4DAOA

Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIDVALHSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase deoD-type
publication title Insights into phosphate cooperativity and influence of substrate modifications on binding and catalysis of hexameric purine nucleoside phosphorylases.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 78
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4daoA00
4UC0A 1Y1QA 2P4SA 5IFKA 1Y1SA 4TTIA 1JE1A 1A9SA 4JP5A 2HWUA 1PW7A 2OC9A 4DA8A 4IP0A 4FFSA 4F2PA 4D9HA 4YNBA 3UAXA 4TTAA 3E0QA 4D8VA 1SD1A 2Q7OE 5CCEA 3QPBA 5B7GA 3FWPA 4EB8A 4WKNA 4P54A 1Y1RA 3SCZA 1Z34A 1SD2A 4JWTA 4OY3A 3OZCA 1A9OA 1U1FA 3KHSA 1ODJA 4YJKA 1V3QE 3FAZA 1YQUA 4OGLA 4LNHA 1VHJA 4R2XA 3UT6A 2AC7A 4OJTA 3LGSA 3EUFA 3OF3A 3O4VA 3GB9A 4M7WA 1ECPA 4G89A 3OOHA 1Y6QA 3MMSA 1XE3A 3KU4A 2QTGA 1ZL2A 4U2KA 1FXUA 5K1ZA 4PNPA 1V41E 1OU4A 4RJ2A 4MCHA 4QEZA 1T8WA 4L6IA 2ON6A 3TL6A 1ODIA 1Q1GA 4BMYA 1U1GA 1YBFA 4EARA 1B8NA 3KVVA 4KN5A 3PNSA 1A9TA 4TYMA 5DK6A 3EEIA 2I8AA 5B7QA 1RFGE 4LZWA 1U1DA 4DANA 4F3CA 5EPUA 4DA0A 3OPVA 5I3CA 1SJ9A 3UAZA 1JDSA 1JPVA 4DAOA 1ZOSA 1QE5A 3ENZA 1VMKA 3EUEA 3EMVA 1Z39A 5ETJA 2AI1A 1LV8A 1YR3A 1YRYE 2A0YA 1LVUA 5F7OA 4WKBA 4QFBA 2PGAA 5F7JA 4LKRA 5F78A 4MARA 3DJFA 1U1CA 4TS3A 3KUKA 4YO8A 1YQQA 1PR5A 4GKAA 3PHBE 4WKCA 2I4TA 4DA7A 5B7NA 4DAEA 1JDTA 1ULAA 4TXNA 1OUMA 3IEXA 3U40A 2GUWA 4PR3A 1K3FA 1RT9A 4I2VA 1V2HE 4F2WA 4LDNA 3DF9A 1PR0A 4TS9A 4E1VA 1WTAA 2HRDA 1NW4A 2BSXA 4F1WA 1Y6RA 4R2WA 5KB3A 3NM4A 1ODKA 1JP7A 1Z37A 2RJ3A 3PNPA 3NM6B 2OC4A 3FOWA 5JPCA 3GGSA 4D98A 4L5YA 4L0MA 1Z5OA 1A9RA 2AI3A 1PWYE 2QPLA 1G2OA 3P0FA 3ONVA 1RR6A 4QAQA 1K27A 3D1VA 4X24A 4M1EA 4BMXA 1T8RA 1RXYA 4WKOA 2HN9A 5FAKA 4ECEA 4G8JA 1NC1A 5CYFA 4TXMA 1JDZA 1RSZA 1A9PA 5IU6A 3BSFA 5F7ZA 1PKEA 3OCCA 3FB1A 1TGVA 4D8YA 2A0WA 4TTJA 1V45E 3MB8A 3KVYA 4OGKA 1TGYA 4K6OA 3UAVA 3DP9A 3FNQA 4DARA 1OTXA 1PF7E 1ULBA 1PR1A 2A0XA 1T0UA 1PK9A 4JOSA 1OVGA 2QTTA 3PHCA 3P0EA 2A8YA 4R31A 4QATA 4H1TA 4DA6A 4GMHA 2HSWA 4TXJA 1U1EA 3BL6A 1V48A 1T8SA 1RXSA 4GLFA 1N3IA 4QASA 1CG6A 1K9SA 2H8GA 4QARA 3ODGA 1Z38A 4BMZA 1RYZA 5F77A 1VFNA 5F7XA 1A9QA 3O6VA 3E9ZA 1JE0A 4WKPA 4GLJA 4OEHA 4LNAA 3FUCA 2ISCA 1RXUA 1PR2A 1ODLA 1TCUA 4M3NA 1CB0A 1RCTE 1Z33A 3UAYA 3F8WA 4YMLA 3DDOA 3C74A 1OTYA 1Z5NA 1JDVA 1NC3A 1Y1TA 1T8YA 3BGSA 3LA8A 4NY1A 1JDUA 1PR4A 2AI2A 2XRFA 1OV6A 4NSNA 1SQ6A 1VHWA 4G41A 1Z5PA 1RXCA 3E9RA 4L5AA 2QSUA 4OF4A 3T94A 1Z35A 5CYGA 3UAWA 1M73E 1I80A 3OZBA 1PBNA 3K8OE 3OOEA 4TXHA 1B8OA 3OZEA 2B94A 3LBAA 1TCVA 1V4NA 2OECA 3INYA 4D8XA 4DABA 1TD1A 5CCDA 3IOMA 2OXFA 2IQ5A 5F73A 4BN0A 3DPSA 4F3KA 1PK7A 1PR6A 1LX7A 5CXSA 5EUBA 3BJEA 5EFOA 4NS1A 3KVRA 3K8QA 3NM5A 3OZDA 1Z36A 1C3XA 5C80A 5CXQA 2QDKA 3NBQA 4L5CA 4TXLA 5B7PA 5F76A 1A69A 1JYSA 4MCIA
chains in the Genus database with same CATH superfamily
