4DAJA

Structure of the m3 muscarinic acetylcholine receptor
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
432
structure length
429
Chain Sequence
IWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVISMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRTTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFYMPVTIMTILYWRIYKETEKMNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYLIKEAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNPVCYALCNKTFRTTFKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics of the M3 muscarinic acetylcholine receptor.
pubmed doi rcsb
molecule keywords Muscarinic acetylcholine receptor M3, Lysozyme
molecule tags Signaling protein, hydrolase
source organism Rattus norvegicus
total genus 159
structure length 429
sequence length 432
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4dajA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4dajA01
1L47A 1XJIA 5ITEA 1LWGA 3UTWA 3SB6A 1L55A 1QT5A 1QTVA 4N6HA 1G0PA 3VI0A 1L02A 2B7XA 151LA 3HH6A 4LZMA 4FBZA 4W53A 4JKVA 114LA 234LA 4LDEA 1C3WA 217LA 196LA 5TGZA 1M0KA 1P56A 1CV6A 1ZWNA 4ZPUA 111LA 169LA 1L94A 4WW3A 4G71B 2X72A 4BUOA 1M0MA 1DYBA 3GUJA 1C8SA 188LA 223LA 5B6VA 127LA 2RBSA 2OTZX 1H2SA 178LA 3V2WA 1C6EA 253LA 1L87A 1XJUA 184LA 1P36A 5H2KA 182LA 199LA 201LA 1HZXA 2RB0X 1QT6A 3GULA 186LA 3GUIA 5G2CA 4GYCA 1QT7A 3GUPA 173LA 4JQ6A 3CDTA 1SX7A 2Q9DA 3C8RA 3FADA 5JJEA 1LYEA 1T97A 4EKRA 3PWHA 1L71A 3SB9A 4N4WA 2QB0B 3CDOA 2EI4A 3SN6R 175LA 1P64A 1QTBA 3PBLA 1L29A 1L76A 1L93A 4I7SA 5ETZA 1C6BA 1QT8A 1L46A 5DYSA 1ZYTA 2F32A 4QI1A 1L42A 2HULA 3L2XA 1PXSA 1L16A 1LYIA 1L66A 3AM6A 3SB8A 3QBLA 123LA 4MBSA 3C81A 1G06A 3HANA 1QSBA 4BEZA 3HARA 3UTXA 1P8IA 2B75A 1D2YA 239LA 3QJUB 5J7AA 4XT3A 1L17A 1JTNA 1L04A 2BRDA 3EH5B 2B6YA 242LA 4IAPA 1DYGA 1L05A 3FA0A 4PXFA 1L99A 4KNFA 1PQMA 1C66A 7LZMA 1CU6A 1Q5IA 4I7KA 5LZMA 1T8AA 1C61A 4ARPA 4EJ4A 2Y03A 1L22A 1QTZA 237LA 1X0K1 5B6YA 3C9LA 4BWBA 1CX6A 2PEDA 1KMEA 1L07A 143LA 1VGOA 109LA 113LA 1C67A 1LYJA 163LA 189LA 248LA 4E97A 5B6XA 1T6HA 3D4SA 3VGAA 1L83A 2HUMA 1L30A 1CV3A 2RB1X 1JQUA 3P0GA 3DN6A 2R4SA 4GBRA 1C6QA 262LA 205LA 209LA 103LA 3L64A 1DYFA 3QBIA 257LA 107LA 1JV7A 2RBQA 1P2RA 1QSQA 2F95A 102LA 3DN4A 4EXMA 1PXRA 1SWYA 2Z6BA 3HTDA 251LA 1R84A 119LA 166LA 3QJSB 4X31A 4X32A 1P7SA 1NHBA 5DHHA 3QJQB 1C6CA 2A4TA 1KGBA 2RAZX 198LA 3OAXA 5KKHA 1KS3A 1L60A 230LA 1OV7A 245LA 2OEAX 4EPIA 1CTWA 3MBVA 3SBBC 4W56A 126LA 1D9WA 4MD1A 1L63A 4FPDA 164LA 4YX7C 3HUAA 4I7NA 120LA 1S52A 1D3FA 170LA 2JAFA 2YDOA 4G7QB 1GUEA 2YCXA 1C6HA 4FAAB 3SB7A 2YCZA 1IW6A 1LI3A 3VG9A 1L77A 1OVJA 235LA 3C8SA 1LGUA 4GBRB 191LA 4EKSA 4I7JA 1T8GA 4I7RA 4PXKA 2O4WA 1L82A 2O7AA 225LA 254LA 1QKOA 2O79A 1P6YA 3PXOA 156LA 3S3BB 3K2RA 4LDLA 4I7LA 1CUPA 4ARQA 2LNLA 3DN0A 4W54A 4XTNA 1DYCA 3S8GB 220LA 1L53A 2LC9A 1KY0A 4I7PA 249LA 3PQRA 192LA 1QUGA 1S8JA 2LZMA 1L51A 1QUHA 4LDOA 2ANVA 180LA 1FBBA 1L35A 3C7YA 4UHRA 1L24A 1G1WA 3ZPRA 3DN3A 2Z73A 3DQBA 1KW7A 3GUOA 3PDSA 1F88A 1Q5JA 3A7KA 1L41A 3S8FB 1LGWA 1L49A 3EH4B 2ZZLA 1OVHA 1X0SA 1OWYA 5AX0A 2B72A 1L10A 172LA 1L06A 3OE0A 240LA 5B2NA 5B6WA 160LA 1L11A 1L74A 1L85A 2R4RA 3CODA 1L32A 1WTHA 1L48A 129LA 1JV6A 3KJ6A 258LA 3HT6A 5H2MA 1AP9A 1LYHA 5G28A 1CU2A 1L50A 3HH3A 4KLYA 1P5CA 3DN8A 1L43A 2ZFEA 1GU8A 3NY8A 3X3CA 4FA7B 4HYXA 1P8UA 141LA 3VW7A 3S3CB 4I7MA 3EMLA 3F8VA 1QT3A 1C6GA 4UG2A 150LA 2OU9A 4YXCA 4EIYA 1EHKB 3CDRA 2B74A 4W59A 1L58A 2M3GA 3X3BA 227LA 6LZMA 252LA 2Z55A 1JTMA 1F4ZA 4EKQA 1L01A 228LA 2B6ZA 1D2WA 219LA 2I1XA 108LA 1L23A 1L0JA 1QTDA 4BVNA 1TN5A 4XT1A 1L25A 1QHJA 4MQTA 218LA 1KG8A 3QDCA 4J4QA 5H2IA 145LA 4BV0A 1C64A 4IAQA 1L52A 2YCYA 5ITCA 1C65A 4PK0A 5BR2A 259LA 221LA 1OV5A 1C62A 1L36A 1C69A 1S54A 4XXJA 214LA 5H2HA 1L14A 1R2NA 1C6LA 1P3NA 1L57A 3EH3B 1L95A 1G0KA 4I7TA 1FBKA 1UCQA 4PJZA 4L35A 1L84A 1L15A 4W52A 3NSBA 1EPYA 3UTVA 148LE 146LA 1C63A 3DNAA 3BVDB 1I6SA 4XTLA 4GRVA 2RB2X 2YCWA 4JR8A 2NTGA 5H2OA 4W51A 261LA 177LA 2OU0X 3C8QA 4EKPA 2KSYA 3DN2A 4EPFA 1E12A 247LA 2RBOA 3DMVA 2KS9A 5BR5A 5B6ZA 2NTUA 4AQNA 2B6XA 125LA 142LA 3COCA 181LA 147LA 152LA 1L79A 1LI6A 1L39A 2QARC 1L72A 4HWLA 1L26A 231LA 1MGYA 1L92A 3NY9A 250LA 1CV4A 1L91A 165LA 3HUKA 187LA 1L27A 2F2QA 3DN1A 4OO9A 216LA 1D3JA 3RFMA 1L97A 1QUOA 1LN6A 1U19A 1L73A 104LA 1K28A 2OU8A 3ZEVA 3RUNA 3F9LA 2Q9EA 4K5YA 1QT4A 2B6WA 2OTYX 1BM1A 4BEYA 1OVKA 3OE8A 115LA 1PQJA 1DZEA 1S51A 112LA 1L21A 4GP4B 1L31A 1L81A 215LA 1L9HA 1L75A 2I21A 1C68A 3HT9A 1LWKA 226LA 195LA 2KSBA 3VVKA 1P37A 4W55A 1L34A 159LA 4S0WA 4WAVA 130LA 1C6NA 3HAQA 149LA 2I20A 1O0AA 2HPYA 1IXFA 2L6XA 1L38A 1XEPA 1BRXA 3HDEA 3QJRB 128LA 1L86A 3QBGA 200LA 1L89A 3UZAA 1C6AA 3QAKA 2RH1A 3UONA 5G2AA 4OV0A 4X1HA 1LPYA 4GP5B 3DMZA 1L18A 4G72B 1D3NA 1L00A 1L68A 155LA 110LA 3GUNA 2WJKA 3G3XA 4I7QA 1L80A 3GUMA 1L45A 3HASA 1S53A 2RBNA 157LA 2Y02A 1L09A 1PQKA 5G36A 158LA 1DYEA 4A4MA 3C9MA 161LA 1L03A 1C6JA 4AMIA 5JJJA 185LA 1B6IA 1X0I1 1L62A 1C6DA 1C6KA 229LA 190LA 1KNIA 1L88A 236LA 131LA 1C6TA 2F47A 2RAYX 5I14A 1KW5A 1E0PA 1JFPA 4N4YB 3ZPQA 183LA 3HT7A 4IB4A 3OE6A 1LYGA 1SSWA 1L64A 138LA 1L90A 1TLAA 3HWLA 3NS0A 1QS5A 1LI2A 4DKLA 2AT9A 4W58A 5B35A 197LA 233LA 3HTGA 4ARQB 1P2LA 3CAPA 5G54A 1L44A 2L78A 5G53A 1QS9A 213LA 2ANXA 238LA 3HH5A 1S8LA 1P46A 1LYDA 1KG9A 255LA 3NYAA 1LW9A 2NTHA 3ODUA 3S3DB 1TN0A 3CDVA 224LA 171LA 1CWQA 4G70B 176LA 1CU5A 4G7RB 168LA 3HU9A 3UG9A 3LZMA 2IGCA 5AZDA 1D3MA 5LWEA 212LA 2RBPA 206LA 1BRRA 222LA 4ARJA 4L6RA 4DAJA 1L65A 1C60A 139LA 3WQJA 1CX7A 1C8RA 144LA 3CDQA 5G2DA 3T45A 1SSYA 1QKPA 2OE7X 5H2LA 5A8EA 3HH4A 1CVKA 244LA 246LA 3JR6A 3HU8A 211LA 3G3WA 1L69A 3HT8A 1L37A 5H2NA 5H2JA 2I35A 1L13A 5AX1A 3UZCA 1AT9A 2RBRA 1P8HA 3C7ZA 1C6IA 5B34A 1G07A 1G0MA 2YDVA 4DJHA 2J4YA 5DHGA 1L12A 1L20A 3C7WA 1XJTA 2B6TA 3C82A 3ABWA 3QJTB 4Y9HA 1PY6A 3VHZA 5A45A 3QBKA 2NTWA 2B73A 4YXAC 1L67A 2VT4A 5F8UA 1JGJA 3REYA 174LA 3FI5A 3SB5A 260LA 2OE9X 1KY1A 3DDLA 5B0WA 2QPDB 1CV0A 4TL3A 1ZURA 1LLHA 1QTHA 137LA 2LCBA 1OWZA 1G0GA 4ARMA 1XMEB 4I7OA 4ARLA 1C6MA 1SX2A 1L59A 3HUQA 4EA3A 4W57A 167LA 3OE9A 2WJLA 1OYUA 1XIOA 1CU3A 3C80A 3C83A 1IW9A 5A44A 1C6PA 1CUQA 2JAGA 5JJNA 1G1VA 2HUKA 1CU0A 4GP8B 210LA 3G3VA 4IARA 1DYAA 1M0LA 1DYDA 1L28A 2Y01A 3SBAA 4QIDA 5AHZA 4MD2A 4HYJA 4MQSA 1BRDA 3HAOA 3AYMA 1F50A 140LA 118LA 122LA 162LA 2Y00A 2OE4X 1QM8A 256LA 243LA 3V2YA 3AYNA 2KSAA 1VJMA 1PQOA 2B70A 1T8FA 5AWZA 2QPEB 1L70A 1L61A 1G0JA 1L33A 2CUUA 5AHYA 3HDFA 3DKEX 1PQDA 1L96A 1LYFA 1QUDA 3DMXA 241LA 1G0QA 232LA 4XTOA 1SWZA 1H68A 1CV1A 3RZEA 4ARMB 3HAPA 4NC3A 4QRYA 1UAZA 5H2PA 4GPOA 3GUKA 3HTBA 2Y04A 1L98A 1QTCA 1L19A 2G87A 2F93A 5C1MA 1L54A 1PQIA 1L08A 3HTFA 3UTYA 1C6FA 1GZMA 3QJVB 4G7SB 1L0MA 1G0LA 5EN0A 1L40A 1L0KA 4AMJA 1LGXA 2ZIYA 3QAPA 1CV5A 5FJGA 1L56A
chains in the Genus database with same CATH superfamily
5ITEA 4GN3A 1QT5A 3VI0A 1LZNA 4JKVA 1UICA 234LA 4LDEA 1C3WA 1GF3A 4BS7A 1P56A 1ZWNA 4NHPA 4ZPUA 3TXEA 4DT3A 1M0MA 3GUJA 4J7VA 2D4KA 223LA 127LA 4WM4A 1L87A 1J1XY 1LZEA 1LJ3A 5H2KA 201LA 5G2CA 4Z41A 3GUIA 186LA 4H9FA 4NHTA 1LHMA 3A34A 1QT7A 4D9ZA 4JQ6A 4LYTA 3CDTA 1SX7A 3C8RA 1LYEA 4NG1A 1WQOA 4EKRA 2QB0B 2NWDX 1GB5A 3IJVA 1QTBA 3D3DA 1L29A 1L93A 1GE0A 4I7SA 4ETEA 1XFPL 1YL0X 1L42A 1PXSA 1YROA 1LZ9A 4G4HA 2H9JA 3HANA 4WO9A 2ZNXY 2B75A 5II3A 1GXXA 4XT3A 2ZIJA 242LA 4UWUA 4IAPA 3FA0A 4PXFA 2YDGA 3EMSA 4WM3A 5LZMA 1C61A 2BQNA 3WVYA 1B2KA 1JKBA 2Y8PA 1CX6A 1IIZA 4WLYA 3TXDA 4GCDA 143LA 109LA 1CJ8A 1LYJA 4WLTA 1T6HA 2F4AA 3VGAA 2HUMA 1L30A 1KXYA 3WPJA 4GBRA 1WVVA 205LA 209LA 103LA 4LYOA 257LA 1GE4A 5KXPA 1SWYA 3HTDA 5JENB 3QJSB 1AM7A 5I4WA 4DQ7A 1NHBA 3QJQB 1GB0A 1KGBA 3SP3A 1JSEA 198LA 3OAXA 5KKHA 1L60A 1LJIA 1PZYA 245LA 5LYZA 3SBBC 2DQDY 5E9RA 4W56A 4NY5A 2HUBA 7LYZA 4I7NA 120LA 1D3FA 4G7QB 1JJ1A 1GE2A 4NWEA 1LI3A 1L77A 4EKSA 3WW6A 1T8GA 4I7RA 4PXKA 1IWUA 1UBZA 1YANA 4BADA 3PXOA 2ZIKA 1AZFA 1C45A 1JPOA 4LDLA 2LNLA 2Z2FA 3DN0A 2WARA 3S8GB 2CJLA 2LC9A 4I7PA 192LA 3WUAA 2LZMA 5EBHA 1QUHA 1L35A 1F6RA 1OUJA 3P4ZA 1AT6A 1C46A 3DN3A 1Q5JA 4GN5C 1GXV2 3EH4B 2CGIA 2ZZLA 5B1GA 160LA 1L11A 3AZ7A 1L85A 1WTHA 1L48A 129LA 3FI7A 258LA 1HELA 5KXMA 3CT1A 1CU2A 3HH3A 2ZFEA 3X3CA 4FA7B 4IATA 4LT0A 3F8VA 1C6GA 4UG2A 1ZMYL 2HEBA 2MEEA 3CDRA 4W59A 5A3EA 1JTMA 1L01A 1LSAA 2HEEA 4OOTA 1BQLY 4XT1A 1QHJA 4ET8A 218LA 2EIZC 3QDCA 4MQTA 1IP1A 1DKKA 1QQYA 2MEDA 221LA 3M3UA 1AKIA 1NF5A 1CKFA 8LYZA 2EPEA 1L14A 1TDYA 1P3NA 1L57A 3EH3B 3A90A 4I7TA 1CNSA 5ILFA 2HECA 3AW7A 3EO5A 2F30A 1B7OA 1C63A 1LYYA 2YCWA 5H2OA 1UA6Y 4WM2A 1VATA 1NHEA 4EKPA 2KS9A 247LA 5B6ZA 1NDMC 1GFVA 4CFOA 3ZVQB 1NMMA 1LJNA 5LVHA 1GFUA 4DQ5A 4II8A 165LA 4GCBA 2Z39A 2FBBA 3TXHA 4DYGA 3ZEVA 1OUIA 4UWNA 2B6WA 3A91A 6LYTA 3OE8A 1EQEA 1LZ8A 1PQJA 1B5WA 1L75A 2I21A 1C68A 3TXFA 1B7NA 1LWKA 5FCPA 1VDQA 1BWHA 1FKVA 3B0IA 4OWCA 3VVKA 1QUTA 1L34A 1DI3A 3HAQA 149LA 4RW2A 1REMA 4Z46A 1FLQA 1HMKA 128LA 3UZAA 1JHLA 5I4XA 3UONA 4DWXA 1LSFA 4XJBA 4GP5B 1LZSA 4G72B 1L00A 1L68A 110LA 1J1PY 3HASA 1LZ1A 3A3RX 1S53A 1QDRA 4A4MA 161LA 1L03A 4LT3A 5FSTA 3AYQA 1B6IA 4DD3A 1VAUA 1IX0A 2ZYCA 1GFHA 2BQHA 4N4YB 3ZPQA 5A3ZA 3HT7A 4MR1A 3OK0A 2LYZA 3OE6A 1IORA 4M4OA 1L64A 138LA 3HWLA 5F9UA 4W58A 2DBTA 1I1ZA 1LHHA 4ARQB 5G53A 213LA 3WYHA 1YAQA 3ODUA 5C6IA 3CDVA 171LA 4G70B 176LA 4G7RB 4H93A 5B59A 3UG9A 3LZMA 2IGCA 4LT1A 5LWEA 4PJ2C 1BRRA 222LA 1QIOA 1L65A 1C60A 3A67Y 4CJ2A 3G3AB 1CJ7A 144LA 3A93A 3CDQA 3T45A 1CJ6A 3HH4A 1CVKA 3JR6A 246LA 1WTMA 3HU8A 1LKSA 1TAYA 4KPMA 5H2JA 1L13A 1LMTA 5IELA 5C6LA 1GFEA 2Z2EA 1JKAA 4B4IA 5DHGA 1L12A 1L20A 1BHZA 2B6TA 1PY6A 5A45A 2XQOA 1CKDA 5D5FA 2LZTA 5F8UA 3REYA 174LA 3SB5A 2DQIY 260LA 3DDLA 4NSGA 1B7PA 2BQEA 1LMAA 4TL3A 4XJIA 1C6MA 4EA3A 4W57A 1B7MA 4HTNA 3OE9A 3G3BB 1XIOA 1IW9A 1C6PA 