4DAGH

Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
220
structure length
220
Chain Sequence
b'EVQLLESGGGLVQPGGSRRLSCAASGFTVSSSYMSWVRQTPGKGLEWISVFYSGGTTYYADAVKGRFSISMDTSKNTLHLQMNSLRVEDTAIYYCARVLSRASGMPDAFDIWGPGTMVTVSSASTKGPSVFPLAPSSAATSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fusion glycoprotein F0
molecule tags Viral protein/immune system
source organism Human metapneumovirus
publication title Structure of the human metapneumovirus fusion protein with neutralizing antibody identifies a pneumovirus antigenic site.
pubmed doi rcsb
total genus 33
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2012-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dagH01
2O5YH 2EDDA 5JOFB 1UEMA 1FLTX 3NCJL 3NFPB 5GGVL 2DLHA 5I8KH 3CXHJ 4LARH 3L3JA 4XPFH 2VDQL 1I7TB 3DSNA 4X80H 3FB7B 2WNGA 4MLSA 5MERA 2R1WB 3LSOA 2FATL 3RA7H 2BVPB 3DBXA 4KV5F 5FHBH 5HDQL 5L2JA 4JFZL 3D87B 3HC0A 3QCVL 2EC8A 1IC4H 5E9DA 3PG2A 2OR9H 4LSQH 3P30L 2FD6L 3KG5A 5CEYB 3SE3A 2NTSP 4M6AA 5HYSG 1EJOL 3PHSA 4R9HA 1KCRH 1KCVH 4N0YL 2C3HA 1DCLA 4JM2C 4QEGA 4LEXH 3UJIH 3P11L 4Y5YB 3A6CL 1QYGH 3CH8A 5DZOA 3I6KB 4L8DB 5ESAB 4HWZB 5GGSY 4N8VB 4NO2B 3QWRD 6CGTA 3DNKA 2AJZA 3N1QC 1CZ8H 1VADB 2VQTA 3OAZH 5CBEB 5I8CA 2FJFB 1EZVY 4GRWH 4ZPVB 2QQLH 3QWOB 5AEAA 5INCB 3VXQA 4DGIL 4YBQD 3TN0D 4M61A 4BK4A 1MFAH 4XMPH 2ARJB 3ZMRA 1YEEH 5GSVB 1JBJA 3GRWH 5FOBB 3CC5A 3WBDA 5EO1A 3RUGB 3VFOB 4OCLC 4XPBL 2B8OT 3OL2A 3SN6N 5CIPH 4M6OH 3VRLE 2O26U 3MBXH 3G6JB 4PLOB 3QUKA 2R15A 1A6PA 5J1SC 2A0LC 1T21A 4P0DA 5CP3A 3PWJB 4N8CL 2PW1A 4TTDC 2BVQB 3RY6A 4GMSL 2DB8A 4CVZB 4XP5H 4MD4A 1JPTL 2ARWA 4OB5L 4P2QB 5GQBA 5I1CH 4PJHA 2ZUTA 4OFKA 4YQXH 4LLWA 5T3XE 4XHJC 5GS1A 2WIIB 1U3HB 4PRAA 2M1KA 4UB0L 4G9DA 3SBWA 1KEGH 4GRLD 3OKOB 3DX8B 4TVPD 4KV5E 5B38A 1RJZB 4M7KL 3T0VA 1LO0H 1QRNE 4GH7B 5EN2A 3MV9E 5DD3H 3V0WH 2HFFA 2H8PA 3T1FB 5DSCB 5CHNA 3FOLA 4NPYA 3EW3B 3K8LA 1YNKH 2R29L 1VEMA 1W72H 4Q6IA 4PBXA 4GQ9H 4PJ8A 4BH7B 4V2CB 3N9GH 1X6NA 1VGEL 3MV9B 4E0RB 5IHUH 3ZKMD 3WFCH 3MLZL 2PTTA 1NFDA 2PR4H 3ARGC 3EYQC 5K9QI 1AIFA 2Q7NA 1OPGL 1DBML 1FPTL 4B7IA 4R4ND 5E7BA 5EO1B 3TT1H 4X7FC 3WXVL 3LRHA 5EO9A 3TT3H 2VYRE 3OKKA 2E7LC 2EDKA 2R56H 2R1WA 3BPCB 4JREB 4MSWA 3MYZA 1I1RA 2VOTA 3ESVF 4EI6A 3HRZB 2E9IA 3H9HB 1HILA 2VDPH 4LNVA 3GUTA 2EDYA 4J1UA 5DO2D 4EKXA 3RPIB 5AUMB 1WBZB 3WNMA 3FQTB 1XH3A 1UM5H 2GCYB 5KVGL 1NH6A 1LK2A 1UC6A 2Y5TB 3GMOA 3T0BA 3C6SA 1JZ4A 4PRHA 5F9WC 3NIGF 3V9FA 5DFWH 4M7LH 1WAAF 5IIEB 4HKBB 4E5XB 4DVBA 4R90L 1ADQL 4N8VA 1LDSA 1M6OB 1DUYB 3WJLC 3O4LD 1R5WA 5B4MD 3QI9D 1LEIB 3F7VA 1KACB 5I1KH 1OB1B 2D31B 1DN2A 1U42A 2DIBA 2VL5B 1N59B 4C83B 3PHQA 2AJSL 5F1NA 4I0PB 3NFNB 4ZPTA 2VC2H 5KG9A 5C0BA 2QADC 1IGTA 3N1PC 1RUKH 1JGDA 3IDNA 1XCQB 3I3DA 1HIML 2OMNA 5IQ7H 2CDGA 1XGTA 4OZGF 1GPOH 5DJDA 3GJFB 4FQIH 4O2EB 1DDHA 5JZ7C 3VXPB 4U3XA 3QBTB 2RGSA 1IAOA 4GXVH 1E27A 3U0WL 2JCCF 2IADA 3A6OA 2JJWA 5BQ7B 1YQVH 5BS0B 4WEUD 5JOFA 1AR2A 1CGTA 3T8XA 1P5UA 3MV01 3ECBA 3T2PA 4ZYKB 3KPNA 1HHKB 2EE6A 4NKIL 5DQJB 1RIUH 1FFNA 3BVNA 4GAYB 1C7TA 3GMQA 4OV5A 2DQUL 5EBGA 3MRNB 2VWEE 3W11C 3JWOL 3L3KA 4F37K 2DD8L 4ALAH 4Z0BL 5FECB 1UYWH 4HPOH 4BK5A 4M5YL 5H94B 4NGHH 4KGLA 4DTGH 1N0LA 3L95A 3B4NA 5IFJA 5FO8A 4G9FE 4HIXH 3RVWD 5JO5A 5MP6H 3ULUL 5DEFA 4CRPA 3MLSL 4ODTL 5EIQA 5F7HA 4GG8A 3PWNB 4S11A 4PJXA 3REVB 2P46B 2V2XA 4NC2B 1T83C 4H8WC 3CVHH 5DRZB 4HKJB 5TH2B 1EUUA 2DQCH 1KJ2A 4OZ4B 1T5XA 4HX1A 5IB2A 3LKSB 3HRZA 3RY6C 4C58B 4OZFB 2Y72A 3GBNH 3VMOA 1IM9D 1WCBB 1KIUA 4K9EL 3ZKMC 4J8RB 4Y19D 1WFTA 4P2RA 3IVKB 5IESH 5TF1L 1CGSL 3SDAD 3IFPA 3MRLB 2I5YH 4PIRF 1MFBH 2NNAB 1IKNA 4NM4H 4OGXL 4HG4J 1EH9A 2VABA 4UUJA 4ZD3H 1M71A 1WTLA 2VL5A 3U7WH 1RUML 2PYEB 3SE9H 1G7PB 4PJEA 3VCLB 4HJGB 1P2CB 3TPUB 3L6FB 2A6IB 1MHCB 4Y4KB 1T89C 5TDOA 5E5UB 3RBGA 1L6XA 1FO0H 4HUXB 4RAVA 1AHWC 3H9SE 3X3FH 1MCWW 3SOBH 4WUUB 5IW6B 2OJZH 3U7YL 3FKUS 4NQDB 3HFML 1WAAE 3EDFA 3DX7B 4GBXB 3RWEA 5DRXA 3SDXA 4M1DH 5TQ0H 15C8H 3VXPA 1AJ7H 4ZPTB 4A2LA 2XPGB 4C56B 2BP3A 2EH8H 3WKMH 3ZE0E 4OLZH 4KK5C 3QQ3B 3EYUL 1VFAB 4NFCA 1U8KA 2DQEH 2V5RA 3EYSL 5MEND 1YJDL 3H42L 4GRMB 1GGYA 2V7HB 4WV1A 1FNHA 1AXSB 3O6ML 2MCPH 3B2UD 4H1LB 5SWSB 1UA6H 1GCFA 4ZOEA 4N0FB 2GUOB 4PJEF 4H0HB 4HEME 4PJIE 1DVFA 4HUKB 5E5RB 4S0SD 3FTGA 4BM7A 4RIRA 5FM5O 5GPRA 4LPXA 1TNMA 3RFZC 4PJFF 4QXTA 2YA0A 5FCUL 4FQCL 1G9ML 4EDXA 5GS3A 4QXWA 5A3IC 4XNMA 1QZ1A 4ZMAT 2DQIH 4WFGE 5LG1A 2W9DH 2C26A 4BH8A 1VKXA 3GUTB 1BD2B 1NKOA 3VFNB 5JIPA 4PJXB 2YUWA 5D9SA 1CIDA 1KV3A 2Z31D 5D7JC 2ZUUA 4E9LA 5F88A 5J56B 5MEOA 2LVEA 4AENB 5JO5B 3NZHH 3GJEA 2HRPL 4XP6L 1EZVX 1W0WA 4WV1C 2HP4A 3UO1L 4BFBD 5C0IA 1MHHA 5H37H 4AG4L 1MCOH 2RR3A 3VXRE 1FNSH 1ORQA 2O5ZL 5DMKA 4JM2F 1OF2B 2A73A 2ED7A 1QLRA 2QHRH 3VJ6B 3EIFA 3PABB 1MPAH 3S96A 3E2HC 4KI5C 4PJAB 4EXKA 1MELA 5SWSA 5IOPB 3C08L 1VHPA 4JCLA 4LEOB 2JJVA 3CFDA 3JZ7A 1M7XA 3QIBC 4PJXF 1XF2B 1H3UA 4KKBC 2AXHA 3BMVA 1FYTA 3MRIB 3L3IB 4WJ5B 4FTVD 4JANA 4MJ5B 3KNBB 4YXLH 4L29B 4RISH 3CDCA 5FO7A 1W0YT 1XIWC 1SYSA 2J88H 4QHUB 5F96H 5KAQG 2OJEA 3HNTH 2RBLA 4L8BB 4ESKA 1RK1B 