2FQ1A 3IVAA 4BXOB 3A4MA 3WP0A 1JFFB 1JWAB 2BN4A 5JISA 2NNWB 1DPGA 1LPOA 3B1JA 2ZTUA 3PXGA 4O4LA 1JAHA 3DZFA 1YVRA 1Z06A 4DADA 1JE1A 1KI6B 4LQCA 4N39A 3ND8A 2HUNA 2VXOA 3IAUA 1IHOA 3CCBA 3VKWA 4TV9A 3GT4A 4R2MA 1NT4A 1XRMA 4WOCA 5FYQA 3RU2A 1JSCA 3WKBA 5L3RA 1V8OA 3SK0A 2A7XA 3E35A 1VG8A 1SBHA 1YA8A 1OZGA 4Q4HA 1I6KA 3KUDA 4EF6A 2ODQA 3VR3A 4CHGA 1NBMA 1C3EA 1RWQA 4ZI3A 1PV1A 2W11A 3PEYA 1Q57A 3LYAA 2VPQA 1K7YA 1SD1A 2APJA 1GLGA 1VMEA 4OK5A 3M9WA 2V54A 2BEWB 5M7EA 3RAGA 1CUXA 3TJRA 2Y67A 5LBUA 4Q00A 2G8LA 2QUAA 3QV2A 3KSMA 4C89A 3VYWA 5JAIA 4M83A 5BN3B 2AVNA 4XLZA 2A35A 1FS6A 3DMTC 1U2GC 2R8YA 1Z34A 3U17A 1ZD1A 1N2CB 2YJNA 2E4ZA 3QVGB 3LPCA 1ZIDA 4QOEA 4Z4CA 1QC5A 5E9QA 3AL2A 4ROSA 5CA1A 3LIIA 1Z6GA 2DETA 1A9OA 4BO0A 1YDEA 2WYVA 2I1WA 2FZLA 5JLJA 1J42A 3PF8A 2J9ZB 3EEOA 2AUTA 1KZYC 1YC5A 5T5QA 4I5IA 2P2CA 1JKJB 4B9AA 1A71A 4DCGA 1DXHA 4KSBA 4I99A 3ZWQA 2IS1A 3F7NA 2H2DA 3UT6A 1XUOA 3OTOB 1Z6XA 2YTZA 3NTQA 3GVXA 2HEGA 3IR6A 1B2LA 3I04A 4K6GA 4REOA 4KQXA 5IWCA 3IDQA 4NL4H 3GV0A 1A04A 4BNVA 1JFVA 1LRLA 2H5JA 3ESZA 3FJYA 4HBZA 4G89A 5ARCA 4D97A 4PCLA 3BD6A 3C97A 3LW7A 1ZNXA 1KJNA 2IW3A 3LKZA 4AROA 1R00A 1OTHA 1JJAA 2VATA 2UYCA 4XVQA 4XOIA 1AZWA 5GVRA 3ROXA 4GZ5A 2ZRLA 3UJNA 3EH2A 2JLVA 3U4DA 1JZQA 1H1TA 4HATA 2R1TA 4MYCA 2ZVQX 1SVOA 2FX2A 1GNQA 1E9RA 2ZU0C 2ON6A 2H9IA 1FUYB 4RDHA 2C9YA 3K70C 4CLEA 1A4XA 3I28A 1W76A 4QTZA 1VCIA 2NU8A 5LMCA 3FNFA 1NR1A 1PS9A 1TW3A 4BNFA 5FA8A 4ETNA 4KN5A 4WL0A 2BGRA 4IDAA 1IHDA 1AA9A 4OHVA 4YS6A 1RBQA 3ZKWA 4BO3A 3HB4X 5BYAA 4F2DA 2QE7D 4GQIA 4ZIRA 1QK3A 2V7QD 3SJCA 5GJCA 4O6VA 2IX3A 2GYVA 4H7IA 1AX9A 1H2ZA 2DUWA 1KEZA 2AK3A 2X2FA 3L0YA 1GLNA 2G06A 2PH5A 4Y9DA 3NNDA 4A5SA 1KWGA 2JLUA 4M87A 1YE3A 3PXEA 4QEKA 3ZD7A 2GEFA 2HRCA 4US1R 1KAOA 3QKWA 3IB3A 3COPA 4NHOA 5AWFC 2FG6C 3FCXA 3W8DA 1E59A 1L8QA 5K0NA 1GEEA 3BJRA 1N5MA 2HQOA 2ZT5A 1N7HA 3QFRA 1GOTA 1ZCFA 2ODPA 1PLKA 2B4YA 4CFSA 4JY7A 2GEKA 2HCJB 4DS3A 3G7NA 1Z56C 4UPEA 2KI5A 3HRHA 3SBDA 1EUCA 2J9GA 3MJ4A 1ES9A 3PUZA 3D7MA 3GUVA 4FIZA 4GPIB 4AKGA 2FCRA 1K5HA 2PL5A 2ZJOA 4LXHA 3WOHA 5AVQA 1PBTA 3HLKA 4DEYA 3C39A 2NYAA 3GYBA 5FFNA 1K9VF 3MQ4A 5K0BA 4WKBA 3JZMA 1O89A 5AIAA 1UMBB 3WLRA 1HV8A 1ADGA 1CZUA 3NJ4A 3GEMA 1D2GA 1H2AS 1DEAA 4W5HA 2HFKA 1OFIA 3RVKA 5AUNB 3GG9A 1I24A 3EXG1 4JUCA 1QP0A 4HDMA 3I9JA 1FX0A 2VHEA 3G1WA 4YP1A 3TM5A 5LUAA 2GF9A 4PHTA 2GF2A 2QBYA 2JIQA 1ACMA 1QQ6A 3FSRA 2CXXA 4B34A 4IO1A 3WGMA 1BWQA 4UUNA 1IN5A 3L8CA 5BR4A 1BJTA 4AT1A 1XCPA 3RGGA 5ALUA 2FP4B 3G8CA 1FSFA 3TQTA 4CGYA 1UMDA 2XD9A 3C3EA 2PYDA 1RP1A 1QO0A 5ALQA 2ZBPA 4RV4A 2ZT6A 1FP4B 2EARA 3EXHC 4RC9A 5BVHB 4YYZA 5LMUB 1CUCA 2C4NA 1MQ9A 3NNSA 4A10A 1U3WA 3FOCA 2CJXA 3NMUF 3GELA 4MWBA 3GEPA 3F4BA 1KAEA 4YH1A 3GEBA 2OZPA 4IEIA 4Y1RA 2JKZA 1E9EA 2HK6A 1JQ3A 1TYCA 1VYUA 4TSRA 4PIPA 3HB9A 4AMBA 4PN7A 2WLSA 3D6NB 3F5DA 4D80A 2QT1A 4R83A 3WSTA 4OMFG 3UT0A 2V6IA 3OFSA 3PJGA 1PR0A 3TD9A 1IK6A 3O5AA 5IARA 2QN3A 3HCAA 1SC1A 2H3EA 1NN5A 1QWOA 3OTWA 3P8ZA 2EJBA 3H8SA 4G84A 2J30A 4CFYA 1PJRA 2RGUA 1GXSB 2BI8A 3EA0A 4L7VA 1AK9A 4LI0A 4PNZA 5AYVA 4DB2A 2GO1A 4DZRA 1K3TA 3FUTA 4KXUA 1R8JA 1BNCA 4ND6A 4YTEA 3V2IA 4BZPA 2XNJA 5EL0A 3OJEA 1P5FA 4U9HS 4ZC1A 3IVCA 3JQ9A 4YDRA 5HMMA 2G80A 2H5IA 1VKOA 3BGDA 3QE2A 4HLNA 1CR4A 4GZ3A 3SOPA 3HVUA 3E7XA 1U4SA 5CVEA 3VC7A 4F91B 1JSXA 2P68A 1U8YA 2QL5A 4QXQA 4D6XA 2YXLA 3UGJA 2W8ZA 2VT2A 2H85A 1GKKA 3LBYA 5KINB 3G5AA 3ONVA 4RD2A 4BX9A 3ZXYA 4DT1A 4HSGA 3AKDA 4LZLA 3RRNA 1T5IA 3RS8A 2BGIA 3JD0A 4PAMA 4DWWA 1RXWA 1KXZA 2PX3A 4ZAZA 4AZ0B 1INLA 1Y3DE 3DCNA 1V6CA 3NHMA 4AN4A 3N2IA 5K8LA 4P4TA 2VP9A 5T8KA 1QOZA 3QELA 5BW8A 1USIA 2QROA 2RGXA 4LE1A 1QHXA 3WFIA 