 3L6OO 4BKRA 2J3HA 1E5QA 2DBRA 5DCYA 1E3LA 1KIFA 1RM3A 2EG9A 4J6FA 2GSDA 3SVTA 1ONNA 1LDMA 3ETGA 3MTJA 4CV0A 3LDHA 4UEJA 4AJKA 1ISMA 1CF2O 1ONOA 3H9UA 4U6QA 4EUEA 2A94A 3OIFA 3RSHA 4BNJA 4CM8B 3JCZA 3RC1A 2HK9A 1KVTA 3RUAA 4GMFA 3UAGA 4YR9A 1WAMA 3CINA 4J4TA 3EHEA 4NI5A 3DZJA 1HE4A 1SOWA 3JD0A 1U9JA 3ZV4A 4YJGB 2XOXA 3RKRA 3HJAA 4DC0A 2CY0A 3PIDA 2O3SA 3NT2A 2HUNA 4NR0A 4J0FA 5JY1A 4ZRMA 2Q45A 4AJJA 2J3KA 5JC1A 2IZZA 2B5WA 2DBQA 2GYYA 4CMJA 4RCVA 2D1YA 4MVJP 4XQCA 4ID9A 3FWNA 4ALIA 1GADO 3C7AA 4KOAA 3W6ZA 1ZJZA 2CMDA 4FW8A 1BXGB 1XYGA 3W4KA 3NV9A 5A9SB 2NLOA 3H3FA 5COAA 1UDAA 1ZFNA 2Q2VA 4RF5A 2I3GA 2GN6A 1WPQA 5KVVA 3GUYA 4WKGA 5ER6A 1T26A 3KUXA 2OHXA 1UUFA 2X1HA 1O8CA 3BMOB 2GDZA 3L6EA 5GMOA 1Q7BA 3KLPX 4TKMA 2FR8A 8LDHA 3G1UA 4CV1A 3QVOA 1DHTA 3NGXA 2AMFA 4Y6RA 3VC7A 2D2IA 4TZKA 4BNUA 3OECA 3VPSA 5CDTA 5DOVA 4XCVA 1KEPA 3JQ9C 1DRVA 2I3AA 3ADOA 3AWDA 4I08A 2ZQZA 3WGIA 3V2UA 3WBFA 3FN4A 4Z0HO 4JBIA 2WSBA 2Y66A 4IDAA 4FFOA 2BLLA 2V7PA 2X0JA 3OJOA 1P1FA 4AJNA 4M87A 3Q1LA 2VUSA 1EFKA 4TVBA 1LQUA 1HYHA 3DOOA 1NVTA 4UVGA 3PDUA 4CPDA 3ASVA 4XGKA 4CQLB 2YQ4A 4R4JA 1VE9A 3KZVA 4ND2A 4P8RA 2SCUA 2XAAA 5CDUA 1PGOA 3FNGA 4RGBA 1NP3A 1MB4A 5G2OA 2JHFA 5EN4A 4CR6A 5HM8A 3RJ9A 4XYBA 5HBRA 1WW8A 3GDFA 2QYTA 4IZHA 4ZU3A 2ZB8A 1KOLA 3F5QA 1E6WA 5ITWA 4JQCA 1SO8A 4FSHA 2DFVA 2V6MA 1EDOA 4DPKA 1WP4A 3FNHA 4XDZA 3B20A 1P77A 1TA4A 3GAFA 2EV9A 1R4MB 3GC6A 3QE3A 1TB4A 4AJPA 4OXNA 1QYWA 3PQEA 1EBUA 2LDXA 4B7XA 1T4BA 1JVSA 3FR8A 3GEDA 1AN9A 1OC2A 3JQBC 4J2HA 4Q3AA 3GT0A 2Z5LA 1GCUA 1W8DA 3AI1A 2WJPA 3BMOA 3X2EA 3IKVA 1UXHA 4CR7A 4CLRB 1PQPA 4L9RA 4WUVA 1AHHA 3VKVA 5DCWA 2O3JA 2OMEA 2DFDA 3ITKA 3K96A 3TQHA 4CM9D 3EGOA 3OP4A 5JMWA 1KC3A 1KEVA 5ER9A 4E13A 4PG6A 3LT0A 5AQ1A 4F3YA 2P4QA 4A26A 2AQIA 5JFOA 1DFGA 3KEOA 2YV3A 1RM0A 3PLNA 1A71A 3DBRA 3UHAA 1LDEA 3KYBA 2IRWA 4RLSA 3C85A 3I9KA 3PK0A 4OM8A 4E5YA 1PZEA 3ICPA 4EW6A 1YJ8A 4HXYA 4PLWA 3ON5A 4PRKA 4DMMA 1UZNA 4UEOA 4W7HA 3I5MA 3KYCA 2Y93A 1K6XA 1RJWA 1CQIA 1LDYA 3WFJA 3BAZA 3PPIA 3RFTA 1V3VA 4PGFA 3WQRA 3W1VA 2PV7A 2P4HX 3GN2A 1HDOA 4K1LA 5L4NA 3GPIA 1Y8QB 3LSYA 4IPTA 5BNTA 3LK7A 1VM6A 3I9MA 3RUEA 1V35A 4FCCA 3A28A 4KQXA 1EMDA 2IDZA 1YKFA 1GPJA 1QRRA 1QV7A 3OICA 2BELA 4JP2A 3VTFA 4I9NA 1Z73A 4W82A 1DSSG 4BO9A 2GGSA 4N5NA 2W8ZA 1YL6A 1SEVA 4RORA 3RI3A 5A03A 3FR7A 4FOOA 4YXFA 2V6GA 3WGQA 1PJTA 2FN7A 1B8UA 5KNLA 1PJCA 2NTVA 1MGOA 1JAXA 4NBRA 1I01A 1X15A 2VYNA 3JV7A 5KVQA 1F14A 2R2GA 4O63O 2YHIA 5DOZA 3P7MA 3UN1A 3ZNOA 5LCXA 4PN3A 1E3WB 3NKLA 4QTZA 5A06A 3WWZA 3TZQA 4ZGWA 4BUCA 5JCXA 1JA9A 3TZ6A 4C4OA 3VH3A 1SZJG 3C3XA 2B35A 4IDDA 4BS9A 5I7VA 1EQ2A 1GZ3A 5IN4A 4ZQHA 2Y1EA 4BO8A 1C0KA 1IHXA 3MTGA 4ND5A 1LRJA 3JQ7B 2P91A 4BKQA 2ZQYA 1V9LA 4JX8A 3GZNB 4QXMA 2BRUA 3E9QA 3GUCA 3ONFA 3QHAA 1HRDA 3OJEA 2WYVA 4IINA 1E3IA 1G1AA 3BMQA 4FPXA 4J7CA 5EMHA 5DP2A 3GPDG 1V8BA 3D5QA 3JQAA 3VZSA 1VPDA 4A73A 3KSUA 3ONDA 1P1IA 1SNYA 4N18A 4BIIA 2JD2A 4IJKA 4XQ9A 3U4CA 2BMAA 5H81A 3AOEC 3PIIA 4A10A 4LRTB 1LI4A 1O6ZA 4RVHA 4TQGA 4MVJA 1O9BA 1RM5A 1GQQA 4YAKA 1Y8QA 3TOXA 2PY6A 4E5KA 5BSFA 4RV9A 5L4LA 1CETA 3EDMA 2PA3A 1HSOA 1T2DA 5I9NA 1WDMA 3RBZA 3L9XA 3RFVA 4DLLA 2G82A 3RVDA 3NT5A 2O2SA 1PGQA 1DAPA 1GV1A 2Q99A 1LDGA 1PJLA 1PS8A 2Q2QA 3NGLA 4YT8A 1LDBA 3RU7A 1GZ4A 1J5PA 1YDEA 2HAEA 2Q50A 2PKQP 1N8KA 3ZU3A 4DBVO 4LK3A 3F4LA 5ADHA 2JFHA 3P2OA 4QFCA 1BTOA 2ZCVA 2HKIA 4FFRA 4KQWA 3T4XA 2PD3A 2C82A 2NV6A 4O5OA 2PGDA 5IAAA 5IXYA 3E5MA 2X4GA 1A7AA 3KHUA 4KTTE 4MKXA 1WXDA 2C29D 4I1IA 3JQCA 3IUSA 1DJQA 1YS4A 2QQ5A 3GHHA 4YAEA 4NJMA 4AICA 3H5RA 