1FE8L 1L6ZA 1A2YA 4MS8C 4NNPH 3TN0B 2CRIA 4OF3A 2NX5A 3W2DH 2GI7A 1B0WA 1NAKL 3VXUE 5JPMB 1ZA6A 3ARBC 4WI4A 1NC4A 1I7UA 4H0GA 4BQBA 3D1MC 4XGZA 3WFHB 4XMLH 4U6TA 3MGTA 4LCCC 4NQCE 5DEGB 3ROLB 2J6EL 2ZJSH 5C09A 4YDKH 1HOCB 5DRWB 3BUYA 3MFFA 3FRPA 4HMCA 3TGXA 5FYLH 4XP6H 4J6RH 1FQ9C 5F7KC 5CD5D 3MBED 5KANI 3TNMB 5E6IC 1SY6L 1KTLA 1QBML 4R26L 1GZQB 5GHWH 3RZCD 5E08H 4HCRL 2ATKA 1DN0A 4YHYB 5DLMH 1FZKB 1T2JA 2I60H 3T2NL 1QHPA 4KI1A 1HE7A 3QO0A 5ENWB 5GJSH 4P23A 5D70L 1P4BL 3S5LA 1IL1A 3CFEB 2V5TA 5DQDH 1A4JB 2VDLL 1TTFA 5F9AC 1H3XA 4QLRA 3WIHL 3NACH 4QRPB 2FEEI 4P2RB 3IVKA 1T6VN 2J7LA 3ARDD 3R8BB 3QUZC 1YEJH 5ADOL 5MEPB 1OAUL 5J6GA 4DN4H 2X1PA 2L7JA 4EI5B 5HYSB 3RVVD 25C8H 1DTUA 1KIRB 1NFDF 1R3IL 2HFGH 2IQ9L 3BQUA 4UDUA 3L7EB 5JW3L 3LN5A 2AJZB 3BT2H 1GGBH 1X7QA 5CUSL 3C8KB 1KJMA 4Y4HC 4KVCH 4PJFB 2R2HB 2MMXA 4GXUN 1GGCL 3FONA 4WO4C 5DRWA 4OLUH 2YUZA 3H0TA 4N8VG 3WUWG 3QULA 2AJVH 2F19L 3W82A 1AFVL 4Z77B 4PJGE 4L29A 2ICWA 1NMBH 1BQHG 3VD5A 4HGWA 4MJ2A 5DUMH 3MV9A 5SWZD 3AY4A 4MA8L 4I4WB 4TVSa 4RFNC 5EULV 1PQZA 4WNQB 2Q6WB 2A2QT 3V6FA 5CHNB 3LPGA 4XBPA 3SE9L 2BMKB 3VXSA 4PGEB 3G6AB 3TO4C 5ANME 5HHNA 5HD8C 3PWJA 3O3BB 4OKVB 2GY5A 5F7WC 4TNWF 4ZD3L 5M94B 1REIA 5FKAB 2I5YL 4P2CG 1TPXC 1CGSH 2XRAH 4X4XB 5A16B 4NO5A 3PGDB 1ACZA 4K9EH 2D9QB 1P5VA 1XGYH 3BPLB 4BSJA 1UGNA 3GBNL 4QHMB 4V1DD 4ZTOL 6FABH 1TVHA 2GAZB 1CR9L 5DHYA 1PZ5A 1FIEA 4L4JA 2F8VA 3G5VA 4ONFL 4ZOCA 2F8XC 1F4WL 1F02I 3ILQD 3KPPA 4MSWB 1NC4B 5D7LA 2ATPA 2R4RL 2FEDC 2ZKHL 5C9JB 1GZQA 4M7ZC 4ZQKB 2NY7H 3NABL 4QTHB 1I3RB 5F71A 1I8LC 3HPLA 5EBLA 5TE7H 4A6YL 3ZL4H 4M6NH 1RJLB 1JI1A 2JCCE 3DWTA 1J11A 2XQYG 2HT4C 5D1QC 2G2RB 5MP6L 4DKFH 4UIMB 5F7NC 5J7CC 1NGWA 3MODL 4PR5B 4JZNB 2Z4QA 1P53A 5DUBA 2C7UB 5C0NC 1N59A 4C83A 1I9IH 3K3QA 3SDCD 2BHUA 1ZLUK 5EIIB 3O3DA 1J0YA 3HR5A 5GRXG 1PSKH 1F6LL 3MX0A 5DI8B 1A7RL 1XZ0A 3DV4A 4FFYH 3LHPH 4K7FB 2DTMH 5JZ7D 2XV6B 2JF1A 3RL2A 2EDLA 2F54A 5TF0A 2DKMA 3CSBA 3MRHB 4NBYB 2FHBA 3T65A 4F7EA 3OAYK 4N0UA 1KB5L 1ITCA 1XH3B 1G9MC 2GCYA 3MRGA 5I66A 4Y5XA 3MRIA 2EE3A 1UVQA 1IBGL 1OT2A 2J5LB 2FX8H 2AI0L 2WINB 3BP6B 3UTSA 4JZOA 4WIQA 2DBLL 3TLRA 1BFTA 1JP5A 3VFTB 3P4NA 2ADGA 4Z95H 4MMZC 4JKPL 1JIBA 2AEPL 4L3CA 1U3JA 4NKOB 4ZUUA 3MR9B 3T8XB 5CJQH 4BELD 1QUNA 5SX4I 1INQA 4OF7A 3RI5K 1R24B 1D5ZB 2PF6A 2HLFD 4I3SL 2F53A 3R06A 5JPMA 4S2SA 3P77B 4I2XE 1CICA 1ZT4A 4LLQB 4FQJH 5E8NA 1PY4A 4K7PX 4TNVK 4QOKE 1MVUA 4DVRL 2X4OB 3NZ8A 2XT1B 1YMHB 4EDWL 2Z91A 4JAMA 1AC6A 3PWNA 4CVUA 3N85H 5DURD 1JHTB 4DAGH 4K2UH 1FV1A 3C9NA 3MLVL 4LLVA 4ONHA 4PY7B 3RIFF 3BKML 5D7LB 2NY4B 5I15H 1WIPA 2I9LB 3MRFA 4FQ2H 5HHQB 4UQ2B 2OZ4H 3GBML 2EZ0D 5D7JB 3G5ZB 1IKFH 1RJYB 5CEYA 1FL3A 1WV7T 4E41E 1D5BA 1BFSA 4WWKC 2H9GB 1RJLA 3QUMA 2DF3A 3TIDB 3AREC 3RTQB 4G80B 4YFLI 5C0GB 3EFFA 5E99H 3REWB 2X1OA 3TT3L 4AT6B 2XN9A 4PB9L 1EEYA 3WXVH 4U31A 4XPHH 3H7LA 1BIIB 4RFEA 4NO2A 3ZYZA 2YD5A 4GKSA 4YK4C 5GXBB 1DBMH 4G7VH 5KW9H 2CK2A 1S7RB 3CFCH 2YBRA 3K7UA 3MLWL 1TZHA 5LXGL 3MLZH 4UINL 1V7NL 5KS9B 3HS0A 3MLRH 1W72L 1CGVA 1T5WA 2PYEA 1RULH 3HC3H 2E6QA 5HY9B 1F4HA 1P6FA 4ZAKC 3E2HB 3WS3B 1LNUA 5DD3L 3V0WL 3HZVA 3I50H 4PJFA 5CEZL 4FQHA 5F9OL 1FH5H 3BOVA 4LLAA 2YHGA 5CZKA 2X40A 4HIHA 5KAQF 3QHTC 3UDWC 5KSUA 4JFDE 5FOJA 4GAJL 1E6OL 2JJSA 3LKSA 3S3JA 1KBGL 1LEKA 5B3JE 1RIHH 4BQCA 1LHZA 4G43A 2ICWB 2P4AB 3K2UL 4X4MA 3HI5H 1JPTH 4L4TB 1WBYA 1C5BH 4HHAA 1MAKA 4PY7A 1KOAA 1F2XK 4DUVA 3HHRB 4S1SL 4X6CB 1OTUD 4J4PC 4HIEB 4YDLB 3VXUA 2SEBA 3C60C 3VXRD 3RWGA 3GSOB 3OKNB 4QNPE 1KCUL 2IH1B 2YRZA 3EZ8A 4UIKL 5C86A 1S5HB 4YAQB 4YE4H 2VDML 1ES0A 4WHTA 4LSDA 3BYTA 1WGOA 5E2VH 2D4DA 2DKUA 1RUQH 2VZVA 4DQOL 3EOBB 2X1WL 1B0GB 2K7QA 1DE4B 5J6HB 3OJ2C 4U2YA 3LKPB 4QHMA 4MMXC 2QBWA 4DGYH 3F5WA 5DHYB 1IT9H 3FB8B 1NQBA 2XPGA 4W6YB 3MGOA 1KLUA 1NJ9B 4IJ3C 3VXTB 4Z76B 4WFGD 1CZ8L 4HH9A 2ADFL 1T5WB 4MAUH 2OTWA 4N1EA 5EZIL 3MCKB 3IAGC 4KK8D 1FAKT 5IVXE 2UWEA 3VI3F 4PJCA 4JQIH 2VLRA 5D1ZD 2Z8SA 2JJSC 4GXUM 5D2LF 4PJ5A 4HIJA 3O3AA 4XAWH 3LEXB 5IFAH 4PPTA 1BM3H 3EYFA 4GAFB 5KS9E 1XGPB 1YUHB 1RSFA 3BGAA 5E7FA 3WL9B 4XC3H 2OR9L 4NRZA 5BOZG 5D72H 4RMRA 2LTQC 3FQNA 4U1GB 5GRUH 3S97C 3RVUD 5CJ8A 3QCUH 1BJ1J 2Q8BL 3DGCR 2WWKT 1DEDA 1XZ0B 2ITCB 1M7DB 5L88H 3LDBB 1AO7D 3QCTL 5C0AD 1MRFL 5AD0A 2WLZA 3MLTB 4XPGL 4FHBD 3E0GA 1U91A 2YD1A 3SDDC 3S36H 1RHFA 4JDZB 5IT2L 2EIEA 4HD9A 2JCCA 1I1AC 1MCLA 2XG4A 3BHBA 3F8UB 5D6DC 2B2XL 1R5WB 3PDDA 4LF3B 1U2CA 3CXDH 3QXAA 1KGCE 1VACB 4IHOA 3NCYP 4KUCF 4OM1H 1FIGH 1I9JL 2XIDA 3UTSB 3EYVA 2YS4A 4G8GE 3W5MA 5C0BB 3WS3A 3IDMB 4KFZC 4M7JH 2R2EA 1SBSH 3H3PH 3UAJC 7CGTA 3DURA 1EEUA 4KMQA 3MGAA 4ZFGL 1K4CA 5C0AE 1JNHA 2ZG3A 3RVTC 3THML 3WFBL 3WN5A 5A2KH 4Y19E 4ELMA 4Y2OA 1OGAA 1MFNA 3ARRA 4FFWC 3F6LA 4P5KA 5BV7H 5IOPA 5D7SL 1UZ6E 2FL5B 4MJIE 1RZ8A 2HT2D 4JPKH 1ZE3C 1MOEA 3IJYA 4KI5E 1HWHB 2D7NA 4OLVL 4MYWB 3A6BL 5LJYH 4XZUB 4XNYH 1OW0C 4Y2DC 4ORGB 2ZCLH 4ODHL 2F5AH 5L7XH 4XPGH 5F9JB 4MNGE 1ETZB 5DJXB 5I76B 5IQ9A 1NDGA 1U3HD 2H3NA 4K94C 4X0KB 1Z6JT 4K3EL 3OQ3B 5K9JL 3VGAC 2Q8BH 1D9KB 1UXWA 4HH9B 2CKBB 1IKNC 3U2SB 4M03A 4L9LA 1EO5A 