4DAOA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
molecule keywords Purine nucleoside phosphorylase deoD-type
source organism Bacillus subtilis
molecule tags Transferase
total genus 78
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4daoA00
1JDZA 1PK9A 4QAQA 1JDVA 1QE5A 4WKOA 4YMLA 4D8VA 1YR3A 3EMVA 3BJEA 4TXJA 4OGKA 1OUMA 4UC0A 1TD1A 4P54A 1YRYE 3IEXA 3LGSA 3EEIA 4NS1A 5CXQA 2BSXA 2QPLA 2A0XA 2ON6A 1Y1QA 4DARA 1ZL2A 5F7OA 5I3CA 3SCZA 1YQQA 1V4NA 3OOHA 4H1TA 1Z37A 1OVGA 4D8XA 1OTXA 1U1DA 3UT6A 1YBFA 2RJ3A 4DANA 3OF3A 1RYZA 1VMKA 2H8GA 3ENZA 4GLJA 2A0YA 4YO8A 1M73E 4D8YA 4LZWA 4G89A 1PR0A 1PF7E 4LNHA 4OJTA 2AC7A 3LBAA 3KUKA 2QTGA 1XE3A 1K3FA 3UAVA 1JDTA 1Z39A 3EUEA 1Z5PA 1Z35A 2HWUA 4E1VA 1JYSA 1RXYA 1TCVA 1OV6A 4F3KA 3QPBA 1Y1RA 2A8YA 4TXMA 4L6IA 5DK6A 1RSZA 4RJ2A 4U2KA 3UAXA 3PHBE 2QSUA 4QFBA 4G41A 4L5CA 1Y6RA 5CYGA 1Q1GA 2Q7OE 5FAKA 4I2VA 4M1EA 5B7NA 2OXFA 4D9HA 4TS9A 1VFNA 4MCHA 4NSNA 4L0MA 5IU6A 1ODJA 1Y1SA 2B94A 4F1WA 4MARA 3KU4A 5B7GA 4DAOA 3NM6B 1PR5A 1TGVA 3DF9A 1JDSA 1V2HE 1SQ6A 1SD1A 4R31A 4TS3A 5K1ZA 1PBNA 1VHWA 4F3CA 1WTAA 4GKAA 4DA7A 1A9SA 4YJKA 4KN5A 3DPSA 1JDUA 5CCDA 3PHCA 3OZCA 2P4SA 3C74A 4QARA 5EFOA 3KVVA 3OZBA 3GGSA 1JE1A 3O4VA 2HSWA 3E0QA 1ODKA 1FXUA 5C80A 1ODLA 5JPCA 1NW4A 5CCEA 4BN0A 4K6OA 4YNBA 1Y1TA 4MCIA 1U1GA 1V45E 2XRFA 4JOSA 3PNSA 3T94A 3UAYA 1T8SA 1SD2A 2AI1A 2QTTA 1T8YA 2A0WA 4PNPA 1Z5OA 3GB9A 1K9SA 3EUFA 4IP0A 4DA6A 2PGAA 1T0UA 1CB0A 1Y6QA 5B7QA 4OEHA 1B8NA 3OOEA 3FUCA 3KVRA 1TGYA 5F76A 4DAEA 4TTJA 4F2PA 5IFKA 3BGSA 5F7XA 4F2WA 3K8OE 5F7ZA 1I80A 5F77A 1CG6A 1U1CA 1ECPA 1Z34A 1PWYE 1G2OA 4TTAA 4WKPA 2QDKA 3KHSA 1PR6A 4LNAA 1PKEA 2I4TA 4WKNA 1PR4A 4PR3A 5ETJA 4TXLA 4QEZA 2ISCA 1PR2A 2HRDA 4FFSA 5EUBA 4EB8A 3INYA 3MMSA 3BL6A 1T8WA 3KVYA 1LX7A 4OGLA 4TXNA 3O6VA 1TCUA 5F73A 4G8JA 2HN9A 1RXCA 1PK7A 3F8WA 1Z38A 4L5YA 1RR6A 5CXSA 1K27A 4LKRA 1PR1A 1JE0A 1Z33A 1VHJA 1ZOSA 1ULAA 1A9TA 1RFGE 2OC4A 1NC3A 3FNQA 1RXUA 4LDNA 4R2XA 1PW7A 3ODGA 3BSFA 1C3XA 1Z5NA 3DP9A 3K8QA 3DJFA 5KB3A 4NY1A 5F7JA 1A9RA 4WKBA 4BMYA 1N3IA 3NM4A 1OTYA 2I8AA 1LV8A 4DA0A 4QATA 3OZDA 3FOWA 3D1VA 3MB8A 3OCCA 4GMHA 5B7PA 3E9RA 2AI2A 1T8RA 4M3NA 4JWTA 1V41E 3E9ZA 4ECEA 4D98A 3FAZA 4BMZA 4BMXA 1RT9A 4M7WA 1ODIA 3PNPA 4TTIA 2OC9A 3DDOA 5CYFA 1YQUA 5F78A 4GLFA 3LA8A 3FWPA 1OU4A 2IQ5A 1JP7A 1U1EA 4TXHA 3UAZA 1A69A 1B8OA 3NBQA 1A9QA 4OY3A 1A9PA 1A9OA 4JP5A 4X24A 4DA8A 1V48A 3TL6A 2AI3A 3UAWA 4DABA 1ULBA 2GUWA 3NM5A 1SJ9A 2OECA 4OF4A 5EPUA 3FB1A 4WKCA 1V3QE 1Z36A 1RCTE 3ONVA 3OPVA 3P0EA 4QASA 1RXSA 3U40A 3P0FA 4TYMA 4EARA 1NC1A 3OZEA 4L5AA 3IOMA 1JPVA 1LVUA 4R2WA 1U1FA
chains in the Genus database with same CATH superfamily
5KNBA 1I4OA 5IW8A 3E9DA 2FRDC 3CTPA 1PG5A 3JRXA 1DP4A 1ND5A 3L4SO 4D8VA 5KVQA 3H5LA 4LJYA 5JBQA 2FOLA 2GX6A 2NVBA 3G2QA 5GJCA 3EMVA 2WWYA 1GNSA 4YJFB 3QVGB 1VG0B 3P8ZA 5JQGB 2CYBA 4Z1MD 4H3HB 5ITWA 3HVRA 1E7YA 2Q5EA 3PFWO 3LBFA 3I39X 2J3IA 1K8XB 5DM4A 5AD1A 4NE9A 3N2EA 2VHJA 3VR5D 1NI4A 5KUTA 2VDUE 5CG2A 4RPHA 1EHIA 3RRMA 1T13A 4OP3A 3NP9A 1O0BA 1KQGA 4RDHA 1R6AA 2FJPA 4PFKA 4KWCA 4FUQA 5EC8A 1MJGM 2BVNA 5KTPA 1BQ3A 2ZUWA 5DISB 5GY7A 4ZCQA 4HMQA 2CMFA 1SCNE 3EH2A 1BYUA 4JI5B 4HKTA 4M1YA 3QVXA 1M8PA 2BN4A 3KAPA 4LHSA 5CUQA 5A9SA 3II6X 4WN9A 4WBNB 5DGTA 2O06A 1X7GA 2CHUA 3C5EA 1E62A 2EZUA 5LYJA 4EQ6A 1PJCA 3OJWA 2WWIA 1JLMA 2Y1FA 2I5PO 2QS9A 1LRKA 4HTAA 1DQNA 1HOTA 3IEKA 3B48A 4A6DA 4K0KB 3REQB 3WYDA 4YFVA 1CULC 1QGED 1QYDA 1TC1A 4JU8A 3WGNA 3W1VA 1X39A 2PUBA 1YI8A 4EABA 5IT9A 4JZYA 1G5QA 3WNQA 3WRYA 1P2UA 5KSPA 3EPKA 1BS1A 3VQTA 4CDRA 4F4JA 2P4HX 1PS8A 3K6JA 1F2TA 4HL6A 2NUTB 1K4MA 3G23A 5CDFA 1SBNE 4BAZA 4NNOA 2DR3A 2BBTA 3KZKA 2GJSA 3PQ8A 3IO3A 1FLAA 4FOOA 5JRDS 3ZXXA 3HP7A 5UKDA 2B4RO 1BU8A 2EATA 1GN9A 1OVMA 3BG5A 3HUFA 1U3CA 3PWTA 4RJIA 3ZUPA 3QHQA 4YO8A 4DIKA 4DT1A 2NWQA 1JMKC 2N9UA 3G0CA 4OP2A 1L7OA 3V80A 4B85A 2F55A 1JQKA 1YUBA 4PCUA 1R8QA 1JJFA 3GEDA 3U7RA 1SKYB 1RVDA 5D3MB 1F4VA 2QKYA 1TK9A 4CG1A 4D4KA 4MR9B 4DKXA 4C5AA 2FVXA 5AJHA 3KDAA 2YXBA 2AQ8A 2GAFA 2HKIA 1G8JA 1ZC4A 4OJTA 3PUIA 1RKUA 1SZCA 2H08A 2AC7A 4C0SA 2F9FA 2VT2A 2FQQA 4X1OA 4KNYA 4XB2A 1ZGCA 5B6PA 4ZAZA 1TXGA 1VL1A 5BN1A 5AOAA 4CRWB 4IUYA 2VYQA 3PJRA 1AMUA 1ZJ6A 3H0EA 5IPFA 1QK4A 3PZRA 3I5AA 3KQKA 2FSVC 2WHQA 3IDSA 4OBBA 4M2LA 5KSZA 1AF4A 4ND4A 1TCVA 3WGVA 1OV6A 3LUDA 4F3KA 4Z86A 3L7BA 3T4EA 4YRAA 4P81A 2FW9A 3L8EA 3O38A 4KVAA 5CFNA 2Z6UA 1QGUA 3HJTA 2EJBA 3D7SA 4ARZB 1CY0A 4IJVA 1NUPA 2CJFA 5DN6D 3CZQA 1HL7A 4DPLA 1IXKA 4IHJB 4B40A 1IDOA 2C2BA 4MKXA 2ZPAA 2AD5A 4YALA 1L4YA 1Z22A 2HXGA 1PWXA 3GAAA 1JHDA 3INNA 3PFCA 4WTOA 3I0MA 4XYMA 3PHBE 4WDRA 3HKEB 2HU5A 5FAXA 3DXFA 2ZRCA 3UMSA 4WXRA 3QXCA 1WJGA 4Y9UA 3WYBA 4OA8A 3TNDA 1X14A 1OH6A 2GVZC 5E7IA 3W0LB 3EVBA 3DDCA 3IAM1 2G76A 3LDGA 2IZZA 3VPXA 3C85A 2O8BA 5JJKA 3SEQA 2C97A 3MB5A 3M34A 1EZ4A 1V7ZA 3QTTA 4M1KA 2IYZA 2RB4A 4MS4B 4COOA 4RKWA 5JH7B 2Z2JA 1E9RA 1EUYA 4FFBB 5AVKA 1NMZA 3ETEA 1X8XA 3LE8A 5DX0A 1CJCA 1Q3HA 2RGAA 1KK0A 3R09A 5K7SA 1NOIA 1XYVA 3HZOA 