3ASUA 1JN0A 3OIGA 3D4OA 3M1LA 3JQBA 4UVDA 4BNGA 4EJ0A 4GQAA 4EJMA 3BTSA 2YV2A 3ZHYA 1LX6A 1SMKA 4WLOA 2UUOA 2QRKA 4RLHA 5A3VA 1V6AA 4JIGA 4D42A 3H5NA 4HADA 2VRBA 4M86A 1BDBA 4A5OA 4ALJA 4E2ZA 4FFMA 3HQ4O 1D4FA 1T2CA 1T2EA 4NFHA 3DBLB 4OSPA 5EPOA 4B3IA 1F12A 3H4VA 1PL7A 4UVHA 1CEQA 4E5MA 2X23A 2CD9A 2B69A 2O7SA 4NFYA 3JQGA 3GH3A 3PFFA 5EJ2A 3MOIA 4W9NC 3WIEA 1NXQA 3IKTA 4GKVA 2P68A 3C1OA 5I8WA 3NJ4A 1C0IA 1E0DA 1DC5A 3E9NA 5CEJA 1I10A 1ISFA 1WZEA 3F46A 1FDUA 2VYVD 3OEYA 5JDIC 4PLCA 1NWCA 1N92A 3WTBA 4YBZA 3C1AA 2AW5A 4GWGA 2YW9A 5IFLA 1LLCA 1HETA 4RF3A 1H6DA 4NZ9A 1R12A 4BOYA 2OBNA 4QECA 3QJ5A 1I32A 4DYVA 3I9NA 2DM6A 4NMHA 3TZHA 3GAZA 1UZMA 2Z95A 4IMRA 1Z75A 3PVZA 4I9UA 3E8XA 1TT5B 2OOSA 3P19A 4BHTA 1PQUA 4E5PA 3ZWOA 4GVXA 3QWBA 1KC1A 4IIUA 3CH6A 2CDBA 1P44A 5B1YA 1EVZA 4J7UA 2C07A 3SLKA 2ZB4A 4PCVA 3L4SO 1QYCA 4B4OA 3DMTC 3FPCA 1TLTA 1VSUA 3SXPA 2OL4A 3LVFO 4J90A 3W4JA 4OQYA 4N54A 2X9NA 4TKLA 1UAYA 3VZRA 4IXWA 4TSKA 4FGWA 4CQMA 2B0JA 3Q9NA 1R6DA 3D4PA 5G0TA 1LA2A 4CMAA 2FMUA 3Q3CA 1PZFA 1Z7EA 5G0UA 3S1LA 5AVOA 1YOVA 2VTDA 1ADCA 4ILKA 3F5SA 1ZMOA 5IDXA 3UVEA 4G65A 1QSGA 3DZBA 1HE2A 3JSAA 5HTOA 2CDAA 4CM5A 4MP8A 1R16A 2FPGA 3K30A 4LVCA 3GLQA 3ICCA 1JU9A 1FDWA 3WGOA 4I8XA 3E03A 1H9BA 3UKOA 5BQFA 4MO2A 2O7QA 4OMUA 4BO7A 3MEQA 1LDNA 3K2EA 4PLGA 2OP1A 1MUUA 4WJZA 5L3ZA 3CTMA 4QT0A 5F5LA 1DDOA 3DTYA 1P1JA 3IIEA 2GERA 3HB4X 3AOEA 3I9LA 4MKZA 3OFSA 5JO9A 1GAEO 3V2GA 3OJ0A 2YUTA 4ZQGA 3DBVO 4DLAA 1NFQA 2B4QA 2JL1A 3L77A 4YT5A 3QWHA 4J2OA 4Y98A 1JKIA 4I5FA 5U4QA 2PKRA 5FI3A 4J43A 4K26A 2H5LA 1C0LA 3O38A 2I76A 3D64A 4CV2A 3OHSX 2VUUA 3HADA 1UR5A 4YA6A 2HSDA 4GLLA 1E3SA 1PS0A 1NFRA 4CMEC 4BNIA 5EERA 2J5KA 4MOWA 5JCJD 2GR9A 1I0ZA 2ZJ1A 3AUSA 4C7JA 5A9RA 2DBZA 5ES3A 1DIAA 3V5NA 1NAHA 4HFMA 3T7CA 2NU6A 3H5AA 5CP8A 2O3RA 4II2A 1W6UA 1UXGA 4MVJI 4XR4A 4Z6KA 3F47A 4FJ0A 2D3TA 1MFPA 4Y67A 5A1TA 3MJSA 5JAMA 4IDGA 3ZWAA 4YRDA 4DLBA 5I7EA 3GFGA 3CZRA 2BD0A 1BSVA 4U7WA 4DQXA 2YDYA 4J3FA 5CAEA 2AXQA 3KVOA 2GF2A 1PX0A 4U0JA 5C37A 2EGGA 1V3TA 4FJ1A 4GX2A 2GPTA 1AXGA 5THQA 1YB5A 4L0QA 1IOLA 3KYDB 3UW3A 2HDHA 2DAPA 2O3QA 3FNFA 9LDBA 4HNHA 3LF2A 2P9CA 2PD4A 4CLEA 2E49A 3DZKA 2P9GA 3PJEA 3VPFA 1B3BA 1I24A 2EIHA 2O3TA 1VLLA 3QVWA 3P5SA 2HO5A 4XB2A 3QIVA 1K6JA 4NBUA 1IPFA 1LJ8A 3HDJA 5L45A 1R4NA 4RL6A 1BMDA 3E18A 4W9NA 1NQAO 4DREA 4PG7A 4B4UA 3RUDA 4HNGA 3GNSA 5JE8A 1Q7GA 1QKIA 3WXBA 2UUPA 2AEMA 3O03A 2NVBA 4XIYA 1J49A 5JDIA 3G49A 4CMCA 3UOGA 1U7HA 3K5PA 1BXKA 1GQYA 3LLVA 2HK7A 3LC2O 4J9UE 4CM6A 5JYEA 4MVJF 1NAIA 4BV9A 4ALKA 3JQFC 4YVFA 4HY3A 4JBGA 1U3VA 3ANNA 3CPSA 3EZLA 1NVMB 3EVTA 2E6UX 3GQVA 4YWJA 5CPBA 3D3EA 1WLYA 1XCBA 3AY3A 3ZI0A 5GZ3A 3ZU5A 1E5LA 4M8SA 4RVFA 1KBZA 3ETDA 1I3KA 1G0NA 1HLPA 2OFPA 3RBXA 1LLDA 4N7RA 4YJHA 4EEZA 3JYQA 3WGGA 3DMTA 1XELA 1PGJA 3OQ6A 2E48A 1X14A 1YL5A 2Y1CA 3UCXA 2ZK7A 4E5NA 2GZ3A 4BQRA 3GGOA 3KXDA 4HFJA 3OF2A 3E1KA 2I99A 3BMCA 3WYEA 1EDZA 1SBYA 2FR0A 3GVHA 4CLOA 3D3WA 1ZSVA 4AVYA 2XXJA 3IP1A 4KZPA 4L4RA 1X0VA 4EEXA 2C0CA 2X9VA 4IM7A 4OAQA 4ZQFA 1L7EA 3OIDA 3DO5A 1B16A 3ORFA 3EMKA 4OH1A 3RC7A 1PGNA 2AQKA 4O1MA 2IEBA 3IS3A 3AFNA 3PYMA 1D1TA 3GRPA 1O89A 1MC5A 4N5LA 3FBTA 2DC1A 4BGIA 4L4SA 3KSZO 2AA3A 3FNEA 3WGZA 3AM5A 2ZYGA 4IGEA 5CHEA 2VYVA 3INRA 2HMTA 1OI7A 5ENDA 4DPMA 4JJFA 3QA9A 2CUKA 2Q1UA 3NTQA 2C20A 1HXHA 5K6AC 4EUFA 4JP3A 2DLDA 3AW9A 3F4BA 4NQZA 4Z0TA 5G4KA 4IJVA 4KWIA 4BNZA 3KM0A 4XGIA 3R1IA 4OJNA 2YZ7A 4KDEA 4R69A 5T5QA 2J3JA 2R00C 3TWOA 3TF5A 3DAGA 1F8GA 8ADHA 1LBEA 4TMFA 2PD6A 4QUKA 1PU2A 2EJWA 1E6EA 4CMEA 3RUFA 3DB2A 1B3RA 