4ZRMA 4QLAA 3KLOA 4MQ4A 2FG5A 5TY0A 4JBIA 5DFAA 1XPRA 1EA5A 3IBYA 4OO3A 2IUEA 4I66A 4IJQA 4ENVA 5BV1A 2E85A 2WKQA 2B98A 4Z4FA 4OCZA 2I2AA 4EO7A 2PU7A 2I78A 1I0ZA 4G0ZA 1N2GA 4GOJA 4DUPA 5JJCA 1NBWB 4Z9BA 4WNYA 3GG2A 3GO4A 3WLFA 2PH7A 3WGUA 2DFKB 4MH0R 4JLJA 1X8JA 4X6UA 4YP6A 3ZZ1A 3DWEX 1W5TA 2JI4A 4DJ5X 5C4IA 1N77A 4V3BA 2UZ0A 1M54A 5ITZB 4WX2B 4JIGA 4HNVA 1TGYA 5JRJA 1DC8A 4XKJA 3IXMA 1FRVA 2C5AA 2YVKA 3NKVA 2G5TA 5COQA 5GV7A 2IDZA 3TTYA 4CLRB 4EUKA 2GVDC 3GJ8A 3UAVA 3TBHA 1CS4C 4GE3A 4LRWA 4P7BA 4MWZA 3PXBA 3E18A 1M0TA 2KBEA 1T9HA 2XAAA 2P4HX 3FH0A 4QU8A 4ED9A 1KDVA 3K2EA 3VOTA 1Y89A 4MIOA 2P62A 2HSDA 1S89A 4TTRA 4IOKA 1EVLA 1OLXA 3TIGA 5A02A 2XUZA 1TTQB 5HCIA 5KOJA 2XKAA 5M2QA 4JENA 2HA6A 3U4IA 4S1VA 2CHFA 3L7JA 3Q2IA 4R1QA 4TYQA 3HVRA 3P0HA 2GEJA 2IU4A 2QXYA 4UDNA 5T4HA 1BYIA 2O4CA 2QRKA 4AG3A 2VRCA 1NSFA 2LCIA 2AMJA 3RC7A 1RVV1 2QTNA 2AOWA 2QG9A 1E3LA 2A33A 1JG6A 3CLTD 3V7YA 3ZHOA 5LD2B 1Q7EA 2XB4A 3PGMA 3OWXA 4X1KA 4DIKA 3RNOA 4GECA 4HC4A 5LQSA 1VLLA 3HWRA 3ZQUA 4AAYA 4CQMA 1BMDA 2N47A 1JU9A 1G66A 1YBHA 3L7LA 3OKPA 4QYMA 2XXAA 3ER9A 1L1FA 1UBNA 1VIYA 2FFBA 1QX4A 2BZGA 2CLCX 2FA9A 3BHJA 3NFYA 4NU8X 3KPVA 4O1MA 1G21A 4AKHA 4ZVLA 2Q8QA 3RT7A 5TPWB 2C99A 1CG6A 1XIVA 3PWTA 4LJYA 4CF6A 3GFPA 4HLUA 4FDAA 1RAFA 4IF4A 2C2KA 1QVVA 2BF7A 5KTRA 2YJ4A 1H5UA 4M1TA 3DV0B 3TKLA 5CW2A 3TW6A 4CKXA 5KJEA 2X8JA 4HUQA 2VK8A 2YZGA 3PLRA 4WRRA 1JIKA 2H92A 5DYNA 3M2PA 2B82A 2ODBA 4AJ1A 1FVOA 4JVOA 1ULTA 2FVXA 5H7XA 5IZ4A 4DV1B 2GTHA 5I9NA 4NENA 1Q77A 2ZXUA 1REQA 1Z68A 2BZ0A 1BGVA 2ZR7A 2XCIA 3JYOA 4OYYA 3ZC3A 3BE6A 4LJRA 2FX3A 3V4VB 4BIIA 5LP6F 2ZJ5A 3IL2A 2VNIA 5ALSA 4B79A 2ZT8A 1YZYA 3TXAA 2P77A 2I7TA 3KWMA 2JLZA 1JA1A 2FMIA 3R40A 3DYBA 5FBWB 2BD0A 1M2VA 3HJUA 3P20A 3R0IA 3E9DA 3G1UA 1QR2A 5FTKA 3AH8A 3NLLA 4MB2A 4OQXA 1DQYA 3G9XA 1AQLA 2JG3A 4O63O 3WGYA 2CXHA 2WTXA 2P78A 1T3LA 5HP4A 1W49A 2P3SA 4JKOA 2QM0A 3OQHA 4C20A 4URUR 1FDUA 1KZ7B 2GH1A 2HXYA 3LA8A 4Y0VA 1H1LA 4DC1A 4O4HF 4A7PA 3CWQA 2CFSA 2NOAA 5HBRA 1PR3A 1JJVA 1Z5GA 9LDTA 2Z6VA 1E8NA 2PXAA 3JX9A 3OE4A 3A9RA 1D8AA 4B3IA 1EUQA 1OV6A 1O9GA 1PG5A 2B1GA 4HXFB 3K0AA 2OOSA 3SKXA 3WKAA 2W6ID 2AG5A 3L4BA 2FDRA 4ZYYA 2IGTA 5B30A 2C96A 4LXGA 3E3LA 3A25A 4HRAA 4ZU3A 4WBSA 1GGNA 1VHWA 4MP8A 4OP1A 3EOBI 2VUUA 2YXEA 4NYMR 2JL1A 2FSGA 5ARDA 1A27A 1YFKA 1EVKA 1C1YA 1MJGA 1GQQA 1QGUB 2CWWA 2E5FA 3BCRA 4XYEA 1SXJA 1ZYUA 1HE3A 1W6UA 3T94A 4N48A 3ABZA 1UKVY 1KOLA 4M1ZA 1FNMA 5LC1A 3AESA 5LA6F 4C4YA 1AUOA 4TOIA 1YKGA 2XVZA 4IMIB 2REOA 2WSYB 4DJEC 4LYYA 2W70A 3EEFA 1TVMA 4XPZA 2JIZD 4R16A 4QM7A 2RE8A 2OBFA 2QZPA 3K53A 1HL3A 3N7UA 5E1BA 5DNVA 2J6HA 4BAZA 2J0VA 5HKOA 2FPSA 2O0LA 2Y1LA 3HY4A 1ZISA 3PE3A 4DC9A 1NXVA 1V4NA 2X9LA 1ZJ5A 1DBSA 2IEZA 3BULA 3CVOA 3KE9A 4G1BA 4P4GA 2GM3A 4CM4B 1NVUQ 1IWPB 3TIVA 1DWUA 2Z5VA 1VG0B 4H27A 1CLUA 3ZWYA 1HDEA 2DR0A 1P0PA 3Q9NA 3O7WA 4KYUA 5DHUA 3OUZA 1OJ7A 2XGGA 1A7KA 1NUAA 5KCMA 3FCAA 4OOEA 4WBNB 4EGSA 4L1KA 1ZKMA 5H59A 2NTYC 1T9BA 4RJJA 4F3KA 4REQB 4MKFA 2AT1A 2J45A 3DTVD 3EYWA 3NC4A 4FDVA 5ALHA 5K3SA 3MINA 4CPDA 4IV5A 1BW9B 1RQ2A 1QIJA 4ZT3A 4RVOA 1KZ4A 1M2WA 3RYIA 3NM5A 1MB4A 4L4XA 5KEIA 5LQMA 2QRNA 1EUZA 3RFUA 1KMQA 1QIGA 1C3VA 1NONA 4KITB 1XF1A 2HJHA 3RTGA 2PJRA 3BM5A 3KOUA 1Y63A 5IAKA 4ZDWA 