3KM0A 4NU0A 4QEDA 4X62B 4WACA 5I9MA 5L3QB 4KWTA 1RLIA 1HXHA 4ZO6A 1RC0A 3DB2A 4U7JA 4CKBA 3TLKA 4YAKA 5JYBA 2RI0A 4LVOA 1DEAA 1FFSA 2FUNB 1Y7IA 1HZJA 4M0UA 1O5IA 4EKNB 3A25A 3JQEA 4IJUA 3RYHA 4ZVLA 2YVKA 1QU3A 4QDXA 2OFOA 2R44A 2J6IA 1PGNA 4Y1RB 4DEYA 4U2CA 3FIUA 2GTPA 1PBNA 2R6FA 2CT8A 2EHDA 3WRXA 1GG9A 3RROA 4BNXA 3D4PA 5KYYA 2DULA 1R4NA 3AF2A 2C0QA 4NU6A 2PZKA 5KTSA 2FK8A 5BYAA 3ISJA 1EGMB 2ZYGA 4CM8A 1PL6A 4GYKA 3E7XA 4EG5A 1JFLA 1KXZA 2AWNA 5HF5A 5KYWA 4E11A 3OIDA 4R2IA 3OESA 3DTVA 4R8RA 3PDWA 3IQEA 3KEOA 1L7PA 2YFQA 1NXTA 1P33A 3N8DA 4FFWA 3DMYA 3CVJA 4N6OA 3PVCA 4G5RA 2GARA 3C3XA 5DBIA 4BCCA 2P2ZA 3FUXA 3RCBA 2YQ5A 3W8EA 2IKSA 3ZE6A 3ZIAD 4POOA 3GMIA 1U8AA 5HYVA 4TLCA 4FR5A 2JI6A 8ABPA 3L40A 2PH5A 1ZVQA 1KI3A 5LKAA 4XD7D 1M6EX 4URXR 2R68A 1T1SA 4O33A 3C45A 3TW8A 3EVTA 5HS4A 5KNDD 1VE7A 4J2TA 2D62A 2O0MA 4WZBA 1XU9A 3FCCA 2CWWA 5E2AA 5TARA 3W5JA 4KQ9A 3MOGA 3GGOA 1I13A 1Q83A 2G80A 2GO7A 3C43A 3VOBA 3GP5A 1PZXA 3RGGA 2OVFA 4DLXA 4IOKA 2QM3A 5D86A 3GRRA 5BXYA 4P7FA 1MW8X 1OC4A 3AFIA 4FI3F 1GXSB 1Z13A 2B5OA 1X74A 3BGDA 4RESA 4D6YA 2H7YA 4CETA 4C07A 3VVBA 1TKBA 3RVSA 3R7SA 1DAEA 1X7DA 2ZWIA 1ZJJA 4I19A 4IVPA 4EATA 2ANCA 1P3Y1 5B64A 4IKPA 4FYPA 4TZTA 3UJDA 2AV6A 2NT3A 1QIJA 1KDZA 5LNK1 1X8LA 5AMXA 1E0DA 1P5JA 3JYLA 1QWSA 3CLUC 2DUMA 5D8DA 4W5NA 2WWFA 1W87A 4JXZA 3NOOA 5F2NA 2VZ8A 1NFFA 3K94A 4ZO9A 1E3MA 5EHQA 4N7RA 1OXVA 4U7GA 4BVHA 2QTVA 1D2NA 3HJCA 3V4OA 5AM2A 1B26A 3BRQA 1H2EA 2G1PA 2ZSHA 4B3IA 3JAWA 1TAQA 4CI9A 1USKA 4UHCA 2GFIA 2K7ZA 3Q85A 5FH9A 1K2VN 4Q6BA 2AT1A 2P0YA 2VDLB 3AY3A 3S70A 1TFRA 4RVUA 2PY6A 2JBWA 4C6SA 4RZHA 3P2JA 3QE3A 2YXLA 2QG6A 1YZVA 4BO0A 1DEHA 4MPTA 1R10A 1PNRA 3MF4A 2ID8A 2VTKA 5E95A 1NPDA 2H4JA 3NI2A 5EIFA 4BFXA 2VHWA 4RTLA 8AT1A 3QEJA 4CDNA 3QBVA 1GAXA 1PWYE 2OKCA 4HFMA 1EFAA 4HDAA 4ZRMA 1K3UB 2RGNC 3NIBA 1NQ5A 1XRSB 1C1XA 1CQPA 3SF8A 4CFYA 1GYPA 5COAA 5LD2C 4E7OA 1G8AA 4YJHB 3ETGA 3B7PA 1ZINA 1QG4A 2I4TA 1EGVB 4PR3A 2PGLA 4PU0A 2FDRA 3X1MA 3TLXA 4DCCA 1X15A 4LRWA 4PAWA 1OKKD 2ZIXB 3DZBA 2HRDA 4BO7A 2GAJA 1DXYA 1WZCA 2HXYA 2NO9A 2I29A 3INYA 1SUDA 4JBHA 4XB1A 3HDYA 4XFKA 4P7JA 1Z12A 3T5BA 3ZZNA 1YVUA 4R1MA 5EZYF 1LA2A 3TLJA 1N2CA 1H3FA 3WIOA 4AKEA 1V37A 4C4PA 3DM5A 4FCCA 2H85A 1EFTA 3K9NA 5FNVB 1DC7A 4E21A 2PQMA 1VHTA 3QF4B 2L2QA 2I4IA 1Y48E 1YS9A 3GLRA 3I2JA 1ENYA 3OZGA 4HQNA 4ZI7F 2R8OA 3AVVA 3HJRA 5HCIA 3FF4A 1I1HA 1L5SA 1D4OA 3QKSB 4DLAA 1ZJWA 5DBFA 1C29B 1NBEA 4ZYYA 4N5IX 1N8SA 4LY9A 1RJEA 1WHTB 3V2HA 2NQ8A 4D26A 1NMYA 1AKNA 1I3OA 3HJUA 4G86A 3TD2A 5JD6A 1IY9A 2CUTA 2DQKA 1RBQA 2BFCB 3IEIA 3B1YA 2O4CA 1D8TA 2OV2A 4KU4A 3U3OA 1T8UA 2A4KA 3GHYA 2GYWA 3KD2A 3X2FA 5LCXA 1OR8A 3FNQA 2ZYIA 3O5AA 4TQGA 4WNYA 5B2EA 3TAUA 5EJ4A 4Z4EA 2FPLA 3P1JA 3MNFA 1N32B 1NXQA 4NPHA 1XTPA 1PV2A 3PR2B 1DS6A 1DQRA 1ZL0A 4XVQA 2ZRIA 3ODGA 5AOVA 3MUOA 2FV8A 5E2BA 1SBIA 4R8KA 1UBNA 2AQHA 2WWHA 3SWWA 3N9IA 1P9OA 3IVXA 3F7TA 3UUWA 4URUR 1C7QA 3VPCA 3S2GA 3WICA 1Z47A 2GAOA 3PNQA 4QJ5A 4ZAFA 1NBME 4DQVA 3FFXA 4HB2A 3G3EA 5FTJA 3O8OA 3I64A 3T95A 4AECA 4AMYA 4EDFA 4L8GA 4QLOA 1W25A 1EWQA 3H13A 5JWOA 4JFAA 2AOVA 1R0YA 5BYKA 3ZCSA 3V8VA 1KJIA 2B1GA 2ACKA 3OOSA 3Q5EA 3B89A 4ZT6A 1SURA 3DULA 3GAMA 4W6QA 3HMKA 4C6TA 2MWMA 2IYUA 4XZ3A 5A5GA 4PSCA 1K68A 3I8XA 3P32A 5BSRA 4KGDA 3W3AD 2I22A 2AG0A 1DAGA 2CK3A 3IAHA 3K0CC 3V1YA 3VTZA 5B7PA 1K4YA 1Y3DE 3UK1A 4H4EA 1H4QA 1JHOA 2IS4A 1RE1A 5D3QA 3RI3A 4ZYVA 1UJMA 1O6ZA 4JWTA 5A4MS 2G4VA 3D7LA 5JCJD 1QLWA 2FMXA 2BKXA 2V9ZA 4IYRA 5DYWA 4ASUA 3I9MA 1KJZA 1G7CA 4I1PA 3H8SA 3DBLB 2FH5B 3GQVA 4KBGA 4LSZA 5T3YA 3RYIA 1VG9B 2QVLA 4FWBA 2AG1A 3S1AA 5CHYA 1RYDA 3WC4A 2YN4A 3I04M 2CHEA 4IFTA 2JVKA 3A3YA 4X0EA 1N5IA 1PQWA 5FNZA 5TGTA 1EUDB 4WOCA 3UUEA 2FYTA 1Y3AA 2JANA 4BMZA 2ZJ3A 4BLWA 4S2UA 5P21A 3C6BA 4Q7LA 4M7WA 3TBFA 4Z8XA 2EJCA 2V3WA 1RM5A 1J8DA 4ISCA 4HSEA 4H7IA 5HRUA 2GBLC 1TF5A 4PYNA 4ZEMA 4UEQA 1P9WA 4C03A 2A5DA 4TLBA 4KXNA 5JQWA 2FSHA 3E5RA 1MVLA 1GZ4A 1Z5VA 3O8QB 2KI5A 4P80A 1IXYA 1JG2A 1HZZA 4B79A 4TKUB 5IJ0B 4LFBB 1PCXA 2R00A 3JWIA 4ZAXA 3VC7A 3EDYA 2A92A 3DYBA 1QFZA 3ZH9B 2VDWA 1JZSA 2ZWAA 5ALVA 1YD7A 5H9WA 4B4WA 3BWEA 3GLIB 2XECA 3I8OA 4LQCA 1W2WB 1KDPA 2WE7A 3L84A 4DDTA 4FU0A 2I0FA 1C9EA 1JEYA 3UB2A 3O9MA 2DPLA 2ENUA 3UKDA 3AFGA 1GGMA 2EJTA 4LKOA 1ZC3A 4FNMA 3ZHYA 1C3OA 2CJWB 2GCOA 3AF4A 3COSA 4NZMA 4BQQA 2GUWA 2WP8J 3M1IA 5FLEX 3M5DA 1SJ9A 4CIXA 3PSAA 1VJTA 1FYXA 3UHAA 1UKYA 2Z98A 3HO8A 2Q8NA 3VA7A 1ATIA 2J87A 4CG3A 4HDKA 4F86A 2CBZA 4Q7EA 4S1NA 3UWKA 2NMVA 4X20B 4XEUA 5AW1A 1W0JD 4FJ2A 3T61A 1YUNA 2Q1WA 2X7HA 821PA 5DLYA 4L0QA 4KAXA 1YHYA 4R7TA 1W48A 2OK7A 1NNEA 1DAKA 3DD1A 3TJMA 4KMRA 1DC5A 1YL7A 2ZVDA 3DDUA 3VMFA 4MGZR 4DQKA 4BNGA 1JJIA 1RU3A 5J4VA 4F56A 3AR4A 3BD9A 5T8KA 1ILEA 3UENA 4JQSA 1ACMA 1IZ8A 1N6KA 3VTAA 2FE4A 1F4LA 3L4JA 1GGEA 4OTZA 2PVPA 1JHMA 1SOMA 3EQ2A 2NU6B 3JZIA 5FWDA 4DV4B 3I6QA 3EF1A 3TLGA 2R6JA 2FLKA 3VR4A 4BKRA 1P2BA 2B7CA 3QWIA 5HOEA 1W59A 2GXQA 1ULUA 4MVXA 4N9QA 5TSDA 5AM5A 4H3KB 2BGLA 2P62A 2YZ7A 3DYVA 2JL1A 2O1XA 1FS4A 