2FLBT 3OKKB 2YN3A 1KG0B 3KLSA 5KN5A 1PEWA 1PKQA 1XGRB 3QXDB 2R23B 4I77L 3C60B 1MF2H 4YHIB 1CFVH 1FFPA 3LPFA 1G1CA 4MGXA 4EI6B 1T6WA 4P99A 3T09A 3U48A 1M7IA 3GO1H 4MAUL 4MNQE 5IMLA 2Y1VA 5FGBA 2D03H 2H45A 2DYPD 1DVFD 4ODVH 1JNJA 1WT5C 4W6XB 1T0PB 1YNTB 2ZUYA 1K6QL 5IF0A 1GIGH 2CMRL 3CMGA 1UWXK 3KHOA 4YHML 1J87A 5C08D 2G9HB 1FG2B 1JK8A 4DGYL 3WUZA 2CKNA 4D0DB 4DGVL 1ZTXH 5JXAH 5DGQA 3LN5B 2XZQH 1HINH 4PRIA 1G7HB 3DROB 1C5DB 2R2BA 3HG1A 2ADIB 4MQ7B 3UZEA 3K46A 1MNUH 3QUXB 4QWWD 1I9RH 3AC0A 1MCNA 3DX9B 4PJ7F 5IJKA 2CR3A 4OSUL 2AEQH 1UZ8A 1HI6A 3KPQA 1UH4A 5D7KE 5C09E 1U8HA 4EVNB 1F8TL 1XGTB 1D9KA 2VDRH 2R0ZL 4IHOB 4NQCA 3TJHC 3G6JF 4ZUSB 1YEKL 3OKDB 1MEXH 4QRSB 4LDOB 4TVPL 3NGBC 2IADB 5F9OH 4KQ4H 5CEZH 4XAKD 3FT3A 1L4IA 3MNVB 1S7TA 3O0RH 2YZ1A 4V1DA 1OHQA 3I50L 1O5DT 4Z7QF 2AJYL 2ITDB 4JCMA 1CLYH 3VDBA 4WY7H 3C5JA 2R4SL 2JB5L 3T77B 1JPGA 3L3DB 4YUEH 1BGXL 3RVXD 1FFNB 1FGNL 3PP4H 2PXYC 4IM8A 1OGAB 3HN3A 1QRKA 4D9QE 4Z7WB 5IB3A 1MAMH 2XXMB 3QA3B 2H3NB 3WS6A 1T0NB 1GVIA 1U6AL 3ZKXB 5IFJB 2HA1A 2EDJA 5LGHL 3GM8A 1R3KB 2HRLA 4HS3A 5I1AB 1OAKL 5I71B 5C7XL 5DR5H 5DMYA 2CLZB 4ORGA 3AY4C 1P4LA 2BSRB 2DQGL 4QNPF 3UTZA 3SKJH 1QR1A 1OTTD 4MD5A 4UIMA 1D7FA 1EFXB 3OJMB 1N6QH 3U1SL 3DSFL 1KC5H 2ZSWA 5F21B 4QHLA 3EHBD 3SPVA 5IHZA 1X5KA 4WO4A 2FX7L 1KB9K 2L0DA 2W0KA 5F6HI 2P7TA 2FGZA 4Y4HA 4Y1AE 2NX5D 3ZDYE 5I30L 1IKFL 5FF6B 4Z7NF 3DVNA 3MV7D 2OZ4L 2VLRD 4LSTH 5D1ZA 4FQ2L 2VIRA 2IQAA 3CZFA 4ZSOA 2DQJH 3HMXL 4X7TB 4JGUA 3BE1L 3TBSB 1NMCB 4OGZA 5HGAA 2PCPA 4HJGA 1OAYL 4FG6D 3V5HB 4G9DB 4CBPA 2F8OA 1EHNA 2ZWLT 1U8OB 4NZUH 5A2LH 3QUYD 2YSSB 2E6JA 3S4SA 4MNGB 3IF1B 5C0CE 1UCBL 4UUJB 1EGJH 4H8WL 1KULA 3VDCA 4PJHB 5LAXA 5IF0B 1RVFH 1A6VH 1A9EA 3AS2A 3RDTA 2OQJB 3TPUA 1QFWH 3HE6B 4LCUA 1OWRM 2AQ1A 4MJIA 2BVEA 1HXMB 2H2SD 3F58H 4QOKA 1J05A 2ADIA 4MQ7A 5DJYA 3QEQD 4CU6A 1MY7A 4Y19B 4OCXL 4ZXBB 4X4YA 2RHEA 3QFDA 5I1EH 2EIDA 1YMHA 3RPKA 4NQCB 5EZOL 5ITBH 5SX5H 4JFOA 4EUPB 1BAFH 3WO3B 4NYLB 2FX8L 4MA3A 3IDIA 2NY1C 5C0BE 2GUOA 4YXHL 5FUZH 1Q9OB 1KB5H 2Q86B 3VMPA 3G5ZA 3NA9L 5CKAA 2OP4H 4FZEL 4I3GA 5J0BA 3C87A 3CUPB 2DI7A 3WFEH 1OD7A 1B88A 4QXTB 5IBTH 2YUXA 2YPLB 1FV1B 3C9NB 3AB0C 4MNHA 4LKCB 4X83A 3JUYA 2EICA 5L2JB 2VLKB 4LRNL 1B6DA 5I2IA 5D71H 1MCCA 1S9WA 1MVFA 1RZJH 2FO1A 3RIAF 1CBVH 3PNWA 2C1PA 3VU2A 3CVIH 3PE9A 1AD0B 4BZ2H 3L3HB 2H32A 1K9TA 1X44A 5C92A 1T0NA 4TRPH 3ZSTA 4X5WA 5LAXB 4GOSA 5C07A 4P23D 2A6JB 5F3HB 1U3ZA 4WU5A 2JK5A 3V4VH 1OQOA 4M6NL 2CUMA 3KR3H 1BBJB 4MAYD 4WTZA 4DVBB 4XRCB 1BIIA 3BE1H 3NABH 1JTPA 1Q9WB 2NY7L 3IDXL 2BOCB 5EBMA 5IUSA 3D85B 2I27N 3HZVB 5TFSH 1A7PL 5CAYB 2ZKHH 4LRIA 3QDJB 12E8H 2R4RH 1HSAB 1C1EL 3UBXB 1P7HL 3CDYA 1U8MB 1OSPH 5FGCE 1MIEL 4KZDL 2KQMA 4KKNA 4PJAF 3TNNB 1D5XA 3GMMB 2CR6A 1HSBB 2FX9L 4G42B 2GQHA 1RJYA 3DSFH 2VLJB 3VFOA 5IM7B 1S7SA 1G7HA 3DROA 4PJXE 2JIXD 4RAUB 3FCTB 2NMSA 1J18A 7FABH 1A14L 4I13B 4XCYB 3WE6A 3KPMB 2M26A 1A6TB 1ZA3B 4GRWB 4Y5VA 1PG7W 4PTUA 2VUYA 4CDGC 1FSKC 1ND0A 5LGHH 1T7ZA 3S7GA 3LN4B 3ORJA 4XNQB 5JHLL 1MJJA 1PX3A 1B6UA 2F53E 3ZE1F 4KK9D 1ZHKB 2HN7A 3EJJX 4YUEL 3NIGE 4JFQA 1KNOA 5DUML 4NKMB 2VAJA 4MJ6A 3VFWA 5IV2B 4XVJL 2I26N 3BP5B 3MNWA 2AJVL 2F19H 4X6CE 1FGVH 4LHUD 3V52L 2APTA 3SJVB 3ARWA 3RWFA 4KQ4L 4TULL 5IEKA 1YDPA 3O8XB 4YGVA 5SWSE 3FL7A 4NO3A 5F8RC 4JE4B 2OZ4A 4XNXL 5IROA 4EN3B 5C0CD 2FNBA 3F65A 3TZVA 1DL7L 3UPRA 3GMPB 1S7QA 5LCVL 5DC9B 2VDRL 3D48R 2IQ9H 3QH3B 5EOTA 4N8PA 3T2QA 5IMMA 1H9VA 4YIQA 3BGFC 3VFUA 1YEJL 5ADOH 2IH3A 4GUPB 2VISB 4UT7H 4Z5RA 4UOW0 4XGZB 4NO5B 4OSUH 4ZOBA 4R2GD 4ERSL 1GHFH 3U9UA 5F1OB 1OP9A 3MCKA 2IF7A 3FQWA 1WICA 3AS0A 4HQQH 3X13B 4P4KA 1K2DA 3T0EC 3BVNB 3P4MB 4LKCA 4RBPK 3DPBA 1K85A 2PYEE 1MREL 2YEZB 1WBXA 5KZCB 4LSSH 5FCSH 3E6HB 5CGTA 1MFEH 1IAMA 4TUOB 3WIFB 3ZHDA 1NCUA 3CDGA 4PJEB 3VCLA 4U49A 2LQRA 2NY0B 1DQTA 5AZEL 4JVUA 3WDIA 1Y6NR 5D1ZB 5HHXH 2XG5A 5AUMA 5E08L 4NDMB 4PP2A 2J4WL 1NFIB 1QBMH 3HAEB 3MCLL 2NY4D 2YKLL 4GQPH 4UNVA 1U92B 2JJTA 4BA8A 3KXFB 1AY1L 4D9QD 4HKBA 5D7LE 2B5IC 3LRGA 3HR5B 5HGBB 4L3EE 4QRPD 4RDQF 2P45B 4URTB 2LU3A 1YECL 5F1IB 4NFDA 4OM0L 4HIJB 4Z7UB 5GGQH 2D31A 3Q6GH 1R0AH 4EI5A 2VITB 1FJ1A 3WSQL 4QF1B 4QHNA 1QLFA 1HSBA 2O61A 2IMMA 1CCZA 1JN6A 2E3VA 1ERNA 4H5SB 1IGIL 2Q1EA 3VGFA 4LFHG 1JGDB 2WV3A 3IDNB 4G3YL 4XXCA 2YUVA 1AD9A 3DV6B 4Y19A 1CE6B 2J88L 3Q1SL 4K3JH 4K23H 4ODHH 2IAMB 5L7XL 2FWOB 3KLHC 2P8PB 5D7KD 5C09D 5A2JH 2DLTA 3C5ZD 5JIIA 1JTOA 4PTUB 1J10A 3L1OH 3PQYE 3O4LB 2BXYA 5AYQA 4K3DH 4PGEA 3M1BA 3O8XC 2PTUA 2XN9D 1Y0LB 1G7LB 1RK0B 4X0KA 1IM3B 3FB5A 1IMHC 3JV4B 3TCXA 5CZVL 5DTFB 1N7MH 4UBDD 3QJFA 1IGIH 1N2RA 1JPSL 4UDTA 3MUZ1 3UPRB 3PGCB 3JTTB 3O3BA 2W59A 1SBSL 4FQXD 4JFDA 5KN5B 3O8XA 5IJVB 1WZ1H 2HLAA 4K8RD 3MOAL 4UQ3B 4Z5RB 1IGMH 3ARFD 2DMKA 3UO1H 2PYFB 5IEHB 3DRQA 4WU7B 5E8OB 2P48B 3B9KC 1CXKA 1CDCA 1U8JA 3OB0H 4JG1H 2VAAA 4KRMB 3NZHL 2G2RA 5DHVB 4X9BA 1ZK9A 4Y2DB 2YKLH 2D7PA 1UWEH 4ISVA 1WBXB 3BYYA 3CPLA 5I8OH 5GGTH 5HHXL 4OGAC 2V17L 4DOHE 2IALB 2W9DL 5IMLB 4AEHL 1WK0A 5E94A 1BJ8A 2FIKB 3CK0H 5E5MB 1MREH 4LVHB 3ELAT 5J3HD 3QAZC 1H8SA 4Y4FC 2C1OB 4MB4A 5SX5K 