2I3ZA 1NKTA 1HNNA 1E2KA 3LI2A 1VKRA 3TCKA 4EG4A 4JI1B 1XZPA 2JGFA 3K9CA 4GWLA 3GLHB 3NBQA 3ICCA 2R47A 4XFKA 1RJDA 5MN6A 3T1OA 3BCSA 1EHIA 1QHYA 5TQVA 1FFAA 2X5OA 4DXAA 1RLTA 1D6NA 1M2FA 2QMUA 5AIBA 4KU4A 1U2GA 3TW0A 1HM5A 1F2UA 2R00C 1A69A 3TTWA 2LRHA 5CB8A 1SKMA 2G1PA 1SIUA 3AR9A 1ZCZA 2F3PA 3V2UA 1FNCA 4ER7A 2X0KA 1M0WA 2AVDA 2ALJA 3ASUA 4TTIA 3IA7A 4GRIA 3C3KA 4JP5A 2ZZKA 1R0LA 1HT1E 1NNUA 3HJHA 1O5TA 1U9IC 1E6KA 3MWLA 1H85A 3P9QA 2VHTA 2Y0EA 3U44A 2BFBB 3ZCSA 1Z6PA 1IRXA 3F49S 2FJPA 4G1MB 1YAHA 3TL3A 2IP4A 3FFWA 1LQUA 1MNAA 4PG8A 4B8YA 5SZIA 2MIIA 3MRSA 1SM4A 2EW2A 5KIAA 3HCDA 2O3TA 1EJ6A 2V65A 3WYEA 1RWVA 1G5PA 2H16A 4BRZA 5KNLA 5BV0A 3R0ZA 1GPLA 2D13A 2IV7A 1GA1A 3F5MA 3W78A 5J4LA 5MN5A 2WUEA 2ZT7A 3HGQA 1KEEB 1OXUA 3DNMA 4NDAA 2W2TA 5A7GA 3T3GA 4E5KA 3R23A 5LZ7A 3M4YA 5DBEX 2O59A 3OVMA 4H6PA 4BO5A 4CR6A 3AHIA 4GM4A 4HDNB 3HDVA 1Y1RA 3UWKA 4WFJA 3TGPA 1J0BA 1XMXA 1WUYA 1O6BA 5FTNA 3FX2A 4E1BA 2BELA 5EKDA 3QY0A 2XJ4A 4OIFA 4TV8B 4E5PA 1EP3B 3ETLA 2UUBB 3UG7A 5AJYA 3RT1A 5EJ9A 1MZPA 4YXWA 3L7BA 1AO3A 4I6GA 1ODJA 1NW9B 1PZXA 3EWSA 4EGCB 4M49A 5L40A 2JD0A 2P9ZA 2W93A 2ZS8A 2C3OA 2GAIA 1XVVA 2XQJA 2P4EA 1EAYA 3EJ6A 3FAZA 3NB0A 4YJKA 4RYDA 5D87A 5LLSA 4LNHA 3E53A 3OOSA 4Y0AA 5KHAA 4ENUA 4R2XA 5AOVA 3FVVA 1GG9A 2FPOA 4YCJA 1YR7A 3IMKA 1JLKA 1PHRA 4FFOA 2CZGA 5FBLB 5IH3A 4UHDA 5IBPA 2BHLA 3AR4A 3ZTYA 3VNUA 3OOHA 1DDGA 5IZCC 2J6IA 1GL3A 1J8VA 2OCBA 4I0WB 1XE3A 3M5CA 2GRJA 5JYCA 1GKIA 1QP8A 5DCLA 1SPBS 4NE7A 1OXMA 2FJUA 3N2EA 3LL7A 4HSEA 5JFGA 1YI1A 3OHMA 3T5CA 1OU4A 3V8QA 4E5UA 4QXAA 1NXTA 5ER9A 3FRHA 4G1VA 1O97D 3G0BA 4ZCQA 3EQ7A 4FYJA 4HF7A 3NBMA 4O02B 4OFBA 1EWVA 2XHEA 4IIXA 3IAS6 3RBXA 1WL8A 4HXEB 4F71A 3SX4A 5A2GA 3NEYA 4RXMA 3SVTA 2PUEA 1ZBQA 3A4YA 3IUMA 1L7MA 1U6JA 3D4PA 1L5LA 4DMKA 4LHEA 5LXTA 5AVOA 2CCKA 1D7OA 3BWVA 3SQLA 4JU9A 4RPIA 3S5JA 5C1BA 4EYSA 4LF5B 1UJ5A 3D0OA 1A9TA 1GILA 2FMKA 2W6JA 3L6EA 5C0OE 4KO2S 5IS2A 1H66A 2BP7B 1YUNA 4FIDA 4BLWA 4L3WA 4MQEB 1ZC4A 2RGWA 3KL4A 2PUCA 2F1HA 1G20E 2WG1A 2CLHB 3MM4A 5DLYA 2WFZA 2FOIA 2BF4A 2GO7A 4FDUA 2A6PA 1N3BA 2GETA 2Z5LA 4FFVA 3QXCA 1F0KA 3P0IA 1D04A 2J4CA 4QRHA 4YT5A 3T8YA 3UY4A 3TUJC 1VIDA 1WHTA 4EW3A 1N2ZA 1NXXA 1G2PA 2YV1A 3GVHA 2FZGA 4F6CA 1XP5A 1SMKA 2M9MA 2P9GA 3ZV3A 1AXRA 2QUKA 2E55A 3NHUA 3NONA 1I3NA 1JVBA 3B70A 3QEOA 4ZYWA 1M1YE 2H48A 1GDHA 3IV9A 3R6GA 4YV0A 2GAAA 3NUQA 4DMHA 3F3YA 3FG9A 3CQ9A 1L9KA 1NP3A 2ZWIA 4P33A 4D4HA 5KYXB 1XX6A 4YP7A 3H5OA 3NAGA 2GNAA 2PSEA 3FI0A 4HG2A 2BAGA 1WUJS 3H9CA 4JLVA 2GXQA 1UR5A 2PMFA 4JQOA 3VYTB 4AWXA 1LV8A 2D7DA 4Y2GA 3IOBA 2BIFA 2Q5QA 1CUZA 4UMFA 1F48A 2WFLB 4WQMA 1XA4A 2LXNA 4OL0A 5G3ZA 2FR1A 2P4UA 5BN5A 3QE4A 2PGAA 2RJNA 3DD5A 4IFBA 1N2OA 2QSJA 2DHCA 2VC2B 1T1GA 4RVDA 3I2HA 5AQEA 4UTPA 4KXYA 4JDPA 3M6FA 3KUCA 4GZMA 1ECCA 1OWNA 3WGHA 1E1RD 3JWEA 2LIVA 3IUYA 4EQ6A 2H06A 2GCOB 3AR6A 4GL4A 2CVOA 3SSNA 2F1KA 3HGTA 3WGQA 1G8MA 1N5KA 1SIBE 4OH1A 4EFMA 1H94A 2NO0A 2X8BA 1ECBA 3AZQA 1TJNA 3QW4B 4GUAA 3UXYA 2MSKA 3AL0C 1AVTA 1SC6A 1U3UA 2ID8A 4GU5A 5IEBA 4UARA 2Q4RA 4AZSA 3AHJA 4PFQA 3HL4A 1YVUA 2PFSA 4BYMA 3U9SA 1E2UA 5HF8A 1H5QA 4MW6A 3ZU4A 4Q3DA 3ZCXA 2C84A 1JDTA 2RGNA 4TXNA 3LUDA 4XB6B 4CEJB 4WN9A 2JZOA 2GUWA 3DLIA 2GFHA 3HN6A 3SYRA 4RTQA 4TMKA 1K88A 2CUNA 