4J4HA 3GA0A 4RQTA 2WYWA 1UZLA 4U6SA 4URFA 1O5IA 4NBWA 4QO7A 4YAGA 2GN8A 3DC2A 4ALMA 5F3RA 1DFIA 3DBHA 3GEMA 3MJVA 4Q9NA 3KBOA 5JDCC 4PLYA 1N1GA 3ADPA 3RUCA 1UAGA 4Z9YA 1XQ6A 2ET6A 3QY9A 3UGKA 3FTNA 2PZMA 4PVCA 4ZN6A 5IDWA 4E30A 2Q4BA 5EQDA 2VT3A 4XYMA 4J1QA 4I5DA 4BNFA 4DQUA 5BSGA 4RPLA 3JYLA 4FFLA 2PGJA 4QX6A 3TL3A 1MG0A 5KJCA 3HHPA 3IJRA 2FHSA 1ML3A 3JD4A 3WICA 3AU8A 4BVAA 4OIMA 4W99A 4AJ4A 3RKUA 3COSA 2RAFA 4XWYA 3M6IA 4M49A 4R9RA 1MFZA 3MJCA 5TJ9A 1HE3A 1ZSYA 1NQ5A 4FOSA 1WZIA 1H94A 3KRTA 5HA5A 4S3MA 4ZD6A 3ZHXA 5CPFA 2TMDA 3QRWA 4QQRA 4R3WA 3ZZNA 4WEQA 1QORA 4OSOA 2OUIA 1DC6A 3EZYA 4QSMA 5IN5A 4LSMA 1K0UA 4KWHA 3TFQA 7ADHA 1AE1A 1PWXA 5KKAA 4R3NA 5IG2A 1WMBA 2AEJA 2B5VA 2UVDA 3NAQA 1GY8A 4IQ0A 4XB1A 5KJEA 2R6JA 5HS6A 4WNCA 1E1NA 3UXYA 4CV3A 1YBMA 2X0RA 3DBRB 2HMUA 4PLHA 1PQWA 5FYDA 4CM1A 1X1EA 2VWQA 2NQ8A 1VSVA 4LCEA 1FMCA 1KERA 4A0SA 5U1PA 2VWPA 3KYCB 1I2BA 5F1OA 4Q3EA 4ZICA 2G1UA 4E33A 2IE0A 1GUFA 2LDBA 3K9QO 4TRJA 1ZH8A 3BZUA 2GN4A 3TDKA 2IXBA 3PZBA 1P0FA 4U0KA 4Z3KA 4GSKA 3ZNPA 1Z6ZA 1ZMTA 1IYZA 1JKJA 1ID1A 1Y1PA 3W8FA 5BNIA 5J23A 4L8VA 3I3OA 4PLPA 4XRRA 2JD1A 4MIEA 3AM4A 3Q11A 1I36A 2VUTA 2PKQO 3G0OA 1P3DA 5T57A 1NX6A 4IDEA 3VPHA 1CQJA 1YQXA 1I8TA 3H2ZA 4JN6B 5MGBA 2PH5A 1QV6A 1HF3A 2NVUA 3I23A 4F6LA 3U09A 1Y8RA 4HBGA 1O95A 2GUGA 5IXSA 5TJHA 4R01A 1C14A 1B14A 2WE8A 1H0KA 4ESOA 1ZZEA 2NQTA 3TPCA 5JMPA 1NPYA 1NQTA 3U0BA 4CMGA 1ZW1A 4ZA2A 2A4KA 3KTDA 5L7WA 4XA8A 4XQGA 3WNVA 3DAPA 1EE9A 2YHIB 4O0LA 4BQPA 4MIOA 5TGDA 4XJTA 5TRTA 5I8ZA 1B15A 3R3SA 1Q7CA 2BGKA 3NRCA 3PI7A 4XGNA 2X9GA 3QVXA 5DBGA 1X0XA 2AE2A 3E6AA 2Q2WA 3EAGA 2FZEA 1U5CA 1H93A 4F6CA 2C5AA 4FD3A 1P74A 2C7GA 5A5EA 3HFGA 1DHRA 3TNLA 5EQFA 1LLUA 1NFFA 3PRJA 1A4IA 2H9IA 2BHLA 4A2CA 4YDRA 5JBIA 2GZ1A 5TQVA 3LQFA 3H7AA 3U5TA 1E3JA 3FBGA 3SC4A 4RF4A 3E5RA 4UAGA 5JW6A 3BMQB 1PJBA 2C59A 1VJ0A 1QLHA 3JQAB 2VNSA 3WIDA 4DBZA 4EDFA 3EY4A 1DIRA 1PSDA 1Q0HA 4R68A 1M66A 4E6PA 3ZWNA 5KKCA 2DPGA 3HNPA 1HYEA 1D7OA 4OQZA 2HLPA 2J5RA 2O48X 3GMDA 3DWFA 4HUJA 4MP6A 2FSSA 6LDHA 3T7EA 2Y1GA 3RJ5A 1N7HA 2BI8A 4BNKA 4WLVA 3I9OA 3MWDB 3K73O 4YJDA 2GLXA 2Y68A 3RC9A 4FBGA 1XSEA 4YAIA 1N9GA 1YQDA 4BL5A 3K2BA 4E2WA 5JDCA
chains in the Genus database with same CATH superfamily
1MABB 1BMFD 3WB9A 3WLFA 3ES9A 4PG5A 2JJ1A 3RS7A 2YY6A 3AY7A 4DMGA 4AMUA 3CLRC 3F9IA 1Z8FA 1W36C 2FX5A 2DETA 3KOWA 4X3OA 3UXEA 4A9AA 1HL3A 2OFOA 1N4AA 3I6QA 1NVAA 1YB6A 3VUEA 1PKEA 1U99A 5DMHA 2VYCA 4E7OA 5KOJB 1ZNQO 4KW7A 4BE4A 5C1PA 1V8FA 2IFTA 2DPMA 3C7KA 2HMWA 1GFZA 2ZRQA 3K0KA 3R40A 4X61A 3ZVKA 2XITA 4MRSA 3FVQA 3U4HA 1Q1NA 4UNSA 2PL3A 1QGOA 4G1VA 4JR0A 3OG9A 1NPDA 3AH8A 5C7OO 3DMYA 4X20A 1UADA 5KNDD 3F6BX 4ZRDA 3G85A 3HLTA 3NM6B 4KNWA 5KPDA 4KFTA 2EF1A 2CLOB 2QZ4A 2OC4A 1HT0A 1VHQA 3EFOB 2G6BA 2NU9A 2JHAA 4XARA 5EJGA 3ZWMA 5F9MA 5KOYA 1TUGA 4B3FX 4NBLA 2RHGB 3IUPA 4U6NA 3WRYA 1MB2A 3OCVA 4HTFB 3F4KA 1H6CA 2R6AA 3FSEA 4GS5A 4O4JF 5HQTA 1AKEA 2FSUA 3SBEA 4DIUA 4P0QB 4JGGA 4YRQA 2ZVDA 4W1QA 3RVSA 1ISGA 2W2KA 2OHJA 3WMFA 1U9CA 1PWEA 2CKDA 1N57A 5C7YA 2G8NA 1X8JA 4Q66C 3TTXA 3GDOA 9LDTA 2PLNA 3PJFA 2VK8A 3CJTA 3EYWA 4TROA 2Y4NA 3DF7A 4R2MA 3CH4B 1ISHA 3M6FA 4PC1A 5AXDA 4RHEA 3IE0A 4BRSA 2LCIA 1YZNA 1X7XA 2HK8A 2INGX 2X8LA 3K0BA 3OQPA 4IQ8A 2I6XA 3PTAA 1E9DA 2HRQA 4JA0A 3W8RA 4DLXA 2V5VA 3BGOS 2TS1A 1I5OA 5FBZA 5BVGB 1ZLYA 1RM4A 3BWEA 3DFZA 4GI1A 5BYKA 2WWIA 3ZWBA 4HQRA 1FZQA 3O4IA 1R88A 4E2YA 3F6SA 4ZEXA 3OX1A 3N6RA 5DCLA 4ZHSA 1T34A 1Q91A 1TF2A 1KBQA 5EWJB 1ENZA 2MWMA 5EINA 2HJVA 3VH1A 3HJFA 3SJ7A 4L75A 1M5TA 2ZWVA 1WEKA 4MYSA 