5JDJA 3VFRB 4JY4B 2EDEA 4RGOL 5JHDD 4U1KB 4PG2A 2WWMC 2QSQA 5T3ZL 3WIFA 3KXFD 2DIJA 2DM3A 5BCAA 2PW1B 3X11A 1ZT7A 3KS0H 1RU9L 4JRXD 3D9AL 1A7BA 4ERSH 1I7RA 4I5BA 4RGNB 3TBVA 2FIRT 1SMOA 2KQNA 5IKCA 5D96B 4XNUL 3OGCA 4UT7L 4G6JL 2MSPA 5MEOB 1A7QH 5HI4D 2G5BB 4MJID 1G9EA 3LQZA 2ZUSA 3QDGE 4F58H 1QLFB 1YJDH 3PUCA 5ANMA 4X9GA 1OAQL 1I8MB 3ZE0F 4P4KC 3FO0H 4PJ9B 2P5ED 1BP3B 2GTZB 1KNOB 4Y4FB 1FZOB 3QEUA 4HUMB 2FO4A 4IIQC 5F3BB 5J1AA 1RUQL 4AM0A 2X4SA 4GBXA 4NJAH 4ODWB 1NCTA 1UXSB 3RWFB 1JGEA 5LGJA 2NXZB 2VDMH 4O51A 4U1HA 1JZ5A 5DUPH 2Z31B 1NFDB 1KTDA 5MHSE 35C8L 3C5SA 3RGVB 3AGVA 4S1DC 1OARH 1MFDH 3K8KA 5T1MB 3R0MA 5H8DA 1DN0B 3L7FB 5JHLH 3GSNA 3KNBA 3U7WL 4PJFE 4CKVX 1S9XA 4DCQB 3W9DA 3HI5L 5B21A 3UTOA 1MFBL 4NM4L 4D8PA 1MLCB 3O6FB 1ZMYA 4G8GA 2R9HD 1A14H 4M5ZL 1DVFB 4G9FD 1IL1B 1VFBB 4P2QE 1N2RB 1UB6A 2IPTL 3S37L 4MXWH 4GW1A 3SDDB 3T0DA 4KZDH 4XTRD 4QYOA 1ZGLB 1NAMA 3O3EA 4ZG1A 3PWVA 5JNYB 3OAYH 3KYMA 4LKXA 5TFSL 3WD5H 5BZDB 4WWID 3ALXA 4RFOH 2CJUL 5JOPD 2L7UA 1AGCA 1ZS8A 1IC7L 3B9EA 5I1LA 3O6LH 5KW9L 4FQ1H 4NRXA 2HMID 3ULUH 3RUGE 1JV5A 2PO6A 4U1MB 5B39A 1GSMA 3EJYC 1NGYA 5SWQA 3X17A 5HGAB 4GW4B 3T4AA 2HKHL 5F70A 1UYWL 3S3PA 3L5XH 4OFPA 3RJDA 2OQJA 3HR6A 1ORSB 1CDHA 1FZKA 5FK9A 2NTFA 1E4WH 4JFXA 1CG9A 4LCWA 4I4WA 4LSPL 3P2TA 4LCCB 1ZLVH 4WTZG 3CMOL 2ZNWA 3GSVA 1GC1L 1NGXB 1PKQE 3GJFA 1Z0NA 3QHFL 4P46A 5IBTL 4YWGH 3Q2CA 1FO0B 5FYLD 3G04A 3NN8B 2EIZB 2ID5A 4QRPA 5HDOA 4DAGL 5F8QC 3BZEB 4Z6AT 4WFED 1GAFL 3GSUA 3NBNA 5FYJE 4GXVL 3L3JB 2NY2B 4F7PA 3TEUA 3VG9B 4DVRH 5FHAH 4JQXC 2FHFA 4XP4L 4FQJL 4MB3A 2NXYC 5EZOH 4OZFH 3HZKA 1WJ3A 1GPOL 1Y0LA 3QHZH 3QNXB 5DMGC 5IBLC 1ZGLA 2F15A 5JR1H 3PGDA 1T22A 2DYPA 1RUKL 3K8MA 3F58L 1FDLL 3TA3D 5IB4A 4ZYKA 2BNQD 2IFGA 5SWZB 1Q9LB 4UILL 1NEZA 2EIBA 1A6VL 1CFNB 4JDVA 4BJLA 1C12B 4UT9H 5GGSA 4NQVB 5I1KL 4Z95L 1EGJL 4H8WH 3CCHA 1KTDB 1EFXD 1DQJA 1V3MA 1R3HA 2BVTA 2BC4B 3HMWH 4R90H 1S7WA 3PNWB 4FFVD 1FFOA 4XWOC 3ISWA 3PWUB 4PTTA 3S35L 1YZZA 4M7LL 4LDEB 3B5HA 5H94A 4MA3B 4GS7B 3QNYA 2DICA 3MRQA 1T04A 1OM3L 3QIUA 2VXSL 2PYED 4Y8DC 5DMIH 2F74B 3DO7A 4L3EB 5AG9A 2W0FB 1J8HB 1GC1H 5D1QA 3LHPL 1KTKE 3JWNC 2ZSVB 3VFGH 2FX7H 1CE1H 2XY1A 4GBXC 1JWMB 2ADJB 2EDBA 5I17A 3OHXB 5I73C 1M71B 3ALPA 4ZUTB 5CD3B 1JMXA 1JNNL 5CSZA 3DVGA 4DEPC 5JOEA 1NBYB 4PJDF 2FJGA 3MODH 4YC2C 2HT3C 3UPCA 4MNQD 1AGEA 4FQ1L 3FCTA 1H5BA 3KHQA 1ZLUH 3WLBB 1U6AH 5FYKU 4C55A 1G0DA 3WFCL 2E6PA 5TE7L 2C3WA 1MAML 4PR5A 3DVIA 2P24B 1AH1A 5SWSD 3QIUD 1F97A 4KHXH 1YNKL 1HYRC 5EA0L 4D0DA 1ORSA 5K9QG 4FQLH 3EAKA 3IJHB 5EOCH 3V6OC 2BJML 8FABA 4ONFH 3KYOA 1NC2A 3FO1A 1RJZA 3MR9A 5CP3H 4TTGA 2X41A 2D7TH 4WI2A 1KJMB 3GSXA 3VFVB 3MV11 4Y4FA 4LIQH 1NGXA 3V0AC 3AMKA 3BPOC 5J1AB 4J3VA 3UTQB 2IAND 4Z9KB 2X5PA 2KZ1B 1NDMB 3PIQA 4D94A 5J13B 3QNZA 1QRNA 2PTTB 1TCRA 3OAUL 2P49B 1F8TH 4M9OA 2GKIA 1LO5B 1JPST 1AIFB 4W4OA 5KTEH 2F74A 1XR9B 5DFVC 3DO7B 1G7JA 3INUL 1BMGA 3CLFL 4MA7L 1YY8B 3WHXB 1CQYA 4N8CH 1OTSD 3JVGC 4Z78B 4PV9A 1P9MC 3MLPA 3OPZH 4FN0A 3K1KC 3Q0HA 2ADGB 3ARZA 4I0PD 5EZLB 5D8JL 1RZ8B 5C0JB 2V2WA 1NMBL 3QNXA 4PP1C 3CFJA 3VA2C 1AFVH 1V3JA 3MREB 5HYJD 5GRZA 4XMKH 3TYFB 3D39A 4ODXA 3RKDC 5CSZB 3V4UH 1JYWA 1JZ3A 2XZQL 3SKNB 3D25B 4DGVH 5JXAL 3BIKB 4X6CF 3G5XA 3GRWL 1YPZE 1GIGL 2CMRH 3G5VB 3A0OA 1K6QH 4G8GD 1J1PH 3QXDA 2HFGL 3EFFB 5ICYA 2YWZA 4XC1L 4P46D 5L9DH 5DJCB 5FAAA 4L3EA 2X4OA 1S7QB 1A7QL 2Y7QB 1I3RA 2VLMD 1IGCL 2MCG1 3MRJB 5DYOA 3GNML 1LD9A 3A6CH 1HYSD 3NACL 4M1CC 2F54E 1KCVL 5T3ZH 5DC0A 1UJTA 2Z8RA 5FOBA 2O61B 5JIHA 4KJYA 1P4BH 4JN2B 3VRLF 4LSQL 4Q9RH 1G1YA 2WBJD 3PJSB 3PL6D 3SO3C 2DI9A 4JVPA 3P4MA 1NCAL 3ZTNH 3WLBA 2W9EH 4K7PL 5K9KA 1H0DB 4XP1L 5E56A 2FWOA 2OS7A 3SE4A 2A77L 3VJ6A 5I8OL 3GSOA 4MQTB 3S35X 1NBYA 1YMME 1YJDC 3QIWD 3U46A 3CD4A 3N1GC 1T7YA 4XNYL 5GGVH 3P0YH 1U2HA 4G7YL 2COQA 4JG1L 5GGUA 2AS5M 4H0IA 4LOUD 4QRRD 2AP2A 1J8HD 1OP3H 1FP5A 2R1XA 1TZIA 3TN0A 4XMLL 1ROWA 1S5HA 4YAQA 1V3KA 3RWHA 1DJSA 3UYRL 2YD6A 2ESVD 3BDYH 4U05A 5ICYB 3UTTB 1PEZA 3DX8A 4P9HL 2WBJA 3H3PL 5DEGA 2UVFA 4NNPL 4QY8A 3UBXG 1BOGB 2EXWC 2ZOKB 5EB9A 2J3SA 1N7ML 1YY9D 4MD0A 3LVEA 1FCGA 4KKAC 5CZVH 3HNTL 3D3VD 3RHWF 2DLEA 3CFBB 5DYOB 4Q6IB 3U4EA 2A1WH 1CK0L 5F1SA 5CGMA 3H7BB 1KXQE 4PRIE 1LO5A 4RISL 4CGTA 1TQBB 2CDEB 3D18A 2YA1A 4APQC 4X8JB 3CPLB 1MJ7L 4WUUD 4ZXBC 5CFHA 2FBOJ 2APBA 2E7MA 3QO1B 4K23L 1KPVB 3S36L 1AXIB 1RJCA 1BECA 3O2DL 2W1NA 4GAYA 3RDTD 4MCYA 3QCTH 3R1GL 2DMBA 2PNDA 3VI4E 1R3LB 5CWSB 4KY1L 2VDOH 4JFDD 5I75C 2GJ6B 3QEHA 4MX7B 4ODXB 1BD2D 2D7QA 1EIBA 2QHRL 5GRUL 5DWUL 1S5IH 2GK0B 5FB8B 5D7JA 3D5OF 1FNSL 4I0KA 3FQNB 2C1PB 4QXUH 3Q48A 1TDQA 4IS6B 5KSBF 2Y4SA 2XWBB 1ZLWK 3W39A 2W0LA 4AJ0A 4YHKL 4HIIA 1G9NC 5DJ0A 3ZE2E 4HFUL 5D7IA 2NZ9C 4IMKC 1A6ZB 2AJUH 3MQIA 5MI0B 4YJZL 5EZIH 3RNQB 3VWKD 1IEBA 1I75A 3MV7B 3BPOB 4BFIA 1CU4H 1Z9MA 4HKJA 2ZOKA 2MOVA 1RZ7H 5DJAA 3OZ9H 4XAKE 1MFEL 9CGTA 3RIAK 4F7CB 1IT9L 2JE8A 2PW2B 4H20H 1U41A 3SDYH 2YA2A 4MZ3A 5JDSA 2R69H 4HZLB 3ZE1E 4FMKA 1NCWH 1W0VA 5LGJB 4J8RA 4DQOH 2GEEA 3F12A 1SEQH 1L9MA 4GLRI 4X4YB 3WE6B 2FO4B 3HZYA 5KS9F 1S7VA 4UIKH 2AABH 