4PFSA 1KRHA 4R1NA 1WZUA 3CW8X 2NLOA 5CJPA 5LM3A 3IDAA 4AW9A 4D4IA 2JA1A 2ZRPA 3FYCA 3GGJA 3MSXA 4HAYA 3CG4A 2AR0A 1V9LA 3LHIA 1S4MA 4JA2A 5KAMA 5IEJA 2NSLA 1PDOA 2P75A 3RSGA 2E4UA 3AJDA 3SXUB 2VNJA 4K9SA 1XU9A 2F4NA 3F8TA 5E9AA 3CX7A 3MWDA 4RCZA 1EU1A 2XVYA 2C1ZA 1POWA 2XE8A 1NW4A 2MSDB 4B3TB 2FQQA 4EENA 3R41A 4NVRA 5AXCA 1NUUA 1Q50A 1DV2A 4MPDA 3CPEA 3NM4A 4OKSA 1R0RE 2E18A 1OZ0A 3MC1A 4JUDX 5TLSA 4K88A 1SPXA 3AFIA 4GPTA 2ZANA 3KT3A 1IXKA 1LVGA 2QPOA 2V7TA 4G9EA 2DAPA 1I4EB 4DIBA 1GNSA 1SVUA 4AJ4A 1XMPA 4LYDA 3ZU6A 1G1MA 1Y37A 1HGXA 1IFXA 1KO8A 1D4FA 3KPYA 4DV7B 1HNWB 2QGFA 2Z9CA 2CLEB 2H1OA 1F38A 2VSOA 3AI1A 3SZMA 1IEWA 1GCAA 2BZ1A 1NVTA 1RKXA 3MCZA 3UJ7A 3FYUB 4NMLA 3ETNA 1K27A 4BVBA 3QBEA 3O9MA 5B58T 3F98A 2XGOA 3C5CA 4AM8A 4W7HA 5DI3B 1D0IA 2OZVA 5J58A 4WT7A 4EITA 3FPKA 3OCVA 4BE7B 4OI0A 3NP7A 4FB4A 1A2BA 4LY0A 5M5BA 3EVCA 4M37A 5LU8A 3PEFA 5H0IA 1U8TA 3QGMA 3ZH9B 1X8LA 1QGOA 1G5TA 3LFTA 3ZGNA 4N5NA 4ZI5A 2I6XA 4YMVA 2Y1WA 1J09A 4Q21A 3QVSA 2Y66A 2P7IA 1N1DA 4D99A 3PDIA 2JFNA 4RMJA 4CUKA 3V4SA 5LMNB 1KPGA 1WOYA 2N9UA 3BSFA 3EOAI 3L93A 4LBYA 5KU7A 1J07A 1MQ8B 3U4GA 2TMGA 5LOVA 1E0AA 1F1JA 1WZNA 3B52X 1M2KA 1E7QA 4MWTA 1P61B 4TKMA 3HBFA 4XIIA 4DMMA 1VL0A 5EMLA 3R7WA 1UINA 3VDQA 2W2OA 1TO2E 4MVYA 1YIDA 5U9CA 1Y5LA 4PHFA 1J90A 5LWHA 5JBIA 5K09A 1KZGB 3PXUA 2QL9A 4A2PA 2FPPB 1Z83A 4IRMA 3SFVA 4B3SB 1TK2A 3HCPA 7ADHA 4MV8A 3P9YA 3I2IA 5A4FS 5LR6A 1E77A 4H9GA 1U6KA 1EXMA 5K3CA 2AR9A 1A7UA 4LDPA 1DXOA 3ETHA 2I4RA 2Z2ZA 1BHO1 5FQOA 2Q9UA 1QRUA 4HX9A 4IIUA 1FNSA 1PUXA 5LYJA 2BMJA 4X90A 1E4EA 6YASA 1UKCA 2X3FA 1NXWA 1V2GA 4JL6A 4MVWA 3RO7A 5DGCA 1CYEA 1P72A 1FSSA 3O4FA 3PZBA 4PLWA 5JXWA 5EQDA 4A15A 1OCEA 1DAGA 2VPYA 3T95A 3D43A 4XIJA 1KVQA 1P44A 4WK4B 4YJHB 1IU9A 4YMWA 5JNUA 1SKBA 3GCXA 4PGHA 1U8ZA 2DBZA 1TF7A 3RVJA 2CYBA 3QI7A 3ORQA 1TNDA 3DGFC 3GGCA 4WJLA 1ZOLA 3O8QA 3GMTA 4KUHA 1QUFA 1FJGB 3VZRA 4ZFNA 4BC1A 2UZ4A 3CZ9A 1T8SA 2XA9A 4R68A 4JS0A 2C31A 3F4KA 4JJ8A 4OXIA 5JMPA 3B36A 3ZGOA 3O3CA 3AU8A 2QM7A 1BFUA 2CVHA 1LPBB 1NQUA 1W1IA 2ZSHA 3O38A 3RH0A 3DTYA 4DA9A 1UAAA 1R5JA 1RU3A 1OLUA 3LVBA 2B8NA 3EC1A 3SZGA 2MSCB 2R1ZA 4H3VA 4AJNA 1DBVO 1OPRA 3ENWA 3UZUA 4B3FX 4CG2A 2EYUA 2OHJA 1S8AA 3LT2A 3M6VA 4MV1A 1DINA 3CZPA 4GRAA 1DCKA 3FRJA 2KW5A 2BJHA 4PX3A 5DX1A 1LPAB 3VPDA 1IY9A 5FEMA 1G7RA 3MBOA 4BWVA 5JSZA 3Q15C 1B0AA 4XWOA 2OCGA 2VP2A 1SKYE 2ZQ5A 1WV0A 4IV0A 1LLQA 4OL9A 4YHHB 3EPLA 1WXWA 2A9JA 2GZAA 3R3UA 3TS1A 4A5OA 2HR1A 4XDYA 4D9EA 1HQCA 1YDHA 4OGGA 1FXWF 3TKAA 4N40A 5DN6D 2IT1A 3FM9A 1VKZA 3IE0A 5FUMA 4PZYA 4J1NA 3RBAA 1LGYA 2N0SA 4IEEA 4Q4DA 3ZZ0A 1A2OA 2WFAA 1M33A 2WYOA 1XL0A 3E1GA 5JLAA 4OQZA 3JALB 2ORVA 2OLKA 4LMBA 2NSHA 5A9TA 4ZDJA 1LDBA 4S2UA 3EGIA 5KNDD 1PAUA 1K7FB 1KS2A 2ZI5A 4J03A 1KC3A 2IEAA 3DDOA 4JFAA 4JHLA 4PYJA 2LCFA 1KQNA 3DDHA 4YMHA 4LAFA 5LDHA 1IPEA 3ULKA 3TGWA 2QN9A 5CW1A 4XM1A 5L7YA 1O87A 4R81A 2CZQA 2PXCA 5CG1A 2ZB4A 4C7KA 3CZQA 3EODA 5ALYA 1T8YA 4B31A 2AFHA 3IIKA 4BRUA 4C76A 4NFSA 5PGMA 3PXAA 4KUGA 2C4HA 3IVXA 5HKKD 2I34A 4AO7A 2HPHA 7GPBA 2X8LA 4GYYA 4ER0A 4MKGA 2PIAA 1G4UR 2COKA 4LOLA 4CMAA 5BVGA 1U81A 5JQGB 2CSUA 2DH5A 2YWGA 3AEKB 3L79A 4MRRA 1KI7A 4ZA2A 4DGQA 4EECA 4UTZA 1KU6A 3FJ1A 2Q5LA 3RDPA 4LOAA 1KYZA 3WLTA 2ZJ2A 1U2TA 3QWAA 