1QB7A 2C04A 4KC0A 2G5CA 3LUKA 1C1DA 2NZ2A 1G98A 3GAMA 5KAPA 3SFTA 3ZCRA 3RU9A 5KTNA 2IYEA 1PT5A 2P79A 3SYRA 1YA8A 4G5RA 1Y3CE 4P35A 4WNAA 1G7RA 1IFXA 3UPUA 4Q1DA 4RTRA 4BWVA 5DYWA 2AF4C 3HKBA 4G4JA 4HSEA 5TPWA 1OWMA 1P5ZB 4WK6A 5I6DA 4QDOA 4DCTA 3VO9A 3O2SB 1B8VA 3HPQA 4HQLA 1PDVA 1Y82A 1YS9A 2W6PA 1FE8A 2VHXA 2Y99A 2FWMX 3BHMA 3H04A 3PBKA 3PR3A 5AUQA 3OOYA 4ZT5A 2HI0A 5IMSA 1GTZA 3BRWD 3WRWA 4OF4A 3FKSA 4S24A 2B30A 3AL2A 1V7ZA 3ROFA 1W4ZA 1KWKA 4OJYA 1PL6A 2ZJBA 3ORYA 5AKHA 3VKHA 4EHAA 5EWMB 1WXHA 3HYLA 1BQEA 4C20A 1R6XA 4ZO9A 1S2MA 1UJNA 3LYLA 1XFDA 1E2PA 4KUHA 4JU8A 4WADA 2YVKA 1M7GA 3K09C 4IGFA 1Z4IA 4Q3BA 3FD8A 3RS4A 2CFOA 4GLJA 3UMYA 3SDZA 1ADBA 3P9YA 2XJ9A 4ZJUA 2UZ4A 3LX5A 3BTOA 2AKYA 1OMOA 4J16A 4JNKA 4PINA 4GYYA 4Z0NA 1H22A 1A2QA 3RUPA 1X7WA 4GICA 4HRXA 4I5EA 1SVMA 3D8RA 2H16A 4C0QC 4EY8A 4E15A 3GCGA 1CS0A 4BFYA 1ULSA 4JXKA 4MVWA 5ICMA 2FWNA 3T6KA 3EZ2A 3FYSA 3SY8A 5CYFA 4UUNA 4HN2A 1I1NA 2E82A 1EX9A 1L5VA 4ZAFA 1RHKA 1EFPB 2VHZA 4R9UC 3G9XA 2E87A 5B30A 3GPCA 3T9AA 4QTUB 3GWGA 1UPXA 4NFLA 4OP2A 3RVNA 1BD4A 4RH3A 5BYBA 1IZ0A 2YASA 3WOHA 4EG5A 3AFGA 4GM0A 3LMKA 1RRCA 2ZYAA 4B3TB 3TVDA 4N39A 1P7WA 1EFAA 4KUEA 1XAHA 4IIJF 4XJSA 2BSQA 2BONA 4D25A 3UMGA 2I2CA 1M75A 5TS3A 1U8TA 3CKMA 4KHPB 2YZGA 4M1MA 1A72A 3K8ZA 4MUHA 2BFBB 3MHTA 1J24A 4PPYA 2ZIGA 2DQ4A 1E3MA 1XWFA 5DM0A 5FPTA 3RVPA 4G24A 3QQPA 3HB5X 3UJPA 1UDCA 3LKBA 3GMSA 1Q0UA 2YRFA 4RPCA 4YRMA 3N8DA 3WYDA 5BN4A 1CZNA 4IXNA 4WCFC 1KQOA 5JHGB 1GYRA 1P0CA 4JJGA 1E6LA 5FNVB 3VJMA 4WZBA 1E2FA 5DM2A 5H82A 4BE7B 4EMUA 2A57A 2YCLA 4JNCA 1NVXQ 5JEEA 4FWTA 2B78A 3Q3IA 4MV5A 2O8NA 1WXIA 3USZA 3ZXXA 3H0CA 2E37A 2F1KA 3S6JA 1UXJA 1ESMA 1Z18A 4HAIA 4MI1A 4BKUA 3IV6A 3W4IA 2RHRA 3BC1A 2VN8A 1ZOSA 3IBSA 4GRDA 2JHPA 4O02B 3CEHA 4EITA 5EI5A 2ATEA 2C97A 4GI5A 5EMLA 3ESXA 1ZD8A 4X24A 2SHKA 4ITUA 4ROSA 3TNFA 1W0JA 1NYLA 4EF5A 1VJ5A 2ADFA 1AQUA 2C58A 1SBQA 4GBJA 5DEOA 4ENTA 1IPHA 1RAFA 4YAWA 1Y63A 1IM5A 1XQXA 3JQQA 1I2ZA 2VP4A 3WSVA 4V1CB 1WU8A 1P2UA 3R7BA 1JX6A 3D1JA 3OH8A 4RKRA 1O4WA 4ZJYA 3QE0A 5AW1A 1K9VF 1ZD4A 4RVCA 3ST7A 3I53A 3I73A 1YVDA 1RJDA 1OW3B 3EDYA 4M0LA 1BKDR 4CKBA 1P0IA 2PZ8A 1HH4A 1Z4JA 1U2ZA 4JL6A 5IK2A 3LG2A 1R0XA 1XL1A 1GUBA 1ZWLA 1JEQB 2NO7A 2QP4A 3STUA 1FUUA 2B83A 4OLJA 4BXOA 4D7AA 1WZ2A 3JWJA 4K9QA 2HCTA 4JGIA 4F6RA 5TLSA 4WK2B 3D0OA 2WZDA 1YBVA 1OD6A 2VHVA 3OF5A 5IJAA 5ALIA 1W85B 3THOA 2O8EB 1NW6A 3LA8A 3UAOA 3MBIA 4YJ3F 3V4OA 2Q5LA 1OV4A 3I4LA 4BNMA 4HLQB 2QRJA 1P2FA 5SZIA 3QLEA 4OYHA 5J2TA 4D80A 5BWOA 3OQBA 3R3UA 4B3HA 4GAEA 3VHLB 5A2QA 5JC8A 3WQQA 1COWD 1LF5A 3A7EA 1CJUC 4IOLA 4J49A 1MW9X 3A1VA 3MJTA 3S99A 1U5BB 3ZDBA 3CX3A 4Z4QA 2VDPB 4QU5A 3NAZA 5CB4B 1UDBA 2PMEA 5B6JA 4QU9A 2P6OA 1U8FO 3CRZA 3M6LA 5K20A 3ZKWA 3F7TA 3FLEA 1QE0A 4H16A 1PWYE 2PWYA 1C81A 3IIIA 1YBFA 4OOEA 1PGPA 2ZB2A 5FJJA 5BN5B 2QB5A 4XIGS 5KSPA 3T7TA 4BVLA 2GUWA 4LXIA 2NO4A 3CYFA 4PG8A 5KDDA 1WUYA 2EEPA 1UJCA 3CZAA 1DCKA 1TGYA 2D0IA 3E4DA 3N1UA 3P1JA 3QE2A 1IJKA 4AG3A 5IEJA 3PITA 4WOKA 4MB6A 1XUOA 1V4NA 5JISA 1ZXLA 1ZD1A 3OUZA 4NL4H 1LW6E 3R5TA 4JVNA 3UCEA 4UNIA 1JDUA 2Q0XA 3O4JA 3L7NA 3IESA 1WG8A 1SG6A 2G9UA 1ECGA 4JJ4A 4EB8A 4B7CA 3TPZA 4YASA 3G0DA 3KG2A 3PWSA 2VH5R 2X0NA 4B8ZA 4DCCA 1D2MA 4F85A 1H2YA 4LPKA 1II8B 4B44A 1E1QD 2XI4A 5D85A 4O29A 4W7SA 3ELYA 3KEQA 1T3LA 1X1TA 2P8JA 3QYPA 3LXXA 1ZBDA 4GOOD 3SDBA 3UEOA 1DINA 1PR3A 3HVHA 3IGFA 3LRPA 5E6SB 1GXSA 3EXFA 1T2FA 2FRDA 2JGJA 1OLSB 4FGUA 1DCTA 1LUAA 2I87A 2PLAA 3AF0A 5ELMA 5GZ6A 5HJEA 1BFKA 4YACA 2VHJA 2NZJA 3SJBA 3ZW8A 5MDHA 3CH7A 4WNYA 1DQNA 2VQ6A 1NVBA 