4L8SB 4LCUB 1NC4D 2ICES 1IAKB 1MRDL 4AIXA 1FC1A 3IDIB 3AU1A 2CSPA 3C5SB 1JWUA 3QZWB 2B20A 3I02B 3WLWC 3ULUF 5E9DB 5KJRL 1UB6B 1RIHL 3AUVA 4HGMA 3O4OC 2HVJB 1UM6H 1JGLH 5MERB 2EH8L 3C09C 3LSOB 1Z9SA 3RP1A 1MCRA 3MLYL 1QKZL 2NY0C 4NUGL 3WDHA 2NY3D 4AEIL 1SM3L 4PLJC 5DVLA 1H3VA 4WTXA 3E3QC 2HTLD 4GS7C 1FNLA 2GAZA 4HT1L 2OJZL 4U1NA 3U7YH 1RULL 3G6JE 1HXYB 3HLAA 1A9BB 4F2MA 3D2UB 4F33B 3MLRL 4O2FB 1A21A 1MCFA 3QPQD 4EEEA 5IVOA 1FO0L 4CAGA 4U1HB 1WC7B 2CUHA 3EO9L 4X5XA 3L95B 1A6UL 4EOWH 4BSVA 3UDWA 1RUMH 4NOBA 2DRUA 4P5TB 3N1FC 3B8YA 5EO0B 2NYYD 2ESVE 5T1KB 5HPOA 4XRCA 4EIGB 4DOHB 2FR4A 3RUGA 4XPHL 2BRQA 1AD0A 4HG4K 2XZAL 4KTDL 3D0VA 1PVHA 4EUPH 2B4CH 3L3GB 1KYOK 2JELL 2Z9TA 3LB6C 4U1MA 4XNMB 4JZNA 1QLEH 5CLTA 2HJKB 2R0WH 1IE5A 1VGKA 3D2UD 3QDGA 1EO7A 4FZ8H 3AROA 1FCCA 4TPRL 4OFIA 5EU7C 1KG0A 3AU1B 4OTXL 5ESQB 4JRYD 3KPRB 1NAMB 3MLVH 5TH2A 3HE6D 2YRPA 3UYOD 1UB5A 4MJ5A 3VXMD 1NKRA 3N85L 1K3ZA 1PW3A 1X5JA 4LLWB 3V4VL 5IR1B 5IB1B 1M7IB 2DWEA 4M7LT 4DTGL 3LIZH 4FP8H 5MENE 2M2DA 5IWLA 5EU6D 2C9AA 3O2DA 4I48A 2HAZA 1KJVA 5ESVB 3FTGB 2UUDK 4ALAL 2XTJC 1CXFA 1ZA3A 5D71L 3S8WA 3LRSA 1EAJA 5DSCA 4YNYB 3D39D 1NEUA 1MQKH 2G9HA 3NIDE 1EXUB 1WZMA 4YHPB 2ED9A 2DQUH 2J8UF 1H3PL 3MJ9L 4LVOB 2AEPH 4V1DE 1FYTB 2JJUA 4KK6C 4P2OD 4FZEH 1CLOH 4H88H 4WGWB 4MD0B 4I3RL 2DWDB 1LDPL 4ENEC 3QJHB 3K2MC 4D0BB 4I18A 4M43L 1ZANH 1D5IL 1I8IB 1BAFL 1ZWIA 4NQSB 3T3ME 4WO4B 3E8UL 3LAFA 4POZC 2ZUQB 1N8ZA 1CLOL 4H88L 4NZTL 2D3VA 1N4XL 4ZUSA 3O2VH 3UTSE 5EUOF 4OLWL 3HCVA 1IEAA 2PXYA 5ENWA 2DTML 2OTPA 3SGDI 2PKDA 3EJZD 1I7UB 3WEXB 5KSAD 3LS5L 3VH8A 4ENED 1RVFL 5D96C 1H5BC 5GRVK 1T0MB 1AE6L 4CMHB 1JPGB 3L3DA 4LLDA 1OCWH 5HI5D 2IANE 3TO4B 4P2OC 4LU5L 4ZSOE 4PRBB 4ORZC 4W4NA 3GJFH 3IDUA 4PBWD 2LU4A 2W0PA 2DBJA 1HDMB 2P8MB 1LMKA 5ISZB 5D1XD 1BX2B 1SJHA 1TMCB 3RRQA 3HE6A 1KF9B 2DQJL 3N1MC 2DIAA 5DJ2B 3QISA 1NCCL 3TV3H 5SV3A 1AGBA 3QDAA 3GJEB 3QFDB 5DJ6A 1KTRL 2HJKA 1XR8B 3KWWA 4X6FA 3I3EA 2O93L 1CR9H 1JK8B 4NQDD 4PJ8C 3ULVE 3NIDF 4LHUA 3WNKA 1ZT7B 2JELH 1N6QL 3B9VA 3HE6C 5FXCH 1I8LA 5BO1L 3O41A 4X7TA 5D2LE 2E9BA 1JZ8A 2B1HL 4KJPD 3BO8A 1Z5LA 1VCAA 3FN9A 5T33L 3KPQB 2CO7B 3V4PH 2NX5E 1AGEB 3NPZB 5ERWB 3RAJH 1MWAL 2FRGP 3SCMC 3VFPA 3QEGL 3TIEA 1FGNH 3U6RA 1X3DA 3QDJD 2JB5H 1P4IH 4WY7L 3LQAH 5DJZB 1JUFA 2XZCL 3TC9A 4ZOAA 4D9LL 2IPUK 2EYSB 2X70B 2IPUG 2DWDA 5E2WL 1EK3A 1PLGL 1R3JA 2BNRA 4KH2A 1VDGA 4L9LC 2NY5C 1GGCH 3KPRD 1MEXL 5E1AA 1KJ2H 1NCBH 4L1DA 5GS0D 3P9WB 3DGGB 3BT2L 2DI8A 5E00B 4YQXL 1EBPA 1BQUA 5I1CL 3RNKB 4R7DA 3IS0X 4JFDB 3D2UA 3HE7C 1SEBB 4F33A 4PLJD 3WNPA 2C5DC 1AI1L 3B9KB 3IDGA 5GRYA 1XF4B 1MRDH 2HG5A 3LKRA 3OX8A 3Q6FA 1IRAY 1XR9A 3O11B 3OJVC 3OKLA 3B5GA 2VXTL 3GEWB 2OSLA 1F2QA 2VZ3A 1I9RL 3MTRA 4JN2A 1TVHB 4XBEL 2UWEB 5DK3A 4FA8A 4JJ5A 5DK0B 4M6OL 5TDNB 1KTLB 1HINL 4XPBH 4OCYH 5C0FB 1WF5A 5GJSL 3EZJB 2UY6A 4I0CC 2PO6C 4EXPX 3FFDB 1KFAL 1LWRA 1UEYA 3SDYL 4H20L 4WFEE 1ND0B 4EI5D 2QQLL 5MI0C 4YR6B 4CJ0A 1MUJA 2W65A 3MXVH 2NXYB 4LF3A 1EEZA 4QOKD 4KRPD 4JFQB 5HVFB 5B39B 3VGEA 3QG6B 2AJUL 4X5LA 1ZSDB 2FSEB 3R4DA 4J6RL 2PN5A 1MF2L 1ZLSH 2Y7QA 5FEBA 2BRRH 3IDMA 3MRJA 2BY1A 4NO3B 1KCRL 4JLRA 2V5SA 1EPFA 1PZUB 3UPAA 1P1ZA 2R2HA 2MHAA 1VACA 1O7SA 1JNHB 4P3WA 3DMMC 3IRZA 4PGDB 1IC4L 1I1YA 5BVJA 1O0VA 4WV1B 5JW4R 5K9JH 3P77A 3QYCA 2NZ9D 4PRDA 3RA7L 1HXMA 4QOKB 5DK2A 2CXGA 3W0WD 5IK3A 1HH6A 2ZPKH 4OFYA 3QQ3A 2H2PC 4QY8B 1QFPA 1T66C 3O11A 3B9DA 1DQMH 3D0LB 1QACA 1FN4A 1OL0A 3GSWA 3K80A 3NCJH 4OLXL 4Y5VB 3A6BH 4AM0B 1EJ6A 1JWSB 4LAQL 2H32H 5ALCH 4OLVH 4JM4L 5B38G 1S9XB 1RPQA 1MCHA 4CVXA 3H7BA 1F45A 1X6LA 1G9NL 3QPXH 1TVDA 3T4YA 1WFOA 1HNGA 3STZA 1IZJA 1A1OA 2ZUWA 3F7YB 1CTOA 5A43C 3BKJL 1A0QL 4KAQH 3MJ8B 4NSKB 1Z9OA 3CDGB 5KVDH 5CZXD 4ZFGH 5GZOC 3MNWB 4TQEH 1WIUA 4GMTL 3IJSB 3GSNH 2GSGA 2O5ZH 5HTSA 1CLZL 2ARJQ 4AG4H 4XH2B 3REWA 4NJ9H 2VLKA 4WHYH 3RL2B 5I1HL 4OM1L 4BH8B 3FZUC 4XP9H 3HI6L 5ESAA 3SQBA 4J23A 1MAJA 5HGHA 4OFDA 5D9SB 1LO4H 4ZNEE 3RNQA 4HLZH 5CJOL 4ACPA 1QPXA 2B2XH 1S7RA 2X7LB 3WJJC 2E5EA 5HHMD 4RGMB 4DFHA 3WIIL 2OTUB 2P5EE 3DUSB 3GI9H 1C08B 4XP1H 4FABH 5L88L 1K8DB 3UXFA 3SQOH 1J88A 2W9EL 4H1LH 4O00A 5EBWB 2P5WE 1TETH 1NCAH 1B4RA 2H9GA 1QFUL 2BFVL 3BAEH 3OB8A 3X14B 4UV7H 5I0ZA 3UTTD 1FJ1B 4KRPB 2NY6D 3QG6A 2K3TA 5HYJA 1R5VB 1QBBA 3MFGB 4AH2A 4JRXE 4PJBF 3ZDXF 4I8DA 4XX1G 4ZAKA 3LS4L 1UCTA 4HLJA 4CVZA 4JJHA 3UEZA 2YBRB 1IGCH 3F7YA 4AMKL 4BZ1H 2P8PA 3CH1B 4F7TA 3HC4L 2Q3ZA 3GSQA 4KUZL 1U36A 1U3YA 2UV3A 4R96B 1SHMA 4WW2C 4FQQB 1F3DH 3MRDA 5C8JA 3RWIB 1YN7A 3VMNA 3MNVA 1HYSC 4Y16D 3WKML 3ZO0A 1WLHA 4LBEA 5D5MF 3MRMB 3FB6A 4JO3L 1HILB 2HFTA 4M48L 5TQ0L 4Y88A 3V4UL 1Q9LA 2NY1B 1A3QA 5EH1A 3UTQA 1A3RL 4LPYA 5D8JH 5C0GA 4YE4L 2XKUA 1T22B 3VXTA 2NR6C 5F97E 1CF8L 1N64L 4EN3A 3ULVH 1UKTA 3QXVA 4R0LC 3O9WC 4HLZG 4P48A 2BVOA 3GSWB 3CLFH 4P59H 5D1XA 5KTEL 4S1SH 5E8EB 1C12A 1C5BL 5DHVA 2P5WB 3U4AA 4Y8AA 1NMAL 4HJ0D 2WW8A 5JUEL 5IESL 4OZHE 4GAJH 3ULVC 4RBPH 3BDBA 1J8HA 1H8NA 1D3CA 2WSKA 4KVNL 2XN9E 3ZDZE 2D7TL 1XCQA 4CU7A 1EFXA 3QNYB 5HXMA 2XTJB 2JJTC 5EDXA 3QRGL 5M95B 5EA0H 3HC3L 2Y6SD 3MRFB 3EO0B 