1CUQA 1HEPA 2JAGA 5JJNA 4H9IA 1G1VA 3F6ZA 2HUKA 2YBLA 3G3VA 4QIDA 5KY1A 1GF7A 1BRDA 3AYMA 1F50A 3LZTA 122LA 4BAPA 5KXOA 1WQNA 243LA 3J4GA 4NGLA 5FELA 2B70A 5AWZA 2QPEB 1XGTC 1IOSA 1LZ4A 5AHYA 3DKEX 1PQDA 1CV1A 5DM9A 3EBAB 4GLVA 5IHGA 5H2PA 3GUKA 3HTBA 2BQFA 1TCYA 1L54A 2BQKA 1L08A 1TBYA 4H9EA 3UTYA 1BB5A 2BAAA 4HTQA 1G0LA 5EN0A 4AMJA 4C3WA 1HERA 4RDSA 2CWIA 4WM6A 1NBZC 2XTHA 4IASA 4QEQA 1L55A 4N6HA 1L02A 4NWHA 3HH6A 1XGUC 4WL7A 2LYMA 2ZQ4A 4LZMA 4P2EA 1DXJA 4W53A 2G4QA 114LA 1UUZC 1UIHA 3TMXA 169LA 4G71B 1DYBA 5I54A 1H2SA 178LA 1C6EA 3A92A 4DD7A 4KL7A 3QE8A 1GFRA 1QT6A 4GYCA 2F4GA 3FADA 5F81A 3W3EA 2EQLA 3TXGA 3PWHA 3PBLA 1LSMA 1IC5Y 1QT8A 3FE0A 3WULA 1YAPA 2HULA 3L2XA 4U3XB 2D6BA 1L66A 3QBLA 1YQVY 239LA 3LHMA 1LJHA 3WMKA 3QJUB 4OOOA 2C8PA 5LA8A 3QNGA 1DYGA 4LZTA 1CU6A 1LJFA 1F6SA 1T8AA 1L22A 5B6YA 3LYZA 1L07A 3LYOA 4NGJA 1LZAA 248LA 2Z12A 4E97A 4NGZA 193LA 4WMGA 1CV3A 2ZWBA 2R4SA 5L3HA 1IWTA 1RI8B 5DLAA 1WQQA 4H94A 2H5ZA 1QSQA 3DN4A 4HV1A 1HSWA 1R84A 166LA 1LZ6A 4X31A 1JWRA 5DHHA 1OUHA 2OEAX 126LA 1D9WA 1L63A 4YX7C 2Z38A 1S52A 2JAFA 3WUMA 1EL1A 1KXXA 1C6HA 1GF5A 1LGUA 4GBRB 191LA 4NSIA 4I7JA 1IOQA 5T3FA 1L82A 225LA 254LA 1QKOA 1P6YA 1B5UA 4WG1A 3J6KA 1REXA 4W54A 1IEEA 1UC0A 5LVKA 249LA 4O34A 1IWVA 1LSDA 2H9KA 3EXDA 1JSFA 2ANVA 180LA 1LSYA 1OUDA 4UHRA 1GFKA 1LJ4A 4LYZA 3S8FB 1HC0A 1B7SA 1KXWA 1L49A 4GCCA 1OWYA 2B72A 1L06A 2DQFC 5B2NA 1L74A 1TEWA 2R4RA 1L32A 3LYTA 1GBWA 2FBDA 2D4IA 1NKHA 5G28A 3AJNA 1L50A 1P5CA 3DN8A 3ATOA 1L43A 4HYXA 4DDCA 3VW7A 1QT3A 3W6FA 150LA 4YXCA 1B5XA 1EHKB 2M3GA 207LA 227LA 4R6CA 1IP4A 2I1XA 108LA 1TN5A 1L25A 4W96A 4BV0A 1KG8A 1C64A 1L52A 1GF8A 1GF0A 2YCYA 1GPQC 5ITCA 4PK0A 4XENA 1D6PA 5BR2A 3M18B 1YILA 1S54A 5F16A 4XXJA 5H2HA 1LJJA 1C6LA 1G0KA 1HEQA 1FBKA 3NSBA 1EPYA 148LE 4H8YA 4GRVA 2RB2X 1HF4A 2NTGA 1AT5A 1H6MA 1F10A 1GF6A 1GF4A 4GN4A 3DMVA 5LVIA 4AQNA 2B6XA 4HJVA 147LA 4DD2A 1HFXA 1L79A 194LA 1L72A 2ZNWY 3NY9A 1DI4A 250LA 4IJ4A 1L91A 1IR9A 2F2QA 4OO9A 1DPXA 1IVMA 5FHWA 1QUOA 2A7DA 1U19A 104LA 2OU8A 3W6EA 3WXUA 3RUNA 1JTTL 4K5YA 1QT4A 4BEYA 3CT5A 2YBIA 1S51A 1L21A 2DQGY 3OJPA 3TMWA 1L9HA 4NIJA 3QAPA 195LA 4DS7E 4XJGA 4B4EA 3AZ6A 1O0AA 4H1PA 6LYZA 1IXFA 4WLXA 1XEPA 5ILCA 3RZ4A 1C6AA 3AGIA 5G2AA 1LZ5A 5LAFA 1LPYA 1LZYA 4XTNA 3GXKA 155LA 1L80A 2RBNA 157LA 2Y02A 1PQKA 1DYEA 1PS5A 2PC2A 1L62A 4GCFA 1C6KA 5LVJA 1XEKA 1E0PA 132LA 3A6CY 4DD1A 5I14A 1KW5A 183LA 1LHLA 4RLMA 1IOCA 1NDGC 1SSWA 3TXJA 1TLAA 1LKRA 2RSCA 2AT9A 5B35A 197LA 2HEAA 1P2LA 2YBHA 5LYTA 238LA 1LYDA 1KG9A 1TN0A 5LAGA 1C10A 4QDNA 5APCA 4DD0A 1EQ4A 2RBPA 4ARJA 4KXIA 5HMJA 139LA 1CX7A 1MELL 4YOPA 3WXTA 5G2DA 5DN4A 1QKPA 1JKDA 4N1EI 2YVBA 4I0CA 1I20A 211LA 3HT8A 5H2NA 1UIBA 1AT9A 2Z18A 2RBRA 1LHIA 5B34A 3WL2A 1G07A 1G0MA 1QDTA 3TXKA 2J4YA 1IY4A 1GFTA 3A6BY 4TSBA 3ZEKA 4Y9HA 1G7IC 3VHZA 1JEFA 3QBKA 1FKQA 2B73A 4NGYA 154LA 3AZ5A 4Z98A 1ZV5L 2OE9X 5B0WA 1LYOA 1CV0A 5B05A 5APFA 4ARMA 3ULRA 4I7OA 1UIAA 4PPOA 4ARLA 1SX2A 1L59A 3HUQA 1IOTA 167LA 1BB4A 2DQCY 5IDDA 2Z19A 1LMNA 4B49A 1CU3A 3LZ2A 5A44A 210LA 2Z37A 1DYAA 2Y01A 5AHZA 3SBAA 1YAOA 1HEOA 140LA 118LA 4CHXA 1ZVHL 1V7TA 162LA 4G49A 5KXSA 2OE4X 1QM8A 1FN5A 5HQ1A 1T8FA 1LMPA 2MEBA 1LHJA 1G0JA 1L33A 2CUUA 3W6DA 1GAZA 1L96A 3DMXA 3B72A 4XTOA 3A95A 3RZEA 4QRYA 1QUSA 3HAPA 3WPKA 1UAZA 4GPOA 2Y04A 1QTCA 2G87A 1FLWA 5C1MA 3HTFA 1C6FA 2BLYA 3AB6A 1GZMA 3QJVB 4E3UA 1L0KA 2ZIYA 158LA 3W6BA 3CT0A 5I53A 1L47A 1XJIA 3UTWA 1LWGA 4WOAA 3SB6A 4LFPA 2B7XA 2B5ZA 151LA 4LFXA 1UACY 196LA 5TGZA 1LZGA 5KXTA 1M0KA 111LA 4WW3A 2DQAA 2Q0MX 4FJRA 4BUOA 1C8SA 5B6VA 1QSAA 4LYCA 1GBZA 2BPUA 5LINA 1XJUA 182LA 199LA 5FDJA 3GULA 3GUPA 1IY3A 4HPIA 1QTEA 1L71A 3SB9A 4N4WA 2EI4A 3SN6R 1W6ZA 1C6BA 1L46A 1ZYTA 4ETDA 3CSRA 2LHMA 153LA 4QY9A 1L16A 1OUEA 3AM6A 1LSCA 1UIEA 2HU3A 1WQMA 5LIOA 3C81A 1QSBA 1G7HC 4BEZA 2W1YA 1H87A 2G4NA 1HMLA 3AZ4A 3T6UA 5DN5A 5J7AA 1L17A 1L04A 1FBIX 3A96A 3EH5B 1PQMA 1C66A 1WQPA 1GD6A 1LPIA 4ARPA 4PHIA 5FEKA 237LA 5B06A 3TXIA 4G9SA 1X0K1 3RNXA 3C9LA 1KMEA 1VGOA 113LA 4TWSA 4DC4A 9LYZA 163LA 189LA 4TX7A 3D4SA 5L3IA 1L83A 1DQJC 1UIFA 2RB1X 1NBYC 1IC4Y 3CB7A 1XGPC 1GBYA 1GFGA 3QBIA 107LA 1LYZA 3RU5A 4DQJA 2RBQA 1PXRA 4EXMA 251LA 119LA 1BB7A 3N9AA 4X32A 1B9OA 3IWRA 4HJYA 1BWJA 5M1YA 4EPIA 1CTWA 3MBVA 4MD1A 1GB9A 3QY4A 4KT3A 2YDOA 1RJCB 3CSQA 1GUEA 2YCXA 4UWVA 4Z3MA 3VG9A 1OVJA 235LA 4NSHA 3C8SA 2O4WA 4XJDA 2O79A 156LA 3S3BB 3K2RA 1GB7A 1CUPA 4ARQA 4H8ZA 2MEAA 1DYCA 3TMVA 1KY0A 1OUFA 1QUGA 1SLYA 4RW1A 1L51A 1OUGA 2BQOA 4NGVA 1HEMA 1L24A 1LZDA 1G1WA 1IWZA 5C6JA 2Z73A 1KW7A 3PDSA 1IP5A 4NHQA 1F88A 2MEFA 1L41A 3A7KA 1KIPC 1LGWA 1JKCA 1OVHA 1X0SA 1L10A 1JISA 240LA 5B6WA 1GEZA 1JV6A 3AGHA 3HT6A 5H2MA 1AP9A 1LYHA 2I26L 1NWGA 4KLYA 1YKXX 2BQJA 3NY8A 2HU1A 1G7JC 3S3CB 1QSWA 1KIQC 3EMLA 4I7MA 3AW6A 2DQJY 3AGGG 2OU9A 2W1LA 4NGKA 1LJGA 1L58A 2Z55A 4CFPA 1IP2A 1F4ZA 1B0DA 4YM8A 2B6ZA 2HEFA 1VDSA 219LA 1L23A 1L0JA 1QTDA 1XGQC 2F2NA 4M6DA 4J4QA 145LA 1GDWA 4OWHA 4ZEEA 1C65A 259LA 3WH1A 1C62A 1HFZA 3LYMA 1L36A 4J1AA 1JJ0A 1D9UA 1JTPL 1LZBA 3WU9A 4C5FA 4HTKA 1UCQA 4L35A 1L84A 4W52A 4J1BA 3UTVA 3DNAA 3BVDB 1XGRC 261LA 4XJHA 1SQ2L 2OU0X 2KSYA 1JTOL 3DN2A 4EPFA 2RBOA 5BR5A 2NTUA 2I6ZA 1LZCA 4XN6A 2D91A 152LA 5HMVA 5J7CA 1LI6A 1C43A 1LOZA 3BKHA 3B6LA 1CKCA 1L26A 231LA 1L92A 1LJKA 1L27A 3DN1A 216LA 1L97A 1LN6A 1DZBX 1K28A 2MECA 2Q9EA 1FDLY 1OVKA 1DZEA 112LA 4PRUA 4GP4B 2EKSC 2MEGA 5L9JA 4B0DA 226LA 1C08C 3K3TA 2CDSA 2ZILA 5KXRA 159LA 4S0WA 1GHLA 1LMQA 2IFFY 5E4PA 4GCEA 1VFBC 5LVGA 2L6XA 1BRXA 3HDEA 3QBGA 3B0KA 1JIYA 200LA 4OV0A 1T3PA 3DMZA 134LA 1L18A 3GUNA 4DD9A 4ET9A 1L09A 4LGKA 3C9MA 5JJJA 3RT5X 1BWIA 1C6DA 4DDBA 190LA 4H8XA 1E8LA 1KNIA 4BAFA 1L88A 1JFPA 131LA 1C6TA 2F47A 1J1OY 1V7SA 1INUA 1LYGA 1LMOA 3NS0A 135LA 4ML7A 3CAPA 5G54A 1L44A 2L78A 1KIRC 1P46A 3W6AA 255LA 4YF2A 1LW9A 3S3DB 1RCMA 224LA 2N5ZA 168LA 4YEOA 4AXTA 4ZFPA 1D3MA 4YEMA 2BQBA 1HFYA 1GF9A 4DAJA 1BGIA 1B7QA 1GE3A 1C8RA 1RFPA 1LZTA 5H2LA 2OE7X 1WTNA 5A8EA 4MSTA 3G3WA 1L69A 3P64A 5AX1A 3UZCA 3D9AC 1Z55A 3C7ZA 4J0LA 4RLNA 2YDVA 1GEVA 1MLCE 4DJHA 4LYBA 3W6CA 1XJTA 4XJFA 3QJTB 2NTWA 3N9EA 1L67A 2W1MA 1JGJA 3FI5A 4HSFA 1LYSA 1KY1A 1VDPA 2VB1A 2QPDB 1LSGA 4WG7A 1ZURA 1LLHA 2LCBA 1OWZA 5AMYA 1XMEB 1IWWA 1OUBA 2GV0A 1F0WA 1DKJA 2DQHY 1OYUA 1NQIA 2D4JA 1N4FA 3C83A 2BQAA 4WM5A 1IP6A 1HENA 1CU0A 3WPLA 4IARA 1M0LA 1DYDA 1IWYA 1P2CC 4HYJA 4MQSA 2C8OA 3HAOA 4NFVA 3WVXA 1LAAA 256LA 3E3DA 3AYNA 3LN2A 1VJMA 2AUBA 4WL6A 3BKVA 1PQOA 4OW1A 1L61A 208LA 4HV2A 5KXKA 2MEIA 1LSNA 1G0QA 1H68A 4NC3A 4ARMB 1L98A 1PQIA 1BB3A 2ZYPA 4G7SB 5DL9A 2BQMA 3CSZA 2MEHA 1T6VL 1QTVA 1G0PA 5I4YA 1IP7A 4H9BA 4FBZA 4NG8A 217LA 1CV6A 3WU8A 5F14A 1L94A 2X72A 188LA 2I25L 2RBSA 2OTZX 3CQLA 2YSSC 1C7PA 4YENA 3V2WA 5KJ9A 253LA 4TSCA 2X0AA 184LA 5LA5A 1P36A 4FDYA 1HZXA 1D0MA 2RB0X 4QGZA 1OUAA 1GB3A 173LA 4B1AA 2Q9DA 1ZVYB 5JJEA 1T97A 2ZQ3A 3CDOA 175LA 1P64A 1UCOA 3WW5A 4EMNA 2XBRA 1CKGA 1L76A 5ETZA 1JJ3A 1WQRA 4H91A 5DYSA 1IC7Y 2F32A 1I56A 4QI1A 4WM1A 1LYIA 3GXRA 3SB8A 123LA 4MBSA 1G06A 3HARA 3UTXA 1P8IA 1VEDA 1D2YA 1RE2A 3WU7A 1LSEA 1JTNA 1QTKA 1B5ZA 2BRDA 2B6YA 1L05A 3HBHA 1L99A 4KNFA 7LZMA 1Q5IA 4I7KA 1B7RA 1LTMA 4EJ4A 2Y03A 5I5QA 1QTZA 4BWBA 2PEDA 1W08A 1GBXA 1C67A 5B6XA 1D0LA 5HNLA 1YKYX 4EOFA 1YKZX 3P0GA 1JQUA 3DN6A 1C6QA 262LA 1OP9B 1XEIA 1GE1A 3L64A 1DYFA 1JV7A 2F95A 1P2RA 102LA 2Z6BA 1GBSA 1DI5A 4I8SA 1P7SA 1G7MC 1C6CA 1LMCA 2A4TA 5HNCA 2RAZX 4N5RA 1KS3A 230LA 1B5VA 1OV7A 1BVKC 1XEJA 2LYOA 4FPDA 164LA 2DKVA 3HUAA 170LA 1GFJA 4FAAB 3ATNA 4OWAA 3SB7A 2YCZA 1IW6A 1A4VA 1WVUA 2BQIA 1O23A 1LJEA 2O7AA 1D0KA 1LSBA 5KXLA 4I7LA 4ZIXA 5B07A 1BB6A 4MCKA 3A3QA 1GFAA 220LA 1L53A 1YIKA 1IR7A 5HLLA 3PQRA 1S8JA 4LDOA 4N1CC 1FBBA 5LXWA 3C7YA 3KAMA 3ZPRA 4NGOA 3DQBA 3GUOA 5KXNA 5AX0A 172LA 3OE0A 3P68A 4B4JA 3CODA 4GLAA 3KJ6A 1REZA 3RW8A 1IR8A 3A8ZA 1GU8A 2HTXA 1P8UA 4X3BA 141LA 3TXBA 1GB6A 2FYDA 4EIYA 3WUNA 2B74A 3X3BA 1UIGA 6LZMA 252LA 4EKQA 228LA 4ETBA 1D2WA 4BVNA 4TTDA 5K7OA 4NHIA 5H2IA 1LSZA 3ZVQA 4IAQA 1LSPA 1BVXA 4N0JA 4L41A 4TUNA 1OV5A 1OUCA 5KKJA 1C69A 4G4CA 214LA 1R2NA 1DPWA 1L95A 5D5CA 5APDA 5KXXA 4PJZA 1L15A 5LYMA 2XJWA 1LCNA 146LA 1I6SA 4XTLA 4JR8A 1GAYA 4NGWA 1IP3A 4W51A 4ETAA 177LA 1GDXA 3C8QA 5APEA 1GBOA 1E12A 2YBMA 125LA 142LA 3MGWA 3COCA 181LA 4PRQA 3P65A 2DQEY 2QARC 1L39A 1UIDA 4N9RA 4HWLA 1MGYA 1CV4A 3HUKA 187LA 1D3JA 4NEBA 3RFMA 4H9CA 3T36A 1L73A 1D6QA 5B1FA 3F9LA 2OTYX 1BM1A 115LA 1IO5A 4LT2A 2G4PA 4WLDA 2LZ2A 2BLXA 1L31A 1L81A 215LA 3HT9A 2KSBA 1YL1X 1P37A 4W55A 4WAVA 130LA 1C6NA 2I20A 3HBEX 4NHSA 4N8ZA 1JUGA 3A94A 2HPYA 1L38A 3QJRB 1L86A 4A7DA 1L89A 2IHLA 3QAKA 3N9CA 2RH1A 4X1HA 3HBDA 1EQ5A 1D3NA 2WJKA 4G4BA 4HP0A 3G3XA 4I7QA 3GUMA 1L45A 5G36A 2FYCA 1C6JA 4AMIA 185LA 1X0I1 1CJ9A 229LA 4LYMA 1G7LC 236LA 2RAYX 1CKHA 133LA 1IWXA 4IB4A 1GWDA 1L90A 1FLYA 3IJUA 1QS5A 1LI2A 5KKIA 4DKLA 233LA 3HTGA 1YAMA 1FLUA 4CGEA 4HPEA 1QS9A 2ANXA 3HH5A 1S8LA 1HNLA 3NYAA 1B5YA 2NTHA 4OWBA 1A2YC 4ETCA 1CWQA 2BQLA 1CU5A 3HU9A 2BQDA 5F9XA 5AZDA 4WO6A 212LA 206LA 4NSJA 2BQGA 4L6RA 3WQJA 3HFMY 3VWOA 1SSYA 4NGIA 244LA 1L37A 2I35A 2YBNA 4H9AA 2XBSA 1P8HA 2W1XA 1C6IA 4HJZA 4W94A 3C7WA 3C82A 3ABWA 4OWEA 4YXAC 2VT4A 5KXZA 1B7LA 4AGAA 1QTHA 137LA 1HSXA 2BQCA 4XYYA 1G0GA 2WJLA 1LHKA 4R0FA 4DDAA 2YBJA 3C80A 3TMUA 1REYA 4GP8B 4XADA 1HEWA 1L28A 1XSFA 4MD2A 4PGJB 4ANRA 2Y00A 5KXYA 4H90A 3V2YA 2KSAA 4H9HA 1L70A 1HHLA 3HDFA 1LYFA 1QUDA 241LA 2HEDA 232LA 1SWZA 1OQMA 1ALCA 1LZRA 1L19A 3B0OA 4H92A 2F93A 1GB2A 2A7FA 1L0MA 3P66A 1JITA 1L40A 1LGXA 5KXWA 1VDTA 1CV5A 5FJGA 1L56A 1GB8A
chains in the Genus database with same CATH topology