2C2HA 2AG6A 1YMVA 3LC1O 3N39C 3H9GA 1KZ6A 2ZCUA 1RWPA 4L73A 2GM5A 3GG2A 3BK1A 1XR3A 4TLEA 5J4VA 3W7BA 3GVCA 2BFNA 2PFGA 3HI4A 4MQEB 3R74A 4TUYA 1Z2OX 1IWPB 1ZK2A 1ZNWA 3DQPA 2DULA 2IVZA 4IOJA 3ZUGA 1Y4UA 2DUUA 1M34E 3OX4A 3G0HA 2R79A 4Q4CA 1QRUA 3T7IA 4KQ6A 5HWSA 3IAUA 4D57A 2DPXA 3IXLA 1R5NA 3UB4A 2FEWB 4V0OA 5AK3A 4Z9BA 3TLJA 2ZUTA 3UAXA 1J4AA 3DW1X 1XD8A 4A27A 3VYRB 5JY6A 4BMSA 2E4AA 3DTVB 3UO8B 4O4IA 2BJVA 4D9BA 1NRJB 3OMWA 3UGTA 3PJDA 5A3RA 3OTQA 3DL2A 2A5FA 3AM3A 3TW0A 1DJMA 2DH6A 2J7PA 3D43A 3CW2A 3IQWA 1DKPA 3VPXA 2WWVD 3DOFA 1HZZC 1T8RA 1ONBA 5AW0A 1OFUX 2MYPA 2I2DA 1KMNA 1XF9A 4PG4A 4BU0A 1DP4A 4R1TA 3ZWYA 5CCBA 4S2UA 2GNOA 3H1PA 5AVZA 2DKNA 2LTAA 5CH3A 2BEWB 4P22A 5HRUA 1WEHA 3N75A 4HB2A 3U7IA 2JLSA 4QYXA 4EECA 2Z6AA 5EAIA 5EKTA 2VPTA 3V7UA 5CD9A 4YV1A 3OCYA 1QS0A 1T5OA 5BSRA 2XVZA 1ZM7A 2L69A 4DCGA 2CFCA 4BO5A 5EESA 4CTKA 4D43A 2HCFA 4CR8A 5K0TA 3EDRA 4D79A 5IJWA 2VIIA 1P5JA 2X8BA 3RRZA 1LSOA 1X3SA 2O1EA 3HC7A 3KKQA 4N0PA 4K28A 4QYSA 3OQVA 1KFEB 3U3MA 2GVNA 3RCBA 4JJ7A 3C7CB 1BN7A 1J1IA 5AJTA 4YCAA 4K05A 1ISRA 1Q1AA 2DPYA 2GEJA 3IUMA 4G6ZA 4LYFA 1WDLA 2XA2A 4N0EA 2C7OA 1YB2A 4LRQA 1F0YA 4A0RA 5M2QA 2BC9A 3UGJA 3KLOA 5E4YA 4E4TA 1F9EA 1NOKA 4XM0A 2PGNA 3QPCA 1T10A 4M38A 3NBYC 4IW3B 1QTNA 3DTNA 3PQ7A 1ECFA 2ZJ7A 1M8KA 2Q5QA 3BCHA 3GEHA 1EX6A 1I3MA 3LVQE 1I7PA 4NBSA 2XE4A 3KETA 4MP3A 1IBCA 1N2CE 3TRDA 4ZVVA 1AKTA 2ZRIA 3CNLA 4QD3A 4B6FA 1UBFA 4MUEA 4Z99A 3DBIA 4GGPA 2R5NA 3GQBA 3ZDYB 3OQIA 4J0DA 4F9GA 2NTJA 2ANBA 1WSAA 1ZCFA 2IYUA 3EF3A 3PUJA 2LR0A 1NUPA 3B1XA 3TRFA 3EEQA 4DEXA 4ZZ3A 2OCGA 4IY1A 3GROA 1VJCA 1K08A 2FCAA 1Z3IX 2RSLA 3PS9A 4YLEA 1WXQA 3ACDA 3IHTA 3K72B 5G4LA 4AI6A 2ZJ5A 3IUNA 3SFVA 1Y9AA 2H18A 2UYGA 2WJ6A 1IU9A 4IAOA 2IZOA 5AKGA 1O96B 1VGRA 3Q85A 2Q9UA 1ISJA 1K3UB 1T0HB 2N3ZA 2ORIA 1T9ZA 2XHEA 4G89A 1I3NA 2P9ZA 2RONA 4XJVA 1TRHA 1KVQA 2CC2A 2CVQA 2QX4A 4LQDA 2O23A 1GQFA 5ENVA 3RTCA 1UL1X 2A0XA 2BEWA 3FBWA 5HF9A 4QGSA 2H59A 5BVHB 5ILOA 2C9MA 1JRLA 2F43B 3HGTA 2CNWD 2YW2A 3B7GA 3JWIA 3M6WA 4P4SB 5F77A 4DWJA 1GL7A 2GZHA 3CXUA 3F97A 3EXG1 3SS7X 4Q0MA 3HCEA 1WNFA 3PKZA 221PA 3WX0A 1HQKA 3ZHBA 1GPH1 1HX7A 1VKNA 1OZ0A 2EDAA 3W5CA 1B93A 4X63A 2DTXA 4JJZA 3GGSA 1P4RA 1X7YB 4KR0A 2NUTB 4FB5A 1KDRA 2QTVB 5HXAA 1TO2E 1W93A 1WUTA 5EXXA 1XMQB 3NR2A 1OKKA 4FDAA 4IG9A 4RE5A 5NULA 3NVAA 5I7HA 4QU8A 5HGXA 3LF1A 1CIVA 4N1AA 4KFCA 1IN8A 4XEHA 1AVTA 1J8FA 4O8CA 5KJFA 1SAYA 3DVLA 3COVA 2JF0A 3EH1A 4NYJQ 4OLBA 1DG3A 1F9AA 4MVJD 3VGJA 5IX8A 4QG3A 2E5LB 3MGKA 5E2BA 3ZD7A 1BE8A 3F73A 2Q5HA 3BT7A 3OM8A 4KRGA 1SVSA 2H2GA 3NBFA 3S2UA 2D59A 3TEJA 1ZM3A 4HAUA 3RYTC 1J8VA 4OQMA 4ABTA 1R0BA 1Y8RB 3ZWQA 3MGAA 4K9KA 1BDHA 1SRQA 1NM5A 2YYYA 4GBMA 5EUBA 3ZV3A 5CJJA 2IHBA 2C4TA 1T0PA 4L72A 2ZYDA 4RDHA 1JJVA 1QH8A 1UXOA 1H9CA 1RC0A 4MAAA 2PANA 5HCNA 4YH1A 3X1ZA 3SQOA 2PKYX 4HZUB 4IZIA 1ZEJA 4MYHA 4JAVC 5TVGA 1ICIA 3PQ5A 1GA4A 3ECCA 3R24A 1BO6A 3X1MA 1AMNA 1XZPA 1N2JA 3TM5A 1DNPA 3T3HA 3MMNA 4FCTA 1COWA 1TW2A 1BEUB 4J07A 4F2PA 2P77A 3H65A 5LDGA 4BVEA 5KS2A 3G0BA 1YJ5A 1X7DA 4DSZA 4LSWA 1O96A 2GAJA 1C3LA 1KYVA 3IJPA 2GH1A 3C74A 4R9SA 5DHTA 2WJ4A 5EIAA 2AFVA 4MVJE 4JI2B 1KO5A 1BVRA 1DRJA 1FX1A 1M3SA 1OWNA 3ANMA 3IQGX 3C3EA 1A77A 1Y9ZA 3B1FA 2ZRCA 4ZPXA 1NVFA 3IALA 4H7JA 3EJWA 1HORA 2P9EA 4P31A 4YRGA 1KP3A 1T8UA 4M1YA 3UJAA 1M8GA 1NTOA 3AF2A 2BM8A 1KMMA 1QUFA 3JQFA 3PT9A 1VHLA 1QF9A 4QLAA 4HKTA 3M1AA 4DLVA 1XJ5A 1RQ2A 3I52A 3EMDA 4MTCA 2QTVA 3VAZA 3LBIA 1M34A 3FVWA 4XYGA 1QGED 2EGHA 2XUGA 4K9DA 4LDZA 4MWEA 3FSGA 4ER7A 2YV1A 2QUBA 3U62A 5CBKA 1FFDA 1PFUA 