1TITA 1U91B 2MPAL 4N5UA 4TUOA 2Q8AH 1G6RH 2ZSVA 3EFDH 1U8JB 4U1NB 4UINH 5FF6A 1Y18B 3MLWH 3BI9X 4AYFA 1DBKL 4S1RH 2VLME 2X7LA 3KJ6L 4LL9A 4OQTL 3K74B 2CUIA 1CT8B 4UAOC 1TTUA 2R0KH 4X5XB 3P73A 4PB9H 4HPOL 4AT6A 5F3BA 4QRQB 4WHYG 3BGMB 3DETD 3IS1X 5BJTA 5D1XC 4NO0B 4OI7A 4F7MA 3ARQA 3DIFA 1EO8H 1CE1L 4OFVA 5DJYB 4NNYA 1FORH 1NFKA 3VFGL 3PV6B 5CILH 1NGPL 2Q6WA 1PX4A 2C1OA 1NBZB 3KYNA 3TBTB 4NQUA 5CSBA 1I7ZA 5I15L 4NKIH 4PGZA 2VXSH 2ORBH 1OM3H 3RWDA 3B6SA 4LPUA 1BIHA 4D2NA 1MCPH 4NZRL 5C0AB 3RGVA 1YQVL 1VFUA 4U6HA 5ITFA 3V6BR 1KPUA 2CD0A 1AKJD 4LBEB 3IKCA 3ECBB 4OGYL 5EU5A 4UOJA 4LGSB 4A2MA 5T1KD 4OJFL 1HHHB 2XXCB 4E41D 2YPVH 3SDDA 3VWJC 4CADB 4KJQD 4UT9L 1F11A 5BQ7A 5CKGA 2DJUA 3FB5B 1A1MA 1Q0YL 1CXEA 3Q5TA 1BOGA 5CS7A 5EPMB 1VPOH 3LRSB 5HVWA 1FDLH 2O5XH 5EBLB 5CJQL 3MV8A 4P5TD 2AJSH 5F6IC 4DZBB 5I6XB 4MNHB 2FGWH 4DEPB 1CFBA 3CZJA 2ENYA 2F58L 3I6LD 1TLKA 2EEDA 4N0UE 2KZWA 4RGND 4PJ5D 2A6JA 5FHAL 1F4XL 4L8DA 3ZKND 1RZFH 1DANU 4NN6B 1GRWA 5FK9B 1JZ7A 5F9JA 5E8EA 2CDFB 5E9DD 4YFEA 4NZRH 4GW5B 1HSAA 2UWEE 1CFTA 5IBLD 1R3LA 3VXQB 2P47B 3OXRB 3LKNA 4NRYA 4KKCC 1UM5L 2HKFL 2X4UA 3RWEB 4N0CD 2F54B 1XR8A 2CKBA 2NXYD 4J3WA 2QQNH 1QEWB 3VE0B 1A7RH 5IG7A 1IGYA 4LLMA 2I24N 4PRHE 1GZPB 1E4WL 3FRUA 2NXZD 1CDBA 4Y5XB 1LVEA 3S88H 4WENB 3WEXA 4KTEH 1ZEAL 1TIUA 2HKHH 3FFCB 1D6VH 1BPVA 2Z93B 1ZVSB 2WMPA 4EVNA 2YN5A 4S1RL 1IC7H 2OCFD 4U6YA 3TIEB 3WUWB 5HBBA 5I19L 4X98B 3GMNA 3K4DA 5IHUL 2CJUH 3JXAA 3BP6A 4A6YH 2VMFA 1B2WL 1BQHB 4MXQD 4P4RB 3C6LA 4WDIB 2FH6A 2VZUA 4JDZA 3QRGH 2ICWI 4R3SB 1KT2A 1R3JB 4G8FA 2NTFB 4O5LH 3H9ZA 2QSVA 3FT4B 5JW5B 4M7KH 2GK2A 4KVNH 3RX7A 4B53A 4R4FL 5EN2B 4MXWL 6FABL 4HK0B 4M3JA 4KU1A 3QH3A 3ZLQC 1CFNA 4LPVA 1EX0A 2XRAL 2XZZA 3GMRB 4QKXB 3QG7H 2GJ6D 4LFHD 1HQ4A 2GT9B 4HUWB 3KLAB 1KIPB 2NY2D 4X9FA 2NY3C 5C0DA 4HWBH 3BWUC 4HV8B 3VXMA 1NUFA 2X42A 4PLKD 4PGJA 4P59L 4GMSH 4JRYA 5T1MA 3C8DA 2VE6A 3MA7B 1OARL 1QQDA 1OAZH 5IVNA 2W60B 3HUJA 4NQDE 3ULVD 2E7BA 3GIZL 3WLWD 4CADA 1AGFB 4M6MH 3SJVD 4HJ0C 5JPNB 4J3TA 3BWAB 4WUKH 4M61B 4QGYA 3ARDA 2BNRD 3MSPA 1EV2E 3HAEG 3B43A 4M48H 3FQWB 3HZMB 1HQRB 5IB4B 5HVHB 4D0CB 5JW4Q 2DL9A 3MV8B 3GJFK 2ICWJ 1IARB 4TYUA 4GAGL 5DJXA 4K07A 3O9WD 4JJ5B 1KELL 3ZSSA 5I76A 3KGRA 1GGBL 2XACC 3C6LC 5F7LB 5HJ3A 3GDBA 3OHXA 4JO1H 3QUXA 5CEZE 25C8L 2GJ6A 3QEHB 5FFLA 5DRNA 1R3KA 3JWDC 3QQ9D 1U8PA 4DN4L 2DLFL 32C2B 4W68A 1XF1A 1XIWA 3OR6B 2DLIA 4G6JH 1D5MB 2A6DB 5HGBA 2QTEA 2EYTB 1K4DB 1SEBA 5BV7C 3D9AH 1BF8A 1RU9H 4QRRB 1DQDL 3LS4H 2GTWB 4PJIF 4ONOA 3WIHH 2ERJB 4N0YH 1FVDB 3KXFA 1EAPA 5AWNL 1CICC 2IJ0C 3CX5K 3QIBA 1VB9A 1DSFL 1LGVA 1X9QA 3P30H 5I1JH 3DVNB 5F89B 1J05B 1DLFL 1TCRB 3QCVH 4LNRA 5CMAB 4AEHH 1QSZA 2RQ8A 5FHBL 5HDQH 2FCBA 4X98A 2G75B 1IILE 3KPLA 2A74A 4HCRH 3GI9L 3RWGB 4YXKH 3WIIH 4XBGB 5ACZA 4YBHA 1UWEL 2VDQH 4X80L 3BD4A 4LARL 1SY6H 3H9SA 5C0JA 3TNMA 1WBYB 1U8IA 4Y1AD 3NCEB 4YDVA 3VA6A 3NFSL 4NQTA 4I48B 1S7XA 1DBBH 2MKWA 3JV4A 3IU4H 4NCC2 4G5ZH 1JGVL 1VEPA 1YNLH 3CUPA 5DDHB 2J6EH 2ZJSL 5I1HH 3UTZB 3QUMH 1QR1B 4OCNC 3RDTB 4EQ2A 4ODUB 1MJUL 1JMZA 1WZ1L 4G8FB 1NAKH 1E28A 4XH2A 1QP1A 4JKMA 5JQHC 3M45A 2GHWB 4PJ7E 4X9HA 5EPMA 3VWJA 5FYJL 3BKJH 3QDHA 5DHVH 5DXWA 1FBIL 5F96L 3FT2B 2C4XA 4YHOH 3TVMC 5GGRY 4M00A 1ZHNA 5F7UA 4AQ1B 3I9GL 3NA4A 4NQCD 4HV8A 4K3DL 3VXMB 1KJ3H 1G7JB 5J89A 3MCG1 3KPOB 1IM9B 1FVEA 1MI5E 3HZMA 4N90D 1AXTH 2R1YA 1RQ5A 1UJ3B 3GK8H 3LPWA 3REVA 3VXUD 4AL8L 3OWEA 4G3YH 1W72A 4MXVE 4DZ8B 4O9HH 1NSNH 1CDIA 3C08H 3EKCA 4LOUC 5DJ8B 1FZMA 1NMCC 4OT1L 3GGWA 4P3CH 3MRQB 4ZO8A 3DX6B 4RNRB 3CSYB 3WSQH 2AGJL 4ZS6D 5DS8B 3NFNA 3FN0H 2B5IB 3MUGA 1P4LB 2V2TA 5A2IH 1QSVA 4OM0H 1MCOL 1INEH 2OM5A 4XI5C 4WW1B 1AQDA 1T1ZA 4XXDB 3BRFA 3DI2B 2WBJC 4J3SA 4ZUTA 2G5BA 5DJCA 3BEWA 4YK4B 1S9YA 2IGFH 3ULVF 1QVOA 1IGFH 4EIZC 2IEPA 5I6XC 5HHPB 2J8UB 1DBJH 3V5HA 2H6PB 5I16A 3V79C 3MXVL 2YC1B 1BFVH 4DN3H 3FOMA 3VXNB 4OD3L 5AZEH 4WFHD 4YPJA 2UZXB 3TBSA 3ZKXC 5E9DE 2LFGA 2D0HA 1CI5A 2MQ3A 4L8CA 5ANMB 5CCKH 3BN3B 3U4EB 2K1MA 2QLVB 3MRDB 3TYGL 2Q87A 3KDMB 5FA4A 4HGWB 5DD0L 4DUXA 4YDVB 4H25B 1WFUA 2BY0A 4XVUC 4HQQL 4NQEA 1UWGH 4IBLT 2VXTH 2BSTA 1V5JA 2EDXA 4PLNC 3P4OA 3V95A 5KG9B 4NIKB 5IFHL 4DCQA 4GUPA 3BX7C 4GSDH 3PHOB 1UA6L 3MROB 3QIWA 1QRNB 3O9WA 5DD6B 2MCPL 4KWUA 1PQZB 3DOSA 4JR9H 5DUBB 3H42H 2BK8A 3LN9A 3EYSH 3S9DB 2Y07L 2QSTA 3M8OH 1FZJB 5EUOB 2PETA 4GRLA 4JFOB 4OLZL 1NLBH 1OTSC 2VXVH 4PJCF 4YGVB 3DBXB 4Z8FL 5IW3A 1PLGH 1NL0H 1AJ7L 2A9NL 2NY2C 4DKAA 4OZ4A 5IGXL 4P2RE 4PLKC 4D9LH 4QT5B 3U30C 4QRPE 5CJXA 3MRHA 4U4BA 3T65B 5IM7A 1C7SA 3HCVB 3SOBL 3QEGH 5L2KD 5FV2A 3RWJB 5GS0C 4KZEH 1S78D 3M07A 4IMLB 4XB8A 2QHLA 4HFWB 1JV5B 5AZ2H 5L6YL 2DQHH 2VDKL 5T3XL 4KMTH 4XVTH 5DFTA 5B8CA 1T0MA 3VFTA 2B1HH 4ODBD 5H37G 5EIIA 1E0OB 2ZOLB 3ARTA 4LPCA 5TF1H 2EYTA 5DK0A 5TDNA 2EH7L 1AQDB 2YMXH 1PJ9A 4X5WB 4RCAA 2FX9H 1PYWB 3T4AB 3KYKH 3ARBA 4JM2B 1D5ZA 1J12A 1CL7L 2C3GA 1MIEH 4TUJA 1IAKA 4HJJH 5HDLA 4PRIB 1C1EH 2C4FU 12E8L 4NWTH 1CDJA 4N5ED 3BZEA 1E6JH 5T5FH 2Z35B 3QZWA 2APFA 1AQKH 2R39A 3IDXH 2H1PH 2ZP0T 4GLRH 3KPMA 2A74B 1A64A 4JZOB 2VZTA 4PJ8D 4ODSH 4ZO6A 