4LWQA 4G0QA 4DCNA 4E51A 5EIEA 5EMJA 1NIPA 3HCBA 3ZNOA 3E9RA 1KK2A 4PZEA 2ZRNA 3U56A 2M6SA 4E5SA 3I3OA 4WE3A 4B17A 1DB3A 4Q1BA 5M04A 4I4TB 3VGJA 2BEUB 3NZEA 4UQLA 2NTNA 5C4MA 1I33A 3GARA 3OOEA 4ZYZA 5LPNA 1ESEA 5KU1A 5IT4A 2EQBA 4DBZA 3NIDB 3CX3A 1RRKA 3FZQA 4P38A 3UK0A 5I7VA 2O0MA 2PUTA 5B4VA 3F9IA 1LBTA 2JRCA 4ZMRA 4V2IA 3G9QA 5C5EA 1QQAA 2BTQB 3EVAA 4OJMX 4RZSA 1TEXA 2EHJA 1HDYA 2YNMC 3FUWA 1A98A 3AWIA 3N6XA 1MB3A 4ND8A 4HBGA 1S3GA 4Q1EA 4EG6A 4Y67A 4IIEA 2R00A 2WKSA 1W0KD 3MGAA 1GL6A 1Y3CE 2AYYA 2QD3A 2X0RA 3B6MA 3M81A 4Q4AA 4W82A 4BTEA 3EWIA 1VPTA 3T7RA 4E31A 3M5PA 3FE2A 4YUVA 1UMBA 1U98A 1XZHA 4P34A 4BDTA 5KOHB 2YV4A 1PR6A 3PD1A 1G4HA 4GI1A 4M0CA 2ZRKA 3A7DA 3U81A 1U9IA 4A8JB 4R05A 1SUAA 1ZGZA 3C8DA 3MJDA 2PRIA 3OZDA 4EW2A 3EFHA 3LDUA 5DDIP 2JFPA 1MAHA 1N4DA 1JTEA 4U8GA 4YWHA 2NZJA 4PZUA 1BKSB 4MA0A 4R2KA 1JR2A 1LQTA 1QKJA 2WSSA 3JARA 3M5WA 4E4TA 2GEDA 4QPDA 1J2EA 3U7GA 3N2LA 3VHXB 1YJ8A 2QDKA 1HEIA 2OLEA 3H8JA 5CT8A 2ZYTX 4DBVO 4EY8A 2X1HA 1QF6A 2EIHA 3FPSA 1CQIA 2GZHA 1Y48E 1YL5A 1IYZA 1QTRA 1BS2A 1DC7A 3KM0A 5BXQC 3P2IA 5KC8A 4TRMA 2HDNB 3LCVB 1S2LA 4TXLA 2DPXA 1FP4A 1MOQA 5HJEA 3Q8KA 3KALA 2AC4A 3ZDQA 1JPNA 4MQ5A 4G6ZA 1BE0A 1FP2A 1RI4A 1Q7GA 2FSUA 5HS4A 1U99A 1UKZA 3PC3A 2IZ5A 4EG1A 1RACA 3PFGA 4ON9A 1E2LA 1IZZA 4BE4A 3CZMA 5IFKA 1V37A 5JZOA 4BB0A 4QHSA 3RRBA 3T38A 2WUGA 1W25A 1V1RA 4BASA 1NAHA 5CITA 2VP5A 2BGMA 3CTMA 3NDRA 1DDIA 4K0KB 2C5EA 1FTGA 1OXBB 2RH4A 4L22A 4BQQA 1TC2A 1ONPA 1QONA 2B7BA 2F43A 3W7VA 1YS4A 1Q7CA 4FFSA 4DBLE 4F8JA 4QU9A 4LQDA 3ANLA 3FMFA 4Y6PA 3A3OA 4YNBA 3TMKA 4F2PA 2R751 5MHTA 1DKPA 2GNOA 4G5FA 1T2FA 4H35A 4CG1A 1BRTA 4IGEA 3SE7A 1GG8A 2XUDA 1VG9B 3QBTA 4UZFA 5DGDA 2HCFA 4FOLA 3OFVA 5DLPA 5CCEA 3KKZA 1PZFA 3IGFA 1AQIA 1L7EA 1L5GB 2GXSA 3RW9A 4WLOA 3DKIA 4EPTA 2FUNB 5IZCA 4S1OA 2HU7A 4JBYA 4RPHA 4DDVA 1D8TA 3IIMA 3IQDB 4D2IA 2HD4A 5HF9A 3ZCQA 5B57C 3C7TA 4QUJA 4YRDA 3VNVA 1EK1A 2HKIA 3HXPA 1S02A 4HWKA 1DIOB 4FINA 3AINA 3IPLA 4AZVA 3WJ7A 4LGCA 4RKEA 4NOJA 2YIVX 1W0CA 3QOYA 1UC5B 5ALJA 1N1EA 2YOHA 2VT7A 2KMLA 2D2EA 4GVLA 1DV1A 2B7CA 1KJYA 1M34A 1VSUA 3N28A 3QXXA 1Q0ZA 1GCOA 4PLHA 4F4IA 2AKAB 5B53A 4BAGA 1UEIA 2OO7A 5HIIA 3KYCB 4AZ0A 3DE4X 1ACJA 1EBUA 1L7AA 1NLFA 2VWHA 3KKMA 1KQGA 3COVA 5K4HA 4MKZA 2BH2A 4OGLA 4CKBB 1SHUX 3FFXA 2V4MA 2FV8A 3F1LA 5BQ5A 5IN5A 4LE2A 1D0VA 3L6RA 5JWHA 4DR3B 1Y42X 2ESRA 3MQFA 4UNRA 5KMGB 2PAAA 2OVFA 2WOOA 5LBTA 4LFCB 1BCRA 1AZSC 3N2GB 1XMSA 2PT9A 2PV7A 4BECA 1QNFA 4ALNA 2OORC 1JR3E 1B76A 3TSOA 3LX5A 1J25A 2GPJA 3OJLA 4KQKA 4CLDA 2FY8A 2FZCA 5JAHA 5KQPA 2OGUA 4XEUA 5C53B 3MLEA 5JU6A 1OD6A 2CBZA 4Q1CA 1YDMA 2IHKA 3DD1A 3DLPX 3LYHA 4Q1DA 5CNJA 3VR5D 2X0NA 3U60B 4EABA 5JCJD 2EL9A 2QVLA 3EAGA 3NOVA 4O4IF 3Q8MA 3RKSA 2RG7A 3S70A 2I4IA 4QE3A 5L4LA 2NV6A 4BFXA 2IHBA 5E6RB 5EYPB 3A1UA 3UEOA 4ZPXA 4FJ2A 2IOYA 1BO6A 2Q3BA 2CFRA 2XUOA 3PFWO 3GPBA 4LC9A 3PNSA 3U9TA 1PGJA 4KTVE 4FYPA 1BVUA 1V95A 1VIVA 1NN3A 2VNSA 3LY8A 4FSHA 4LDJA 3W8NA 2ZYVX 3DQPA 4NFYA 5CURA 3DA8A 5BYBA 1K1EA 1MTZA 1V5EA 5C18A 4KQMA 5DNEA 2Q9CA 3MS2A 4HVTA 4BMPB 1SUSA 2QLMA 1UEXC 4DIDA 1HNZB 1IATA 3M4JA 1X1EA 3KZVA 1MHPA 4LZWA 2LP4Y 4IFIA 2C7PA 5I7OA 5IDVA 4KIWA 2ACEA 4P0QB 4A9AA 3OPVA 4PG6A 1USKA 3N2KB 4M99A 3BH0A 2IE8A 3KXPA 2MHCA 1KY3A 