5ITEA 4GN3A 1QT5A 3VI0A 1LZNA 4JKVA 1UICA 234LA 4LDEA 1C3WA 1GF3A 4BS7A 1P56A 1ZWNA 4NHPA 4ZPUA 3TXEA 4DT3A 1M0MA 3GUJA 4J7VA 2D4KA 223LA 127LA 4WM4A 1L87A 1J1XY 1LZEA 1LJ3A 5H2KA 201LA 5G2CA 4Z41A 3GUIA 186LA 4H9FA 4NHTA 1LHMA 3A34A 1QT7A 4D9ZA 4JQ6A 4LYTA 3CDTA 1SX7A 3C8RA 1LYEA 4NG1A 1WQOA 4EKRA 2QB0B 2NWDX 1GB5A 3IJVA 1QTBA 3D3DA 1L29A 1L93A 1GE0A 4I7SA 4ETEA 1XFPL 1YL0X 1L42A 1PXSA 1YROA 1LZ9A 4G4HA 2H9JA 3HANA 4WO9A 2ZNXY 2B75A 5II3A 1GXXA 4XT3A 2ZIJA 242LA 4UWUA 4IAPA 3FA0A 4PXFA 2YDGA 3EMSA 4WM3A 5LZMA 1C61A 2BQNA 3WVYA 1B2KA 1JKBA 2Y8PA 1CX6A 1IIZA 4WLYA 3TXDA 4GCDA 143LA 109LA 1CJ8A 1LYJA 4WLTA 1T6HA 2F4AA 3VGAA 2HUMA 1L30A 1KXYA 3WPJA 4GBRA 1WVVA 205LA 209LA 103LA 4LYOA 257LA 1GE4A 5KXPA 1SWYA 3HTDA 5JENB 3QJSB 1AM7A 5I4WA 4DQ7A 1NHBA 3QJQB 1GB0A 1KGBA 3SP3A 1JSEA 198LA 3OAXA 5KKHA 1L60A 1LJIA 1PZYA 245LA 5LYZA 3SBBC 2DQDY 5E9RA 4W56A 4NY5A 2HUBA 7LYZA 4I7NA 120LA 1D3FA 4G7QB 1JJ1A 1GE2A 4NWEA 1LI3A 1L77A 4EKSA 3WW6A 1T8GA 4I7RA 4PXKA 1IWUA 1UBZA 1YANA 4BADA 3PXOA 2ZIKA 1AZFA 1C45A 1JPOA 4LDLA 2LNLA 2Z2FA 3DN0A 2WARA 3S8GB 2CJLA 2LC9A 4I7PA 192LA 3WUAA 2LZMA 5EBHA 1QUHA 1L35A 1F6RA 1OUJA 3P4ZA 1AT6A 1C46A 3DN3A 1Q5JA 4GN5C 1GXV2 3EH4B 2CGIA 2ZZLA 5B1GA 160LA 1L11A 3AZ7A 1L85A 1WTHA 1L48A 129LA 3FI7A 258LA 1HELA 5KXMA 3CT1A 1CU2A 3HH3A 2ZFEA 3X3CA 4FA7B 4IATA 4LT0A 3F8VA 1C6GA 4UG2A 1ZMYL 2HEBA 2MEEA 3CDRA 4W59A 5A3EA 1JTMA 1L01A 1LSAA 2HEEA 4OOTA 1BQLY 4XT1A 1QHJA 4ET8A 218LA 2EIZC 3QDCA 4MQTA 1IP1A 1DKKA 1QQYA 2MEDA 221LA 3M3UA 1AKIA 1NF5A 1CKFA 8LYZA 2EPEA 1L14A 1TDYA 1P3NA 1L57A 3EH3B 3A90A 4I7TA 1CNSA 5ILFA 2HECA 3AW7A 3EO5A 2F30A 1B7OA 1C63A 1LYYA 2YCWA 5H2OA 1UA6Y 4WM2A 1VATA 1NHEA 4EKPA 2KS9A 247LA 5B6ZA 1NDMC 1GFVA 4CFOA 3ZVQB 1NMMA 1LJNA 5LVHA 1GFUA 4DQ5A 4II8A 165LA 4GCBA 2Z39A 2FBBA 3TXHA 4DYGA 3ZEVA 1OUIA 4UWNA 2B6WA 3A91A 6LYTA 3OE8A 1EQEA 1LZ8A 1PQJA 1B5WA 1L75A 2I21A 1C68A 3TXFA 1B7NA 1LWKA 5FCPA 1VDQA 1BWHA 1FKVA 3B0IA 4OWCA 3VVKA 1QUTA 1L34A 1DI3A 3HAQA 149LA 4RW2A 1REMA 4Z46A 1FLQA 1HMKA 128LA 3UZAA 1JHLA 5I4XA 3UONA 4DWXA 1LSFA 4XJBA 4GP5B 1LZSA 4G72B 1L00A 1L68A 110LA 1J1PY 3HASA 1LZ1A 3A3RX 1S53A 1QDRA 4A4MA 161LA 1L03A 4LT3A 5FSTA 3AYQA 1B6IA 4DD3A 1VAUA 1IX0A 2ZYCA 1GFHA 2BQHA 4N4YB 3ZPQA 5A3ZA 3HT7A 4MR1A 3OK0A 2LYZA 3OE6A 1IORA 4M4OA 1L64A 138LA 3HWLA 5F9UA 4W58A 2DBTA 1I1ZA 1LHHA 4ARQB 5G53A 213LA 3WYHA 1YAQA 3ODUA 5C6IA 3CDVA 171LA 4G70B 176LA 4G7RB 4H93A 5B59A 3UG9A 3LZMA 2IGCA 4LT1A 5LWEA 4PJ2C 1BRRA 222LA 1QIOA 1L65A 1C60A 3A67Y 4CJ2A 3G3AB 1CJ7A 144LA 3A93A 3CDQA 3T45A 1CJ6A 3HH4A 1CVKA 3JR6A 246LA 1WTMA 3HU8A 1LKSA 1TAYA 4KPMA 5H2JA 1L13A 1LMTA 5IELA 5C6LA 1GFEA 2Z2EA 1JKAA 4B4IA 5DHGA 1L12A 1L20A 1BHZA 2B6TA 1PY6A 5A45A 2XQOA 1CKDA 5D5FA 2LZTA 5F8UA 3REYA 174LA 3SB5A 2DQIY 260LA 3DDLA 4NSGA 1B7PA 2BQEA 1LMAA 4TL3A 4XJIA 1C6MA 4EA3A 4W57A 1B7MA 4HTNA 3OE9A 3G3BB 1XIOA 1IW9A 1C6PA 1CUQA 1HEPA 2JAGA 5JJNA 4H9IA 1G1VA 3F6ZA 2HUKA 2YBLA 3G3VA 4QIDA 5KY1A 1GF7A 1BRDA 3AYMA 1F50A 3LZTA 122LA 4BAPA 5KXOA 1WQNA 243LA 3J4GA 4NGLA 5FELA 2B70A 5AWZA 2QPEB 1XGTC 1IOSA 1LZ4A 5AHYA 3DKEX 1PQDA 1CV1A 5DM9A 3EBAB 4GLVA 5IHGA 5H2PA 3GUKA 3HTBA 2BQFA 1TCYA 1L54A 2BQKA 1L08A 1TBYA 4H9EA 3UTYA 1BB5A 2BAAA 4HTQA 1G0LA 5EN0A 4AMJA 4C3WA 1HERA 4RDSA 2CWIA 4WM6A 1NBZC 2XTHA 4IASA 4QEQA 1L55A 4N6HA 1L02A 4NWHA 3HH6A 1XGUC 4WL7A 2LYMA 2ZQ4A 4LZMA 4P2EA 1DXJA 4W53A 2G4QA 114LA 1UUZC 1UIHA 3TMXA 169LA 4G71B 1DYBA 5I54A 1H2SA 178LA 1C6EA 3A92A 4DD7A 4KL7A 3QE8A 1GFRA 1QT6A 4GYCA 2F4GA 3FADA 5F81A 3W3EA 2EQLA 3TXGA 3PWHA 3PBLA 1LSMA 1IC5Y 1QT8A 3FE0A 3WULA 1YAPA 2HULA 3L2XA 4U3XB 2D6BA 1L66A 3QBLA 1YQVY 239LA 3LHMA 1LJHA 3WMKA 3QJUB 4OOOA 2C8PA 5LA8A 3QNGA 1DYGA 4LZTA 1CU6A 1LJFA 1F6SA 1T8AA 1L22A 5B6YA 3LYZA 1L07A 3LYOA 4NGJA 1LZAA 248LA 2Z12A 4E97A 4NGZA 193LA 4WMGA 1CV3A 2ZWBA 2R4SA 5L3HA 1IWTA 1RI8B 5DLAA 1WQQA 4H94A 2H5ZA 1QSQA 3DN4A 4HV1A 1HSWA 1R84A 166LA 1LZ6A 4X31A 1JWRA 5DHHA 1OUHA 2OEAX 126LA 1D9WA 1L63A 4YX7C 2Z38A 1S52A 2JAFA 3WUMA 1EL1A 1KXXA 1C6HA 1GF5A 1LGUA 4GBRB 191LA 4NSIA 4I7JA 1IOQA 5T3FA 1L82A 225LA 254LA 1QKOA 1P6YA 1B5UA 4WG1A 3J6KA 1REXA 4W54A 1IEEA 1UC0A 5LVKA 249LA 4O34A 1IWVA 1LSDA 2H9KA 3EXDA 1JSFA 2ANVA 180LA 1LSYA 1OUDA 4UHRA 1GFKA 1LJ4A 4LYZA 3S8FB 1HC0A 1B7SA 1KXWA 1L49A 4GCCA 1OWYA 2B72A 1L06A 2DQFC 5B2NA 1L74A 1TEWA 2R4RA 1L32A 3LYTA 1GBWA 2FBDA 2D4IA 1NKHA 5G28A 3AJNA 1L50A 1P5CA 3DN8A 3ATOA 1L43A 4HYXA 4DDCA 3VW7A 1QT3A 3W6FA 150LA 4YXCA 1B5XA 1EHKB 2M3GA 207LA 227LA 4R6CA 1IP4A 2I1XA 108LA 1TN5A 1L25A 4W96A 4BV0A 1KG8A 1C64A 1L52A 1GF8A 1GF0A 2YCYA 1GPQC 5ITCA 4PK0A 4XENA 1D6PA 5BR2A 3M18B 1YILA 1S54A 5F16A 4XXJA 5H2HA 1LJJA 1C6LA 1G0KA 1HEQA 1FBKA 3NSBA 1EPYA 148LE 4H8YA 4GRVA 2RB2X 1HF4A 2NTGA 1AT5A 1H6MA 1F10A 1GF6A 1GF4A 4GN4A 3DMVA 5LVIA 4AQNA 2B6XA 4HJVA 147LA 4DD2A 1HFXA 1L79A 194LA 1L72A 2ZNWY 3NY9A 1DI4A 250LA 4IJ4A 1L91A 1IR9A 2F2QA 4OO9A 1DPXA 1IVMA 5FHWA 1QUOA 2A7DA 1U19A 104LA 2OU8A 3W6EA 3WXUA 3RUNA 1JTTL 4K5YA 1QT4A 4BEYA 3CT5A 2YBIA 1S51A 1L21A 2DQGY 3OJPA 3TMWA 1L9HA 4NIJA 3QAPA 195LA 4DS7E 4XJGA 4B4EA 3AZ6A 1O0AA 4H1PA 6LYZA 1IXFA 4WLXA 1XEPA 5ILCA 3RZ4A 1C6AA 3AGIA 5G2AA 1LZ5A 5LAFA 1LPYA 1LZYA 4XTNA 3GXKA 155LA 1L80A 2RBNA 157LA 2Y02A 1PQKA 1DYEA 1PS5A 2PC2A 1L62A 4GCFA 1C6KA 5LVJA 1XEKA 1E0PA 132LA 3A6CY 4DD1A 5I14A 1KW5A 183LA 1LHLA 4RLMA 1IOCA 1NDGC 1SSWA 3TXJA 1TLAA 1LKRA 2RSCA 2AT9A 5B35A 197LA 2HEAA 1P2LA 2YBHA 5LYTA 238LA 1LYDA 1KG9A 1TN0A 5LAGA 1C10A 4QDNA 5APCA 4DD0A 1EQ4A 2RBPA 4ARJA 4KXIA 5HMJA 139LA 1CX7A 1MELL 4YOPA 3WXTA 5G2DA 5DN4A 1QKPA 1JKDA 4N1EI 2YVBA 4I0CA 1I20A 211LA 3HT8A 5H2NA 1UIBA 1AT9A 2Z18A 2RBRA 1LHIA 5B34A 3WL2A 1G07A 1G0MA 1QDTA 3TXKA 2J4YA 1IY4A 1GFTA 3A6BY 4TSBA 3ZEKA 4Y9HA 1G7IC 3VHZA 1JEFA 3QBKA 1FKQA 2B73A 4NGYA 154LA 3AZ5A 4Z98A 1ZV5L 2OE9X 5B0WA 1LYOA 1CV0A 5B05A 5APFA 4ARMA 3ULRA 4I7OA 1UIAA 4PPOA 4ARLA 1SX2A 1L59A 3HUQA 1IOTA 167LA 1BB4A 2DQCY 5IDDA 2Z19A 1LMNA 4B49A 1CU3A 3LZ2A 5A44A 210LA 2Z37A 1DYAA 2Y01A 5AHZA 3SBAA 1YAOA 1HEOA 140LA 118LA 4CHXA 1ZVHL 1V7TA 162LA 4G49A 5KXSA 2OE4X 1QM8A 1FN5A 5HQ1A 1T8FA 1LMPA 2MEBA 1LHJA 1G0JA 1L33A 2CUUA 3W6DA 1GAZA 1L96A 3DMXA 3B72A 4XTOA 3A95A 3RZEA 4QRYA 1QUSA 3HAPA 3WPKA 1UAZA 4GPOA 2Y04A 1QTCA 2G87A 1FLWA 5C1MA 3HTFA 1C6FA 2BLYA 3AB6A 1GZMA 3QJVB 4E3UA 1L0KA 2ZIYA 158LA 3W6BA 3CT0A 5I53A 1L47A 1XJIA 3UTWA 1LWGA 4WOAA 3SB6A 4LFPA 2B7XA 2B5ZA 151LA 4LFXA 1UACY 196LA 5TGZA 1LZGA 5KXTA 1M0KA 111LA 4WW3A 2DQAA 2Q0MX 4FJRA 4BUOA 1C8SA 5B6VA 1QSAA 4LYCA 1GBZA 2BPUA 5LINA 1XJUA 182LA 199LA 5FDJA 3GULA 3GUPA 1IY3A 4HPIA 1QTEA 1L71A 3SB9A 4N4WA 2EI4A 3SN6R 1W6ZA 1C6BA 1L46A 1ZYTA 4ETDA 3CSRA 2LHMA 153LA 4QY9A 1L16A 1OUEA 3AM6A 1LSCA 1UIEA 2HU3A 1WQMA 5LIOA 3C81A 1QSBA 1G7HC 4BEZA 2W1YA 1H87A 2G4NA 1HMLA 3AZ4A 3T6UA 5DN5A 5J7AA 1L17A 1L04A 1FBIX 3A96A 3EH5B 1PQMA 1C66A 1WQPA 1GD6A 1LPIA 4ARPA 4PHIA 5FEKA 237LA 5B06A 3TXIA 4G9SA 1X0K1 3RNXA 3C9LA 1KMEA 1VGOA 113LA 4TWSA 4DC4A 9LYZA 163LA 189LA 4TX7A 3D4SA 5L3IA 1L83A 1DQJC 1UIFA 2RB1X 1NBYC 1IC4Y 3CB7A 1XGPC 1GBYA 1GFGA 3QBIA 107LA 1LYZA 3RU5A 4DQJA 2RBQA 1PXRA 4EXMA 251LA 119LA 1BB7A 3N9AA 4X32A 1B9OA 3IWRA 4HJYA 1BWJA 5M1YA 4EPIA 1CTWA 3MBVA 4MD1A 1GB9A 3QY4A 4KT3A 2YDOA 1RJCB 3CSQA 1GUEA 2YCXA 4UWVA 4Z3MA 3VG9A 1OVJA 235LA 4NSHA 3C8SA 2O4WA 4XJDA 2O79A 156LA 3S3BB 3K2RA 1GB7A 1CUPA 4ARQA 4H8ZA 2MEAA 1DYCA 3TMVA 1KY0A 1OUFA 1QUGA 1SLYA 4RW1A 1L51A 1OUGA 2BQOA 4NGVA 1HEMA 1L24A 1LZDA 1G1WA 1IWZA 5C6JA 2Z73A 1KW7A 3PDSA 1IP5A 4NHQA 1F88A 2MEFA 1L41A 3A7KA 1KIPC 1LGWA 1JKCA 1OVHA 1X0SA 1L10A 1JISA 240LA 5B6WA 1GEZA 1JV6A 3AGHA 3HT6A 5H2MA 1AP9A 1LYHA 2I26L 1NWGA 4KLYA 1YKXX 2BQJA 3NY8A 2HU1A 1G7JC 3S3CB 1QSWA 1KIQC 3EMLA 4I7MA 3AW6A 2DQJY 3AGGG 2OU9A 2W1LA 4NGKA 1LJGA 1L58A 2Z55A 4CFPA 1IP2A 1F4ZA 1B0DA 4YM8A 2B6ZA 2HEFA 1VDSA 219LA 1L23A 1L0JA 1QTDA 1XGQC 2F2NA 4M6DA 4J4QA 145LA 1GDWA 4OWHA 4ZEEA 1C65A 259LA 3WH1A 1C62A 1HFZA 3LYMA 1L36A 4J1AA 1JJ0A 1D9UA 1JTPL 1LZBA 3WU9A 4C5FA 4HTKA 1UCQA 4L35A 1L84A 4W52A 4J1BA 3UTVA 3DNAA 3BVDB 1XGRC 261LA 4XJHA 1SQ2L 2OU0X 2KSYA 1JTOL 3DN2A 4EPFA 2RBOA 5BR5A 2NTUA 2I6ZA 1LZCA 4XN6A 2D91A 152LA 5HMVA 5J7CA 1LI6A 1C43A 1LOZA 3BKHA 3B6LA 1CKCA 1L26A 231LA 1L92A 1LJKA 1L27A 3DN1A 216LA 1L97A 1LN6A 1DZBX 1K28A 2MECA 2Q9EA 1FDLY 1OVKA 1DZEA 112LA 4PRUA 4GP4B 2EKSC 2MEGA 5L9JA 4B0DA 226LA 1C08C 3K3TA 2CDSA 2ZILA 5KXRA 159LA 4S0WA 1GHLA 1LMQA 2IFFY 5E4PA 4GCEA 1VFBC 5LVGA 2L6XA 1BRXA 3HDEA 3QBGA 3B0KA 1JIYA 200LA 4OV0A 1T3PA 3DMZA 134LA 1L18A 3GUNA 4DD9A 4ET9A 1L09A 4LGKA 3C9MA 5JJJA 3RT5X 1BWIA 1C6DA 4DDBA 190LA 4H8XA 1E8LA 1KNIA 4BAFA 1L88A 1JFPA 131LA 1C6TA 2F47A 1J1OY 1V7SA 1INUA 1LYGA 1LMOA 3NS0A 135LA 4ML7A 3CAPA 5G54A 1L44A 2L78A 1KIRC 1P46A 3W6AA 255LA 4YF2A 1LW9A 3S3DB 1RCMA 224LA 2N5ZA 168LA 4YEOA 4AXTA 4ZFPA 1D3MA 4YEMA 2BQBA 1HFYA 1GF9A 4DAJA 1BGIA 1B7QA 1GE3A 1C8RA 1RFPA 1LZTA 5H2LA 2OE7X 1WTNA 5A8EA 4MSTA 3G3WA 1L69A 3P64A 5AX1A 3UZCA 3D9AC 1Z55A 3C7ZA 4J0LA 4RLNA 2YDVA 1GEVA 1MLCE 4DJHA 4LYBA 3W6CA 1XJTA 4XJFA 3QJTB 2NTWA 3N9EA 1L67A 2W1MA 1JGJA 3FI5A 4HSFA 1LYSA 1KY1A 1VDPA 2VB1A 2QPDB 1LSGA 4WG7A 1ZURA 1LLHA 2LCBA 1OWZA 5AMYA 1XMEB 1IWWA 1OUBA 2GV0A 1F0WA 1DKJA 2DQHY 1OYUA 1NQIA 2D4JA 1N4FA 3C83A 2BQAA 4WM5A 1IP6A 1HENA 1CU0A 3WPLA 4IARA 1M0LA 1DYDA 1IWYA 1P2CC 4HYJA 4MQSA 2C8OA 3HAOA 4NFVA 3WVXA 1LAAA 256LA 3E3DA 3AYNA 3LN2A 1VJMA 2AUBA 4WL6A 3BKVA 1PQOA 4OW1A 1L61A 208LA 4HV2A 5KXKA 2MEIA 1LSNA 1G0QA 1H68A 4NC3A 4ARMB 1L98A 1PQIA 1BB3A 2ZYPA 4G7SB 5DL9A 2BQMA 3CSZA 2MEHA 1T6VL 1QTVA 1G0PA 5I4YA 1IP7A 4H9BA 4FBZA 4NG8A 217LA 1CV6A 3WU8A 5F14A 1L94A 2X72A 188LA 2I25L 2RBSA 2OTZX 3CQLA 2YSSC 1C7PA 4YENA 3V2WA 5KJ9A 253LA 4TSCA 2X0AA 184LA 5LA5A 1P36A 4FDYA 1HZXA 1D0MA 2RB0X 4QGZA 1OUAA 1GB3A 173LA 4B1AA 2Q9DA 1ZVYB 5JJEA 1T97A 2ZQ3A 3CDOA 175LA 1P64A 1UCOA 3WW5A 4EMNA 2XBRA 1CKGA 1L76A 5ETZA 1JJ3A 1WQRA 4H91A 5DYSA 1IC7Y 2F32A 1I56A 4QI1A 4WM1A 1LYIA 3GXRA 3SB8A 123LA 4MBSA 1G06A 3HARA 3UTXA 