4DKEL 3V6ZB 1DFBL 2X1XR 3HNVH 1R5IA 4UMGA 1BWWA 4LU5H 4WI9A 4YEEA 4HCRA 4BZ2L 1OGTA 1HZHL 4X6DB 1S7TB 4ZNCD 4JDTL 3OKYA 2KH2B 3KS0J 1N5AA 4OFYD 2EDHA 4U33A 2A9MH 5E2TH 3PWPD 3O6FC 3JWOH 3OKDA 1MIML 4O02H 3LS5H 4MAYC 1S3KH 4Z7WA 3AS1A 1XEDA 5LBSL 1WC7A 3RUGF 4H25A 3B3IB 1RIUL 4OLWH 3O2VL 3QUXD 4NKMA 1KENH 5H35A 4MJ4A 3QXWA 4NQEE 1NBZA 1XAUA 4PJAE 3SO5A 5T1LD 3PXHA 4JFEA 1ZT1A 3NIFE 1YEHH 3SJVA 1ZVYA 5FV1L 1ACYL 1OOAA 4YXHH 3W81A 1CXIA 1D5IH 1PBYA 3U0WH 1LE5A 1ZANL 2AV1A 5KSAC 4WI8A 4FXKB 3MACH 3FO9A 4M43H 1X5XA 3LOWA 2HG5B 3OX8B 5HHVL 1E4JA 5ITBL 1HHJB 4YZFF 4POUB 3GMPA 4FQIL 2WAHA 4Y4HB 5GGVY 1CYGA 4UDTB 2IALA 3BEVA 1JNLH 2VQ1A 1MCBA 4POZD 4MLIA 3ZT6A 1WAAA 5BOPA 1CFTB 2R0LL 4Y16A 1H3PH 2Y5TA 3BPLC 4HKXB 5TGBA 1MSPA 1S3KL 2I9LA 3OKLB 1CVSC 2X9WA 5D7IE 5IW1B 3BH8B 1EEYB 4B41A 4JO4H 4XCCL 3HPJB 3OXSB 4N5EC 5D2NB 4JDTH 3TO2A 1HZHH 1H5BB 2AW2A 5GS1C 1UFUA 3TIDA 3G6DH 3HNVL 3LIZL 1XF3B 3PL6B 4TN9A 2ZG1A 3GMNB 3UP1A 4Q6YA 5C6PB 5KS9A 2H2SC 2VRAA 1T80A 1KIRA 4WWKA 5DQ9B 4I0PA 4JB9L 4NOFA 1YPZF 1U9KA 2H1PL 4PJDB 4HDIA 1IM3A 3VG0H 3GSRB 3V6OE 5KVGH 1LK3L 4PJ9A 5DZLA 2IPKB 2RAMA 4PJIB 1LEIA 4APQA 4RQQA 2VJXA 1A2YB 5KSUB 1MWAA 1A47A 2R0WL 3QULB 3MRPA 5EU6E 3U9PH 4Z77A 5DEZA 1G7MA 2YMXL 2QSCH 5CGYD 4JLRB 3C2AH 4YHLH 2B4CL 1E4XI 3UROR 4NKDB 3K4ZA 4P2RD 1MJ8H 3PGFH 3SKJL 1FC2D 3MGTB 1CGUA 3IFOA 4LVOC 5ALBL 5C7XH 2VITA 4XBPB 3Q5YA 2VE6B 3MA7A 3HE7A 1BJ1H 1OPGH 4XVTL 4F57L 2DQHL 1LEKB 5L6YH 3M1BB 2PR4L 2DJSA 2W60A 4F9PC 1A6UH 2DWEB 3QNZB 4OD2B 3VD9A 4M3KB 1A7OL 4MHHG 1UM4L 3UZVB 3KLAA 3BD3A 4GQ9L 4U3CA 3STZB 3LB6D 3MC0A 1AD9B 2R29H 3DV6A 3ARDB 1BGXH 1LEGB 2OLDA 1OTTC 2EDTA 3KPNB 4Z78A 2YD9A 3U82B 1F6FB 1IQDA 5IGXH 1SM3H 2NYYC 5EFIB 2IBBA 2A9NH 4BSWB 5F9DC 4CL7A 1KEGL 3SE3C 4P23B 3O3EB 2XTLA 1BZ7A 2YOCA 3OJDA 3MRCB 1IQWH 3L3KB 1JGLL 3EOBA 1L0XA 4JKWA 3STLA 3MO1B 3SCMA 1HDMA 2P8MA 4WWKB 3LD8B 1P2CA 3M8OL 5KJRH 3DYPA 3OF6D 1IFHL 2HTLC 4PJDA 4JR9L 4HMDA 2V5YA 2V2XB 2GTWA 4GSDL 3RZWA 5IFHH 1I8IA 5I71C 3MOQA 1P7KB 4QHKJ 4NM8H 4HUVA 4K9EC 2I9TB 4Y16C 5FGCB 1H3GA 5IW1A 1J0KA 4FQPA 3H6JA 3SDXE 4HWUA 5F89A 4AY0A 4OF8A 1I8MA 3HUJB 4OZFG 5T3XD 2FIKA 3I75B 5DD0H 3V0VA 4PJ5B 1M7DA 3TYGH 1MHEA 2GSIB 2R69L 5CCKL 3BRGC 1YEEL 5EUKA 2UZIH 1MFAL 4TSCH 3X3GL 3RGHA 4DGIH 1WQVT 4IDJH 2WWMD 4KQ3H 1U8QB 5GS2H 2HJLA 3U0TA 1EVUA 4DN3L 5ERWA 2WUCL 4OIIH 3LD8C 1P6AB 5K9KB 1KN2L 3GO1L 3P40A 5FUCC 2AK1H 5TQ2L 3B2VH 3TESA 4MB5A 2KKQA 1IGFL 3FMGL 3FB7A 2VNCA 1A8JH 3SDXF 3L6FA 3P11H 5TDOB 4LEXL 1JYVA 4BSWA 3QDMB 1LP9A 3X12B 2NPLX 2AK4B 5ID1B 3DIFB 3GSRA 2BNQE 4P49A 2VXQL 1N0XH 5D5MB 3VGAB 1WUNT 3ULUE 1SVCP 5BS0E 1INEL 4W4OC 3MJGX 1C5CH 4R96A 1BD2A 5E4EB 5KOMC 1I7ZB 3QB7C 3QT2A 4ELME 4LLYB 2VDOL 1T20A 1QPPA 2XYCA 2VTFA 4YIQB 3BESR 2FATH 5E1AB 2Y5EA 2GJZB 4QO1A 3FZUD 3CX2A 4K3GA 1B4JL 3HNSL 4JQVA 4NP4H 5FYKH 4OF5A 4XPFL 1QHOA 2JB6A 2B7DT 1MJ7H 2Y9RT 5D1XB 1JHTA 4XBGA 5ACZB 3ET9F 1MCSA 2Y06L 2QQKL 3FAWA 2FL5A 5CBAB 2X4NA 3BN9D 1L7IL 5BV7L 4JHBA 4NWUL 3JSSA 5DT1L 4GG6E 1U8NB 1HHJA 3THMH 3X13A 4IRJA 4JFFB 1TFHA 4R97B 5HHNB 3BJLA 4P9HH 1JWMA 3BDYL 1VESA 1RFDL 3RI5F 4IIQB 4B50A 3LEYL 4M7JL 4FNLH 1KCKA 1PG7X 2R23A 4WJ5A 3RIFK 3UYRH 1TJHL 4HXBL 4BQ8A 2VR9A 1D9KC 1SBBA 5IP4A 1T66D 4U1JB 5DS8A 1T21B 3I85A 1F6AB 3U2SA 4LASH 5C1MB 2BCKB 3TH3T 4P5MA 1CDYA 1SYSB 1T2XA 3NFSH 5I1LB 4OCSH 3SHSA 4Q9BA 3P0YL 3UAJD 2WUBL 1P84K 4RX4A 3ARGA 3BW9B 1ORQB 4O58L 1DZBA 4Z7QE 5DMKB 1CICD 3PWVB 3MLXL 4JFHD 3RGVC 3EOTL 1AR1D 3MMEB 3VFSB 2AJ3A 1TVBA 2BVQA 2ZUXA 4IRZH 1W0WB 4EUPG 4BYHA 3MV7A 4LEOA 4ZDHB 1C5DA 2R2BB 3HG1B 3QCUL 4P2QD 3R0NA 3EDEA 4KRPC 1DLFH 5DJ8A 1GGUA 4M7ZB 3QQ9C 1QLRB 5E6IA 4RA3A 4P46B 2BSTB 3QIWC 3SDDD 1NFDE 2XKNB 2KDGA 3S4SG 5J11C 4Y4KC 3O3DB 5FO7B 4BFGA 5BXFB 1RZGB 3BP4A 1HH6B 3GNMH 2PO6D 3WXWL 4FXGB 1Z3GL 2Q7YB 1G7IB 4EI5C 4LQ1A 4LCCA 4HS8L 4R8WH 4JPVL 1NC2D 3PL6C 1P7QA 5CINH 2EDQA 4NSKA 1BQHA 3NOIA 3SGKA 2ADFH 5L9DL 4XC1H 2P8LA 4MAYB 4B0MM 2CKBL 3MUJA 3DUUA 5E8PB 3MOBL 2NCMA 1EMTL 5LWYH 1KELH 3IB4A 4MDJB 1INDL 3I3BA 1G6VK 5H2BA 3CFEA 1LEGA 1LP9E 1I8KA 4PRNA 4R7NB 3G5XB 1J8KA 2WIIA 5J11B 4F80A 1GJIA 3VXSE 1BBDL 2OI9B 3HKFA 4UOW1 4P46C 1KPRB 4ZUUB 1DANT 3WFHA 3QAZB 2GITB 4ZTPL 1KGCD 1KCUH 4CN4A 3GKWH 1L9NA 3D6GA 3B9AA 4M62H 4M02A 2CIKA 4NPYB 3INUH 3HLAB 3T0EA 1RV6X 1U8OA 3GMOB 1K3IA 4HF5L 1QA9A 2E9JA 3OAUH 2DAVA 1YA5A 2E7CA 4PP1D 3IDYC 3O45A 2P24A 2NY3B 4OQTA 1H3TA 4LIQL 4IRJB 3PDOB 4ZFOA 5J9PB 2BSRA 4AQOA 4G8IB 2A38A 1Q38A 4LSRH 1HHGB 2LE9A 4PBVC 1RZIA 4MNQB 5F6HJ 4PFEA 4I5BB 3TBVB 2CDGB 4K94L 2LV4A 5EOCL 3OXRA 3CH1A 1X5IA 1L7TL 4PRHD 4KJPC 1A6AB 1UKSA 2VLLB 5TE6L 4FFZL 5F9WB 5IROC 2OK0L 2BMKA 2VSDA 3VXSB 1VENA 4PB0H 2MTPA 2XWJB 1JF1A 2MJWA 1FL3B 1K8IA 5LXGH 2BVPA 3QI9A 3CFCL 4G6AC 3MRRB 5BS0A 4V2BA 1Q9OA 2Q86A 4O2EA 3AREB 4N0CC 1I8KB 1CDUA 4PRNB 2VXUL 1GGIL 5GJTL 4RMWA 2MKLC 3UC0L 3H0TB 3JBG7 1A9EB 4UT6L 1TXKA 4E5XA 4KTEL 3TCLA 3FRPG 4ODWA 2WIMA 1MLBA 5FA3A 3RWIA 1M6OA 2UY7A 1PG7L 1BLNB 4K71B 4YLQT 1WITA 4MNGA 3IU3B 5DHXB 4XX1E 5JTWA 3ZKNC 3GBMH 5KVEH 1FL5A 3G6AA 3SE8L 3FB8A 3S98A 5DMIL 4HULB 3GKZA 