3NWPA 3QG5A 3ORFA 3K9CA 1MIHA 3PFIA 3TNJA 2CNOA 5LSAA 1B6TA 4CIWA 2IHTA 2XJ9A 2UXDB 3R5SA 2D1YA 4FYMA 1QHYA 4OXIA 3QKWA 3TGPA 3HR4A 2VK4A 4ZOQI 1B0AA 1ZHOA 1BXRA 2VDJA 3AZOA 4AK9A 2D2FA 4LHEA 4LMPA 4BO8A 1E4EA 4J75A 3CXRA 1RHQA 2VF5X 1KBOA 3PFFA 1Z0FA 3QM1A 2J6BA 1FFAA 4W82A 1L8OA 3KYJB 2GGSA 3BXGA 4UC0A 4E5DA 1RYEA 4MLCA 5SYMA 3LT5A 4DSZA 3BH6A 4FMCB 1U0EA 1LVGA 3I1JA 5FPPA 5KNBH 3EQZA 4HXEB 4KLCA 4Y0AA 4XOIA 3EXHC 2O2EA 2WSMA 1T8TA 4CNBA 2HWKA 5FBHA 1KPIA 1OF1A 3LUFA 4R0NA 3GRCA 2HH9A 4NZ9A 4FR2A 4OMCA 1UZLA 1VHQA 3H2HA 3PL5A 4QDZA 5AO9A 1G3UA 1P0MA 4ARUA 1ZNYA 1T5OA 1V8OA 4YBZA 4E12A 1NVAA 2XT0A 1NV8A 4TN5A 4DIUA 1YMQA 2QW1A 3U0BA 3I4LA 1AB6A 1UEIA 3RFFA 3ZQKA 4V1CI 2E5FA 4LRTB 1FC0A 1C7IA 1U5BB 3SFVA 3AUJB 1M1NB 3I34X 1UEJA 4KPFC 4ZJPA 4A10A 4XIJA 4H35A 3TD6A 2ZUBA 1ZGGA 2DPMA 3E84A 4KNVA 2ET6A 4CMGA 2WW8A 4P33A 3V9PA 1JG6A 5LXTB 2R6GA 4EB6A 3FG9A 2PMEA 3IQHX 3OE7D 2Y0DA 2JCVA 5T3UA 4B5LA 1Z25A 5LZ7A 3MHTA 2XAAA 2QVGA 1E99A 2VHXA 5K3BA 3JQFA 1G1AA 1XU4A 2FHSA 2PT7A 1ZCFA 2OZLA 4G81A 4DM3A 4ID9A 1WSWA 3NHZA 2ZR0A 3B7GA 3I9KA 4L57A 2V7TA 3PJDA 1TD9A 1NSFA 3T5AA 4PN7A 2AJBA 3PENA 1O6FA 3QVVA 3T4PA 2ZYSA 5HQ3A 2HNKA 1R8YA 4OK5A 1SBCA 3SIRA 3NBFA 2D8MA 1TT5B 5AJYA 3DAPA 1T1GA 5KTKA 1PDOA 2XUGA 2EX0A 2PWPA 3LRTA 4YAJA 3ZNOA 1SMKA 1BX1A 4CM1A 4D99A 1R6TA 3SSOA 4F93B 3E1SA 1IBLB 1L9KA 1PX0A 3AG6A 5HF8A 3WAKA 4Y9SA 5HW0A 2IH5A 2FFAA 4H0NA 2FZLA 3OE5A 1P3DA 2CXPA 4OCZA 5CBPB 1W8IA 3W90A 4XSHA 5AQEA 3KYBA 1NPYA 3OCWA 1V47A 3QYFA 4RLSA 4JC8A 5CDHA 1L7QA 4M21A 1XVIA 2HK7A 2ZSJA 1W44A 3IV9A 1X1DA 3RVMA 3RYFB 1WCIA 1NR7A 2O2CA 2GXAA 1KAGA 1VQ1A 2GLXA 3QFCA 3LQ4A 2F2TA 1YNOA 1GA4A 3ZNQA 1WU7A 3IA2A 2Z4TA 1R00A 1KEKA 5JD4A 1EQAA 1VCIA 3G7UA 4ACBA 4BGDA 1ZS9A 3E05A 3TOZA 3LX5A 2IA5A 4C0LA 1LJ8A 1MC1A 1BWQA 1WSBA 3U09A 1DBIA 2YJGA 4DQ0A 1FVXA 4MTLA 4HRVA 8ATCA 2LE0A 3GPLA 2WIJA 1E2QA 4WA8A 3ND9A 2PBLA 3CB2A 4EH1A 3AF5A 1SEPA 3AWIA 2Q4OA 2VJOA 5A5EA 3G8DA 2VO1A 2UVPB 4TSFD 4CV1A 1GQ2A 5IKOA 3EGVA 2H92A 2W42A 4DLNA 3RWBA 3CN9A 3U3KA 3WFJA 4HVAA 4MWCA 1BE1A 1ACLA 2WSLA 1BCRB 4YROA 1QP7A 4CNQA 1R5OA 3PGMA 3N07A 1H0RA 1N5MA 1YB4A 2P77A 4G0ZA 2GYVA 5EMHA 4QJ3A 3ZVKA 5ADHA 2PLWA 2MSNA 2DSTA 4MPJA 5JPIA 5FTWA 5EPEA 2CKDA 5FYQA 1OH7A 5F51A 5CB4A 1Y37A 4G5QA 5IN5A 3LECA 1RZVA 4NTZA 2HMWA 4J3JA 4KFTA 4TM7A 3S27A 1FQKA 1GFSA 1JR4A 3HY4A 3ZGZA 1HBJA 3THXB 5FLKA 4UUBA 4PSDA 2HUNA 3VSBA 1LBQA 2UZ3A 1Z7GA 2VP2A 4HDOB 2WVAA 4RHTA 5KYUA 3RFXA 3AIOA 2N3ZA 3NFRA 1EFRD 2FN9A 3HXPA 4KGZA 4LECA 4BE4A 1N2OA 3FWNA 3JWEA 3IQIX 1I1NA 5EJMA 2BFNA 2R8EA 1CRPA 1A5SB 1E9VA 3NV7A 1RDFA 4QTUB 1AO0A 2ZTMA 1OFIA 4JJ4A 2CN1A 4RM2A 4ZOLF 5E38A 1UJ5A 3BRCA 5JJBA 5AW4A 4LF7B 3HG7A 4XQEA 3HJHA 3UWOA 1OB5A 2V65A 3G89A 3N3BC 5M2QA 1GL6A 3NGMA 5U4XA 3L7MA 1SHTX 5EFZA 1DE0A 3QVTA 3WISA 4G1VA 2XYQA 4BX0A 1GVNB 1VLHA 4MKFA 2JHAA 3FPHA 1LRJA 3GG9A 3KLPX 4OMUA 1CKEA 4RQUA 4B2IA 3KJHA 4RA6A 1KEUA 4HLQB 4G4IA 2VT7A 2ISQA 1YC2A 2SCUB 3CV3A 4M36A 2P4SA 1E96A 3W9YA 1J9EA 2OV4A 2J30A 4QPCA 5B3JA 3A36A 5JMTA 4CQJA 4LJ5A 4JFRA 1UDXA 1LJUA 2Y1XA 3HVJA 3Q3VA 1P19A 3VKHA 1YQEA 1Z0DA 2ECOA 3H5WA 4GI5A 3X0DA 5HWSA 1ZRMA 1TX4B 2FKNA 2QRLA 4MVJH 2JFFA 4IDOA 4IIJA 2VCHA 3CW9A 3ENVA 1E89A 2P2DA 4Y1EA 3GLHB 2GXUA 4TLDA 1Z08A 3CRW1 4WZAE 1GTL1 1JUDA 5K3CA 1ZGJA 3H4MA 3DE4X 1NVBA 3OTIA 3PNKA 4WCDA 3DO5A 4YRDA 4DV7B 2EW2A 4HAWA 1TIPA 2L82A 3K3PA 3OAAD 2PMKA 4A7PA 3WWEA 1G9SA 1I10A 1Y8QA 4JJIA 3WLOA 1CETA 2NPIA 2NSLA 3G5MA 2ZEJA 2Q6LA 4OHPA 5C5DA 5JNVA 5GIOE 4CEIA 3I28A 5DULA 2OO3A 3KD3A 1OLUB 2YWXA 3CLSD 3PUJA 4JDUA 3UJNA 1ZCBA 2XYRA 4OXNA 4D6PA 2VXOA 2IHVA 2XQKA 4OJNA 3UAYA 1HSOA 1Y34E 4E51A 3IAEA 5TV2A 2VQFB 3PK0A 1IULA 1U3GA 1ESDA 4JBLA 3ZTTA 3FLMA 4BNZA 1DMSA 1JF8A 1NJFA 1EJ0A 3I3SR 3GJ6A 4X3OA 4ZVSA 2QVXX 1DRVA 2VFAA 2ZQYA 4YUAA 2ZPUA 3EE6A 2AZ4A 3GFTA 3LOQA 1K7CA 4MRMA 1ZU5A 1DVRA 2C61A 2WTEA 3FVRA 3EHDA 4PC1A 3RVNA 4RTNA 2XMSA 4R71A 4EW3A 1P2FA 1US8B 1WXEA 1RYHA 4EF5A 1Z6GA 1IMJA 2G0AA 3BFXA 1E7RA 1Q3KA 2BUAA 2G9ZA 3JYHA 1TM5E 4JUAA 3A6PC 5IZ4A 4Y2XA 1A4XA 3C8UA 3E9MA 2Q1XA 5IM5A 3ZU4A 1YJ8A 2VPPA 4B4UA 1JFTA 4CTOA 1W96A 5F7XA 1B6RA 5EERA 4PLWA 2EBUA 4IGAA 4PGMA 1Q1NA 2WNSA 2DKFA 4BVGA 5E0OA 4XDHA 4Z1MA 3ZWNA 2GJKA 2NTJA 1T3SA 3D7MA 3CR8A 3KWLA 5F77A 3NW9A 4MV3A 3T1YB 1YSCA 3LNTA 1MQAA 3ABSB 1AQIA 3JQCA 1GRQA 4AZ0B 3G2MA 4ZI7B 2L17A 4YAUA 2A58A 4RVGA 2J1LA 1AK2A 3A9UA 1Z88A 5DCUA 5EP1A 2XGGA 1HNXB 1N2XA 4MRAA 4JYCA 1XI2A 2IL1A 3QKIA 2ATEA 1W5AA 4F3NA 1S3GA 4GOKA 2GN8A 2FPOA 2H7XA 2PJUA 4OOFA 4CKXA 4M98A 2A1UA 4YO7A 4ECAA 3IYLW 4BJ3A 2ECPA 4ZICA 5KEIA 4ALMA 2GVNA 4OM7A 3TXAA 1WB5A 2EBHX 1P2SA 1BOFA 4FZJA 3ZU3A 3SBXA 3EOBI 3O74A 1OFHA 3K1AA 3MMSA 2QN2A 4N8EA 4UPVA 3BL6A 2DEUA 1HOXA 1EWKA 2NV6A 2YWBA 3O1LA 4GX5A 5E4FA 5ITSA 3QXXA 1FMCA 2I7TA 2IUEA 1TYBE 3GRVA 4KKXB 3RAJA 4KFCA 4ZI5A 1SVUA 1FFDA 2XQVA 1XLUA 3DLPX 1BU5A 5FD8A 1PWZA 4CMBA 4GEGA 4DV5B 3IUMA 2D4AA 3F8WA 1ZZGA 5J3JA 3OD5A 1N2ZA 2AL7A 4ZYXA 4C88A 2R6ZA 4OQ4A 4WLOA 3VMMA 4QSHA 4HB3A 3EGCA 4EL0A 4Z8YA 1UADA 2QSZA 