1P8IA 1VEDA 1D2YA 1RE2A 3WU7A 1LSEA 1JTNA 1QTKA 1B5ZA 2BRDA 2B6YA 1L05A 3HBHA 1L99A 4KNFA 7LZMA 1Q5IA 4I7KA 1B7RA 1LTMA 4EJ4A 2Y03A 5I5QA 1QTZA 4BWBA 2PEDA 1W08A 1GBXA 1C67A 5B6XA 1D0LA 5HNLA 1YKYX 4EOFA 1YKZX 3P0GA 1JQUA 3DN6A 1C6QA 262LA 1OP9B 1XEIA 1GE1A 3L64A 1DYFA 1JV7A 2F95A 1P2RA 102LA 2Z6BA 1GBSA 1DI5A 4I8SA 1P7SA 1G7MC 1C6CA 1LMCA 2A4TA 5HNCA 2RAZX 4N5RA 1KS3A 230LA 1B5VA 1OV7A 1BVKC 1XEJA 2LYOA 4FPDA 164LA 2DKVA 3HUAA 170LA 1GFJA 4FAAB 3ATNA 4OWAA 3SB7A 2YCZA 1IW6A 1A4VA 1WVUA 2BQIA 1O23A 1LJEA 2O7AA 1D0KA 1LSBA 5KXLA 4I7LA 4ZIXA 5B07A 1BB6A 4MCKA 3A3QA 1GFAA 220LA 1L53A 1YIKA 1IR7A 5HLLA 3PQRA 1S8JA 4LDOA 4N1CC 1FBBA 5LXWA 3C7YA 3KAMA 3ZPRA 4NGOA 3DQBA 3GUOA 5KXNA 5AX0A 172LA 3OE0A 3P68A 4B4JA 3CODA 4GLAA 3KJ6A 1REZA 3RW8A 1IR8A 3A8ZA 1GU8A 2HTXA 1P8UA 4X3BA 141LA 3TXBA 1GB6A 2FYDA 4EIYA 3WUNA 2B74A 3X3BA 1UIGA 6LZMA 252LA 4EKQA 228LA 4ETBA 1D2WA 4BVNA 4TTDA 5K7OA 4NHIA 5H2IA 1LSZA 3ZVQA 4IAQA 1LSPA 1BVXA 4N0JA 4L41A 4TUNA 1OV5A 1OUCA 5KKJA 1C69A 4G4CA 214LA 1R2NA 1DPWA 1L95A 5D5CA 5APDA 5KXXA 4PJZA 1L15A 5LYMA 2XJWA 1LCNA 146LA 1I6SA 4XTLA 4JR8A 1GAYA 4NGWA 1IP3A 4W51A 4ETAA 177LA 1GDXA 3C8QA 5APEA 1GBOA 1E12A 2YBMA 125LA 142LA 3MGWA 3COCA 181LA 4PRQA 3P65A 2DQEY 2QARC 1L39A 1UIDA 4N9RA 4HWLA 1MGYA 1CV4A 3HUKA 187LA 1D3JA 4NEBA 3RFMA 4H9CA 3T36A 1L73A 1D6QA 5B1FA 3F9LA 2OTYX 1BM1A 115LA 1IO5A 4LT2A 2G4PA 4WLDA 2LZ2A 2BLXA 1L31A 1L81A 215LA 3HT9A 2KSBA 1YL1X 1P37A 4W55A 4WAVA 130LA 1C6NA 2I20A 3HBEX 4NHSA 4N8ZA 1JUGA 3A94A 2HPYA 1L38A 3QJRB 1L86A 4A7DA 1L89A 2IHLA 3QAKA 3N9CA 2RH1A 4X1HA 3HBDA 1EQ5A 1D3NA 2WJKA 4G4BA 4HP0A 3G3XA 4I7QA 3GUMA 1L45A 5G36A 2FYCA 1C6JA 4AMIA 185LA 1X0I1 1CJ9A 229LA 4LYMA 1G7LC 236LA 2RAYX 1CKHA 133LA 1IWXA 4IB4A 1GWDA 1L90A 1FLYA 3IJUA 1QS5A 1LI2A 5KKIA 4DKLA 233LA 3HTGA 1YAMA 1FLUA 4CGEA 4HPEA 1QS9A 2ANXA 3HH5A 1S8LA 1HNLA 3NYAA 1B5YA 2NTHA 4OWBA 1A2YC 4ETCA 1CWQA 2BQLA 1CU5A 3HU9A 2BQDA 5F9XA 5AZDA 4WO6A 212LA 206LA 4NSJA 2BQGA 4L6RA 3WQJA 3HFMY 3VWOA 1SSYA 4NGIA 244LA 1L37A 2I35A 2YBNA 4H9AA 2XBSA 1P8HA 2W1XA 1C6IA 4HJZA 4W94A 3C7WA 3C82A 3ABWA 4OWEA 4YXAC 2VT4A 5KXZA 1B7LA 4AGAA 1QTHA 137LA 1HSXA 2BQCA 4XYYA 1G0GA 2WJLA 1LHKA 4R0FA 4DDAA 2YBJA 3C80A 3TMUA 1REYA 4GP8B 4XADA 1HEWA 1L28A 1XSFA 4MD2A 4PGJB 4ANRA 2Y00A 5KXYA 4H90A 3V2YA 2KSAA 4H9HA 1L70A 1HHLA 3HDFA 1LYFA 1QUDA 241LA 2HEDA 232LA 1SWZA 1OQMA 1ALCA 1LZRA 1L19A 3B0OA 4H92A 2F93A 1GB2A 2A7FA 1L0MA 3P66A 1JITA 1L40A 1LGXA 5KXWA 1VDTA 1CV5A 5FJGA 1L56A 1GB8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L47 A;  1XJI A;  5ITE A;  1LWG A;  3UTW A;  3SB6 A;  1L55 A;  1QT5 A;  1QTV A;  4N6H A;  1G0P A;  3VI0 A;  1L02 A;  2B7X A;  151L A;  3HH6 A;  4LZM A;  4FBZ A;  4W53 A;  4JKV A;  114L A;  234L A;  4LDE A;  1C3W A;  217L A;  196L A;  5TGZ A;  1M0K A;  1P56 A;  1CV6 A;  1ZWN A;  4ZPU A;  111L A;  169L A;  1L94 A;  4WW3 A;  4G71 B;  2X72 A;  4BUO A;  1M0M A;  1DYB A;  3GUJ A;  1C8S A;  188L A;  223L A;  5B6V A;  127L A;  2RBS A;  2OTZ X;  1H2S A;  178L A;  3V2W A;  1C6E A;  253L A;  1L87 A;  1XJU A;  184L A;  1P36 A;  5H2K A;  182L A;  199L A;  201L A;  1HZX A;  2RB0 X;  1QT6 A;  3GUL A;  186L A;  3GUI A;  5G2C A;  4GYC A;  1QT7 A;  3GUP A;  173L A;  4JQ6 A;  3CDT A;  1SX7 A;  2Q9D A;  3C8R A;  3FAD A;  5JJE A;  1LYE A;  1T97 A;  4EKR A;  3PWH A;  1L71 A;  3SB9 A;  4N4W A;  2QB0 B;  3CDO A;  2EI4 A;  3SN6 R;  175L A;  1P64 A;  1QTB A;  3PBL A;  1L29 A;  1L76 A;  1L93 A;  4I7S A;  5ETZ A;  1C6B A;  1QT8 A;  1L46 A;  5DYS A;  1ZYT A;  2F32 A;  4QI1 A;  1L42 A;  2HUL A;  3L2X A;  1PXS A;  1L16 A;  1LYI A;  1L66 A;  3AM6 A;  3SB8 A;  3QBL A;  123L A;  4MBS A;  3C81 A;  1G06 A;  3HAN A;  1QSB A;  4BEZ A;  3HAR A;  3UTX A;  1P8I A;  2B75 A;  1D2Y A;  239L A;  3QJU B;  5J7A A;  4XT3 A;  1L17 A;  1JTN A;  1L04 A;  2BRD A;  3EH5 B;  2B6Y A;  242L A;  4IAP A;  1DYG A;  1L05 A;  3FA0 A;  4PXF A;  1L99 A;  4KNF A;  1PQM A;  1C66 A;  7LZM A;  1CU6 A;  1Q5I A;  4I7K A;  5LZM A;  1T8A A;  1C61 A;  4ARP A;  4EJ4 A;  2Y03 A;  1L22 A;  1QTZ A;  237L A;  1X0K 1;  5B6Y A;  3C9L A;  4BWB A;  1CX6 A;  2PED A;  1KME A;  1L07 A;  143L A;  1VGO A;  109L A;  113L A;  1C67 A;  1LYJ A;  163L A;  189L A;  248L A;  4E97 A;  5B6X A;  1T6H A;  3D4S A;  3VGA A;  1L83 A;  2HUM A;  1L30 A;  1CV3 A;  2RB1 X;  1JQU A;  3P0G A;  3DN6 A;  2R4S A;  4GBR A;  1C6Q A;  262L A;  205L A;  209L A;  103L A;  3L64 A;  1DYF A;  3QBI A;  257L A;  107L A;  1JV7 A;  2RBQ A;  1P2R A;  1QSQ A;  2F95 A;  102L A;  3DN4 A;  4EXM A;  1PXR A;  1SWY A;  2Z6B A;  3HTD A;  251L A;  1R84 A;  119L A;  166L A;  3QJS B;  4X31 A;  4X32 A;  1P7S A;  1NHB A;  5DHH A;  3QJQ B;  1C6C A;  2A4T A;  1KGB A;  2RAZ X;  198L A;  3OAX A;  5KKH A;  1KS3 A;  1L60 A;  230L A;  1OV7 A;  245L A;  2OEA X;  4EPI A;  1CTW A;  3MBV A;  3SBB C;  4W56 A;  126L A;  1D9W A;  4MD1 A;  1L63 A;  4FPD A;  164L A;  4YX7 C;  3HUA A;  4I7N A;  120L A;  1S52 A;  1D3F A;  170L A;  2JAF A;  2YDO A;  4G7Q B;  1GUE A;  2YCX A;  1C6H A;  4FAA B;  3SB7 A;  2YCZ A;  1IW6 A;  1LI3 A;  3VG9 A;  1L77 A;  1OVJ A;  235L A;  3C8S A;  1LGU A;  4GBR B;  191L A;  4EKS A;  4I7J A;  1T8G A;  4I7R A;  4PXK A;  2O4W A;  1L82 A;  2O7A A;  225L A;  254L A;  1QKO A;  2O79 A;  1P6Y A;  3PXO A;  156L A;  3S3B B;  3K2R A;  4LDL A;  4I7L A;  1CUP A;  4ARQ A;  2LNL A;  3DN0 A;  4W54 A;  4XTN A;  1DYC A;  3S8G B;  220L A;  1L53 A;  2LC9 A;  1KY0 A;  4I7P A;  249L A;  3PQR A;  192L A;  1QUG A;  1S8J A;  2LZM A;  1L51 A;  1QUH A;  4LDO A;  2ANV A;  180L A;  1FBB A;  1L35 A;  3C7Y A;  4UHR A;  1L24 A;  1G1W A;  3ZPR A;  3DN3 A;  2Z73 A;  3DQB A;  1KW7 A;  3GUO A;  3PDS A;  1F88 A;  1Q5J A;  3A7K A;  1L41 A;  3S8F B;  1LGW A;  1L49 A;  3EH4 B;  2ZZL A;  1OVH A;  1X0S A;  1OWY A;  5AX0 A;  2B72 A;  1L10 A;  172L A;  1L06 A;  3OE0 A;  240L A;  5B2N A;  5B6W A;  160L A;  1L11 A;  1L74 A;  1L85 A;  2R4R A;  3COD A;  1L32 A;  1WTH A;  1L48 A;  129L A;  1JV6 A;  3KJ6 A;  258L A;  3HT6 A;  5H2M A;  1AP9 A;  1LYH A;  5G28 A;  1CU2 A;  1L50 A;  3HH3 A;  4KLY A;  1P5C A;  3DN8 A;  1L43 A;  2ZFE A;  1GU8 A;  3NY8 A;  3X3C A;  4FA7 B;  4HYX A;  1P8U A;  141L A;  3VW7 A;  3S3C B;  4I7M A;  3EML A;  3F8V A;  1QT3 A;  1C6G A;  4UG2 A;  150L A;  2OU9 A;  4YXC A;  4EIY A;  1EHK B;  3CDR A;  2B74 A;  4W59 A;  1L58 A;  2M3G A;  3X3B A;  227L A;  6LZM A;  252L A;  2Z55 A;  1JTM A;  1F4Z A;  4EKQ A;  1L01 A;  228L A;  2B6Z A;  1D2W A;  219L A;  2I1X A;  108L A;  1L23 A;  1L0J A;  1QTD A;  4BVN A;  1TN5 A;  4XT1 A;  1L25 A;  1QHJ A;  4MQT A;  218L A;  1KG8 A;  3QDC A;  4J4Q A;  5H2I A;  145L A;  4BV0 A;  1C64 A;  4IAQ A;  1L52 A;  2YCY A;  5ITC A;  1C65 A;  4PK0 A;  5BR2 A;  259L A;  221L A;  1OV5 A;  1C62 A;  1L36 A;  1C69 A;  1S54 A;  4XXJ A;  214L A;  5H2H A;  1L14 A;  1R2N A;  1C6L A;  1P3N A;  1L57 A;  3EH3 B;  1L95 A;  1G0K A;  4I7T A;  1FBK A;  1UCQ A;  4PJZ A;  4L35 A;  1L84 A;  1L15 A;  4W52 A;  3NSB A;  1EPY A;  3UTV A;  148L E;  146L A;  1C63 A;  3DNA A;  3BVD B;  1I6S A;  4XTL A;  4GRV A;  2RB2 X;  2YCW A;  4JR8 A;  2NTG A;  5H2O A;  4W51 A;  261L A;  177L A;  2OU0 X;  3C8Q A;  4EKP A;  2KSY A;  3DN2 A;  4EPF A;  1E12 A;  247L A;  2RBO A;  3DMV A;  2KS9 A;  5BR5 A;  5B6Z A;  2NTU A;  4AQN A;  2B6X A;  125L A;  142L A;  3COC A;  181L A;  147L A;  152L A;  1L79 A;  1LI6 A;  1L39 A;  2QAR C;  1L72 A;  4HWL A;  1L26 A;  231L A;  1MGY A;  1L92 A;  3NY9 A;  250L A;  1CV4 A;  1L91 A;  165L A;  3HUK A;  187L A;  1L27 A;  2F2Q A;  3DN1 A;  4OO9 A;  216L A;  1D3J A;  3RFM A;  1L97 A;  1QUO A;  1LN6 A;  1U19 A;  1L73 A;  104L A;  1K28 A;  2OU8 A;  3ZEV A;  3RUN A;  3F9L A;  2Q9E A;  4K5Y A;  1QT4 A;  2B6W A;  2OTY X;  1BM1 A;  4BEY A;  1OVK A;  3OE8 A;  115L A;  1PQJ A;  1DZE A;  1S51 A;  112L A;  1L21 A;  4GP4 B;  1L31 A;  1L81 A;  215L A;  1L9H A;  1L75 A;  2I21 A;  1C68 A;  3HT9 A;  1LWK A;  226L A;  195L A;  2KSB A;  3VVK A;  1P37 A;  4W55 A;  1L34 A;  159L A;  4S0W A;  4WAV A;  130L A;  1C6N A;  3HAQ A;  149L A;  2I20 A;  1O0A A;  2HPY A;  1IXF A;  2L6X A;  1L38 A;  1XEP A;  1BRX A;  3HDE A;  3QJR B;  128L A;  1L86 A;  3QBG A;  200L A;  1L89 A;  3UZA A;  1C6A A;  3QAK A;  2RH1 A;  3UON A;  5G2A A;  4OV0 A;  4X1H A;  1LPY A;  4GP5 B;  3DMZ A;  1L18 A;  4G72 B;  1D3N A;  1L00 A;  1L68 A;  155L A;  110L A;  3GUN A;  2WJK A;  3G3X A;  4I7Q A;  1L80 A;  3GUM A;  1L45 A;  3HAS A;  1S53 A;  2RBN A;  157L A;  2Y02 A;  1L09 A;  1PQK A;  5G36 A;  158L A;  1DYE A;  4A4M A;  3C9M A;  161L A;  1L03 A;  1C6J A;  4AMI A;  5JJJ A;  185L A;  1B6I A;  1X0I 1;  1L62 A;  1C6D A;  1C6K A;  229L A;  190L A;  1KNI A;  1L88 A;  236L A;  131L A;  1C6T A;  2F47 A;  2RAY X;  5I14 A;  1KW5 A;  1E0P A;  1JFP A;  4N4Y B;  3ZPQ A;  183L A;  3HT7 A;  4IB4 A;  3OE6 A;  1LYG A;  1SSW A;  1L64 A;  138L A;  1L90 A;  1TLA A;  3HWL A;  3NS0 A;  1QS5 A;  1LI2 A;  4DKL A;  2AT9 A;  4W58 A;  5B35 A;  197L A;  233L A;  3HTG A;  4ARQ B;  1P2L A;  3CAP A;  5G54 A;  1L44 A;  2L78 A;  5G53 A;  1QS9 A;  213L A;  2ANX A;  238L A;  3HH5 A;  1S8L A;  1P46 A;  1LYD A;  1KG9 A;  255L A;  3NYA A;  1LW9 A;  2NTH A;  3ODU A;  3S3D B;  1TN0 A;  3CDV A;  224L A;  171L A;  1CWQ A;  4G70 B;  176L A;  1CU5 A;  4G7R B;  168L A;  3HU9 A;  3UG9 A;  3LZM A;  2IGC A;  5AZD A;  1D3M A;  5LWE A;  212L A;  2RBP A;  206L A;  1BRR A;  222L A;  4ARJ A;  4L6R A;  4DAJ A;  1L65 A;  1C60 A;  139L A;  3WQJ A;  1CX7 A;  1C8R A;  144L A;  3CDQ A;  5G2D A;  3T45 A;  1SSY A;  1QKP A;  2OE7 X;  5H2L A;  5A8E A;  3HH4 A;  1CVK A;  244L A;  246L A;  3JR6 A;  3HU8 A;  211L A;  3G3W A;  1L69 A;  3HT8 A;  1L37 A;  5H2N A;  5H2J A;  2I35 A;  1L13 A;  5AX1 A;  3UZC A;  1AT9 A;  2RBR A;  1P8H A;  3C7Z A;  