2DTDA 4HMQA 4QFMA 1N77A 5EZYB 5HJ7A 3JALA 5C2JB 1FVHA 2AD5A 2OK7A 2WUVA 3Q5DA 3R3JA 5IKOA 1EEHA 4M0CA 2H1OA 4Y6SA 4G8CA 3EVAA 4JBWA 2V55B 2OB2A 2QLTA 4CM8A 5KX5A 1W4AA 2I2AA 4K40A 2ZJAA 2IYVA 4XAQA 1TK9A 2QORA 5JU6A 1Z16A 3WHLA 3PE4A 2C83A 4XOUA 5BUQA 2ESRA 1DKLA 1HBJA 2NSJA 2XUAA 2DHQA 4YJGA 1MQAA 3VOSA 3G13A 5A3QA 1V7PC 2QM7A 3WLRA 4GWKA 4XWWA 2GARA 3PNSA 3MCWA 1KXJA 1MRNA 1EVEA 1GQOA 2ZW9A 4BWYA 4J7XA 3U7RA 5G02A 2RJOA 3QV1A 4MDFA 4I4NA 1H8EA 3PXXA 4Y2VA 4FTWA 1PRYA 2C92A 3K6KA 3ZOZA 2GZDA 3IVGA 3EGXA 3ZGZA 4HDSB 5JJKA 4U3JA 3H99A 2ZJFA 5KUTA 1E89A 2J59A 2ZETA 3IL2A 10MHA 4WZAE 2VK2A 4G9BA 2LCFA 3D5EA 4LXGA 1RYYA 1CVRA 2GN2A 2ZI5A 3QNMA 3INNA 3A6EA 3STVA 3TSCA 4Y1EA 2WVJA 3TIVA 3AFIA 2OILA 2JFPA 4I36A 4G36A 2BLNA 2MJLA 5E6RA 2I54A 4YMIA 3BCRA 3RVOA 2QE6A 1KS9A 1USIA 1G5PA 4AG5A 1DO0A 4JI4B 3A06A 1QQBA 1D4ZA 1HI9A 2XUHA 1K7EB 5K4AA 5LDDC 2CZGA 4NWIA 1IWBB 1KVSA 1RKUA 5IKXA 3MINA 5B3LA 3WADA 3K92A 1ZKDA 3PQFA 5E4TA 2BGGA 2O59A 1GNRA 1F8FA 3EIUA 3HFSA 4D99A 1F4LA 4UM5A 1C4KA 3EXHC 3A1DA 3HMQA 3LWZA 3AHHA 3ZVRA 3ZHRA 1CJKC 1P4AA 2BEUB 2OKGA 2UYQA 4PSDA 5ICEA 3PNVA 3D6HA 4HH1A 2HEIA 4FZ5A 1VLVA 2A1IA 4CG1A 2ZBUA 1R9MA 4H15A 1NHWA 1MEOA 1C29B 2VAXA 4GKBA 3L4JA 3ZBUA 1FU8A 1E58A 3WZLA 1BJRE 1WCXA 4RJIA 1U2GA 2X1MA 1E66A 3IYLW 1JDTA 2IUFA 2PXXA 3KR0A 3PVCA 4P98A 4CQLA 1QUEA 2XH8A 4RZHA 5I45A 1P1HA 4REQA 1EUQA 4HD8A 1VFPA 3P26A 1PNOA 3P27A 1TVKA 5F5NA 3U3OA 1PLKA 4Y9UA 2CDNA 3KD2A 5AKJA 2X8JB 1P9LA 421PA 3EXAA 2OM6A 4FCWA 3ONNA 2PVPA 1POXA 2WQ6A 3RHZA 4DUGD 2JCYA 4H7IA 3LBNA 1WRBA 3HWWA 2JJYA 4BO3A 4UEKA 4XWOA 4WERA 5C5IA 5JROA 4U5QA 4CKEB 5FWNA 1BGWA 1N5IA 4MKIA 4P33A 4QUBA 4AJIA 1IOVA 2POCA 3FYUB 4AZ0B 4XYLA 1YI0A 2IPXA 2REXB 3CF2A 1UJMA 3ASZA 4S1OA 1RC8A 2JIBA 1T1EA 2G9RA 1S8OA 2F1OA 4KPUB 2N1MA 3HXLA 4BP3A 2IEDA 4CI0B 2GWRA 4EI2A 3LU1A 2YY7A 2FKAA 1BS9A 1ZI9A 1E1KA 3BTUA 4TX1A 4LHXA 4DANA 4ZWNA 2Z6VA 4C6TB 3QU5A 4YRKA 1EX1A 1PZGA 1J8YF 4H17A 2DHEA 4LVNA 2JCSA 4OXIA 2IP1A 1D1PA 5EJAA 2C4WA 3KAKA 3BXFA 3SD7A 2XD9A 3ESAA 3TTWA 4PGMA 4KG7A 1ISIA 4FGJA 3UMSA 4F1JA 1RXVA 4R71A 1T25A 4RD4A 4O33A 1CSEE 4RFSB 4WL0A 3DM5A 1VLQA 5JS1A 2OZEA 3RANA 3RPEA 2CJYA 3V1TC 3WLOA 1X9IA 2H1SA 1L4UA 1HEYA 2VA9A 4HYQA 3RK0A 4LJ6A 3BKXA 1VL6A 4MUFA 1P7PA 1AZSC 4N8EA 2VDVE 4PZDA 2NZWA 4BVFA 5MN6A 3JWEA 5AWFC 4FLMA 4I55A 3GVPA 3PDIB 4RADA 3HFJA 3SYLA 3LT2A 1MIHA 5BOVA 1NBOA 1HC7A 1M2HA 3BD9A 4ND4A 5BMVA 821PA 1XEWX 4MWOA 5L7YA 4A23A 2F00A 2OZLB 5BSHA 1WIWA 1KK3A 3IAS1 4X1KB 4IDNA 5J5CA 1E9FA 2DBVO 4FC7A 4L16A 3ENWA 1DZIA 2JLRA 4NS4A 4Q7MB 5IJ9B 3H3JA 2PE5A 4RELA 2HB6A 3AEQB 1JWBB 5FV4A 3F5FA 3ILSA 3K4PA 5CURA 5JS6A 1NU8A 2PYIA 4EPVA 2PRZA 2B9EA 2HMSA 4JLOA 2UKDA 3IDAA 5MGNA 1O08A 3BKWA 4CNBA 3L8YA 3G1TA 3VSBA 4RTMA 2J4CA 1IHYA 3B9QA 1Z0JA 3QKSB 2Q8QA 4BQOA 5KTMA 1C7EA 4KE8A 5F3WB 4LWPA 3P9NA 2CK3D 1I5RA 4BGEA 4L6AA 1I1HA 1NN3A 3FX2A 2VXBA 1FL9A 5L3QA 2AJTA 1ZI8A 1Q7TA 4NMLA 3ZLVA 2ZEJA 4DLUA 4O2BA 4Z9AA 4AU1A 1ZQ1A 2Z09A 1GQSA 2J7KA 4N9WA 3VFDA 1T4CA 3VR5A 1RRFA 4FFDA 1C9DB 3NG1A 2R65A 4GXNA 1OHHA 3ICEA 1JPNA 1MO5A 3A4YA 3ODGA 1HDRA 2FX2A 4DUPA 2BF4A 3IEKA 5D01A 1MDBA 1JS1X 3DDHA 2BFOA 1EVYA 1D2RA 1P61B 1Q0SA 2ZANA 3AIMA 4KWCA 4R8VA 4TS1A 1MQ8B 4EW2A 2TMGA 3PC2A 3VA7A 3LLCA 1BKYA 1JIUA 2I66A 4PAQA 4PHFA 1XZQA 3GRCA 2B37A 3NHAA 4KPGA 4RENA 1KFJB 2DTEA 2W90A 4HF7A 2XT0A 2VNAA 1WL8A 1O94C 2QTTA 2P7HA 3DDOA 5I7WA 4FFSA 4D9IA 1OZAA 4LRYA 1R15A 4RDIA 2D8AA 3EHDA 3JQ7A 2B25A 3LVRE 3RJZA 1L4FA 1SOVA 3M0EA 3GZNA 4AS1A 1JXOA 1RHQA 3GFRA 1DTWA 2VYFA 4HN4B 4IRMA 4KKXB 3ZN2A 