5CIWA 1OJLA 1B3BA 3B6MA 1PR1A 2E5LB 4E5MA 1BXGB 3NT5A 4R9VA 4BZPA 2XTAA 4EI9A 4ZJZA 3OLXA 2EGHA 1M6VA 2ZS7A 2AQKA 3L1KA 4XX0B 5CA0A 5DX1A 4D3YA 3GGJA 4DHWA 1EUCB 5KX5A 2X0IA 1SUFA 2HDNB 4LHXA 1ZXXA 2EP8A 2VUHB 2O3UA 2G1AA 4MV8A 3D2CA 1ISGA 3ILVA 5DNYB 1P1RA 4IDQA 1QO9A 2OCBA 1P29A 3L93A 3HS3A 1IN6A 3L07A 4BMPB 2OHVA 4K9LA 2QL7A 5ALFA 3ZPXA 4N9WA 1KI8A 4LTDA 3HCWA 1R64A 1ZSVA 4FS3A 4MVJP 4DUZB 3AH8A 3RG8A 2QAIA 1H6CA 3IQWA 2OUIA 2IOHA 1E2GA 1ZD5A 4HNAB 5E6UA 1RQGA 1U9JA 4GM4A 2VRCA 4CT4B 1PSDA 4PAMA 2J0SA 2A5LA 1BYIA 5E0KB 1HWYA 1P0IA 4CTJA 4Q34A 4WHMA 2P5UA 1X9IA 4EKDA 3AVTA 5F7JA 2GN2A 4NBNA 1YR7A 4HDMA 2QX9A 5AVXA 1LBSA 2P65A 1XZIA 3Q0TA 3UTDA 1N3IA 4GM0A 1EVZA 4JAVC 3ER8A 1R16A 1BHO1 2QX8A 1G1MA 2Y1GA 5JEEA 2RHDA 2BTQA 2HGZA 2YWRA 1TUIA 1E1QA 3D1VA 3MLEA 1DIGA 1ZA1A 3V48A 4ZI3A 2JATA 2JGNA 3PEWA 3C70A 1T8RA 2DFDA 1QTNA 1ZD2P 3HP4A 4RZSA 3E7PA 5CYOA 3FOZA 5FLXA 4C78A 1M1UA 1SCJA 2Z3WA 5A4KA 2G70A 4KDRA 4RD6A 4RK7A 5DN6A 4P86A 4W5HA 4DCJA 3SK0A 3ANSA 1CEYA 4MRSA 1MFZA 1U7TA 5FA8A 3MK31 4RTSA 3I45A 1SKMA 5TPWB 3S1SA 4U0KA 1TU3A 4LJ8A 2XVXA 1Q5PA 1DIBA 3LO8A 2AA3A 3RF6A 1BE0A 4IICA 3LCMA 5IKPA 1AOXA 5CDGA 3ZK7A 5MFZA 4RKRA 4F4HA 2ORIA 3G0HA 4MAAA 5LOVA 5I7SA 1P9NA 1U1IA 4IIYA 5CT9A 4ZO8A 4L51A 3WO1A 2AF4C 1R0XA 3N53A 4TMZA 2PL9A 5KQPA 2BI8A 2C9OA 2JGLA 3CO0S 3IP8A 1IHOA 4LWQA 4ZOEA 4D3DA 1I4DD 2AOTA 2SHKA 2D13A 3CWZA 1UP7A 3LF1A 4HNSA 4XGQA 1U04A 3CEPB 3O8BA 3GZNB 2ZJ6A 4KRXA 5HXAA 3F4BA 1A69A 3KQMA 3TIGA 1K75A 3PICA 3STVA 5IEJA 2E9SA 2QAGA 1W1IA 5C3MA 3OTOB 1CDDA 3H3JA 4F3TA 3FZYA 4EUKA 5LD2B 3ZJUA 3LXRA 3RU2A 5KQMA 4DDKA 1E2BA 5LBUA 2ETXA 2Z6AA 1AZWA 1E3DA 1THGA 4GAEA 3FGNA 1S5PA 1T34A 1UJNA 2P69A 3ES9A 3MBKA 4FIZA 2QEQA 1ML3A 1AURA 3EGWA 4IOJA 3WDLA 3MGKA 2QJWA 1IM5A 3LJKA 4MWDA 1P5RA 4P4SA 4TS1A 2WD7A 2G88A 2DT5A 2ZJ2A 1QRDA 3ANTA 3FYSA 3T3MB 5BUSA 2QPAA 4Q00A 2ADFA 2DM6A 4NCAA 1FFGA 5KVSA 1J2RA 2EQAA 3A0UA 3FB1A 4IMRA 2GBFA 1XQWA 3AR6A 1K7YA 2XMCA 1QANA 2YICA 1AD2A 3E3OA 3I73A 2RAVA 1V35A 3KC2A 1QS0B 3ABQB 3OCUA 1VLVA 3OPQA 4UPEA 5IASA 2WF5A 3GIWA 2H4YA 4HVCA 2IWRA 1SKYE 3JQBC 4M1OA 1NIPA 5LMUB 2FW8A 2NTNA 2WMOB 4K9MA 2C92A 3I2YX 1V95A 1MVNA 3EW9A 2BIFA 1PLKA 3IAXA 1PWEA 1E8NA 5AVOA 1MP0A 1O03A 2FA9A 2I6UA 4MVCA 3QUQA 4KIJA 4NOJA 3OZEA 4KC0A 5H1YA 1LNSA 1N2BA 1BMDA 4JJ8A 4ILKA 1A5BB 3VNQA 3R5JA 3P97A 3EWSA 3I6ZA 1TZJA 4R2WA 3H2JA 4XIYA 2I2FA 3U61B 2K87A 4XD7A 4B3GA 3CCCA 4D8TA 1QKIA 1JDZA 4D3SA 3W2HA 3SNHA 1Y7PA 4EO7A 5KNDA 1HO3A 1CUYA 4BLQA 4FTWA 4GX0A 4CTNA 4ERXA 2HDOA 5EINA 4X6UA 1E6CA 5FF9A 2GJ4A 4I6EA 3R0IA 1V5IA 2Z9CA 2REQB 2YW2A 4CKEA 4QT4A 4TZ6A 4G0MA 4UAGA 3DFMA 4LGVA 5J2TA 1M66A 2BF4A 2IU0A 721PA 2Q6VA 4PRKA 3PNBA 2OBXA 4XJVA 1LTKA 1E6UA 2RGWA 4OQDA 1SN7A 2VP0A 1W52X 4OIMA 1OY1A 2JAQA 1TRHA 2CV0A 4JB8A 3F67A 3IAM6 2J7PA 2PE5A 5EJ6A 2GPAA 1KEPA 4LJLA 1OH5A 3AVUA 1DINA 1FU7A 3EVCA 5FUBA 1TD1A 2QAJA 3HNPA 1GA1A 4ANFA 3EXAA 3PT9A 2DF8A 3DP7A 3D8TA 4LY0A 2PXCA 2ZSAA 4UTNA 1D6JA 3IKMB 9ABPA 1ICEA 4HWSA 3L6UA 4IJ6A 1HKHA 2Z8YM 1NU8A 4XDYA 2X8JB 3KBOA 2V6IA 2QUAA 3PD7A 3HA7A 4LOIA 4IR7A 1H05A 5TEWA 3TK1A 1ZPDA 2FF5A 2QN7A 2OHJA 5K6AC 4KBFA 5HFJA 1W4LA 3MPUA 1GPKA 4FINA 4PLHA 4HGYA 2OQ2A 2YY5A 3CU5A 2OG2A 3FGPA 1RIFA 3I8SA 3LS2A 4OD0A 1WULS 3SFTA 3M5WA 5F7OA 3PLNA 4TPKA 3G2JA 1XRPA 1V4NA 2PX8A 2BM8A 5AUPB 2LV8A 4JK3A 2FEXA 6NULA 3RABA 1SVNA 3L0CA 4W1RA 2EGGA 1YA8A 1W4CA 1ZUD1 2Q3BA 3NYWA 1L3BA 4O4IF 3TLBA 3RUEA 4FB5A 2YKGA 4W9NC 1KOJA 3I01A 2JCYA 4HHEA 4B8ZA 3ZDDA 3HVIA 4UE6A 1MV8A 1OXUA 4F8JA 2B92A 3FVTA 4KITB 1DAFA 4G1UC 1CZKA 3WRYC 2C5EA 1NQVA 3EF3A 2PCLA 4JLMA 5J4KA 2LIVA 1AHPA 1B41A 1VMKA 2XE4A 2X6TA 3HXLA 1R9NA 4GLJA 1SFRA 1QO0D 3H2YA 3ITEA 1E6MA 4JLNA 3L7KA 1W0KD 4S0ZA 1MO6A 1V1MA 1Z4KA 4OK3A 5EZSA 4M1QA 2XRZA 1ZMRA 4J8PA 4AMBA 3R3SA 1WXQA 2Y2UA 3ME5A 4YREA 2QU7A 2NIPA 1RWQA 3BFJA 3EJWA 3I2FA 3MLAA 5FFNA 3T99A 1ND6A 1NXSA 3OEEA 4FCTA 3DOJA 4YUWA 4JLJA 5B4TA 3WQSB 3E9QA 3KDPA 4MCJA 3CIOA 3KT3A 3CT6A 5PNTA 4UATA 2EBFX 1YC5A 2DTDA 2GVDC 1SIWA 2O48X 3FPKA 3MRXA 1GV0A 4FOLA 4Y6PA 3HB7A 4YDQA 1YFKA 2VYCA 2JAUA 1C1DA 2EFJA 3D2BA 4LJ9A 4KE8A 3GAZA 1YXMA 2PSSA 1T35A 3GFRA 4E15A 4IIHA 3KOXA 2VR1A 7REQB 1KYWA 3M5CA 2VJMB 3GNQA 4IPTA 5EMJA 5BQFA 2PANA 3S81A 2WAAA 2UUOA 4QYWA 1JB1A 3PUZA 1WMFA 3QSYA 5AUQA 3N75A 3BL5A 3UKOA 5FNVF 2IU4A 2A59A 4GGOA 2XKAA 5KYTA 4L16A 3DLTA 5DK6A 1BE8A 2A9VA 3JVUA 2PV0A 4NONA 5EPOA 1J0AA 2C58A 3NCTA 5B3AA 4B6GA 3ADCA 2AHOA 1UXIA 3M6AA 3QA3E 1GNLA 4KIWA 3TZEA 1B6GA 5COQA 4MB6A 4EZEA 1X1TA 4XQCA 1EAMA 1MB4A 2XZOA 2PHZA 1NUTA 1VDMA 2W6JD 3O4GA 3UAXA 3OURA 3QU7A 4O8ZA 5KOIA 4HRAA 1T4DA 4CL2A 2B1JA 2IYPA 3PGXA 1EFPA 3ROQA 3PDIA 1FTSA 3ERCA 3EEOA 2PWAA 2WIFA 2ZRAA 3HCFA 1MOQA 2QVBA 1EHYA 4INPA 5ALQA 3UT5B 4CW7A 2A84A 3AKYA 2W70A 3AERB 5EXSA 2PS3A 4DILA 1X1AA 1QHGA 4M1EA 3KKKA 3UATA 4EMTA 5K8JB 5GINE 2J32A 2DAPA 1EJ6A 2VC2B 1Z83A 4JLSA 4JVLA 2H3HA 4H27A 4QUKA 3VU1A 4B4VA 4NSNA 3KAJA 4G1BA 3L4BC 3RNOA 2R6DA 4INOA 2FG7C 4P35A 1TM7E 1GRVA 3VVMA 3CNHA 2ABWA 2RIPA 2ZI5A 