1C6I A;  5B34 A;  1G07 A;  1G0M A;  2YDV A;  4DJH A;  2J4Y A;  5DHG A;  1L12 A;  1L20 A;  3C7W A;  1XJT A;  2B6T A;  3C82 A;  3ABW A;  3QJT B;  4Y9H A;  1PY6 A;  3VHZ A;  5A45 A;  3QBK A;  2NTW A;  2B73 A;  4YXA C;  1L67 A;  2VT4 A;  5F8U A;  1JGJ A;  3REY A;  174L A;  3FI5 A;  3SB5 A;  260L A;  2OE9 X;  1KY1 A;  3DDL A;  5B0W A;  2QPD B;  1CV0 A;  4TL3 A;  1ZUR A;  1LLH A;  1QTH A;  137L A;  2LCB A;  1OWZ A;  1G0G A;  4ARM A;  1XME B;  4I7O A;  4ARL A;  1C6M A;  1SX2 A;  1L59 A;  3HUQ A;  4EA3 A;  4W57 A;  167L A;  3OE9 A;  2WJL A;  1OYU A;  1XIO A;  1CU3 A;  3C80 A;  3C83 A;  1IW9 A;  5A44 A;  1C6P A;  1CUQ A;  2JAG A;  5JJN A;  1G1V A;  2HUK A;  1CU0 A;  4GP8 B;  210L A;  3G3V A;  4IAR A;  1DYA A;  1M0L A;  1DYD A;  1L28 A;  2Y01 A;  3SBA A;  4QID A;  5AHZ A;  4MD2 A;  4HYJ A;  4MQS A;  1BRD A;  3HAO A;  3AYM A;  1F50 A;  140L A;  118L A;  122L A;  162L A;  2Y00 A;  2OE4 X;  1QM8 A;  256L A;  243L A;  3V2Y A;  3AYN A;  2KSA A;  1VJM A;  1PQO A;  2B70 A;  1T8F A;  5AWZ A;  2QPE B;  1L70 A;  1L61 A;  1G0J A;  1L33 A;  2CUU A;  5AHY A;  3HDF A;  3DKE X;  1PQD A;  1L96 A;  1LYF A;  1QUD A;  3DMX A;  241L A;  1G0Q A;  232L A;  4XTO A;  1SWZ A;  1H68 A;  1CV1 A;  3RZE A;  4ARM B;  3HAP A;  4NC3 A;  4QRY A;  1UAZ A;  5H2P A;  4GPO A;  3GUK A;  3HTB A;  2Y04 A;  1L98 A;  1QTC A;  1L19 A;  2G87 A;  2F93 A;  5C1M A;  1L54 A;  1PQI A;  1L08 A;  3HTF A;  3UTY A;  1C6F A;  1GZM A;  3QJV B;  4G7S B;  1L0M A;  1G0L A;  5EN0 A;  1L40 A;  1L0K A;  4AMJ A;  1LGX A;  2ZIY A;  3QAP A;  1CV5 A;  5FJG A;  1L56 A; 
#chains in the Genus database with same CATH topology
 5ITE A;  4GN3 A;  1QT5 A;  3VI0 A;  1LZN A;  4JKV A;  1UIC A;  234L A;  4LDE A;  1C3W A;  1GF3 A;  4BS7 A;  1P56 A;  1ZWN A;  4NHP A;  4ZPU A;  3TXE A;  4DT3 A;  1M0M A;  3GUJ A;  4J7V A;  2D4K A;  223L A;  127L A;  4WM4 A;  1L87 A;  1J1X Y;  1LZE A;  1LJ3 A;  5H2K A;  201L A;  5G2C A;  4Z41 A;  3GUI A;  186L A;  4H9F A;  4NHT A;  1LHM A;  3A34 A;  1QT7 A;  4D9Z A;  4JQ6 A;  4LYT A;  3CDT A;  1SX7 A;  3C8R A;  1LYE A;  4NG1 A;  1WQO A;  4EKR A;  2QB0 B;  2NWD X;  1GB5 A;  3IJV A;  1QTB A;  3D3D A;  1L29 A;  1L93 A;  1GE0 A;  4I7S A;  4ETE A;  1XFP L;  1YL0 X;  1L42 A;  1PXS A;  1YRO A;  1LZ9 A;  4G4H A;  2H9J A;  3HAN A;  4WO9 A;  2ZNX Y;  2B75 A;  5II3 A;  1GXX A;  4XT3 A;  2ZIJ A;  242L A;  4UWU A;  4IAP A;  3FA0 A;  4PXF A;  2YDG A;  3EMS A;  4WM3 A;  5LZM A;  1C61 A;  2BQN A;  3WVY A;  1B2K A;  1JKB A;  2Y8P A;  1CX6 A;  1IIZ A;  4WLY A;  3TXD A;  4GCD A;  143L A;  109L A;  1CJ8 A;  1LYJ A;  4WLT A;  1T6H A;  2F4A A;  3VGA A;  2HUM A;  1L30 A;  1KXY A;  3WPJ A;  4GBR A;  1WVV A;  205L A;  209L A;  103L A;  4LYO A;  257L A;  1GE4 A;  5KXP A;  1SWY A;  3HTD A;  5JEN B;  3QJS B;  1AM7 A;  5I4W A;  4DQ7 A;  1NHB A;  3QJQ B;  1GB0 A;  1KGB A;  3SP3 A;  1JSE A;  198L A;  3OAX A;  5KKH A;  1L60 A;  1LJI A;  1PZY A;  245L A;  5LYZ A;  3SBB C;  2DQD Y;  5E9R A;  4W56 A;  4NY5 A;  2HUB A;  7LYZ A;  4I7N A;  120L A;  1D3F A;  4G7Q B;  1JJ1 A;  1GE2 A;  4NWE A;  1LI3 A;  1L77 A;  4EKS A;  3WW6 A;  1T8G A;  4I7R A;  4PXK A;  1IWU A;  1UBZ A;  1YAN A;  4BAD A;  3PXO A;  2ZIK A;  1AZF A;  1C45 A;  1JPO A;  4LDL A;  2LNL A;  2Z2F A;  3DN0 A;  2WAR A;  3S8G B;  2CJL A;  2LC9 A;  4I7P A;  192L A;  3WUA A;  2LZM A;  5EBH A;  1QUH A;  1L35 A;  1F6R A;  1OUJ A;  3P4Z A;  1AT6 A;  1C46 A;  3DN3 A;  1Q5J A;  4GN5 C;  1GXV 2;  3EH4 B;  2CGI A;  2ZZL A;  5B1G A;  160L A;  1L11 A;  3AZ7 A;  1L85 A;  1WTH A;  1L48 A;  129L A;  3FI7 A;  258L A;  1HEL A;  5KXM A;  3CT1 A;  1CU2 A;  3HH3 A;  2ZFE A;  3X3C A;  4FA7 B;  4IAT A;  4LT0 A;  3F8V A;  1C6G A;  4UG2 A;  1ZMY L;  2HEB A;  2MEE A;  3CDR A;  4W59 A;  5A3E A;  1JTM A;  1L01 A;  1LSA A;  2HEE A;  4OOT A;  1BQL Y;  4XT1 A;  1QHJ A;  4ET8 A;  218L A;  2EIZ C;  3QDC A;  4MQT A;  1IP1 A;  1DKK A;  1QQY A;  2MED A;  221L A;  3M3U A;  1AKI A;  1NF5 A;  1CKF A;  8LYZ A;  2EPE A;  1L14 A;  1TDY A;  1P3N A;  1L57 A;  3EH3 B;  3A90 A;  4I7T A;  1CNS A;  5ILF A;  2HEC A;  3AW7 A;  3EO5 A;  2F30 A;  1B7O A;  1C63 A;  1LYY A;  2YCW A;  5H2O A;  1UA6 Y;  4WM2 A;  1VAT A;  1NHE A;  4EKP A;  2KS9 A;  247L A;  5B6Z A;  1NDM C;  1GFV A;  4CFO A;  3ZVQ B;  1NMM A;  1LJN A;  5LVH A;  1GFU A;  4DQ5 A;  4II8 A;  165L A;  4GCB A;  2Z39 A;  2FBB A;  3TXH A;  4DYG A;  3ZEV A;  1OUI A;  4UWN A;  2B6W A;  3A91 A;  6LYT A;  3OE8 A;  1EQE A;  1LZ8 A;  1PQJ A;  1B5W A;  1L75 A;  2I21 A;  1C68 A;  3TXF A;  1B7N A;  1LWK A;  5FCP A;  1VDQ A;  1BWH A;  1FKV A;  3B0I A;  4OWC A;  3VVK A;  1QUT A;  1L34 A;  1DI3 A;  3HAQ A;  149L A;  4RW2 A;  1REM A;  4Z46 A;  1FLQ A;  1HMK A;  128L A;  3UZA A;  1JHL A;  5I4X A;  3UON A;  4DWX A;  1LSF A;  4XJB A;  4GP5 B;  1LZS A;  4G72 B;  1L00 A;  1L68 A;  110L A;  1J1P Y;  3HAS A;  1LZ1 A;  3A3R X;  1S53 A;  1QDR A;  4A4M A;  161L A;  1L03 A;  4LT3 A;  5FST A;  3AYQ A;  1B6I A;  4DD3 A;  1VAU A;  1IX0 A;  2ZYC A;  1GFH A;  2BQH A;  4N4Y B;  3ZPQ A;  5A3Z A;  3HT7 A;  4MR1 A;  3OK0 A;  2LYZ A;  3OE6 A;  1IOR A;  4M4O A;  1L64 A;  138L A;  3HWL A;  5F9U A;  4W58 A;  2DBT A;  1I1Z A;  1LHH A;  4ARQ B;  5G53 A;  213L A;  3WYH A;  1YAQ A;  3ODU A;  5C6I A;  3CDV A;  171L A;  4G70 B;  176L A;  4G7R B;  4H93 A;  5B59 A;  3UG9 A;  3LZM A;  2IGC A;  4LT1 A;  5LWE A;  4PJ2 C;  1BRR A;  222L A;  1QIO A;  1L65 A;  1C60 A;  3A67 Y;  4CJ2 A;  3G3A B;  1CJ7 A;  144L A;  3A93 A;  3CDQ A;  3T45 A;  1CJ6 A;  3HH4 A;  1CVK A;  3JR6 A;  246L A;  1WTM A;  3HU8 A;  1LKS A;  1TAY A;  4KPM A;  5H2J A;  1L13 A;  1LMT A;  5IEL A;  5C6L A;  1GFE A;  2Z2E A;  1JKA A;  4B4I A;  5DHG A;  1L12 A;  1L20 A;  1BHZ A;  2B6T A;  1PY6 A;  5A45 A;  2XQO A;  1CKD A;  5D5F A;  2LZT A;  5F8U A;  3REY A;  174L A;  3SB5 A;  2DQI Y;  260L A;  3DDL A;  4NSG A;  1B7P A;  2BQE A;  1LMA A;  4TL3 A;  4XJI A;  1C6M A;  4EA3 A;  4W57 A;  1B7M A;  4HTN A;  3OE9 A;  3G3B B;  1XIO A;  1IW9 A;  1C6P A;  1CUQ A;  1HEP A;  2JAG A;  5JJN A;  4H9I A;  1G1V A;  3F6Z A;  2HUK A;  2YBL A;  3G3V A;  4QID A;  5KY1 A;  1GF7 A;  1BRD A;  3AYM A;  1F50 A;  3LZT A;  122L A;  4BAP A;  5KXO A;  1WQN A;  243L A;  3J4G A;  4NGL A;  5FEL A;  2B70 A;  5AWZ A;  2QPE B;  1XGT C;  1IOS A;  1LZ4 A;  5AHY A;  3DKE X;  1PQD A;  1CV1 A;  5DM9 A;  3EBA B;  4GLV A;  5IHG A;  5H2P A;  3GUK A;  3HTB A;  2BQF A;  1TCY A;  1L54 A;  2BQK A;  1L08 A;  1TBY A;  4H9E A;  3UTY A;  1BB5 A;  2BAA A;  4HTQ A;  1G0L A;  5EN0 A;  4AMJ A;  4C3W A;  1HER A;  4RDS A;  2CWI A;  4WM6 A;  1NBZ C;  2XTH A;  4IAS A;  4QEQ A;  1L55 A;  4N6H A;  1L02 A;  4NWH A;  3HH6 A;  1XGU C;  4WL7 A;  2LYM A;  2ZQ4 A;  4LZM A;  4P2E A;  1DXJ A;  4W53 A;  2G4Q A;  114L A;  1UUZ C;  1UIH A;  3TMX A;  169L A;  4G71 B;  1DYB A;  5I54 A;  1H2S A;  178L A;  1C6E A;  3A92 A;  4DD7 A;  4KL7 A;  3QE8 A;  1GFR A;  1QT6 A;  4GYC A;  2F4G A;  3FAD A;  5F81 A;  3W3E A;  2EQL A;  3TXG A;  3PWH A;  3PBL A;  1LSM A;  1IC5 Y;  1QT8 A;  3FE0 A;  3WUL A;  1YAP A;  2HUL A;  3L2X A;  4U3X B;  2D6B A;  1L66 A;  3QBL A;  1YQV Y;  239L A;  3LHM A;  1LJH A;  3WMK A;  3QJU B;  4OOO A;  2C8P A;  5LA8 A;  3QNG A;  1DYG A;  4LZT A;  1CU6 A;  1LJF A;  1F6S A;  1T8A A;  1L22 A;  5B6Y A;  3LYZ A;  1L07 A;  3LYO A;  4NGJ A;  1LZA A;  248L A;  2Z12 A;  4E97 A;  4NGZ A;  193L A;  4WMG A;  1CV3 A;  2ZWB A;  2R4S A;  5L3H A;  1IWT A;  1RI8 B;  5DLA A;  1WQQ A;  4H94 A;  2H5Z A;  1QSQ A;  3DN4 A;  4HV1 A;  1HSW A;  1R84 A;  166L A;  1LZ6 A;  4X31 A;  1JWR A;  5DHH A;  1OUH A;  2OEA X;  126L A;  1D9W A;  1L63 A;  4YX7 C;  2Z38 A;  1S52 A;  2JAF A;  3WUM A;  1EL1 A;  1KXX A;  1C6H A;  1GF5 A;  1LGU A;  4GBR B;  191L A;  4NSI A;  4I7J A;  1IOQ A;  5T3F A;  1L82 A;  225L A;  254L A;  1QKO A;  1P6Y A;  1B5U A;  4WG1 A;  3J6K A;  1REX A;  4W54 A;  1IEE A;  1UC0 A;  5LVK A;  249L A;  4O34 A;  1IWV A;  1LSD A;  2H9K A;  3EXD A;  1JSF A;  2ANV A;  180L A;  1LSY A;  1OUD A;  4UHR A;  1GFK A;  1LJ4 A;  4LYZ A;  3S8F B;  1HC0 A;  1B7S A;  1KXW A;  1L49 A;  4GCC A;  1OWY A;  2B72 A;  1L06 A;  2DQF C;  5B2N A;  1L74 A;  1TEW A;  2R4R A;  1L32 A;  3LYT A;  1GBW A;  2FBD A;  2D4I A;  1NKH A;  5G28 A;  3AJN A;  1L50 A;  1P5C A;  3DN8 A;  3ATO A;  1L43 A;  4HYX A;  4DDC A;  3VW7 A;  1QT3 A;  3W6F A;  150L A;  4YXC A;  1B5X A;  1EHK B;  2M3G A;  207L A;  227L A;  4R6C A;  1IP4 A;  2I1X A;  108L A;  1TN5 A;  1L25 A;  4W96 A;  4BV0 A;  1KG8 A;  1C64 A;  1L52 A;  1GF8 A;  1GF0 A;  2YCY A;  1GPQ C;  5ITC A;  4PK0 A;  4XEN A;  1D6P A;  5BR2 A;  3M18 B;  1YIL A;  1S54 A;  5F16 A;  4XXJ A;  5H2H A;  1LJJ A;  1C6L A;  1G0K A;  1HEQ A;  1FBK A;  3NSB A;  1EPY A;  148L E;  4H8Y A;  4GRV A;  2RB2 X;  1HF4 A;  2NTG A;  1AT5 A;  1H6M A;  1F10 A;  1GF6 A;  1GF4 A;  4GN4 A;  3DMV A;  5LVI A;  4AQN A;  2B6X A;  4HJV A;  147L A;  4DD2 A;  1HFX A;  1L79 A;  194L A;  1L72 A;  2ZNW Y;  3NY9 A;  1DI4 A;  250L A;  4IJ4 A;  1L91 A;  1IR9 A;  2F2Q A;  4OO9 A;  1DPX A;  1IVM A;  5FHW A;  1QUO A;  2A7D A;  1U19 A;  104L A;  2OU8 A;  3W6E A;  3WXU A;  3RUN A;  1JTT L;  4K5Y A;  1QT4 A;  4BEY A;  3CT5 A;  2YBI A;  1S51 A;  1L21 A;  2DQG Y;  3OJP A;  3TMW A;  1L9H A;  4NIJ A;  3QAP A;  195L A;  4DS7 E;  4XJG A;  4B4E A;  3AZ6 A;  1O0A A;  4H1P A;  6LYZ A;  1IXF A;  4WLX A;  1XEP A;  5ILC A;  3RZ4 A;  1C6A A;  3AGI A;  5G2A A;  1LZ5 A;  5LAF A;  1LPY A;  1LZY A;  4XTN A;  3GXK A;  155L A;  1L80 A;  2RBN A;  157L A;  2Y02 A;  1PQK A;  1DYE A;  1PS5 A;  2PC2 A;  1L62 A;  4GCF A;  1C6K A;  5LVJ A;  1XEK A;  1E0P A;  132L A;  3A6C Y;  4DD1 A;  5I14 A;  1KW5 A;  183L A;  1LHL A;  4RLM A;  1IOC A;  1NDG C;  1SSW A;  3TXJ A;  1TLA A;  1LKR A;  2RSC A;  2AT9 A;  5B35 A;  197L A;  2HEA A;  1P2L A;  2YBH A;  