1GLVA 2XYVA 4YP6A 5ICSA 3GT3A 4YMUA 5JLJA 3RHTA 1JR3A 4W8HA 4ZI7A 2B5OA 1GFIA 1YNSA 3D31A 1NBMD 3S40A 4H1VA 5JIBA 3FTFA 4HAZA 5KREA 2KHZA 3E7FA 3DZIA 3WO1A 4WZAA 3FDXA 3ZDAA 1H0RA 2DFNA 3NIGB 2ZJ8A 4BO2A 3G68A 3HGQA 4ND8B 3Q2OA 5M3BA 5CXUA 3T4EA 2IYOA 1PS9A 4RD6A 4Y30A 1PJ4A 2O1SA 4P4GA 5AMXA 4OA8A 3U48A 1KY4A 1GO2A 1ZBQA 3KQYA 3OZUA 1ZGGA 3YASA 4F4DA 5L4SA 3E58A 3QG5A 1YIAA 3CFYA 4MJLA 1SWWA 1G2OA 2NMVA 3COYA 1O54A 2QXUA 4NBTA 3SC2B 2FFHA 1PEDA 3KV1A 4F8EA 2KMLA 3BD6A 3VRHA 2PBRA 1DU4A 5CYPA 5IM4A 1ID8A 4ZRNA 4Q47A 3O3OB 4BMNA 4YCSA 1JF8A 1AO0A 2AUTA 3TMKA 5U4XA 4P0PB 3AEUA 1Q11A 1RIFA 3PDCA 2FJUA 3VX3A 2AHOA 3ONEA 1TVMA 3VV3A 1NBME 2VATA 1K8RA 1ZK3A 4Q34A 4LYHA 1XTIA 2WT8A 5KX5F 1AV6A 2GCPA 3BN3A 1GCOA 1KMIY 1CWUA 3SHQA 1K66A 3IJ5A 2AH5A 2FUKA 2WOOA 4JDPA 4QFDA 4XQEA 2QBYA 2EBFX 4K3VA 1Q57A 3EK2A 1ZY2A 4TTVA 2DU8A 3ZHZA 2BFAA 5K8CA 1P9NA 3OA2A 1LW7A 3ETLA 2G5PA 1JIJA 1NGSA 1VE6A 3GYBA 5ALSA 3D59A 4D9CA 4BB6A 4E32A 2OHOA 2FEAA 3QA3E 5C51B 5DK4A 4HHEA 2H00A 1K89A 2W70A 4ZV9A 4YGYA 3GLHB 4MCAA 5BNFA 1UPAA 1YH3A 5DP1A 1IQRA 3M4JA 5CDGA 1VHTA 2X9LA 1FSGA 2ZWOA 3VHXB 1TEHA 2WB4A 4PZLA 4CZ2A 4IIGA 4ZV4A 4CIAA 3UOWA 1ADGA 1G8JA 1SK9A 1M2VB 3PEVA 4U39A 4XD7A 1DG1G 2PX4A 1BE6A 1IDN1 4CHGA 4GOJA 1Z2CA 3AR3A 3RC9A 3STHA 2Y0BA 3L6UA 4L8FA 3O5AA 1GD1O 3BOSA 4EMSA 3GJ5A 2CL7X 4J6EA 2J5BA 4BMCA 1UWLA 3D0RA 4U63A 5TC4A 2F59A 4ND8A 2BMFA 3H1TA 3QG1A 4R84A 1TJ3A 4ENSA 4ZYVA 5KWEA 1FNSA 1U3GA 4NYJR 3TEMA 1GIAA 4J9VA 3W8DA 2UXCB 4HYYA 2VDKB 3GW8A 3NC4A 2C2XA 3P2JA 2QNRA 4PLVA 5HMLA 1KK1A 1AS0A 1II0A 2QSZA 4KVGA 2A3NA 3F71A 4MW5A 4KXQA 1BCRA 1Z6YA 4YCCA 3DLPX 3SHFA 4RD2A 4XIFA 2IS6A 1N6IA 5E6UA 5LLSA 2FOIA 4PONA 2A92A 2GI4A 2OSBA 3CUTA 5EJ4A 4TMTA 2IHYA 3A3NA 2B4AA 2HUPA 2OVBA 3FCCA 4RTLA 4KLRA 4F7DA 4BWFB 3RYCA 1FPMA 3TKLA 4NYIQ 4B40A 1OH7A 1MR3F 2NNWB 3T1QA 2FPOA 4YFVA 3QWAA 2FP4B 4LSGA 4L4ZA 4XX0A 1K7CA 1OXTA 2G17A 2GKSA 4RPIA 1GUYA 5B37A 5SZHB 3UGQA 2PKXA 4J4BA 4JQSA 3QH4A 5FLEX 4GF5A 4L74A 4M7PA 1AUXA 4MYUA 4YT4A 3AXTA 1DXHA 3QXGA 4KR2A 5FL7A 4PEVA 3U49A 3G8CA 3K0CA 2WU0A 1UC8A 2W2LA 4KE6A 4F4JA 4DDVA 1V37A 1ZITA 5BSKA 2PSJA 4E1AA 4M0KA 2FG6C 3QXCA 4EL5A 1OT3A 2G06A 4URWR 2B4KA 3ISJA 2IU3A 5FQNA 2ZSKA 1CRLA 1U2QA 1E9SA 1W581 2B6HA 1C1XB 2GNAA 2JBWA 3HVIA 5CYOA 4RIGA 1NNI1 5LC1A 1BW9B 3O91A 1EFCA 1OIVA 4TSFD 4C2AA 1CRWG 4DSTA 1DJLA 2N1BA 1HTBA 1Z8HA 1AGXA 1Z4KA 2WEKA 3U26A 3Q87B 3AUAA 1EGAA 1CD5A 3ZZ0A 5KIAA 2V6BA 3B3FA 3FGPA 4OPMA 1G9SA 2YJZA 2P5TB 1P39A 3GH1A 2JFYA 4RSMA 2QVYX 4TYQA 2GM9A 3O3NB 2H11A 1U31A 1QIDA 4M7WA 2DBYA 1MGPA 4ITRC 5LYJA 3ZK9A 2AHRA 2W0SA 1G16A 2WUGA 3S8MA 1UM8A 3Q6MA 3HKEB 4PF1A 4GX5A 1AKYA 4L3VA 2IYQA 1XP8A 1Y6FA 2G4VA 2P90A 4PANA 5IANA 2IWRA 2QRNA 3N8GA 4FFPA 2P2DA 3JU3A 4XVQA 4EOGA 1JA0A 3ID6C 1BS2A 4DNPA 1KI4A 1SC9A 4TVOA 2AZDA 1R00A 9GPBA 1FW6A 3T4PA 1C7IA 1QB8A 1QDEA 1Y6ZA 2FRXA 3PHJA 2AN4A 4OJMX 4Q1AA 4Q1BA 1W35A 2CHVA 1O95D 2IZ7A 2D06A 2DRIA 2TSYB 3TNJA 4R1LA 1U7WA 1Q6YA 4NENA 3DLHA 2FR1A 2V7QD 1YZLA 2Q6KA 3UW1A 4MR9B 1DOHA 2DVMA 3R2JA 3VDMA 2XQJA 2NUBA 1X19A 2GHQA 2Y0EA 3DZ8A 4LZOA 1QOZA 4EAQA 1JLSA 5C53B 5BW6B 3RVLA 3KLBA 4NCBA 3EXIA 3LCVB 1FYFA 1QP8A 1XWIA 2ZE7A 1ML4A 1X13A 5AHRA 2UYOA 5FBQB 5JXWA 4RYDA 4HDNA 3PE3A 4MJXA 5LSAA 4G1FA 2JB9A 3U4DA 5CDSA 1SXQA 4X1OA 5DBIA 1DBSA 4FN4A 1EEXB 3DVSX 2O8CB 1H2BA 4RLQA 3ZH2A 2RD2A 4HAOA 1U5AA 2TYSB 3AT1A 3H6GA 1N1EA 1YU9A 4LC9A 5BMVF 5TF0A 4G97A 4BNNA 2OOKA 3CSDA 1UIMA 3OQ1A 5LP6B 3GN1A 4L6IA 2QAGA 2HRDA 1AKQA 5JAHA 3EPHA 1ZR4A 4NU5A 1L8LA 4KAXA 1E0AA 2HYDA 3E0QA 4NESA 2ACEA 1M5UA 