1JIVA 5F9MA 4CL8A 2V97A 1JECA 4CQLA 2NYUA 1IU9A 5FQNA 3SM9A 3C6KA 5FORA 4MV5A 4H16A 1LY1A 1OWNA 1EZZA 2Y0BA 4YDSA 1NBMA 1Z68A 4JKYA 4V0SA 3T1OA 1TEXA 1U02A 4BO5A 4GP9A 3EXHB 3O4FA 2HK9A 1YIAA 5DM1A 3DF9A 1V16A 2EZ9A 2GRAA 4IDEA 1V1RB 2E4AA 5ECWA 2OA0A 4ARCA 3CURA 1FSPA 4U2BA 4BL5A 4AFNA 1S2LA 1CVLA 3MJTA 4G6ZA 3ADPA 3QFRA 3AV3A 2E49A 2F8LA 2R60A 3TOVA 2J41A 4QVGA 2QJTA 3GLFB 2QBYB 1EM8A 2X7XA 2DHDA 1FW8A 2XDAA 3EIXA 4ZT7A 2YX1A 4QBIA 5HKKD 3ZOKA 2FKAA 3BBLA 1LK5A 4FLMA 3QENA 4JP3A 3CRNA 3NWEA 1YZLA 4B8WA 2WYIA 3FUTA 4HQ6A 4YV1A 3RHTA 3C74A 4GPBA 1FF9A 1FFWA 1NUSA 4HO1X 4PRLA 1QVRA 4GOMD 1H9AA 2VDPB 5KINB 3ETJA 2Z4RA 2RGXA 4QYSA 4NBKA 1FVOA 4HLDA 3ET4A 2P6UA 3MGAA 4YEDA 4U9UA 1JPNA 1TPZA 4ZFNA 1XDGA 1B16A 2EV9A 1JE1A 2HEIA 2X5JO 4CHGA 3DC7A 3PGKA 1UKEA 5E9WA 2IPMA 5IUJC 2HSWA 2I8LA 4FBGA 1D7OA 4MLZA 4MW7A 4BNMA 3P9QA 3B2EA 4KFRA 1XZPA 1DIAA 1GKLA 5CPFA 1PNTA 3KVNA 1CY7A 2IPLA 4N3BA 2J0UB 2OCAA 3TIFA 2HA5A 4FDAA 5LZ2A 2H48A 1MZPA 3HU5A 4YNBA 3U4IA 4AL4A 1B6SA 4D0NA 2HFJA 4UD6A 1ZYUA 1UUFA 2P6RA 3WIBA 4A0FA 1KHHA 3R77A 4ZANA 3Q8MA 1XTKA 3ZWOA 1A95A 1D9ZA 3HSYA 4Q4JB 1KVSA 3PIDA 4WK0B 2VIIA 3TRDA 4FFLA 2Z5GA 3V1MA 5BW8A 5LZ5A 1CE8B 1PZHA 1EUZA 5DSZA 1SD2A 4J0FA 4QULA 1H5NA 1XYYA 3U80A 1L5NA 1DADA 1AKEA 1XROA 3ZXUB 1W0JA 2WAMA 3AJDA 1M2EA 4Z0HO 5DNAA 1HR0B 4JBYA 1GYRA 1LK0A 3OHSX 2O7VA 3EUFA 4X9XA 4LZZA 3F4KA 3FBGA 5AHKA 3VX3A 4XVCA 5EXTA 1QM5A 1YVEI 4CV2A 1QIIA 4D5EA 3WXBA 2SECE 4NYMQ 3LYLA 5ECYA 1RADA 2V8BA 4PPGA 3DR3A 1JNXX 3IE1A 5CJJA 3RVQA 4A8PA 2G0TA 2WF7A 1OZHA 3MQFA 2LGJA 3QMPA 1S2DA 3WYGA 3PCXA 1TGYA 5F76A 5TT1A 4L4XA 2MOKA 2GZRA 1FTYA 2QTBA 1TQ4A 1DKQA 2ZLBA 4JT9A 2MSWA 1NRWA 3ER9A 3PG5A 1LFAA 3GVHA 3V1TC 4DJFC 4JJZA 4XRRA 2IV7A 4MW4A 3U17A 3B1XA 2EAUA 4AZ3A 4DQXA 4DR2B 6ADHA 1JIQA 2WSSA 4RVFA 4JXXA 1ESCA 2WIKA 3L82B 1NBOA 4NX2A 1AS2A 1PRYA 2QB5A 4BDTA 3BX1A 4Q19A 3ROEA 1ZGAA 3C1AA 3GRKA 3MD0A 3S40A 4IX1A 4DSAA 3A27A 4IIEA 1HM5A 4X64B 4HMOA 1KEEA 4U7DA 1U0BB 1EXWA 4PZCA 1Z7YA 3V3TA 4PZZA 2L42A 4LDAA 3QGMA 1VXRA 3VOSA 4L02A 2QDKA 1XZ8A 2R84A 5C1IA 4XIIA 2PX5A 1QAOA 4MMZB 4AG3A 5C35A 5H4GA 4PRYA 3AQ4A 3DV0A 4FNGA 4CKWA 1Y9EA 4GWKA 1C7JA 2PTHA 2NOAA 4S0XA 3DOEA 4WERA 2FSFA 5AHRA 4D6XA 1D4ZA 1CQIA 4LRQA 4P93A 3UJ3X 5LQDA 3IQZA 2ZYWX 3LLCA 3OZTA 2A86A 4FSHA 4MW1A 3ZQJA 3AQIA 4IDNA 3UOWA 1YE5A 4EITA 4DR3B 4WNAB 4HZUA 4EGFA 5AKIA 3U5ZB 2KSQA 4OHKA 3HJGA 2N42A 3R3JA 4FMCF 2D1RA 5JDCA 3GLIE 3IMFA 2IITA 5GOTA 1CR6A 3MTDA 4TYPA 4OKIA 4TL7A 5DFAA 5HBGA 2OBMA 3TCKA 1N9ZA 1P74A 2VSOA 3D02A 4CEHB 5D7NA 1ZM3A 1Z63A 5H3HA 1UJ2A 4UMEA 4BTLA 1C7FA 2CXHA 4KUHA 4S3MA 3KEMA 1TVMA 3ID6C 1B43A 2HRQA 5EWMA 4CE6A 1GPAA 2VUIB 1XEFA 4CLEA 3KL4A 2IK8A 2NO1A 1GKKA 3PI6A 2Z0MA 2C5SA 1JE0A 4BFLA 1GKYA 3VXKA 4NCKA 3HDHA 3LK7A 1X87A 1FA9A 3AX6A 1XDBA 2PGJA 3B78A 4UHFA 5LA6B 5K0SA 1M7GA 3O8RA 2F59A 4ZHQF 1OLXB 2DXIA 4Q21A 2O07A 1JQAA 3WK9A 2VA8A 3JSXA 1SXJE 3S5JA 1UFOA 5B1IA 2HJGA 1G5FA 1ZRNA 2OC4A 1XRJA 1OAOC 1CF9A 1R0RE 4DQDA 4EMUA 2UZ4A 2VPIA 3RYCB 4LDNA 2CZQA 4BBAA 2VPXA 1QH1A 3OSUA 3MWEA 4TROA 4MDYA 5EJIA 1J5XA 1TTHA 4GH5A 1YZHA 4IX9A 3ZU2A 5JR3A 3QPDA 4FFVA 1PAUA 1FSSA 3GEHA 2C29D 4UHHA 3ZW7A 5L7YA 1L7RA 2R8RA 2A9RA 3H6HA 2V58A 3LHFA 2V6JA 1W4RA 3C24A 5E3IA 4YWHA 3JVIA 3BMQA 1KVQA 1SXJD 4QX6A 3ELWA 4BV9A 4U7TB 1U6IA 4X60A 3TTYA 1KMNA 2XA2A 2ZYVX 3PTLA 4O63O 1S2OA 3BAZA 4JLUA 2IF2A 1XEWX 4OAOA 4A27A 2WZCA 1R5BA 3IDAA 5ALIA 3UAOA 4L9SA 2GA9A 3OZDA 3MB8A 4RD0A 4D8YA 3WIDA 2XVAA 1MO2A 4PN3A 5JW6A 1OPRA 4LX0A 2EVWX 4J0IA 3DFKA 5IF9A 1AQLA 4CI0B 3HFGA 3O1IC 2WUFA 2WDPA 2FP4B 3F1LA 3F49S 4QFDA 5DV9A 1FU4A 2G25A 4TSFA 4CDGA 4HRYA 4BYMA 1YJBA 2AMVA 2JAOA 4TTVA 3B6EA 3KKOA 5EUCA 2DPXA 2QM7A 4IDGA 5AVUA 5LWQA 4TL9A 2PRYA 4Q7MB 2O7QA 2JBAB 2PPLA 2YBEA 4US0R 5JZOA 2O8NA 3V4ZA 2Q7XA 2Q5CA 5E6RB 2Q4EA 4I9UA 2MSDB 5A02A 4C9BA 1KYTA 1RAHA 4Z1OA 2GUGA 2Q0HA 1EVJA 3DDOA 4WLEA 2X15A 5TJHA 1O6CA 1C0IA 1X0VA 4RDIA 2HIHA 5EKSA 2UYCA 3KOYA 1YDEA 2RJNA 3R20A 4WQMA 3Q41A 4JITA 1E5VA 3OCZA 1NA5A 4S35A 5BQPA 4PQRA 4EX7A 4DA4A 1NUAA 2QE7A 5I4CA 4AF7A 5MDHA 3A4NA 1FDUA 1QHSA 2I2AA 6Q21A 4NU8X 1XCMA 3NAQA 2ZTUA 1MX5A 4GKBA 4ZZ1A 5M04A 1CZNA 3BFVA 4DZRA 3QSGA 1O94C 3EXG2 4KHZA 1VZ2A 4LXHA 1UM9A 1U5AA 2JKYA 2X1VA 3IGFA 3LM8A 3OU2A 3RQIA 3NEPX 3QLEA 4A91A 4PC7A 4JP5A 3H5IA 2E4UA 4JBNA 4RCVA 5FA5A 3K16A 4FCVA 1TU4A 4PHCA 4PXYA 2C96A 2I2DA 2JGJA 1V11A 3I09A 4FW9A 2JGDB 3RC3A 3EULA 3U3MA 1V48A 3VV2A 3NU1A 1WP9A 4QBFA 3UAGA 4K28A 3QYPA 5CTJA 5F9FA 1T9GS 2Z2YA 2Z43A 3HRKA 1ONOA 5J2UF 2YQZA 1PEKE 3RSGA 1KH1A 4LBWA 1DIRA 4H7KA 3MOSA 4X6XA 3WYNA 5A6SB 4C43A 3AXTA 3PHIA 5EJ5A 3QU5A 3OD1A 3KQVA 1DTWB 4NYJR 1GA6A 1EWVA 1A77A 3FOCA 4Q48A 4WA7A 3RK1A 2YOHA 4RIEA 1O9HA 3B2QA 5I4BA 3W2FA 2VWPA 3P96A 1G21B 3WO0A 1Y5MA 3ASUA 4W1SA 1UBUS 5HM6A 1KY2A 1MBZA 1RYYA 5GIPE 3LF2A 1ID8A 3SOZA 4AWXA 1O95C 4UCXA 4RMIA 3KG2A 1M8FA 3S7TA 2XMBA 3TNLA 2DLCX 1M83A 1FXWF 4RA9B 4KTTE 4B4KA 3DWIA 1Q3TA 3AM1A 3DE7X 4MJ3A 1F12A 1QIMA 2ZRGA 1KZ6A 4QLBA 4XH9B 4MR7B 4E2FA 4JQYA 4LWOA 4WL0A 