2ZLBA 2KLBA 2B0CA 3GUCA 2PMEA 4PLFA 5K99A 3I2YX 4EB0A 1JG4A 3LD9A 4PWZA 3SI7A 3ZXIA 1E6UA 3GUUA 1DJPA 3PX2A 4BGUA 2IYEA 2X5KO 1RWPA 1F17A 2GX6A 4K2AA 4DMLA 1SXQA 4EHFA 2IH4A 1ETHA 3MJFA 4ETWA 3ON5A 2V7BA 4ITRC 1XLTC 2VKTA 5KTNA 5AI5A 5JCOC 4TKVB 3DFKA 4P4UA 2ZBGA 1A0OA 1ZZGA 3BBLA 1WABA 4ZGBA 4HZUB 1RHRA 4LZNA 4M54A 2RAPA 3O4JA 3U3XA 3QKSB 1ORVA 2NP7A 2QN6A 1XDZA 3KQWA 1II8B 2AXNA 4G1EB 2JI8A 5A6SB 5TR9A 1SC3A 3SZRA 3AGQA 4LRTB 1ZD8A 2W8BA 2WD9A 3WLSA 4D4GA 3A26A 4OYHA 4I55F 1JU3A 4YJGB 2QF7A 5CA0F 2PWBA 5B1HA 1RJGA 1A72A 2IHUA 1OILA 2PZFA 2W22A 2ZSEA 3DTVB 4P6VF 2JRLA 4UEOA 3ZE0B 4F6LA 3WJAA 2O5RA 4A6DA 2XZTA 3IBTA 2YIJA 3CE9A 2VT3A 1MF7A 5I47A 1BKYA 1K86A 3WMRA 1GPYA 1SULA 2YVLA 4N49A 1T25A 3QG1A 1HDGO 2NYRA 1YASA 2HK7A 2SNIE 3K1AB 4DE5A 2VJPA 2WJ6A 3EVEA 5AW9A 5CXUA 4E5MA 5C9ZA 2P30A 2XCUA 2I4TA 3SGLA 5ADVA 2B0JA 4YBZA 2IHNA 1Y1LA 1EGHA 1TA9A 3ZPXA 1TZMA 3TWOA 4CR7A 1E1CB 3GEDA 1UEJA 1UXHA 4PQRA 1L5OA 5TX7A 3RJZA 4EEXA 3ZW9A 2CLOB 1I7DA 4MR9A 4W6ZA 1OMOA 2GPTA 4DCVA 5KJ6A 3QXGA 3BEOA 3ADCA 3WWYA 1YBVA 1F1BA 3PFHA 1R88A 4RZIA 1PJAA 3QQPA 1G8AA 3CRW1 3TZ6A 1XDUA 3V8MA 2NQ2C 3H2ZA 2Q9BA 3HFRA 4IDFA 3TDKA 2FPGB 1V2HE 3VSDA 5KYWA 2ISQA 4O4LF 1X86B 2H1LA 4BBPA 1WTAA 1TLLA 4UU0A 4E0BA 4EIWA 1AQ6A 1FQKA 1WMAA 3CEJA 1IPFA 4G8BA 4TV9F 2QAGB 1J39A 4EHLA 4EPWA 4TYYA 1GQ2A 3SN6A 4A0RA 4GXTA 5SZHB 2O8DB 2M2IA 3MT0A 1N6NA 1JHDA 2JVJA 2BZSA 2C3MA 2HHHB 4EK9A 1HDZA 1ZM2A 2K4MA 4NJOA 4CM5A 2HBZA 5K3FA 4FHFA 4I8IA 4NNOA 3SJ7A 1ECGA 3BZBA 3SDBA 3STXA 3HBJA 1JEYA 1X1BA 2V1UA 3FOWA 3SE0A 1KKUA 3BFJA 4Q9LA 1JDNA 5HGXA 5KDDA 5BPHA 2EZ8A 3Q5EA 3MTEA 3AIIA 5CIWA 1GQRA 5DHAA 1PQYA 1IRIA 3NKFA 4FBGA 1D5CA 2OGSA 1S9HA 4J3NA 3MCWA 4CKEA 2CY0A 3OZGA 1G98A 1RPJA 3IQZA 4IG9A 4G4SO 4TVKA 3T41A 5CJ2A 5KNDH 1PL0A 3ZDDA 2LGJA 1HI9A 3ICWA 3MOGA 4ZQBA 5AM2A 4A8TA 3NETA 4JXJA 5CA1F 4X24A 4WXYB 4F5YA 2XZPA 3RVSA 4HRYA 1HOXA 3JAMA 1Z28A 4Z6KA 1M2OB 2CVPA 3BMOA 1Z7YA 3BXFA 3MTBA 3DBIA 2I1LA 1SZDA 2IIVA 5DTJA 3K7EA 3OTIA 3ADKA 4EUSA 2H2AA 5CMLA 4PLCA 1XTPA 2XD4A 5J4KA 3DVLA 2JLXA 2NXNA 2RK4A 2HJGA 5CYFA 5EP4A 4NQRA 1TZCA 5J2UB 1DTWB 2H1VA 3DEHA 3VJLA 1IHXA 2IPLA 1I8TA 3IAHA 5TARA 1D03A 5B1EA 1JTFA 1XQYA 5TMPA 4TLCA 1MFPA 3NWEA 4PSVA 3AMVA 1WBBA 3FB1A 3N59A 1G3RA 4WK6A 1EGMB 4Z4GA 2IITA 3GNSA 4UHHA 5SYAA 4MS3B 2YJ6A 4I14A 3K73O 2A0WA 3B13B 1VFPA 4X97A 2ZRFA 5GZ3A 2B4TO 3DYIA 4EY4A 4W9NC 4YRKA 1RYEA 4QGAA 2F1JA 5JO9A 1UXGA 4FBMA 1L5FA 1S3FA 3ACBA 4NBWA 1V6SA 4PAQA 4UBLA 1PT9A 1ZH6A 2CGEA 2IYAA 4IAOA 4J16C 3QE0A 2J6CA 3F7TA 4KRYA 4WH0A 4C0JA 1F14A 3N86A 2HO5A 2JPDA 3OLZA 5KJCA 5AM4A 4OG2A 1OPXA 4BZZA 2PBFA 1JN0A 4HNQA 5H4HA 1LPMA 1YZFA 2FLWA 5H16A 4NE2A 3U7QA 3DE7X 2HNKA 4JOSA 2QYOA 2QTTA 5CDHA 2ZJBA 3VR6A 3CJTA 5DCYA 4LJ7A 1UBGA 1X7XB 1ZM4A 1P3DA 3EC2A 4XYLA 2QL6A 3SMVA 2D6FA 1BQEA 2A5JA 2C7QA 4GC9A 2O2ZA 2BFBA 5EXTA 5IJ9B 5KC9A 4CM7A 1OWLA 4UD2A 1N8SA 5IYZA 2HBYA 1UBUS 3H1GA 5DNWA 1L4LA 4BO1A 4LZJA 2HGZA 2K87A 4GMKA 4YAOA 5K4AA 2XDQB 1JF8A 2B21A 3E5RA 3QOXA 4MW7A 3FWZA 4TXJA 1Q0TA 2QMEA 1FFCA 3GLFA 5F5NA 4UKDA 2CJFA 1PL8A 4TSKA 3ZK7A 1UPCA 4L07A 1MPXA 2UZ1B 3UH0A 4HADA 2NTVA 2DY1A 3VRHA 5A5VA 4D25A 4RHXA 1UFQA 1P4SA 3BTUA 5ALMA 2GD2A 5ELMA 1KEEA 1FRQA 4D74A 3L01A 3WP1B 4EX7A 2X3YA 4F56A 1FYXA 