2EX0A 1K4YA 3GZJA 3NPMA 3NWJA 5DU2A 2YXDA 4A92A 5A6SA 5LJIA 4ZT3A 2DERA 1QO0A 4KH1A 4B3CA 4BP1A 4AN1A 5CXQA 3U44B 2WVHA 4XR9A 1YR8A 1Z6PA 3H9CA 1VJ1A 3AL3A 4QLBA 5JBNA 4AJHA 4UMFA 4CUZA 2ZAMA 3AI7A 4XSHA 2GKGA 4CMKA 1EK5A 3MTIA 2GNPA 3KPJA 3WR5A 3AVYA 4FOPA 4DM7A 1VA4A 4KBYA 4KQ2A 5I47A 2XYPA 1EM8B 3OPVA 3VR3A 3H8VA 1ENOA 2ZBRA 1E8MA 3LS2A 5BN1A 5KTKA 5ECWA 1CUHA 4M8LA 4HFRA 2QPTA 2C3OA 3EEOA 1KJNA 3JQ6A 4O2BF 5AQEA 1LK0A 2R62A 2PXCA 2QE7A 3KYDA 3PNOA 1WJGA 4OGWA 4NNJA 5M34A 5KPJA 3NEPX 2Q46A 3IV9A 1BDIA 5CTAA 2EERA 2O52A 4O2LA 2XMCA 1ONPA 5IUKC 4LY0A 4WCDA 3LO8A 5EIBC 1W4RA 3DA8A 1IUOA 1QYXA 5LNK1 2I8LA 4OCZA 2XYRA 3OLYA 1UOPA 2XDQB 3EZ9A 3QBDA 1RLTA 3VHRA 1TVEA 1U0GA 3PR2B 3UIEA 4B6SA 1C3EA 1WD7A 3KR2A 4WOPA 2LP4Y 3KZ1E 5DYGA 2FPMA 4FR5A 3RAEC 3OQOA 2CVHA 3PYXA 4NK4A 1EUDA 4X7PA 5I01A 3PDHA 1QIGA 3B89A 4R7TA 4OI4A 3UAWA 2HLHA 1JFSA 1KOJA 1L7DA 1I7SB 1FNBA 1MAUA 5ABPA 4NPHA 1PF7E 3GCXA 4LIPD 1LTHR 2VC2B 1ZXBA 4F8JA 2HGZA 2XZPA 1TUIA 3MN1A 5D51S 5GV8A 4A0FA 2SKCA 2W2XA 1LF0A 3HCPA 3I45A 1VCIA 1IHUA 1FP1D 1BGVA 2NZYA 4R2KA 5CCDA 1R6VA 1T9GS 1ECCA 1Z74A 2OV8A 3OE1A 5D3ZA 5AXBA 4ZI7F 5GADl 3WGJA 1RRGA 2O2CA 2CDRA 1JQ5A 3LIPA 3KXKA 3AJ9A 3EIEA 1T36B 2JDID 4GVLA 5CDYA 1EUCB 3AV0B 3JZAA 2GXAA 2J67A 1WSWA 1W4LA 3NH9A 3I8SA 3SKYA 2VJBA 2VWGA 2XUKA 1TF5A 5J2UA 2PH7A 1NA5A 2SKEA 4GYJA 1VXOA 2GWHA 1KORA 3RF7A 5DIFA 3FETA 5TSDA 4EHLA 4KIWA 1B7GO 4L0MA 2G25A 1WCV1 2Q5OA 3L6OO 4FQ7A 4BKRA 5L3SA 1BCSB 3VO8A 4D9NA 3SVTA 2EG9A 1J07A 3BWCA 5C5EA 1NW9B 1LDMA 3R5KA 4EQ6A 3P96A 1IAVA 3HCCA 3TSAA 2QTBA 3LDHA 4EG8A 5ITZB 1CF2O 1ONOA 3H9UA 4U6QA 3B9RA 2I6UA 1E1CA 2IUUA 4UD6A 3A2KA 2VVTA 3BF7A 1BH6A 3ME5A 5DWVA 2E5FA 3LBHA 3M1YA 4OJQA 2IPMA 2C1XA 4FW9A 2W7TA 3I64A 4YR9A 1FBTA 2VXOA 2NO1A 1ESCA 4NI5A 3IURA 4X3PA 5AI8A 1F4VA 3MQ4A 3VR0A 2KSQA 1OR8A 2LD4A 2EQBA 1NUUA 3RSLA 3FE2A 2HOQA 1UBTS 2E85A 4K2HA 3EF1A 1CG6A 3A1WA 2QI9C 2PU7A 3I6MA 3A6ZA 2ODTX 4UAUA 2HUNA 2W11A 4J0FA 3LY8A 5JC1A 1GTRA 2PRJA 2B5WA 2UZ3A 3ISTA 1THGA 2FEOA 4JHXA 3N8HA 4JOBA 4K88A 2CLLB 4LRXA 4TQUS 2A7QA 2D0PB 2D1YA 4ESEA 4XQCA 1B2RA 4ID9A 1C41A 1HTTA 3AQIA 4MLPA 1UBNA 1XVIA 3FUXA 1T2NA 3GXOA 4URZR 5FI1B 3C7AA 4H6XA 4XUGB 3W6ZA 3K71B 1XPUA 5CGQB 5DNVA 1XYGA 1LBSA 2OCIA 3W4KA 3H3FA 3CE9A 5COAA 4EF6A 1BH2A 1ZNZA 2Q2VA 2PRYA 4EJ2A 2GN6A 4YJ3B 1WPQA 4FEGA 4WSOA 4EDHA 1EYZA 1G66A 5KVVA 1L5QA 3LWBA 2MYUA 5ER6A 5SZKB 3KUXA 1HQDA 3QI7A 1UUFA 1GGMA 3T3IA 4AO8A 4FHCA 1NQXA 1TKBA 4MRRA 4E14A 1FRZA 1KAQA 2P2LA 2Z08A 3L6EA 1JYSA 1L4MA 3ZPXA 4FYWA 4QEKA 3QVOA 1O6BA 4QRIA 4FXPA 1O9GA 1JXAA 1A7UA 2R751 2D2IA 3DAOA 5KSWB 2QQ0A 4G1MB 1J06A 5IZCA 5CDTA 1L5SA 2O0HA 2FWJA 1KEPA 2XA1A 4UOZA 1N5KA 4Z1MA 3AWDA 2MINB 1RC1A 1S0UA 2ZQZA 1TLLA 1YCDA 3G2OA 5I9BA 1XBTA 3WBFA 1DG9A 1KQPA 3FN4A 4DIEA 2Z5FA 1T8WA 3C3BA 3HR8A 4DCUA 1HV8A 3GARA 2WIBA 4FFOA 2X0JA 2TECE 3AZPA 1CR0A 3OJOA 1P1FA 4H7EA 4RJ2A 5GGYA 4E94A 5LOVB 2VUSA 1EFKA 2GETA 4XGQA 4XGKA 4ZGGA 2HPVA 1ZJ4A 3LPDA 3PUXA 4OQFA 4ZEVA 1MHTA 4MR8B 2J9FB 4ZK2A 5CDUA 2ERYA 4EA6A 1BFDA 1I4DD 3UMFA 2KI5A 3N0RA 1FP4B 1MB4A 1TEVA 1LBHA 4GE0A 3BB4A 4XTRA 4DSUA 3HBMA 1XA4A 1WZCA 5EN4A 4DCPA 1YMQA 3K15A 3MMXA 4XYBA 1V11B 4WKCA 1WW8A 2PRSA 4F3KA 1JG3A 1DDIA 4ENWA 4ZU3A 1Z15A 5IH3A 5JMOA 1EHYA 1FXWA 2FK7A 3PGVA 5AKZA 1NSFA 4JQCA 3SAJA 5DJ5A 1ZPDA 5DTQA 4B32A 1SUIA 1R4ZA 1KH2A 2HQSA 1M7HA 3FNHA 3B20A 3O90A 2C1ZA 1R10A 1TA4A 3GAFA 1NXWA 5ALPA 2EV9A 2ZJ3A 3NATA 4AJPA 1TB4A 4OXNA 1QYWA 4YMLA 3UPTA 4GPBA 2FEKA 1JVSA 3CZ4A 2YXBA 4R2HA 1AN9A 2AFIA 2AWOA 2DUJA 3RS8A 3UMCA 3WZMA 3AKEA 3B5JA