2Q99A 3H9UA 2C7GA 5A7FA 3UHJA 3OAAA 2YWEA 1YRLA 1ZJ4A 5E7MA 1VC2A 2XCUA 1GDHA 3OZFA 9LDTA 5KNCA 1QE5A 3BWVA 4NABA 1OMOA 1FNSA 1SVMA 3B9BA 4QICA 4Q1VA 4RZIA 2NXEA 4BO9A 2D5CA 4BC1A 5ALJA 1F06A 1VSUA 3QUTA 4PTZA 1U9ZA 4RV9A 4ZREA 3OT1B 2B9VA 1E3WB 2AQIA 1IZZA 2V5UA 4LPKA 2MYNA 3PRYA 1T2FA 1L7MA 1EK2A 1UZAA 3NLLA 2PRSA 3QOYA 1C3EA 2ZUUA 4PSUA 4QO8A 2Q7DA 4BUJA 4EUSA 1ZUHA 2JA2A 5BORA 5I01A 5LZ9A 3ZVNA 4EY3A 4WCFA 3QX8A 4WZAA 4HXYA 1PU2A 4GR5A 4M1ZA 3D5QA 4NOKA 4X1IA 4XQ0A 1XK7A 2QXTA 1L7EA 5TIIA 3BWYA 1UBSB 1S1MA 3NX4A 4XWTA 4ZRNA 4DRXB 3FI0A 1Y8CA 1E6KA 1GUFA 2ZJYA 2WFLA 3PX7A 2C2GA 2JZCA 3LIIA 2WILA 1YB1A 3R7NA 5BOSB 1EM6A 1RKXA 5HIMA 1I0ZA 2YS6A 3BDAA 1GQQA 2B8NA 4OL9A 3VGJA 4BNWA 2OAQ1 3IVGA 4QQ8A 2VAXA 1BFKA 2C03A 2QPLA 4YJ3F 3UUFA 5FRDA 3IP9A 3SHTA 1M2FA 4OYYA 4M9SA 2J9GA 4GOND 1GD1O 3GBSA 1G6Q1 1NJ5A 1WEHA 2VWHA 5EG5A 1FBNA 4BY9E 3WKDA 4DDHA 1NBIA 1HGXA 4WXYB 5HG0A 1PEAA 1TNDA 1ZAKA 5LIRA 4L3WA 1U2RA 2DBYA 2W2QA 4ER0A 4H1WA 2GF9A 4MVJE 5KQGA 3H97A 4OA5A 2O3SA 4KRGA 4Q02A 3GPDG 3PDUA 4XDZA 5KAMA 4E03A 2ZOSA 2V7GA 1VI5A 1IY0A 2C9DA 4EHJA 3RS9A 2PX0A 4I5FA 2ZUVA 2RKBA 1H5QA 4EHBA 1GZDA 2HWWA 2JCBA 4LA4A 1O2DA 3O4IA 1U6JA 3HJNA 3F9CA 3MCWA 1U7HA 3CMMA 4J7XA 4YRQA 5DGDA 4AJLA 3IEVA 1OPXA 2JGAA 2HHHB 1Y9ZA 3VZBA 2DFTA 2QG9A 3HSKA 3IQFA 4HWOA 3Q7EA 1SUAA 4IH4A 1G7RA 1RHRA 2EARA 3C97A 1U3VA 3KKQA 4ILEA 2GCGA 1GJRA 1YKGA 3MXOA 3GFFA 2O2YA 4MVJD 1NTRA 2BGMA 1VBFA 2GBCA 5CX1B 2IWHA 2GLUA 1ATZA 3KSUA 3DAHA 1GV1A 4KQJA 1JG3A 1PR0A 4QTZA 5LB4A 1SBQA 4BMNA 1YRQA 4NCXA 1HE4A 1PF7E 5KMGA 3I37X 4X00A 4X8MA 4JLBA 5LQKA 3CN7A 3FYTA 1L8QA 1ULZA 2W6QA 4KVZA 3GLHE 1IUKA 1GILA 2OM6A 3BTVA 4W6ZA 4BTVA 4HEQA 5FUVA 1KKLA 3RT7A 4RTQA 3UAVA 3W5SA 3ZD8A 3L4EA 2MR5A 3MEQA 3E0XA 4C0KA 1AS0A 1RYNA 4U5QA 5LC1A 1E58A 4IQ8A 4F8YA 2OLEA 3PTZA 2GK3A 4E6PA 4PAOA 5CLQA 5EJ8A 5ITZB 1RQ2A 3C3BA 1ZD3A 2DH6A 5FBKA 5G4KB 3TFOA 3OWXA 4ENTA 1J2EA 1E1LA 1XMXA 4MA5A 2C7QA 4JJGA 4U3JA 3OFSA 1ZW1A 3ZCPA 5HUJA 4KYUA 4ARZA 2PD4A 4B3DA 2YJ3A 4FGKA 6ABPA 2G06A 4G56A 3S7ZA 2RHWA 3WZMA 5LDHA 5GM1A 4QODA 3RUDA 3HHEA 3JQ8A 2BRUC 2H2HA 3I9NA 1ZUNB 4S24A 1FVHA 2M1XA 2XR1A 3RSOA 1ESNA 1XG5A 2QL6A 1NY6A 4E08A 4PE5B 5KS2A 5K0EA 2G08A 4DLKA 4EG4A 2FU5C 2RI1A 1DEOA 3Q8LA 2XXAB 4LJ6A 1P4GA 2WG1A 3ZWMA 1GP2A 2YWCA 3PQ7A 1LDYA 1ZCAA 2DZDA 5TC4A 1WOYA 3BK7A 3LY5A 4UTVA 1Y3BE 1FX0A 1XL0A 2BMWA 3DBRB 3H1BA 3GCXA 3LUAA 4K9PA 1Z6TA 4U7PB 1FQJA 3WLFA 2HA2A 1QPBA 2DGDA 1KS9A 2NV0A 3RFTA 3GGDA 4UTPA 4ZGBA 1JL3A 2PUEA 1RC8A 5HZMA 2BMAA 2YZMA 4CQNA 3ENWA 1Y4ZA 2HDHA 3IT3A 1NHWA 4AP9A 4BO3A 2J5QA 1UMCA 4CKZA 2IFTA 3V00A 1VYVA 2HIMA 3P2IA 2CGEA 1NUUA 3SPXA 1V26A 3MJ4A 4O25A 4QNRA 1Q15A 3MFYA 4IRXA 4V39A 4DSNA 4R1LA 2XCIA 5C8VA 3BXOA 3GLVA 2GEDA 2QTNA 1XCLA 4U7WA 3CE6A 3SEAA 5CG1A 2A9PA 2XTMA 4Z0NA 4PLFA 3WL5A 1PTJA 1XDSA 1C0KA 3WLQA 1X1RA 2I3GA 1JDSA 2XOKD 2NSDA 1YS7A 1NT2A 2C99A 2WWXA 3AOEA 1EVQA 3K0EA 3QLJA 2PWYA 2FPGB 1VP9A 1J0BA 3R6LA 5IARA 3IL2A 4KQHA 3WK7A 4WUVA 1MO5A 1X7YB 4MXDA 3W5CA 1Z4PX 2CHVA 2ZJ5A 4YJFA 1UBHS 3QVGA 5F21A 1VP3A 1Z4MA 5EYPB 2ORED 3ZLUA 5C8YF 1PZFA 2N46A 5JQGA 5FOSA 1L4UA 4U6QA 1SKBA 5HKLA 4JOBA 1U2EA 2DU8A 1L4HA 2JHGA 3C14C 1ECCA 1WW8A 2K2QB 3KXLA 4II3A 4HT3B 2PX6A 1K7EB 3D1LA 3S2ZA 3EWNA 3H19A 1DJLA 3I12A 4PR0A 2WZBA 4X84A 1XRRA 2W2TA 2HXSA 2OZEA 3AVQA 3DQQA 3AY6A 3RJ5A 1BZYA 4OFWA 1E7SA 5AK5A 5FPTA 3WWYA 1U7ZA 2HU7A 1ZA2A 2AUMA 1GSIA 2BLLA 3UN1A 4BNDB 1GL7A 4Z49A 2YIMA 1RWWA 1X42A 4GE0A 3WGYA 3KCNA 1THMA 2WJPA 2BM9A 2PAAA 4MCAA 4PS1A 4DR1B 5EQJB 1DJNA 3B3FA 2PD3A 3V8MA 3CEHA 5JPCA 3R6WA 3M9WA 3BXHA 2IU3A 4R9SA 4D3XA 1T2NA 2W2NA 4WBNA 4CF7A 1QOPB 1ZN2A 3OO1A 3M49A 3NBYC 4K8RB 5HGJA 3ROFA 4BXOB 2C2ZA 2Y8EA 4YDHB 1UBLS 3ZGNA 4A2WA 4AJ1A 1GNRA 2HT6A 4JOSA 1ZHFA 1TMYA 1KZ9A 3O2NA 3PNSA 3REQA 4C29A 2CBGA 3PUVA 3RC2A 4K2HA 3HCRA 2RGBA 3RS2A 1HE5A 2KE5A 2WAXA 2ID7A 1CUZA 1FTGA 2VDRB 3DE2X 3ER6A 4D44A 4YXWD 3AO0B 4MDHA 4AMVA 1Z0KA 3N0WA 3OZUA 3UA4A 3VVCA 5LP6A 1A1SA 1QE0A 1SXHA 3TQQA 2JKVA 1GR1A 1A8PA 2N0SA 1IUPA 1H0KA 3FDZB 3LVQE 1TZBA 1X80B 4LMBA 2NUTA 3TTXA 4ABTA 4NQRA 1Q0RA 4IP0A 5EY5B 3Q3GE 1WD5A 3C5VA 3NC1C 2EGUA 4ZHSA 1XWWA 1JFRA 3RIHA 1VKOA 3TSYA 3GPIA 4X85A 4L73A 4R3NA 4V0MA 1PD0A 2VOJA 1U7UA 3VKWA 1N36B 1L5YA 3HI4A 3DFFA 1I5OA 5FT9A 3E48A 4JU9A 4W5WA 2WT8A 5G0VA 3TLEA 3HO1A 4ND2A 4RVSA 4R05A 4NE7A 2YTZA 1J24A 3IPXA 2GD2A 5D3MA 2XUFA 3O8NA 4AKSA 5LMNB 4QQFA 1UR5A 1VE9A 4MR9A 1JEDA 2RGRA 1FFYA 1ECLA 4XGNA 2DUJA 4HGZA 2FUKA 3R0JA 3AEQB 3IBYA 4D9NA 1QV7A 2O0KA 5TF4A 3SS9X 1Y6JA 2G9RA 3PR1A 2I1LA 1DDOA 3NC0C 1YB5A 3ESAA 3PQ5A 3Q9SA 3QYAA 4JWKA 1I80A 2H9AA 1GU1A 1SULA 1G42A 1OJ7A 2C2OA 3D0KA 2OHFA 2QN3A 2VOEA 2A0FA 1NBHA 5AKKA 2BBSA 5C0OE 3UJ8A 1I3CA 1KYQA 3IUPA 1DC6A 2DHRA 3OM8A 3DAOA 1XZBA 1Z2PX 2C5BA 2WA1A 3CVOA 2A9KA 1WMSA 3PXUA 1K63A 1T1RA 2C9MA 2J3JA 4NESA 3TRIA 2P4EA 5IJXA 3MRVA 1N0WA 2J4DA 3G8AA 2HK6A 3WDKA 1OWPA 5T57A 1GZ5A 2YNMD 5DCYA 3TQTA 2I33A 2JH3A 2R1ZA 1A50B 1Y7LA 2AXNA 1XT6A 2H0RA 1NMSA 2VJLA 3ADKA 2FEKA 1KMQA 3AG5A 2W37A 1NLMA 