3BKMH 4JPWL 4MJIB 4OQ1A 4ZAKB 4PYHA 4PJGA 4ELKA 4NN5C 3ARED 4WNQA 3S35H 4AIZA 4XZUA 5GZNC 1X4ZA 3HMWL 1RUAH 2EC9T 4WCYH 5DD1H 3QQ4A 3EJZC 3BEVB 5BW7A 1HHGA 2EZ0C 3MRKA 4KJQC 5D6CB 1ZAGA 2CXKA 4HUUB 2X4NB 4RMUA 1A3LH 2F58H 4G8GB 4MWFB 3KPSE 1SJVA 2CPCA 2NY1D 4I1NB 4K71C 5BZWA 2O5XL 5GZND 4KMLB 1V7MH 4L3ED 4F7EB 3BIKA 1Q0YH 5TE4L 1IEAB 2ICEA 2NY5L 1U95A 4P9MH 4HBCH 4K3HA 4OZIB 1XGRA 1G0XA 3GMQB 4PG2C 4WHTB 3MRLA 2WBWB 4NC0B 5JPNA 4PJEE 4XPAL 2CDEA 2ED8A 4HWBA 4YPGB 5HDBE 3QUXC 2HLFC 4DUWA 2AI0H 5D93C 3UJTH 4OI8A 1IBGH 1Y18A 3HPJA 1IAII 1UJ3A 2EDWA 4NUJB 5JA8B 3TA3C 4N90E 1A7NH 4JFXB 5FYKE 2P5WA 1FL6A 4ZS7L 2CLRA 3SE4C 3QWOA 1MCQA 5C07B 3T3MF 4LLUA 4N1CA 4MX7A 4YX2H 1T83A 1HKFA 4YWGL 4LP4A 3TNNA 3H9SD 4D9RE 3DXAD 1RUPL 1X5HA 3G04B 2AXGB 4Y4KA 3IGAB 2VQ1B 2MQ0A 4G6AD 3RKPA 1EA9C 1YC7A 5CILL 3GFUA 5L0QB 1JTTA 1FORL 3FO2A 3HUJF 5IVXB 4QRRA 4LLQA 3W39B 3G6JA 2QJDA 1AGBB 4TNWK 2VR4A 1CGXA 2ENSA 3DX7A 3WN5B 2Y6SC 3BO8B 1YEDA 1LO3L 3DI3B 3F7PC 5E8DL 1GGIH 2N4IA 1S8DB 4OCWL 5T5NF 1AHWB 4ELMB 4PJ7B 4OZFA 4F15B 3U83A 1Z2KA 4DKFL 1FRGL 1F11B 1F4AA 4OQTH 4MD4B 4LVEA 2XY2A 1XF3A 3ZL4L 4RFOL 2Q8AL 1PAMA 2D7MA 2YD3A 2MPAH 1ONQB 4P4KB 1KPVA 3WD5L 4F7CA 4J2XA 2OK0H 2EDRA 1M4KA 3LV3B 5GRWA 2F53B 4K94H 4CDHA 3OKOA 2MWCA 4WUUA 2X4TA 2YD7A 4M9PA 4RQQB 4GRWE 5AYUH 3S37H 1J1OH 4MDIB 4ZTOH 4CJ1A 2NR6D 3WYRA 3QPQC 5IB3B 4WHCA 5GGSB 3NH7H 5JOPE 1J1XL 4U6XB 4NKDA 4HF5H 5I1IH 2DOCA 4MWFA 5L8KB 1ZGLM 3ILQC 2C4FT 3MV8D 4P5TA 3N50A 3NZ8B 3KPOA 3BISA 5HY9A 2CIKB 4GRLB 3C8HA 4X7EC 3ULVL 1K2DB 3CFBA 4ZTPH 2ICEB 5DUPL 3FRUB 3NAAH 2R9HC 4QRRE 4JQVC 5DJDB 4HIHB 2YEZA 3KYAA 1FG9C 2OSLB 3CC5B 3D69A 4JKKA 1I3UA 4OLUL 4KRLB 3TO4D 5C3TA 1YMMD 2EEAA 3T0WA 4Q7DA 3P9LA 4KVCL 1QSFB 1N3NB 2C3VB 3FO0L 3DXAA 4Y4KD 1OAQH 3EOYG 5C2UB 3ZE2F 4ZFOL 2BNRE 3QUKB 3WFDH 1CD0A 3STLB 3FQRA 4KUZH 1NPUA 5FUOL 4CW1A 2DQTH 1VKXB 2BNUB 1RHHA 4OD1H 4J3OC 3STBA 1G7LA 4BZ1L 1EHLH 4AMKH 4HS8H 4R8WL 4WW1A 1CD1B 2YPLE 2ZCHL 3DHJA 3GRWA 1OB1A 5EC1A 1AR1C 4X7CC 1BVKB 2VDLH 3RGVD 1LE9A 4YNYA 4P4RA 3H3BC 1QSED 4UI2A 3RZCB 1HEZA 5KSAB 4LLYA 4TUJB 2AXGA 3QDMA 2QADB 5D70H 1MLBB 5FA3B 1KEMH 1NC2B 3FO1B 5DK2B 3T2NH 1YN6A 5FO8B 4X9IA 2I60L 3QUZD 3NCYS 4JFYA 4LDLB 4XCEB 5IMKB 3ROLA 4Z7UA 4U2ZA 1CFQA 4TSAH 4UTBL 1D9KD 4PGDA 5EOQL 3PP3K 1YEFL 2OL3L 3WCYA 3EUUA 2IH1A 4PJCB 4S0TD 2FJHA 4FQXB 3VDAA 3IXTB 2J1KA 2WUBH 43CAB 4Y4FD 5FDWA 1X5GA 5GZOD 2APWA 5HYJE 4TNVF 4X6CA 5CZXC 2OBGA 4ZS6C 1LO4L 3BIAX 4YDJB 5FYLL 4IJ3B 1N5AB 4LASL 3MFFB 4PJDE 1DE4A 4XP9L 1U8LB 5L2KB 3WL9A 4PJHE 2DQFB 4YDKL 2D0GA 3UYPA 1RZKC 1W8OA 2UVEA 1OAXH 1IGML 2AKRA 4M4PA 5ICZA 2E7HA 3BN9C 3D0VB 1HHHA 4R3SA 3PHOA 5HHMB 1NLDL 1VERA 3GSNL 4ETQB 4GMTH 4GO6B 3D39B 4ZXBD 1Q8MA 3D3VA 4M1GH 2R8SH 3VGHA 5I2IB 4N0RA 5EU4A 5HYQA 2H2PD 1A4JA 1N5YL 5D2LA 2VZOA 4WHDA 3FFCE 3VW3L 2BCKA 4Q9CA 3CGTA 1F3RB 3U30B 4OBSA 2A83B 4OUUA 2APVA 4KKAD 4PS4H 3QPXL 3TBWB 4PRHB 1QRND 1RAMA 4LAQH 1JJUA 4GKNB 4PREA 5KSVA 1U58B 5ACLA 3MNZA 4OLXH 4JRYB 1G7QA 2FYYA 4G9FA 4K3JL 2VAAB 4C56A 2GFBA 3ZDYF 4UBDC 2ZPKL 1LD9B 2PXYB 4ZO9A 1FAIL 5FM5M 3B5TA 1ULVA 4HS6B 5DRZA 5MEPA 1H0DA 2K9UA 3BWAA 3ZHKA 3GB7A 4NRYB 4U1SA 3EYFB 1NBQA 1ZKAA 2D0FA 3EDKA 3VD7A 1C5CL 1KCLA 1R0AL 1XMWA 5DD5H 3RJQB 1OT1A 2FJHB 2Z8WC 4ONGL 1L0YA 2JCCB 3BHBB 4MD5B 2VXQH 4OZGB 3N0PB 1G7IA 4LSVL 1RIVL 3S5LB 3KPRA 1P7QB 1ZLSL 4DW2L 5HHOA 5DRNB 3ARBB 3MA9H 4JM2A 2K7PA 3FHAA 3SKOB 5D93B 5TQ2H 1OGAD 2RB8A 3ZTJH 2WUCH 2Z35A 5MENA 1FZOA 4GRWF 4HBQA 1RZKL 3S34L 2XNAB 4JZJA 3V7AG 5D6DA 2DQIL 4BUGA 1KFAH 2YPLA 5E03A 3HE7D 4FQCH 3GMLB 2NY4C 2EEBA 4WFFE 5D7JD 3MYJB 5C2BL 5KSBA 5CEXB 3HPLB 1JPFA 1U93A 2X4SB 2EDOA 4DJMA 4LMQI 4NM8L 3TWCH 3C6LD 1AO7A 5T5NG 3IFNL 4OKDA 4FQXA 2ATPB 3FJTA 1URLA 3IDJA 1YC8A 3O6MH 3OKMA 3JUZA 3BP7B 1A1NA 4NFBA 3WO4B 1IFHH 3V6FB 3ZYJA 1BX2A 2DQEL 3L7FA 2R1YB 3O6KH 4ZFZB 3SCMD 1CG9B 4XNXH 4MCYB 5HVGB 2W9LA 1FZMB 5FYJD 4Z18A 3V52H 2AXFA 4M1DL 3VFMA 1VFBA 2XZCH 4JFED 3D69B 1S9YB 4JN1H 1HQRA 4Q0XL 3CSPA 4L4TD 4L9LB 3VWJB 1I1FB 5D2NC 4WI7A 2KL6A 5CGYC 1X5YA 4OZIF 3D3VE 5FM8A 4HAGA 1NFIA 1T1ZB 3RAJL 5D4QA 3G08B 4R4BA 3BKYH 4Y5YA 5T1DL 3L5JA 4U0RC 3EO0A 4WI6A 4WEBH 1CXLA 1H8OA 4JHZA 1SMAA 2ZZUT 5EUOE 4OLYL 4X7DC 5BO1H 3F12B 3VFPB 4U1LA 1K5NB 5I8CB 2WM0A 3C2AL 5CLWA 2ITDA 1KLGA 1T3FA 1WEJH 4NC1E 3BPNC 1VA9A 5CEXA 43C9B 1LE9B 5J8OA 2CH8A 2PW2A 3PABA 4YZFE 2HT3D 3U9PL 4OI9A 3VXRA 4PGCA 4OBRA 3A67L 1BEYL 1QNZH 3R06B 4I2XA 4PRPB 1EEQA 3TV3L 1JHLL 3VI4F 3UJJH 2ZCKL 4NHCL 5DVOA 3T1WA 1QSFD 1OP5H 3MJ9A 3IFOB 3UZQA 2ERJC 4WWKD 2Y36H 1PGRB 1JWSA 4OIBA 4WEMB 4X6FB 2NXZC 4DK6A 3ZDZF 4ELMF 4QXGH 4GBXD 1EHAA 1G7MB 1I3VA 1QVOB 1JF1B 4HIXL 4KXZH 4CVXB 4TOYH 1I1AB 4NQXA 3V8CA 1CICB 4NGHL 3G6DL 1JWUB 2OJEB 4MHHI 4YHZH 2AXFB 4NHUA 3BPNB 1CBVL 4JO4L 4KKCD 3LZFH 2DD8H 1AE6H 3CVHB 1I1YB 4XWOD 4PRPD 4FFVC 3ULSB 2NLJA 2VIRB 3ZDXE 2HLAB 5GGTA 5ADPL 3QA3A 1ODAA 2NW2B 3WFEL 4NT6B 1JNLL 1J0JA 4RGNC 3RWCA 5KVFL 4UZGA 3L7EA 4WW2B 5TPWL 1U95B 5HHVH 4PJ8B 1Y6MR 1FL6B 3MACL 3P4LA 3QIWB 3AMLA 3OJDB 4Y0GA 3O6FD 5HHOD 1ACYH 4HUVB 2I9TA 2XA8H 1U8NA 4Y89A 5TDPA 3VXRB