5LYT A;  238L A;  1LYD A;  1KG9 A;  1TN0 A;  5LAG A;  1C10 A;  4QDN A;  5APC A;  4DD0 A;  1EQ4 A;  2RBP A;  4ARJ A;  4KXI A;  5HMJ A;  139L A;  1CX7 A;  1MEL L;  4YOP A;  3WXT A;  5G2D A;  5DN4 A;  1QKP A;  1JKD A;  4N1E I;  2YVB A;  4I0C A;  1I20 A;  211L A;  3HT8 A;  5H2N A;  1UIB A;  1AT9 A;  2Z18 A;  2RBR A;  1LHI A;  5B34 A;  3WL2 A;  1G07 A;  1G0M A;  1QDT A;  3TXK A;  2J4Y A;  1IY4 A;  1GFT A;  3A6B Y;  4TSB A;  3ZEK A;  4Y9H A;  1G7I C;  3VHZ A;  1JEF A;  3QBK A;  1FKQ A;  2B73 A;  4NGY A;  154L A;  3AZ5 A;  4Z98 A;  1ZV5 L;  2OE9 X;  5B0W A;  1LYO A;  1CV0 A;  5B05 A;  5APF A;  4ARM A;  3ULR A;  4I7O A;  1UIA A;  4PPO A;  4ARL A;  1SX2 A;  1L59 A;  3HUQ A;  1IOT A;  167L A;  1BB4 A;  2DQC Y;  5IDD A;  2Z19 A;  1LMN A;  4B49 A;  1CU3 A;  3LZ2 A;  5A44 A;  210L A;  2Z37 A;  1DYA A;  2Y01 A;  5AHZ A;  3SBA A;  1YAO A;  1HEO A;  140L A;  118L A;  4CHX A;  1ZVH L;  1V7T A;  162L A;  4G49 A;  5KXS A;  2OE4 X;  1QM8 A;  1FN5 A;  5HQ1 A;  1T8F A;  1LMP A;  2MEB A;  1LHJ A;  1G0J A;  1L33 A;  2CUU A;  3W6D A;  1GAZ A;  1L96 A;  3DMX A;  3B72 A;  4XTO A;  3A95 A;  3RZE A;  4QRY A;  1QUS A;  3HAP A;  3WPK A;  1UAZ A;  4GPO A;  2Y04 A;  1QTC A;  2G87 A;  1FLW A;  5C1M A;  3HTF A;  1C6F A;  2BLY A;  3AB6 A;  1GZM A;  3QJV B;  4E3U A;  1L0K A;  2ZIY A;  158L A;  3W6B A;  3CT0 A;  5I53 A;  1L47 A;  1XJI A;  3UTW A;  1LWG A;  4WOA A;  3SB6 A;  4LFP A;  2B7X A;  2B5Z A;  151L A;  4LFX A;  1UAC Y;  196L A;  5TGZ A;  1LZG A;  5KXT A;  1M0K A;  111L A;  4WW3 A;  2DQA A;  2Q0M X;  4FJR A;  4BUO A;  1C8S A;  5B6V A;  1QSA A;  4LYC A;  1GBZ A;  2BPU A;  5LIN A;  1XJU A;  182L A;  199L A;  5FDJ A;  3GUL A;  3GUP A;  1IY3 A;  4HPI A;  1QTE A;  1L71 A;  3SB9 A;  4N4W A;  2EI4 A;  3SN6 R;  1W6Z A;  1C6B A;  1L46 A;  1ZYT A;  4ETD A;  3CSR A;  2LHM A;  153L A;  4QY9 A;  1L16 A;  1OUE A;  3AM6 A;  1LSC A;  1UIE A;  2HU3 A;  1WQM A;  5LIO A;  3C81 A;  1QSB A;  1G7H C;  4BEZ A;  2W1Y A;  1H87 A;  2G4N A;  1HML A;  3AZ4 A;  3T6U A;  5DN5 A;  5J7A A;  1L17 A;  1L04 A;  1FBI X;  3A96 A;  3EH5 B;  1PQM A;  1C66 A;  1WQP A;  1GD6 A;  1LPI A;  4ARP A;  4PHI A;  5FEK A;  237L A;  5B06 A;  3TXI A;  4G9S A;  1X0K 1;  3RNX A;  3C9L A;  1KME A;  1VGO A;  113L A;  4TWS A;  4DC4 A;  9LYZ A;  163L A;  189L A;  4TX7 A;  3D4S A;  5L3I A;  1L83 A;  1DQJ C;  1UIF A;  2RB1 X;  1NBY C;  1IC4 Y;  3CB7 A;  1XGP C;  1GBY A;  1GFG A;  3QBI A;  107L A;  1LYZ A;  3RU5 A;  4DQJ A;  2RBQ A;  1PXR A;  4EXM A;  251L A;  119L A;  1BB7 A;  3N9A A;  4X32 A;  1B9O A;  3IWR A;  4HJY A;  1BWJ A;  5M1Y A;  4EPI A;  1CTW A;  3MBV A;  4MD1 A;  1GB9 A;  3QY4 A;  4KT3 A;  2YDO A;  1RJC B;  3CSQ A;  1GUE A;  2YCX A;  4UWV A;  4Z3M A;  3VG9 A;  1OVJ A;  235L A;  4NSH A;  3C8S A;  2O4W A;  4XJD A;  2O79 A;  156L A;  3S3B B;  3K2R A;  1GB7 A;  1CUP A;  4ARQ A;  4H8Z A;  2MEA A;  1DYC A;  3TMV A;  1KY0 A;  1OUF A;  1QUG A;  1SLY A;  4RW1 A;  1L51 A;  1OUG A;  2BQO A;  4NGV A;  1HEM A;  1L24 A;  1LZD A;  1G1W A;  1IWZ A;  5C6J A;  2Z73 A;  1KW7 A;  3PDS A;  1IP5 A;  4NHQ A;  1F88 A;  2MEF A;  1L41 A;  3A7K A;  1KIP C;  1LGW A;  1JKC A;  1OVH A;  1X0S A;  1L10 A;  1JIS A;  240L A;  5B6W A;  1GEZ A;  1JV6 A;  3AGH A;  3HT6 A;  5H2M A;  1AP9 A;  1LYH A;  2I26 L;  1NWG A;  4KLY A;  1YKX X;  2BQJ A;  3NY8 A;  2HU1 A;  1G7J C;  3S3C B;  1QSW A;  1KIQ C;  3EML A;  4I7M A;  3AW6 A;  2DQJ Y;  3AGG G;  2OU9 A;  2W1L A;  4NGK A;  1LJG A;  1L58 A;  2Z55 A;  4CFP A;  1IP2 A;  1F4Z A;  1B0D A;  4YM8 A;  2B6Z A;  2HEF A;  1VDS A;  219L A;  1L23 A;  1L0J A;  1QTD A;  1XGQ C;  2F2N A;  4M6D A;  4J4Q A;  145L A;  1GDW A;  4OWH A;  4ZEE A;  1C65 A;  259L A;  3WH1 A;  1C62 A;  1HFZ A;  3LYM A;  1L36 A;  4J1A A;  1JJ0 A;  1D9U A;  1JTP L;  1LZB A;  3WU9 A;  4C5F A;  4HTK A;  1UCQ A;  4L35 A;  1L84 A;  4W52 A;  4J1B A;  3UTV A;  3DNA A;  3BVD B;  1XGR C;  261L A;  4XJH A;  1SQ2 L;  2OU0 X;  2KSY A;  1JTO L;  3DN2 A;  4EPF A;  2RBO A;  5BR5 A;  2NTU A;  2I6Z A;  1LZC A;  4XN6 A;  2D91 A;  152L A;  5HMV A;  5J7C A;  1LI6 A;  1C43 A;  1LOZ A;  3BKH A;  3B6L A;  1CKC A;  1L26 A;  231L A;  1L92 A;  1LJK A;  1L27 A;  3DN1 A;  216L A;  1L97 A;  1LN6 A;  1DZB X;  1K28 A;  2MEC A;  2Q9E A;  1FDL Y;  1OVK A;  1DZE A;  112L A;  4PRU A;  4GP4 B;  2EKS C;  2MEG A;  5L9J A;  4B0D A;  226L A;  1C08 C;  3K3T A;  2CDS A;  2ZIL A;  5KXR A;  159L A;  4S0W A;  1GHL A;  1LMQ A;  2IFF Y;  5E4P A;  4GCE A;  1VFB C;  5LVG A;  2L6X A;  1BRX A;  3HDE A;  3QBG A;  3B0K A;  1JIY A;  200L A;  4OV0 A;  1T3P A;  3DMZ A;  134L A;  1L18 A;  3GUN A;  4DD9 A;  4ET9 A;  1L09 A;  4LGK A;  3C9M A;  5JJJ A;  3RT5 X;  1BWI A;  1C6D A;  4DDB A;  190L A;  4H8X A;  1E8L A;  1KNI A;  4BAF A;  1L88 A;  1JFP A;  131L A;  1C6T A;  2F47 A;  1J1O Y;  1V7S A;  1INU A;  1LYG A;  1LMO A;  3NS0 A;  135L A;  4ML7 A;  3CAP A;  5G54 A;  1L44 A;  2L78 A;  1KIR C;  1P46 A;  3W6A A;  255L A;  4YF2 A;  1LW9 A;  3S3D B;  1RCM A;  224L A;  2N5Z A;  168L A;  4YEO A;  4AXT A;  4ZFP A;  1D3M A;  4YEM A;  2BQB A;  1HFY A;  1GF9 A;  4DAJ A;  1BGI A;  1B7Q A;  1GE3 A;  1C8R A;  1RFP A;  1LZT A;  5H2L A;  2OE7 X;  1WTN A;  5A8E A;  4MST A;  3G3W A;  1L69 A;  3P64 A;  5AX1 A;  3UZC A;  3D9A C;  1Z55 A;  3C7Z A;  4J0L A;  4RLN A;  2YDV A;  1GEV A;  1MLC E;  4DJH A;  4LYB A;  3W6C A;  1XJT A;  4XJF A;  3QJT B;  2NTW A;  3N9E A;  1L67 A;  2W1M A;  1JGJ A;  3FI5 A;  4HSF A;  1LYS A;  1KY1 A;  1VDP A;  2VB1 A;  2QPD B;  1LSG A;  4WG7 A;  1ZUR A;  1LLH A;  2LCB A;  1OWZ A;  5AMY A;  1XME B;  1IWW A;  1OUB A;  2GV0 A;  1F0W A;  1DKJ A;  2DQH Y;  1OYU A;  1NQI A;  2D4J A;  1N4F A;  3C83 A;  2BQA A;  4WM5 A;  1IP6 A;  1HEN A;  1CU0 A;  3WPL A;  4IAR A;  1M0L A;  1DYD A;  1IWY A;  1P2C C;  4HYJ A;  4MQS A;  2C8O A;  3HAO A;  4NFV A;  3WVX A;  1LAA A;  256L A;  3E3D A;  3AYN A;  3LN2 A;  1VJM A;  2AUB A;  4WL6 A;  3BKV A;  1PQO A;  4OW1 A;  1L61 A;  208L A;  4HV2 A;  5KXK A;  2MEI A;  1LSN A;  1G0Q A;  1H68 A;  4NC3 A;  4ARM B;  1L98 A;  1PQI A;  1BB3 A;  2ZYP A;  4G7S B;  5DL9 A;  2BQM A;  3CSZ A;  2MEH A;  1T6V L;  1QTV A;  1G0P A;  5I4Y A;  1IP7 A;  4H9B A;  4FBZ A;  4NG8 A;  217L A;  1CV6 A;  3WU8 A;  5F14 A;  1L94 A;  2X72 A;  188L A;  2I25 L;  2RBS A;  2OTZ X;  3CQL A;  2YSS C;  1C7P A;  4YEN A;  3V2W A;  5KJ9 A;  253L A;  4TSC A;  2X0A A;  184L A;  5LA5 A;  1P36 A;  4FDY A;  1HZX A;  1D0M A;  2RB0 X;  4QGZ A;  1OUA A;  1GB3 A;  173L A;  4B1A A;  2Q9D A;  1ZVY B;  5JJE A;  1T97 A;  2ZQ3 A;  3CDO A;  175L A;  1P64 A;  1UCO A;  3WW5 A;  4EMN A;  2XBR A;  1CKG A;  1L76 A;  5ETZ A;  1JJ3 A;  1WQR A;  4H91 A;  5DYS A;  1IC7 Y;  2F32 A;  1I56 A;  4QI1 A;  4WM1 A;  1LYI A;  3GXR A;  3SB8 A;  123L A;  4MBS A;  1G06 A;  3HAR A;  3UTX A;  1P8I A;  1VED A;  1D2Y A;  1RE2 A;  3WU7 A;  1LSE A;  1JTN A;  1QTK A;  1B5Z A;  2BRD A;  2B6Y A;  1L05 A;  3HBH A;  1L99 A;  4KNF A;  7LZM A;  1Q5I A;  4I7K A;  1B7R A;  1LTM A;  4EJ4 A;  2Y03 A;  5I5Q A;  1QTZ A;  4BWB A;  2PED A;  1W08 A;  1GBX A;  1C67 A;  5B6X A;  1D0L A;  5HNL A;  1YKY X;  4EOF A;  1YKZ X;  3P0G A;  1JQU A;  3DN6 A;  1C6Q A;  262L A;  1OP9 B;  1XEI A;  1GE1 A;  3L64 A;  1DYF A;  1JV7 A;  2F95 A;  1P2R A;  102L A;  2Z6B A;  1GBS A;  1DI5 A;  4I8S A;  1P7S A;  1G7M C;  1C6C A;  1LMC A;  2A4T A;  5HNC A;  2RAZ X;  4N5R A;  1KS3 A;  230L A;  1B5V A;  1OV7 A;  1BVK C;  1XEJ A;  2LYO A;  4FPD A;  164L A;  2DKV A;  3HUA A;  170L A;  1GFJ A;  4FAA B;  3ATN A;  4OWA A;  3SB7 A;  2YCZ A;  1IW6 A;  1A4V A;  1WVU A;  2BQI A;  1O23 A;  1LJE A;  2O7A A;  1D0K A;  1LSB A;  5KXL A;  4I7L A;  4ZIX A;  5B07 A;  1BB6 A;  4MCK A;  3A3Q A;  1GFA A;  220L A;  1L53 A;  1YIK A;  1IR7 A;  5HLL A;  3PQR A;  1S8J A;  4LDO A;  4N1C C;  1FBB A;  5LXW A;  3C7Y A;  3KAM A;  3ZPR A;  4NGO A;  3DQB A;  3GUO A;  5KXN A;  5AX0 A;  172L A;  3OE0 A;  3P68 A;  4B4J A;  3COD A;  4GLA A;  3KJ6 A;  1REZ A;  3RW8 A;  1IR8 A;  3A8Z A;  1GU8 A;  2HTX A;  1P8U A;  4X3B A;  141L A;  3TXB A;  1GB6 A;  2FYD A;  4EIY A;  3WUN A;  2B74 A;  3X3B A;  1UIG A;  6LZM A;  252L A;  4EKQ A;  228L A;  4ETB A;  1D2W A;  4BVN A;  4TTD A;  5K7O A;  4NHI A;  5H2I A;  1LSZ A;  3ZVQ A;  4IAQ A;  1LSP A;  1BVX A;  4N0J A;  4L41 A;  4TUN A;  1OV5 A;  1OUC A;  5KKJ A;  1C69 A;  4G4C A;  214L A;  1R2N A;  1DPW A;  1L95 A;  5D5C A;  5APD A;  5KXX A;  4PJZ A;  1L15 A;  5LYM A;  2XJW A;  1LCN A;  146L A;  1I6S A;  4XTL A;  4JR8 A;  1GAY A;  4NGW A;  1IP3 A;  4W51 A;  4ETA A;  177L A;  1GDX A;  3C8Q A;  5APE A;  1GBO A;  1E12 A;  2YBM A;  125L A;  142L A;  3MGW A;  3COC A;  181L A;  4PRQ A;  3P65 A;  2DQE Y;  2QAR C;  1L39 A;  1UID A;  4N9R A;  4HWL A;  1MGY A;  1CV4 A;  3HUK A;  187L A;  1D3J A;  4NEB A;  3RFM A;  4H9C A;  3T36 A;  1L73 A;  1D6Q A;  5B1F A;  3F9L A;  2OTY X;  1BM1 A;  115L A;  1IO5 A;  4LT2 A;  2G4P A;  4WLD A;  2LZ2 A;  2BLX A;  1L31 A;  1L81 A;  215L A;  3HT9 A;  2KSB A;  1YL1 X;  1P37 A;  4W55 A;  4WAV A;  130L A;  1C6N A;  2I20 A;  3HBE X;  4NHS A;  4N8Z A;  1JUG A;  3A94 A;  2HPY A;  1L38 A;  3QJR B;  1L86 A;  4A7D A;  1L89 A;  2IHL A;  3QAK A;  3N9C A;  2RH1 A;  4X1H A;  3HBD A;  1EQ5 A;  1D3N A;  2WJK A;  4G4B A;  4HP0 A;  3G3X A;  4I7Q A;  3GUM A;  1L45 A;  5G36 A;  2FYC A;  1C6J A;  4AMI A;  185L A;  1X0I 1;  1CJ9 A;  229L A;  4LYM A;  1G7L C;  236L A;  2RAY X;  1CKH A;  133L A;  1IWX A;  4IB4 A;  1GWD A;  1L90 A;  1FLY A;  3IJU A;  1QS5 A;  1LI2 A;  5KKI A;  4DKL A;  233L A;  3HTG A;  1YAM A;  1FLU A;  4CGE A;  4HPE A;  1QS9 A;  2ANX A;  3HH5 A;  1S8L A;  1HNL A;  3NYA A;  1B5Y A;  2NTH A;  4OWB A;  1A2Y C;  4ETC A;  1CWQ A;  2BQL A;  1CU5 A;  3HU9 A;  2BQD A;  5F9X A;  5AZD A;  4WO6 A;  212L A;  206L A;  4NSJ A;  2BQG A;  4L6R A;  3WQJ A;  3HFM Y;  3VWO A;  1SSY A;  4NGI A;  244L A;  1L37 A;  2I35 A;  2YBN A;  4H9A A;  2XBS A;  1P8H A;  2W1X A;  1C6I A;  4HJZ A;  4W94 A;  3C7W A;  3C82 A;  3ABW A;  4OWE A;  4YXA C;  2VT4 A;  5KXZ A;  1B7L A;  4AGA A;  1QTH A;  137L A;  1HSX A;  2BQC A;  4XYY A;  1G0G A;  2WJL A;  1LHK A;  4R0F A;  4DDA A;  2YBJ A;  3C80 A;  3TMU A;  1REY A;  4GP8 B;  4XAD A;  1HEW A;  1L28 A;  1XSF A;  4MD2 A;  4PGJ B;  4ANR A;  2Y00 A;  5KXY A;  4H90 A;  3V2Y A;  2KSA A;  4H9H A;  1L70 A;  1HHL A;  3HDF A;  1LYF A;  1QUD A;  241L A;  2HED A;  232L A;  1SWZ A;  1OQM A;  1ALC A;  1LZR A;  1L19 A;  3B0O A;  4H92 A;  2F93 A;  1GB2 A;  2A7F A;  1L0M A;  3P66 A;  1JIT A;  1L40 A;  1LGX A;  5KXW A;  1VDT A;  1CV5 A;  5FJG A;  1L56 A;  1GB8 A; 