3MTGA 4ISBA 1ETUA 2B98A 2I80A 4QHTA 1WR8A 3WLEA 1XN4A 3QHAA 1QV9A 1LX7A 2H18A 3IPYA 4IHJA 3BA6A 3CH7A 5T4EA 5C5IA 1DARA 2BD0A 4RZUA 3CLUD 1TUBB 1Z0AA 4N6GA 1Z6AA 1G8KA 5T64A 3ESBA 3GVXA 2ZYTX 5IBPA 1TMGE 2OHGA 2R62A 2JIQA 1CY1A 1P2TA 2WU0A 2J59A 2J9FB 2O3RA 1U7DA 3AVPA 1NQXA 2VZ9A 4FKZA 4AMGA 1BWSA 2GHTA 3TX2A 2UU9B 4KXVA 4ZI2A 1U11A 4QA9A 3UJPA 1L4GA 3EH1A 2QENA 3VOAA 1AGRA 1XMIA 4FYWA 1EVIA 1KC3A 2OD9A 5HZHA 3QX7A 3TPFA 4PIPA 1RYMA 1JR6A 4MS4A 5M34A 1U9YA 3SC4A 1WMEA 5JH7A 1YS4A 3ZY6A 5IULC 2HRRA 5KTMA 3SXPA 4D98A 1RMTA 4FFBA 4UXJA 3EVNA 2FJ0A 2FG6C 2JJ2D 4RK0A 5FTKA 4CIYA 1BVHA 1QO0A 1PX2A 3NHKA 3SU8A 1I3LA 3R40A 5EHZA 1VPVA 1FZTA 1W0KA 1TA0A 5KYWB 1ZIXA 1BEUB 5L3QA 4IQ4A 4DR7B 4OKNA 1FTWA 5HA5A 3BWMA 5CCBA 1Q0PA 3X1YA 4NENB 4Q3LA 2FEOA 1K0FA 5FTNA 3LBNA 2ZRNA 2NTVA 1EH5A 2ZB2A 3G6WA 4M53A 4AJEA 4DEXA 3RW9A 3ZI4A 4L5IA 2H2FA 3B9PA 4Y1RA 1F60A 3G7NA 3L7LA 3RKSA 2IP1A 2ZWMA 4BMOB 1IOZA 1BHJA 3D43A 2QL5A 5K8UA 3CH4B 3DP9A 1TCAA 4KQEA 4X45A 3K8QA 2H17A 1QCCA 2PMFA 3DJFA 4YAIA 1SKAA 1Y7HA 3C3DA 3IR6A 3TZHA 1GHTA 1RBMA 1NLZA 1T6YA 1KK3A 5FR1A 4MSUA 4DBLE 3KV3O 4RS3A 1CZOA 5DP2A 1KO7A 2PX4A 2V4UA 2XD9A 2F43B 4FWIB 3E5NA 1H6AA 1NP7A 3RQSA 4CYMA 4Y67A 4PICA 2OAGA 3PC8A 1T29A 1JHUA 2RHTA 1KWGA 2YMMA 1AV6A 5DTMA 4A0RA 2X9QA 3E82A 1J2JA 1DOAA 5L95A 1IEQA 4TLAA 1PG2A 3BQNB 3OZXA 4Q1FA 3UW3A 4E7PA 4NV0A 3TAXA 1U3WA 3I9V1 3IAS6 1ZMBA 1KOGA 1GT6A 3QPAA 3JZFA 2I6GA 2AZXA 2WTAA 1VJ5A 4FX2A 1OLOA 4B45A 3WP0A 3HN6A 5K3SA 4WVFA 3FCOA 2JZOA 4FHEA 3AI1A 2IYVA 1XA0A 1P1KA 4Q1EA 2ACVA 1WDWB 2QMEA 5H4HA 4BQFA 5HR5A 3N8GA 3IJ5A 5I9TA 1H9BA 1FJ2A 5KZMB 1S3IA 5FPKA 4QOIA 4HQOA 5FP0A 2C59A 2XCQA 2PSEA 2QTVB 4MQ4A 3W4IA 4KV7A 2VF4X 3K2BA 3WRWA 2C04A 4NU5A 1U0NA 5F78A 2NZ8A 5CAEB 3C8HA 1K06A 3SC2B 4EYKA 1GXSA 3H5OA 2LDBA 2WLTA 2HU8A 3M6WA 2PR2A 4TYQA 4IGEA 1NG9A 3CNOA 2NTYC 3OECA 2IXGA 4Z3OA 4G36A 1JW9B 2GESA 1JIXA 3EEYA 1IWBB 3L7YA 3NTUA 5CLIA 4EHIA 4CKCB 1T4MA 1L5LA 1EVKA 3G0GA 3I2GA 1LTQA 4O4HB 4DCNA 1FIUA 4OY3A 2GN1A 3JQ9A 1DOHA 4FQ7A 2QQFA 2QT0A 2ZI7A 3VKFA 3FSGD 3CG0A 1ZLXA 1A04A 2Q0QA 4HNHA 4WE3A 5TR9A 5IHPA 2BGUA 3OFNA 3T8YA 2I4MA 4B82A 1KFEB 1SBTA 3F6CA 4DSTA 5K8LA 1RD4A 3D3JA 4QBKA 4RD3A 4GICA 4D82A 2GN4A 2IZ5A 2NM0A 3R7DA 2ZP1A 4HUTA 1UPCA 1CR1A 1HE8B 3PVZA 1C0PA 1GPDG 1KP3A 2XNCA 4QXMA 3QUAA 1YJQA 4LJSA 1OX6A 2ZWVA 3A8TA 3MT8A 1GTVA 4DIDA 4ZJYA 5SZKB 4MTCA 1XQ1A 1XU7A 3MUEA 2C1ZA 4D9BA 4F9FA 3M6LA 1B0PA 3OPVA 4KDFA 2W2KB 1ORTA 1N0HA 3P9RA 4QASA 4U8GA 5J5CA 2F8TA 4RXTA 1CPYA 2AJTA 2Z4SA 3SKVA 4FIDA 1TVKA 4NZZA 4YJHA 4GBED 4MDFA 1P7WA 3DV9A 4G3XA 1DWPA 2F90A 2DFVA 3Q9NA 3G88A 3EAQA 4JGBA 2ZITA 2MHCA 4IZHA 5EIWA 3VR2D 5M7EA 2WDZA 2YJ5A 2COUA 1KQ3A 3V33A 2ZIXA 4H1VA 3MMXA 4K9NA 4C7KA 1XZQA 2HSEA 4V0RA 5A2GA 5K51A 1DFIA 1EA7A 1V1JA 1O89A 3IA7A 3KSDO 3LUHA 1P80A 1ZK0A 2XPCA 1ESEA 2Q9AA 2NU9B 1R6UA 3TQHA 1WY5A 3K09C 4B31A 1SQFA 2C20A 3WLLA 1XXHE 1XFAA 4Q9IA 2P9EA 5FNVA 2H1SA 4YTEA 1Y5LA 4EAQA 4UTOA 4WGGA 1XCJA 3HFRA 1J8YF 2Q0SA 1VYTA 1J1IA 2G63A 3LVFO 3QF4A 1WZ2A 2YV4A 3BXPA 5BMVF 3CNLA 1TFUA 2D06A 1TO6A 5HHTA 4HS4A 2WHEA 4YQEA 5TXGA 3QKSA 2JIRA 3F98A 2Q62A 3BD8A 4FOTA 1AVTA 2ZE8A 3LT2A 3ONDA 1U7WA 3QMMA 4NJOA 4R68A 1E1NA 1WHTA 3UXEA 3A9TA 3WGKA 2DKOA 3PIRA 1JIJA 4FYJA 2B3DA 5K09A 2O0HA 4V24A 4AAYA 1J8MF 3HLYA 3SM3A 121PA 1GR0A 1TTQB 1ZN7A 2HPZA 2TSYB 3LX4A 3ILHA 3O8OB 4WINA 5FHQA 3TQFA 4X65B 4DIMA 5JSHA 4Z4GA 5AICA 1D6SA 1XZCA 1O3YA 3D3KA 1OA0A 2Q9UA 5KJEA 4MGKR 4Y9DA 2XYVA 1JEOA 2ZRMA 1MDFA 2BFDB 2ZAGA 4EG6A 3SYKA 5J9FA 3PL1A 5JMOA 2LCIA 1YZYA 1DT5A 3LWNA 3IMEA 3EN0A 4GDMA 2V5VA 3ZWXA 2WMDA 3J81k 3V8NA 5ESDA 1Z9BA 3EZYA 3QHPA 3MTIA 2A33A 2GXSA 1L5RA 4DDUA 2BFMA 4L0CA 3I1IA 2JVJA 3ZS9A 3OJFA 5JI2E 5L7WA 4PLPA 3WMGA 4IM7A 4X8OA 2M2IA 5DNWA 3A14A 1G0NA 3TM5A 4AKGA 4UEWA 2WTUA 3PT5A 1SXGA 3N70A 3WMXA 3VNBA 2B4AA 5B2ZA 4QDKA 5DYYA 1TIKA 2KBFA 1U0SY 2O6HA 4YRLA 3GLFE 1GUBA 1XDZA 2YUIA 3ENNA 1EX6A 1JN0A 4C04A 2JI7A 3H84A 3KYCB 1GSOA 2BI4A 1BDBA 8LDHA 2WKWA 4QLAA 3V4PB 4EOGA 3EUAA 2W0SA 2GPBA 1R0LA 2AN4A 1WF3A 1EFUA 2CNKA 3PCRB 5DCLA 5E3JA 2ZT5A 3RS0A 3MWFA 4FC7A 3G02A 1HTWA 3DBLA 2NZVG 1YT5A 4Z3DA 1UWKA 3MXTA 1AA9A 2PEZA 1NFRA 1XZMA 1WDMA 4JUDX 4INJA 5GZ6A 3SVZA 1AKYA 2VDWB 1JKXA 1IDN1 3LRPA 1EUDA 2IIQA 4MQ5A 5LQRA 1KQFA 4OH7A 4LQLA 2IW1A 5C37A 1V9LA 4PW0A 4QU8A 1YI1A 1WBDA 3MM4A 4YA6A 1HLDA 4QDJA 1DX9A 1NVXQ 1HQKA 2B0JA 2COKA 2PX3A 5CT4A 2IZ6A 2X0JA 4NYIQ 2ZIZA 3FHTA 1E2DA 5MGNA 3MTJA 3THWA 4MQLA 3CUUA 4D43A 1Z6ZA 3O8QA 3T7SA 4ARBA 1J70A 3INRA 4TKUA 5IJ0A 3CLTD 4IQGA 4O4JB 4AMUA 1OZAA 1L6RA 1LK7A 2FXVA 1RAFA 1EZ1A 2Q3LA 3DKVA 3GFSA 3PXAA 3QQPA 3GLIA 4Z9AA 1UH5A 5CBKA 3ICEA 2Q41A 3EVZA 3EYAA 4TXMA 5E1DA 3HCEA 4AURA 3RJMA 3UMMA 1ZJYA 3F5SA 3KZNA 1CFJA 1JHYA 1I4EB 2VQSA 4NFYA 3W2EA 2P2LA 3LQYA 2VPZA 3S8MA 4K6GA 2YFKA 5TX7A 4DY4A 4EKEA 5MF6A 3C7AA 1Q20A 1I3NA 2JI9A 1QF7A 4QPDA 3T52A 4BE9A 2CJWA 1G4UR 2QSUA 3LQQA 1ENOA 3T3IA 5FDFA 3KKZA 4TX1A 3JQ7B 3OX3A 3IEUA 1N6IA 4K6FA 4NKRA 4MUHA 2GF0A 2GZMA 3OOJA 2LD4A 1N8TA 3OJXA 4G84A 4ZD6A 3V2IA 1H42A 3KQPA 2A30A 2XNJA 3E1KA 3HY3A 4NHOA 3VNVA 1SXJA 3IT2A 4G0PA 2DFNA 3ND5A 4IRUB 1SA0B 1K98A 1PL0A 1W19A 4X20A 5DDIP 2QTLA 3ZEIA 5C1OA 1T2DA 1NZDA 4C89A 4FC6A 5FBRB 2FEWB 3HUTA 1ITZA 5ERXA 5H0IA 3NTXA 4E3WA 1OYYA 4K0RA 1A1VA 2X6RA 4I0WB 1M10A 1OYWA 2VJYA 2Y68A 3LX8A 2OOKA 4UDXX 2QNBA 4DXHA 1VI6A 2YRFA 4ODIA 5IZCC 1U99A 2QK4A 2ZYRA 3CF6R 2FMKA 4XPZA 1IY2A 4RGBA 1CUUA 1XNGA 3K2EA 3K15A 2NU6A 3PRJA 4U39A 1JT9A 3T35A 4B76A 1BTOA 2CLKB 3I61A 4Y6QA 2Z30A 2B7LA 2EJWA 4XM1A 1RW4A 3O2SB 4X1YB 5EHGA 3SYMA 1G6HA 1SIBE 2GH1A 2D54A 3IUYA 3CJRA 1NVFA 2F48A 2J3QA 3HI6A 2XI4A 4LDQA 5DHRA 4IIVA 2VHYA 4UCQA 2PS9A 1W36C 3N0XA 1K3TA 3IUJA 4UBIA 2J0EA 4E31A 2GEFA 3P9SA 5JCOC 4PXSA 1L5QA 4YPFA 1EK6A 1D2HA 3WADA 3A10A 1ZN9A 3WJAA 2Q46A 4RHUA 1DX6A 5LZ4A 1QB7A 4GPTA 3FYHA 4REQB 5AM3A 1KFCB 1XRMA 1ZIDA 2QN9A 3D0RA 1KFBB 2BHSA 3DZFA 3GU3A 3CONA 4MKRA 1IATA 1Z8FA 2XUPA 3U0VA 5TDHA 1LSUA 1ZGBA 3CTMA 3TBKA 5AK3A 5LB2A 4BEVA 1KIAA 3L6RA 4KO1S 4QE3A 3HXTA 5BRNA 1T6NA 3QBDA 1AX9A 1FDRA 2C9ZA 3PC2A 2B5VA 3D3QA 1H2RS 5I5EA 2OHIA 3LHSA 2UVQA 3T7IA 2FR0A 5BWBA 3HVUA 5CB6A 2AXQA 1EQUA 1MFPA 3ZDCA 2JLVA 1DQYA 2P9ZA 1FUIA 4DLTA 1O5TA 4BRUA 2XRFA 1GPWB 2NW6A 1NVDA 2VXYA 3CF2A 4TMTA 1U5BA 2C42A 5HQ3B 4L5BA 2X58A 4IV8A 1M1NA 4UVDA 5I8WA 3S3TA 2VYVD 1N6RA 1TMOA 3AUTA 3DE5X 3R7BA 4RHEA 1N5OX 3EPHA 4TTQA 4EVSA 1UAYA 1KIMA 5LXTA 3CJTA 1B74A 4MA4A 1NAIA 2UZAA 3DR5A 1BVYF 3QVLA 4UNSA 3W1EA 2BZGA 1PT5A 2ZZKA 2QTCA 4UPDA 1P61B 3PPIA 3SZ3A 3W6UA 3WLMA 1T3LA 2SKCA 5AW3A 3ZI7A 4DV6B 2BSAA 1QYRA 2FGKA 5DTIA 3WB2A 4EENA 1XYGA 3GJXC 1XTIA 5TMEA 1CB0A 1T3HA 2G5GX 4YJGB 3R7AA 4IEEA 2C9CA 3NKVA 4D9JA 5FI0B 2XCSB 1CLUA 1USVA 4BFTA 5JNWA 5JT1A 2JZNA 3DVSX 3S8YA 3ZE9A 1IZ0A 1S1CA 1OHHA 4AO8A 3NWBA 4O4LF 4Q15A 4UHEA 4PNEA 2C2XA 1Y5RA 2Y92A 2FQYA 2CE2X 3P9NA 3HHPA 1B73A 1Z0UA 4NYMR 1NMXA 4WVLA 4K9SA 3T9EA 3QELB 2HMYB 1C4KA 1UFQA 3L4KA 4WAUA 1TQDA 1CVIA 3Q3IA 1YK0A 2GYYA 1B8VA 1EFDN 1RP7A 3EK2A 1Z75A 1SCDA 4I55F 4JLAA 4MI1A 3ORSA 5ALWA 5JE8A 2BW0A 3U9SA 4AIRA 1GG2A 2X0KA 2JCSA 3DDSA 3FLBA 2C4HA 4G25A 2XQJA 4XAQA 5FI5A 3W34A 2WIAA 3C98A 2ZSIA 1P7CA 3DONA 3H5VA 3QLUC 3OM9A 5I7FA 4HCJA 3IOEA 2JIZD 1Z34A 2QLMA 2PQ2A 1DKNA 3OA2A 4HNRA 1KZ4A 3DHYA 1MAAA 2WU3A 4GZ3A 3RDPA 3G9ZA 5KC9A 4G0VA 4M0PA 5CFQA 1IAQA 4GPIB 1JTVA 2FZGA 4E13A 3VM6A 2JRLA 5EIEA 1D2CA 1KY3A 3FBTA 4QGAA 1BRMA 1GAQA 1NVVR 3C2QA 1G6KA 2I6QA 3EXG1 1VB3A 4EAAA 2HM7A 5IDVA 1ZAYA 3W9SA 1E3IA 1F5NA 2JC3A 1O9GA 1R6BX 4JP8A 2FE1A 2BGJA 4FFSA 4AKIA 5SICE 4UM8B 4OL0A 1U8FO 5IG2A 2UVPA 1VL5A 2O9JA 4M54A 3CCFA 3D5TA 3RIMA 2P78A 1KFJB 1YHNA 2XODA 3PVSA 4PYJA 3B1JA 1CP3A 4OHBA 5F73A 4G5FA 3A2KA 4G8JA 2ADOA 2YBDA 4GNRA 5TS2A 2KWIA 5BQXA 2HPHA 4Q0MA 1BCRA 4OOEA 1PK7A 1W7AA 1E61A 4PZ9A 1AV7A 5J5AA 1QOQB 2BONA 3ZGLA 2FRDA 5IANA 2FPIB 3GEGA 5I9BA 3VR6H 3NIGB 2R1TB 3TLAA 1YOVB 4LJ7A 3IFSA 1S02A 1U2TA 2ZE7A 3QI7A 3STHA 3Q9LA 2PO7A 3HY6A 3UWSA 5U9CA 3CPEA 1QP8A 1ST2A 2JGKA 2F3SA 3FROA 3OT4A 4PS0A 2FP3A 4LXYA 4V2IA 2PUHA 1FUKA 3Q3EA 4QAJA 3PX2A 2GCIA 2GETA 2M98A 3THXA 4EJFA 3B1VA 1EWYA 4DR4B 4W7IA 4X71A 1NC3A 4IFBA 1N3LA 2I6XA 3N2GB 4YCAA 1G2QA 4MVJA 4R2XA 1G21E 1QE3A 2BZ0A 2AE2A 2PH7A 3C6ZA 4KMMA 4O2AB 4QOGA 5SYNA 4TV9F 3RT1A 1R0ZA 3MINB 4AJIA 4MP3A 3I01M 1FP2A 1E5QA 4IILA 3FYCA 4PGGA 3FCXA 4J0GA 3F74A 1QJCA 1FQOA 1T9KA 3RSCA 5EIOA 1SAYA 3SKXA 3C15C 2X41A 1N7IA 4LV6A 4WADA 3ZKWB 1PWHA 5DMXA 4FYYA 3REGA 4BO6A 3HC7A 2XADA 4ZVRA 3YASA 2CEKA 1X1SA 2WJZB 4HH4A 4OHRA 3KETA 2D0IA 1ZXLA 2REXB 4DLYA 1GZUA 2XW6A 1TM4E 3AR5A 3UMJA 4JZKA 3BSYA 4PX5A 3B6ZA 4PNHA 2JGFA 2SCUA 1Q7CA 3CBGA 1VYUA 2V74B 3LZCA 1RQPA 3INTA 4LK2A 2I8AA 3HCAA 1A9XB 3KFVA 3X1XA 4H6VA 1MR3F 1RLMA 2DMRA 3F1KA 2QIPA 3KR2A 4UAUA 4Z9XA 1YRHA 5IYZB 4AX4A 4Q37A 4A2QA 3CZCA 3TDKA 4FUTA 3VKUA 3QE0A 3WLSA 3HBFA 3DBVO 5EGSA 2UUAB 1QGYA 4IOLA 4ETIA 1SZDA 3EIFA 3GLHA 4NBWA 5I47A 2XDWA 3FZEA 1YASA 1TAUA 2ZRLA 2VL7A 3AJAA 3GELA 4LOAA 3WAJA 1WDKA 5T67A 3C41J 1NSTA 2GBIA 5EESA 5B36A 1W581 1GPYA 3WL8A 4PZYA 1P5HA 2IHYA 2UZ0A 3RANA 3CH5A 5FPQA 3ZIAA 1YQDA 2QTFA 4WZ6A 1OLUA 3MWLA 1MO4A 3CVYA 2AKYA 5ALMA 3SMQA 5F3WB 3T3OA 3JAKB 2HTEA 2QGZA 1ZQ9A 1EE1A 3N6VA 3EEBA 3HU3A 2NUPB 3OUZA 4GI1A 4K05A 3UCEA 1Q1QA 4R3WA 2RK4A 5WRFA 3ZGVA 5LL6P 3LDHA 2D5LA 3QLVC 5TY0A 4M8KA 2NXNA 3ESXA 3U7QB 5CB0A 5KSWB 2E21A 1J8VA 2J0QA 3ZCUA 4BLUA 1FSFA 5A0VA 2V7QD 3BF7A 2ZIVB 4Q9KA 1JDBC 1FLVA 2QVCA 1V25A 1QQAA 3DBHA 5K0FA 1T2UA 4QYMA 3BCSA 4E5YA 5L3RA 4MV4A 3GEBA 1FP7A 3GLGB 4GSKA 2BKUA 3OCJA 1US8A 1VMEA 3OP4A 5AJWA 1Y1KE 2E6KA 2JASA 2FSVA 2WM8A 4DA8A 4PZEA 3GJRA 1RJGA 4YV0A 3WNCA 3BILA 2AX3A 5CFMA 2XIQA 3MSCA 3O3CA 1Z7BA 2XOKA 5D00A 3THYB 2CCKA 3GDOA 1E18A 4LYGA 4DMMA 2QLBA 4E2ZA 1PQPA 3FUVA 4QO7A 5DI9A 2GO1A 3NM5A 2A1UB 2ZB4A 3GF4A 1COWA 3WL6A 1P9RA 2E4WA 3BCRA 3AR9A 4D9IA 4NECA 3PSHA 1W2GA 1DWUA 3OQOA 3RIYA 1PDWA 5AKLA 3U62A 1AMNA 1WU8A 2CB9A 4Y7CA 4HAYA 4M0MA 1WETA 1NM5A 4AZ0A 4X6LA 4RMGA 1B1AA 3U40A 3UFBA 4FVTA 1KFKB 1G16A 3A2MA 3PWSA 3GUVA 2YXPX 2MYUA 2WWRA 1SVLA 1FL9A 1WXGA