#chains in the Genus database with same CATH homology
 5ITE A;  4GN3 A;  1QT5 A;  3VI0 A;  1LZN A;  4JKV A;  1UIC A;  234L A;  4LDE A;  1C3W A;  1GF3 A;  4BS7 A;  1P56 A;  1ZWN A;  4NHP A;  4ZPU A;  3TXE A;  4DT3 A;  1M0M A;  3GUJ A;  4J7V A;  2D4K A;  223L A;  127L A;  4WM4 A;  1L87 A;  1J1X Y;  1LZE A;  1LJ3 A;  5H2K A;  201L A;  5G2C A;  4Z41 A;  3GUI A;  186L A;  4H9F A;  4NHT A;  1LHM A;  3A34 A;  1QT7 A;  4D9Z A;  4JQ6 A;  4LYT A;  3CDT A;  1SX7 A;  3C8R A;  1LYE A;  4NG1 A;  1WQO A;  4EKR A;  2QB0 B;  2NWD X;  1GB5 A;  3IJV A;  1QTB A;  3D3D A;  1L29 A;  1L93 A;  1GE0 A;  4I7S A;  4ETE A;  1XFP L;  1YL0 X;  1L42 A;  1PXS A;  1YRO A;  1LZ9 A;  4G4H A;  2H9J A;  3HAN A;  4WO9 A;  2ZNX Y;  2B75 A;  5II3 A;  1GXX A;  4XT3 A;  2ZIJ A;  242L A;  4UWU A;  4IAP A;  3FA0 A;  4PXF A;  2YDG A;  3EMS A;  4WM3 A;  5LZM A;  1C61 A;  2BQN A;  3WVY A;  1B2K A;  1JKB A;  2Y8P A;  1CX6 A;  1IIZ A;  4WLY A;  3TXD A;  4GCD A;  143L A;  109L A;  1CJ8 A;  1LYJ A;  4WLT A;  1T6H A;  2F4A A;  3VGA A;  2HUM A;  1L30 A;  1KXY A;  3WPJ A;  4GBR A;  1WVV A;  205L A;  209L A;  103L A;  4LYO A;  257L A;  1GE4 A;  5KXP A;  1SWY A;  3HTD A;  5JEN B;  3QJS B;  1AM7 A;  5I4W A;  4DQ7 A;  1NHB A;  3QJQ B;  1GB0 A;  1KGB A;  3SP3 A;  1JSE A;  198L A;  3OAX A;  5KKH A;  1L60 A;  1LJI A;  1PZY A;  245L A;  5LYZ A;  3SBB C;  2DQD Y;  5E9R A;  4W56 A;  4NY5 A;  2HUB A;  7LYZ A;  4I7N A;  120L A;  1D3F A;  4G7Q B;  1JJ1 A;  1GE2 A;  4NWE A;  1LI3 A;  1L77 A;  4EKS A;  3WW6 A;  1T8G A;  4I7R A;  4PXK A;  1IWU A;  1UBZ A;  1YAN A;  4BAD A;  3PXO A;  2ZIK A;  1AZF A;  1C45 A;  1JPO A;  4LDL A;  2LNL A;  2Z2F A;  3DN0 A;  2WAR A;  3S8G B;  2CJL A;  2LC9 A;  4I7P A;  192L A;  3WUA A;  2LZM A;  5EBH A;  1QUH A;  1L35 A;  1F6R A;  1OUJ A;  3P4Z A;  1AT6 A;  1C46 A;  3DN3 A;  1Q5J A;  4GN5 C;  1GXV 2;  3EH4 B;  2CGI A;  2ZZL A;  5B1G A;  160L A;  1L11 A;  3AZ7 A;  1L85 A;  1WTH A;  1L48 A;  129L A;  3FI7 A;  258L A;  1HEL A;  5KXM A;  3CT1 A;  1CU2 A;  3HH3 A;  2ZFE A;  3X3C A;  4FA7 B;  4IAT A;  4LT0 A;  3F8V A;  1C6G A;  4UG2 A;  1ZMY L;  2HEB A;  2MEE A;  3CDR A;  4W59 A;  5A3E A;  1JTM A;  1L01 A;  1LSA A;  2HEE A;  4OOT A;  1BQL Y;  4XT1 A;  1QHJ A;  4ET8 A;  218L A;  2EIZ C;  3QDC A;  4MQT A;  1IP1 A;  1DKK A;  1QQY A;  2MED A;  221L A;  3M3U A;  1AKI A;  1NF5 A;  1CKF A;  8LYZ A;  2EPE A;  1L14 A;  1TDY A;  1P3N A;  1L57 A;  3EH3 B;  3A90 A;  4I7T A;  1CNS A;  5ILF A;  2HEC A;  3AW7 A;  3EO5 A;  2F30 A;  1B7O A;  1C63 A;  1LYY A;  2YCW A;  5H2O A;  1UA6 Y;  4WM2 A;  1VAT A;  1NHE A;  4EKP A;  2KS9 A;  247L A;  5B6Z A;  1NDM C;  1GFV A;  4CFO A;  3ZVQ B;  1NMM A;  1LJN A;  5LVH A;  1GFU A;  4DQ5 A;  4II8 A;  165L A;  4GCB A;  2Z39 A;  2FBB A;  3TXH A;  4DYG A;  3ZEV A;  1OUI A;  4UWN A;  2B6W A;  3A91 A;  6LYT A;  3OE8 A;  1EQE A;  1LZ8 A;  1PQJ A;  1B5W A;  1L75 A;  2I21 A;  1C68 A;  3TXF A;  1B7N A;  1LWK A;  5FCP A;  1VDQ A;  1BWH A;  1FKV A;  3B0I A;  4OWC A;  3VVK A;  1QUT A;  1L34 A;  1DI3 A;  3HAQ A;  149L A;  4RW2 A;  1REM A;  4Z46 A;  1FLQ A;  1HMK A;  128L A;  3UZA A;  1JHL A;  5I4X A;  3UON A;  4DWX A;  1LSF A;  4XJB A;  4GP5 B;  1LZS A;  4G72 B;  1L00 A;  1L68 A;  110L A;  1J1P Y;  3HAS A;  1LZ1 A;  3A3R X;  1S53 A;  1QDR A;  4A4M A;  161L A;  1L03 A;  4LT3 A;  5FST A;  3AYQ A;  1B6I A;  4DD3 A;  1VAU A;  1IX0 A;  2ZYC A;  1GFH A;  2BQH A;  4N4Y B;  3ZPQ A;  5A3Z A;  3HT7 A;  4MR1 A;  3OK0 A;  2LYZ A;  3OE6 A;  1IOR A;  4M4O A;  1L64 A;  138L A;  3HWL A;  5F9U A;  4W58 A;  2DBT A;  1I1Z A;  1LHH A;  4ARQ B;  5G53 A;  213L A;  3WYH A;  1YAQ A;  3ODU A;  5C6I A;  3CDV A;  171L A;  4G70 B;  176L A;  4G7R B;  4H93 A;  5B59 A;  3UG9 A;  3LZM A;  2IGC A;  4LT1 A;  5LWE A;  4PJ2 C;  1BRR A;  222L A;  1QIO A;  1L65 A;  1C60 A;  3A67 Y;  4CJ2 A;  3G3A B;  1CJ7 A;  144L A;  3A93 A;  3CDQ A;  3T45 A;  1CJ6 A;  3HH4 A;  1CVK A;  3JR6 A;  246L A;  1WTM A;  3HU8 A;  1LKS A;  1TAY A;  4KPM A;  5H2J A;  1L13 A;  1LMT A;  5IEL A;  5C6L A;  1GFE A;  2Z2E A;  1JKA A;  4B4I A;  5DHG A;  1L12 A;  1L20 A;  1BHZ A;  2B6T A;  1PY6 A;  5A45 A;  2XQO A;  1CKD A;  5D5F A;  2LZT A;  5F8U A;  3REY A;  174L A;  3SB5 A;  2DQI Y;  260L A;  3DDL A;  4NSG A;  1B7P A;  2BQE A;  1LMA A;  4TL3 A;  4XJI A;  1C6M A;  4EA3 A;  4W57 A;  1B7M A;  4HTN A;  3OE9 A;  3G3B B;  1XIO A;  1IW9 A;  1C6P A;  1CUQ A;  1HEP A;  2JAG A;  5JJN A;  4H9I A;  1G1V A;  3F6Z A;  2HUK A;  2YBL A;  3G3V A;  4QID A;  5KY1 A;  1GF7 A;  1BRD A;  3AYM A;  1F50 A;  3LZT A;  122L A;  4BAP A;  5KXO A;  1WQN A;  243L A;  3J4G A;  4NGL A;  5FEL A;  2B70 A;  5AWZ A;  2QPE B;  1XGT C;  1IOS A;  1LZ4 A;  5AHY A;  3DKE X;  1PQD A;  1CV1 A;  5DM9 A;  3EBA B;  4GLV A;  5IHG A;  5H2P A;  3GUK A;  3HTB A;  2BQF A;  1TCY A;  1L54 A;  2BQK A;  1L08 A;  1TBY A;  4H9E A;  3UTY A;  1BB5 A;  2BAA A;  4HTQ A;  1G0L A;  5EN0 A;  4AMJ A;  4C3W A;  1HER A;  4RDS A;  2CWI A;  4WM6 A;  1NBZ C;  2XTH A;  4IAS A;  4QEQ A;  1L55 A;  4N6H A;  1L02 A;  4NWH A;  3HH6 A;  1XGU C;  4WL7 A;  2LYM A;  2ZQ4 A;  4LZM A;  4P2E A;  1DXJ A;  4W53 A;  2G4Q A;  114L A;  1UUZ C;  1UIH A;  3TMX A;  169L A;  4G71 B;  1DYB A;  5I54 A;  1H2S A;  178L A;  1C6E A;  3A92 A;  4DD7 A;  4KL7 A;  3QE8 A;  1GFR A;  1QT6 A;  4GYC A;  2F4G A;  3FAD A;  5F81 A;  3W3E A;  2EQL A;  3TXG A;  3PWH A;  3PBL A;  1LSM A;  1IC5 Y;  1QT8 A;  3FE0 A;  3WUL A;  1YAP A;  2HUL A;  3L2X A;  4U3X B;  2D6B A;  1L66 A;  3QBL A;  1YQV Y;  239L A;  3LHM A;  1LJH A;  3WMK A;  3QJU B;  4OOO A;  2C8P A;  5LA8 A;  3QNG A;  1DYG A;  4LZT A;  1CU6 A;  1LJF A;  1F6S A;  1T8A A;  1L22 A;  5B6Y A;  3LYZ A;  1L07 A;  3LYO A;  4NGJ A;  1LZA A;  248L A;  2Z12 A;  4E97 A;  4NGZ A;  193L A;  4WMG A;  1CV3 A;  2ZWB A;  2R4S A;  5L3H A;  1IWT A;  1RI8 B;  5DLA A;  1WQQ A;  4H94 A;  2H5Z A;  1QSQ A;  3DN4 A;  4HV1 A;  1HSW A;  1R84 A;  166L A;  1LZ6 A;  4X31 A;  1JWR A;  5DHH A;  1OUH A;  2OEA X;  126L A;  1D9W A;  1L63 A;  4YX7 C;  2Z38 A;  1S52 A;  2JAF A;  3WUM A;  1EL1 A;  1KXX A;  1C6H A;  1GF5 A;  1LGU A;  4GBR B;  191L A;  4NSI A;  4I7J A;  1IOQ A;  5T3F A;  1L82 A;  225L A;  254L A;  1QKO A;  1P6Y A;  1B5U A;  4WG1 A;  3J6K A;  1REX A;  4W54 A;  1IEE A;  1UC0 A;  5LVK A;  249L A;  4O34 A;  1IWV A;  1LSD A;  2H9K A;  3EXD A;  1JSF A;  2ANV A;  180L A;  1LSY A;  1OUD A;  4UHR A;  1GFK A;  1LJ4 A;  4LYZ A;  3S8F B;  1HC0 A;  1B7S A;  1KXW A;  1L49 A;  4GCC A;  1OWY A;  2B72 A;  1L06 A;  2DQF C;  5B2N A;  1L74 A;  1TEW A;  2R4R A;  1L32 A;  3LYT A;  1GBW A;  2FBD A;  2D4I A;  1NKH A;  5G28 A;  3AJN A;  1L50 A;  1P5C A;  3DN8 A;  3ATO A;  1L43 A;  4HYX A;  4DDC A;  3VW7 A;  1QT3 A;  3W6F A;  150L A;  4YXC A;  1B5X A;  1EHK B;  2M3G A;  207L A;  227L A;  4R6C A;  1IP4 A;  2I1X A;  108L A;  1TN5 A;  1L25 A;  4W96 A;  4BV0 A;  1KG8 A;  1C64 A;  1L52 A;  1GF8 A;  1GF0 A;  2YCY A;  1GPQ C;  5ITC A;  4PK0 A;  4XEN A;  1D6P A;  5BR2 A;  3M18 B;  1YIL A;  1S54 A;  5F16 A;  4XXJ A;  5H2H A;  1LJJ A;  1C6L A;  1G0K A;  1HEQ A;  1FBK A;  3NSB A;  1EPY A;  148L E;  4H8Y A;  4GRV A;  2RB2 X;  1HF4 A;  2NTG A;  1AT5 A;  1H6M A;  1F10 A;  1GF6 A;  1GF4 A;  4GN4 A;  3DMV A;  5LVI A;  4AQN A;  2B6X A;  4HJV A;  147L A;  4DD2 A;  1HFX A;  1L79 A;  194L A;  1L72 A;  2ZNW Y;  3NY9 A;  1DI4 A;  250L A;  4IJ4 A;  1L91 A;  1IR9 A;  2F2Q A;  4OO9 A;  1DPX A;  1IVM A;  5FHW A;  1QUO A;  2A7D A;  1U19 A;  104L A;  2OU8 A;  3W6E A;  3WXU A;  3RUN A;  1JTT L;  4K5Y A;  1QT4 A;  4BEY A;  3CT5 A;  2YBI A;  1S51 A;  1L21 A;  2DQG Y;  3OJP A;  3TMW A;  1L9H A;  4NIJ A;  3QAP A;  195L A;  4DS7 E;  4XJG A;  4B4E A;  3AZ6 A;  1O0A A;  4H1P A;  6LYZ A;  1IXF A;  4WLX A;  1XEP A;  5ILC A;  3RZ4 A;  1C6A A;  3AGI A;  5G2A A;  1LZ5 A;  5LAF A;  1LPY A;  1LZY A;  4XTN A;  3GXK A;  155L A;  1L80 A;  2RBN A;  157L A;  2Y02 A;  1PQK A;  1DYE A;  1PS5 A;  2PC2 A;  1L62 A;  4GCF A;  1C6K A;  5LVJ A;  1XEK A;  1E0P A;  132L A;  3A6C Y;  4DD1 A;  5I14 A;  1KW5 A;  183L A;  1LHL A;  4RLM A;  1IOC A;  1NDG C;  1SSW A;  3TXJ A;  1TLA A;  1LKR A;  2RSC A;  2AT9 A;  5B35 A;  197L A;  2HEA A;  1P2L A;  2YBH A;  5LYT A;  238L A;  1LYD A;  1KG9 A;  1TN0 A;  5LAG A;  1C10 A;  4QDN A;  5APC A;  4DD0 A;  1EQ4 A;  2RBP A;  4ARJ A;  4KXI A;  5HMJ A;  139L A;  1CX7 A;  1MEL L;  4YOP A;  3WXT A;  5G2D A;  5DN4 A;  1QKP A;  1JKD A;  4N1E I;  2YVB A;  4I0C A;  1I20 A;  211L A;  3HT8 A;  5H2N A;  1UIB A;  1AT9 A;  2Z18 A;  2RBR A;  1LHI A;  5B34 A;  3WL2 A;  1G07 A;  1G0M A;  1QDT A;  3TXK A;  2J4Y A;  1IY4 A;  1GFT A;  3A6B Y;  4TSB A;  3ZEK A;  4Y9H A;  1G7I C;  3VHZ A;  1JEF A;  3QBK A;  1FKQ A;  2B73 A;  4NGY A;  154L A;  3AZ5 A;  4Z98 A;  1ZV5 L;  2OE9 X;  5B0W A;  1LYO A;  1CV0 A;  5B05 A;  5APF A;  4ARM A;  3ULR A;  4I7O A;  1UIA A;  4PPO A;  4ARL A;  1SX2 A;  1L59 A;  3HUQ A;  1IOT A;  167L A;  1BB4 A;  2DQC Y;  5IDD A;  2Z19 A;  1LMN A;  4B49 A;  1CU3 A;  3LZ2 A;  5A44 A;  210L A;  2Z37 A;  1DYA A;  2Y01 A;  5AHZ A;  3SBA A;  1YAO A;  1HEO A;  140L A;  118L A;  4CHX A;  1ZVH L;  1V7T A;  162L A;  4G49 A;  5KXS A;  2OE4 X;  1QM8 A;  1FN5 A;  5HQ1 A;  1T8F A;  1LMP A;  2MEB A;  1LHJ A;  1G0J A;  1L33 A;  2CUU A;  3W6D A;  1GAZ A;  1L96 A;  3DMX A;  3B72 A;  4XTO A;  3A95 A;  3RZE A;  4QRY A;  1QUS A;  3HAP A;  3WPK A;  1UAZ A;  4GPO A;  2Y04 A;  1QTC A;  2G87 A;  1FLW A;  5C1M A;  3HTF A;  1C6F A;  2BLY A;  3AB6 A;  1GZM A;  3QJV B;  4E3U A;  1L0K A;  2ZIY A;  158L A;  3W6B A;  3CT0 A;  5I53 A;  1L47 A;  1XJI A;  3UTW A;  1LWG A;  4WOA A;  3SB6 A;  4LFP A;  2B7X A;  2B5Z A;  151L A;  4LFX A;  1UAC Y;  196L A;  5TGZ A;  1LZG A;  5KXT A;  1M0K A;  111L A;  4WW3 A;  2DQA A;  2Q0M X;  4FJR A;  4BUO A;  1C8S A;  5B6V A;  1QSA A;  4LYC A;  1GBZ A;  2BPU A;  5LIN A;  1XJU A;  182L A;  199L A;  5FDJ A;  3GUL A;  3GUP A;  1IY3 A;  4HPI A;  1QTE A;  1L71 A;  3SB9 A;  4N4W A;  2EI4 A;  3SN6 R;  1W6Z A;  1C6B A;  1L46 A;  1ZYT A;  4ETD A;  3CSR A;  2LHM A;  153L A;  4QY9 A;  1L16 A;  1OUE A;  3AM6 A;  1LSC A;  1UIE A;  2HU3 A;  1WQM A;  5LIO A;  3C81 A;  1QSB A;  1G7H C;  4BEZ A;  2W1Y A;  1H87 A;  2G4N A;  1HML A;  3AZ4 A;  3T6U A;  5DN5 A;  5J7A A;  1L17 A;  1L04 A;  1FBI X;  3A96 A;  3EH5 B;  1PQM A;  1C66 A;  1WQP A;  1GD6 A;  1LPI A;  4ARP A;  4PHI A;  5FEK A;  237L A;  5B06 A;  3TXI A;  4G9S A;  1X0K 1;  3RNX A;  3C9L A;  1KME A;  1VGO A;  113L A;  4TWS A;  4DC4 A;  9LYZ A;  163L A;  189L A;  4TX7 A;  3D4S A;  5L3I A;  1L83 A;  1DQJ C;  1UIF A;  2RB1 X;  1NBY C;  1IC4 Y;  3CB7 A;  1XGP C;  1GBY A;  1GFG A;  3QBI A;  107L A;  1LYZ A;  3RU5 A;  4DQJ A;  2RBQ A;  1PXR A;  4EXM A;  251L A;  119L A;  1BB7 A;  3N9A A;  4X32 A;  1B9O A;  3IWR A;  4HJY A;  1BWJ A;  5M1Y A;  4EPI A;  1CTW A;  3MBV A;  4MD1 A;  1GB9 A;  3QY4 A;  4KT3 A;  2YDO A;  1RJC B;  3CSQ A;  1GUE A;  2YCX A;  4UWV A;  4Z3M A;  3VG9 A;  1OVJ A;  235L A;  4NSH A;  3C8S A;  2O4W A;  4XJD A;  2O79 A;  156L A;  3S3B B;  3K2R A;  1GB7 A;  1CUP A;  4ARQ A;  4H8Z A;  2MEA A;  1DYC A;  3TMV A;  1KY0 A;  1OUF A;  1QUG A;  1SLY A;  4RW1 A;  1L51 A;  1OUG A;  2BQO A;  4NGV A;  1HEM A;  1L24 A;  1LZD A;  1G1W A;  1IWZ A;  5C6J A;  2Z73 A;  1KW7 A;  3PDS A;  1IP5 A;  4NHQ A;  1F88 A;  2MEF A;  1L41 A;  3A7K A;  1KIP C;  1LGW A;  1JKC A;  1OVH A;  1X0S A;  1L10 A;  1JIS A;  240L A;  5B6W A;  1GEZ A;  1JV6 A;  3AGH A;  3HT6 A;  5H2M A;  1AP9 A;  1LYH A;  2I26 L;  1NWG A;  4KLY A;  1YKX X;  2BQJ A;  3NY8 A;  2HU1 A;  1G7J C;  3S3C B;  1QSW A;  1KIQ C;  3EML A;  4I7M A;  3AW6 A;  2DQJ Y;  3AGG G;  2OU9 A;  2W1L A;  4NGK A;  1LJG A;  1L58 A;  2Z55 A;  4CFP A;  1IP2 A;  1F4Z A;  1B0D A;  4YM8 A;  2B6Z A;  2HEF A;  1VDS A;  219L A;  1L23 A;  1L0J A;  1QTD A;  1XGQ C;  2F2N A;  4M6D A;  4J4Q A;  145L A;  1GDW A;  4OWH A;  4ZEE A;  1C65 A;  259L A;  3WH1 A;  1C62 A;  1HFZ A;  3LYM A;  1L36 A;  4J1A A;  1JJ0 A;  1D9U A;  1JTP L;  1LZB A;  3WU9 A;  4C5F A;  4HTK A;  1UCQ A;  4L35 A;  1L84 A;  4W52 A;  4J1B A;  3UTV A;  3DNA A;  3BVD B;  1XGR C;  261L A;  4XJH A;  1SQ2 L;  2OU0 X;  2KSY A;  1JTO L;  3DN2 A;  4EPF A;  2RBO A;  5BR5 A;  2NTU A;  2I6Z A;  1LZC A;  4XN6 A;  2D91 A;  152L A;  5HMV A;  5J7C A;  1LI6 A;  1C43 A;  1LOZ A;  3BKH A;  3B6L A;  1CKC A;  1L26 A;  231L A;  1L92 A;  1LJK A;  1L27 A;  3DN1 A;  216L A;  1L97 A;  1LN6 A;  1DZB X;  1K28 A;  2MEC A;  2Q9E A;  1FDL Y;  1OVK A;  1DZE A;  112L A;  4PRU A;  4GP4 B;  2EKS C;  2MEG A;  5L9J A;  4B0D A;  226L A;  1C08 C;  3K3T A;  2CDS A;  2ZIL A;  5KXR A;  159L A;  4S0W A;  1GHL A;  1LMQ A;  2IFF Y;  5E4P A;  4GCE A;  1VFB C;  5LVG A;  2L6X A;  1BRX A;  3HDE A;  3QBG A;  3B0K A;  1JIY A;  200L A;  4OV0 A;  1T3P A;  3DMZ A;  134L A;  1L18 A;  3GUN A;  4DD9 A;  4ET9 A;  1L09 A;  4LGK A;  3C9M A;  5JJJ A;  3RT5 X;  1BWI A;  1C6D A;  4DDB A;  190L A;  4H8X A;  1E8L A;  1KNI A;  4BAF A;  1L88 A;  1JFP A;  131L A;  1C6T A;  2F47 A;  1J1O Y;  1V7S A;  1INU A;  1LYG A;  1LMO A;  3NS0 A;  135L A;  4ML7 A;  3CAP A;  5G54 A;  1L44 A;  2L78 A;  1KIR C;  1P46 A;  3W6A A;  255L A;  4YF2 A;  1LW9 A;  3S3D B;  1RCM A;  224L A;  2N5Z A;  168L A;  4YEO A;  4AXT A;  4ZFP A;  1D3M A;  4YEM A;  2BQB A;  1HFY A;  1GF9 A;  4DAJ A;  1BGI A;  1B7Q A;  1GE3 A;  1C8R A;  1RFP A;  1LZT A;  5H2L A;  2OE7 X;  1WTN A;  5A8E A;  4MST A;  3G3W A;  1L69 A;  3P64 A;  5AX1 A;  3UZC A;  3D9A C;  1Z55 A;  3C7Z A;  4J0L A;  4RLN A;  2YDV A;  1GEV A;  1MLC E;  4DJH A;  4LYB A;  3W6C A;  1XJT A;  4XJF A;  3QJT B;  2NTW A;  3N9E A;  1L67 A;  2W1M A;  1JGJ A;  3FI5 A;  4HSF A;  1LYS A;  1KY1 A;  1VDP A;  2VB1 A;  2QPD B;  1LSG A;  4WG7 A;  1ZUR A;  1LLH A;  2LCB A;  1OWZ A;  5AMY A;  1XME B;  1IWW A;  1OUB A;  2GV0 A;  1F0W A;  1DKJ A;  2DQH Y;  1OYU A;  1NQI A;  2D4J A;  1N4F A;  3C83 A;  2BQA A;  4WM5 A;  1IP6 A;  1HEN A;  1CU0 A;  3WPL A;  4IAR A;  1M0L A;  1DYD A;  1IWY A;  1P2C C;  4HYJ A;  4MQS A;  2C8O A;  3HAO A;  4NFV A;  3WVX A;  1LAA A;  256L A;  3E3D A;  3AYN A;  3LN2 A;  1VJM A;  2AUB A;  4WL6 A;  3BKV A;  1PQO A;  4OW1 A;  1L61 A;  208L A;  4HV2 A;  5KXK A;  2MEI A;  1LSN A;  1G0Q A;  1H68 A;  4NC3 A;  4ARM B;  1L98 A;  1PQI A;  1BB3 A;  2ZYP A;  4G7S B;  5DL9 A;  2BQM A;  3CSZ A;  2MEH A;  1T6V L;  1QTV A;  1G0P A;  5I4Y A;  1IP7 A;  4H9B A;  4FBZ A;  4NG8 A;  217L A;  1CV6 A;  3WU8 A;  5F14 A;  1L94 A;  2X72 A;  188L A;  2I25 L;  2RBS A;  2OTZ X;  3CQL A;  2YSS C;  1C7P A;  4YEN A;  3V2W A;  5KJ9 A;  253L A;  4TSC A;  2X0A A;  184L A;  5LA5 A;  1P36 A;  4FDY A;  1HZX A;  1D0M A;  2RB0 X;  4QGZ A;  1OUA A;  1GB3 A;  173L A;  4B1A A;  2Q9D A;  1ZVY B;  5JJE A;  1T97 A;  2ZQ3 A;  3CDO A;  175L A;  1P64 A;  1UCO A;  3WW5 A;  4EMN A;  2XBR A;  1CKG A;  1L76 A;  5ETZ A;  1JJ3 A;  1WQR A;  4H91 A;  5DYS A;  1IC7 Y;  2F32 A;  1I56 A;  4QI1 A;  4WM1 A;  1LYI A;  3GXR A;  3SB8 A;  123L A;  4MBS A;  1G06 A;  3HAR A;  3UTX A;  1P8I A;  1VED A;  1D2Y A;  1RE2 A;  3WU7 A;  1LSE A;  1JTN A;  1QTK A;  1B5Z A;  2BRD A;  2B6Y A;  1L05 A;  3HBH A;  1L99 A;  4KNF A;  7LZM A;  1Q5I A;  4I7K A;  1B7R A;  1LTM A;  4EJ4 A;  2Y03 A;  5I5Q A;  1QTZ A;  4BWB A;  2PED A;  1W08 A;  1GBX A;  1C67 A;  5B6X A;  1D0L A;  5HNL A;  1YKY X;  4EOF A;  1YKZ X;  3P0G A;  1JQU A;  3DN6 A;  1C6Q A;  262L A;  1OP9 B;  1XEI A;  1GE1 A;  3L64 A;  1DYF A;  1JV7 A;  2F95 A;  1P2R A;  102L A;  2Z6B A;  1GBS A;  1DI5 A;  4I8S A;  1P7S A;  1G7M C;  1C6C A;  1LMC A;  2A4T A;  5HNC A;  2RAZ X;  4N5R A;  1KS3 A;  230L A;  1B5V A;  1OV7 A;  1BVK C;  1XEJ A;  2LYO A;  4FPD A;  164L A;  2DKV A;  3HUA A;  170L A;  1GFJ A;  4FAA B;  3ATN A;  4OWA A;  3SB7 A;  2YCZ A;  1IW6 A;  1A4V A;  1WVU A;  2BQI A;  1O23 A;  1LJE A;  2O7A A;  1D0K A;  1LSB A;  5KXL A;  4I7L A;  4ZIX A;  5B07 A;  1BB6 A;  4MCK A;  3A3Q A;  1GFA A;  220L A;  1L53 A;  1YIK A;  1IR7 A;  5HLL A;  3PQR A;  1S8J A;  4LDO A;  4N1C C;  1FBB A;  5LXW A;  3C7Y A;  3KAM A;  3ZPR A;  4NGO A;  3DQB A;  3GUO A;  5KXN A;  5AX0 A;  172L A;  3OE0 A;  3P68 A;  4B4J A;  3COD A;  4GLA A;  3KJ6 A;  1REZ A;  3RW8 A;  1IR8 A;  3A8Z A;  1GU8 A;  2HTX A;  1P8U A;  4X3B A;  141L A;  3TXB A;  1GB6 A;  2FYD A;  4EIY A;  3WUN A;  2B74 A;  3X3B A;  1UIG A;  6LZM A;  252L A;  4EKQ A;  228L A;  4ETB A;  1D2W A;  4BVN A;  4TTD A;  5K7O A;  4NHI A;  5H2I A;  1LSZ A;  3ZVQ A;  4IAQ A;  1LSP A;  1BVX A;  4N0J A;  4L41 A;  4TUN A;  1OV5 A;  1OUC A;  5KKJ A;  1C69 A;  4G4C A;  214L A;  1R2N A;  1DPW A;  1L95 A;  5D5C A;  5APD A;  5KXX A;  4PJZ A;  1L15 A;  5LYM A;  2XJW A;  1LCN A;  146L A;  1I6S A;  4XTL A;  4JR8 A;  1GAY A;  4NGW A;  1IP3 A;  4W51 A;  4ETA A;  177L A;  1GDX A;  3C8Q A;  5APE A;  1GBO A;  1E12 A;  2YBM A;  125L A;  142L A;  3MGW A;  3COC A;  181L A;  4PRQ A;  3P65 A;  2DQE Y;  2QAR C;  1L39 A;  1UID A;  4N9R A;  4HWL A;  1MGY A;  1CV4 A;  3HUK A;  187L A;  1D3J A;  4NEB A;  3RFM A;  4H9C A;  3T36 A;  1L73 A;  1D6Q A;  5B1F A;  3F9L A;  2OTY X;  1BM1 A;  115L A;  1IO5 A;  4LT2 A;  2G4P A;  4WLD A;  2LZ2 A;  2BLX A;  1L31 A;  1L81 A;  215L A;  3HT9 A;  2KSB A;  1YL1 X;  1P37 A;  4W55 A;  4WAV A;  130L A;  1C6N A;  2I20 A;  3HBE X;  4NHS A;  4N8Z A;  1JUG A;  3A94 A;  2HPY A;  1L38 A;  3QJR B;  1L86 A;  4A7D A;  1L89 A;  2IHL A;  3QAK A;  3N9C A;  2RH1 A;  4X1H A;  3HBD A;  1EQ5 A;  1D3N A;  2WJK A;  4G4B A;  4HP0 A;  3G3X A;  4I7Q A;  3GUM A;  1L45 A;  5G36 A;  2FYC A;  1C6J A;  4AMI A;  185L A;  1X0I 1;  1CJ9 A;  229L A;  4LYM A;  1G7L C;  236L A;  2RAY X;  1CKH A;  133L A;  1IWX A;  4IB4 A;  1GWD A;  1L90 A;  1FLY A;  3IJU A;  1QS5 A;  1LI2 A;  5KKI A;  4DKL A;  233L A;  3HTG A;  1YAM A;  1FLU A;  4CGE A;  4HPE A;  1QS9 A;  2ANX A;  3HH5 A;  1S8L A;  1HNL A;  3NYA A;  1B5Y A;  2NTH A;  4OWB A;  1A2Y C;  4ETC A;  1CWQ A;  2BQL A;  1CU5 A;  3HU9 A;  2BQD A;  5F9X A;  5AZD A;  4WO6 A;  212L A;  206L A;  4NSJ A;  2BQG A;  4L6R A;  3WQJ A;  3HFM Y;  3VWO A;  1SSY A;  4NGI A;  244L A;  1L37 A;  2I35 A;  2YBN A;  4H9A A;  2XBS A;  1P8H A;  2W1X A;  1C6I A;  4HJZ A;  4W94 A;  3C7W A;  3C82 A;  3ABW A;  4OWE A;  4YXA C;  2VT4 A;  5KXZ A;  1B7L A;  4AGA A;  1QTH A;  137L A;  1HSX A;  2BQC A;  4XYY A;  1G0G A;  2WJL A;  1LHK A;  4R0F A;  4DDA A;  2YBJ A;  3C80 A;  3TMU A;  1REY A;  4GP8 B;  4XAD A;  1HEW A;  1L28 A;  1XSF A;  4MD2 A;  4PGJ B;  4ANR A;  2Y00 A;  5KXY A;  4H90 A;  3V2Y A;  2KSA A;  4H9H A;  1L70 A;  1HHL A;  3HDF A;  1LYF A;  1QUD A;  241L A;  2HED A;  232L A;  1SWZ A;  1OQM A;  1ALC A;  1LZR A;  1L19 A;  3B0O A;  4H92 A;  2F93 A;  1GB2 A;  2A7F A;  1L0M A;  3P66 A;  1JIT A;  1L40 A;  1LGX A;  5KXW A;  1VDT A;  1CV5 A;  5FJG A;  1L56 A;  1GB8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...