4HDNA 2QR3A 4IDCA 4HH3C 2MSLA 4JYBA 4AJ9A 1NI4A 1RYYA 2GGSA 5ILOA 4LF7B 3STTA 2J46A 1M7HA 2Y1GA 3RG2A 2D5BA 3TW8A 4JQZA 3L7OA 4CM1A 3C2QA 1R0ZA 2KYRA 4JNCA 2ZROA 4OIMA 4PXSA 4QPZA 2VJYA 4AS3A 2C5LA 1DKRA 1OC4A 4P32A 5KTPA 5C37A 4C6TB 1YSCA 1Y4SA 2G04A 4R2HA 3DUFA 5PNTA 2QZJA 1VYVA 3DTVA 5C7OO 3RIXA 5HZHA 2AJLI 3A11A 3RUCA 2FX5A 1UODA 2HA2A 3EZ6A 5J9FA 1L4HA 1NBEA 4HNUA 5JW6A 4E3WA 3CPSA 1T2UA 2WMDA 1PL7A 3F46A 4E70A 4HJXA 4M3NA 4LYGA 2W2LD 3HXTA 1JQLB 2AG1A 2YQ5A 3ZK8A 1K6XA 2MMGA 1P4RA 1N2SA 1N5RA 1LW6E 4YMLA 3OJ0A 4OB8A 4BNNA 5J4YA 1X1TA 2Y76A 1JT2A 3FSGA 3OT1B 4IJVA 2GHTA 4WERA 3KKPA 2B8TA 4KQFA 2FFAA 2OBNA 3H42B 3W2HA 4RA6A 3ES9A 5F2KA 5HRCA 2HA3A 2QM3A 4FONA 1OXXK 4KYVA 4OX9B 3PHHA 3ORRA 4IMRA 4FFMA 4OHXA 3I9MA 1L4KA 1JHXA 1PN3A 3RARA 1XTBA 2JH9A 3E6AA 5ALGA 2FR8C 2O20A 2QD2A 4B4VA 1YJXA 1U7OA 3QRWA 1JQDA 2YNMA 4NY1A 1SUDA 3FCYA 2JGAA 4IPTA 1NVMB 4MTLA 5BWOA 1F3LA 2FWJA 5I4BA 5HM8A 4K0RA 5C46F 3BIWA 2CXOA 2AFRA 5HFAA 1TM3E 3D7KA 4E2WA 1UWKA 1NZFA 1W85A 2BP7A 3VR1A 1JR6A 4NSNA 4OJQA 5DZSA 1KA9H 1N32B 1L5RA 1BDIA 3PQ6A 1DKOA 3GFSA 4URXR 1K5DA 3PUVA 3WK6A 2QSUA 2AJTA 3QW2A 4RKRA 1QOQB 5DXJA 1KY2A 3LRXA 1Z35A 3D3WA 4IZOA 1BVYF 2NV2B 2PR2A 4QREA 5EHQA 4R1OA 2OUKA 4Z0HO 3VSEA 4LJ4A 4XIGS 1MJ5A 5IPFA 1QP4A 1SR8A 1PDVA 4I1VA 1H2BA 2PYZA 1VDZA 4KVGA 4MKRA 3ANMA 1ZXLA 1Z6ZA 2P5TB 1EQUA 4L02A 5DI9A 4C0SA 2WM2A 4CF3A 4PC6A 5EQTA 1GVNB 2ZRMA 2WIKA 1UWVA 3OQ6A 5TQ0A 5FLXA 1BRMA 4BEVA 3TZEA 4F8YA 4P7JA 1RAGA 3KQOA 4Z9YA 1RYNA 3SQWA 3DH0A 1EPUA 3EEQA 3BL8A 1Z29A 2QQ0A 3PHGA 1AKRA 4JLSA 3OMXA 5AVYA 2SBTA 3ZZNA 1FYEA 4DJTA 2CXPA 3VR5H 1IJBA 1NJSA 2JFQA 2K2QB 4HWGA 4I3HA 3DC2A 4HB2A 1NVEA 3NH6A 1KGSA 4P84A 1FUUA 3PNVA 3V1MA 3Q41A 1IMOA 1VPVA 2QQGA 4IH9A 2RBEA 2YYZA 5G40A 2A3NA 3VZBA 4BL5A 3WMEA 2ZGVA 3Q85A 1PVOA 2CK3A 2G0TA 1K8XB 5JS7A 2YWRA 1OX5A 2YJTD 4YLGA 1PNQA 2GVNA 1VL1A 2R6AA 4FR5A 1C3OA 3NNNA 4FTWA 1E79A 4GP9A 4HYQA 4UBKA 5C8YA 5JPDA 5IT9A 1B6GA 3BPSA 3KZNA 2YZNA 3E3MA 2Q50A 4PR0A 3TEJA 2G72A 2R6HA 3A6LA 3MS7A 4BLSA 4J7CA 3I6ZA 1HRKA 4G0XA 5CTAA 3CGWA 3RREA 5EIHA 4C04A 3E23A 2JW5A 2MDTA 3VPFA 1TPYA 1P8AA 2OSVA 2HBRA 2VEDA 3IMFA 3NBYC 2IPAB 4NZZA 3KO8A 3GH3A 3WTCA 2YRFA 4PLVA 4FP9A 1YMQA 1CUHA 3R8XA 1SFRA 2WP0A 4JLMA 4E5VA 3C3JA 3TNLA 5B7PA 5F76A 5BWNA 2QE6A 4J0GA 1V9CA 4CEHB 1MRNA 5DM0A 1UP6A 4MI3A 4OQNA 2ZIVB 3QF4B 2FUEA 1U0EA 4QTXA 2OCLA 2VDJA 1QZXA 3EXFA 3I9OA 5DV9A 2Q1TA 2CMFA 5F4BA 5I4IA 4BGEA 2A9PA 4B3HA 2OE2A 4L7QA 1E5LA 3S2YA 2QNBA 3WE7A 3GLUA 4LY9A 3F6PA 1EXNA 1VRCA 4LHZA 1LC3A 3EDMA 2HWUA 5EJ4A 1XDGA 1D7AA 3IJRA 1F51E 1JXQA 1XWWA 4WNIA 3B85A 4G65A 4JI7B 4YRGA 3SYNA 5D7NA 1NW5A 4J07A 3TQOA 2OKGA 2X76A 3G2JA 4H31A 4NG5A 1PEKE 1Z6YA 3EISA 3D0QA 2PX2A 3OCXA 4UVIA 4XGQA 3PQ4A 2P2GA 4M1QA 5DTRA 1SQFA 3T06B 2XMGA 1EXDA 4UHKA 1O0CA 1Y6GA 1M0EA 4N5IX 4DG9A 4MIYA 3HE3A 4MVJI 1HMPA 4HHEA 3AM3A 2VJNA 4MYDA 4OAOA 2OORA 1PT7A 4CM8B 2GFIA 3QFHA 4PC7A 3TOSA 4B2YA 3EVFA 5F12A 4AZ3A 5F4ZA 2DBQA 5IJ0A 4M8KA 2ZJZA 2I6GA 4JWTA 5GGYA 3U6KA 4HVLA 621PA 2ZAGA 3N2ZB 5FTJA 1FMFA 1RWOA 2A9QA 5DYYA 4XWGA 5KCZA 1W4ZA 4M0EA 2WVGA 4GM0A 3FHTA 1YAJA 1YHNA 2P11A 3KG2A 4C08A 2NT4A 4KR6A 1RI2A 2BEVB 2G5PA 2R66A 4ND1A 2FSPA 3CEPB 5FADA 2GJSA 4FB5A 5JWRA 4JYAB 1VMDA 4OHCA 2JLQA 3NGXA 4KQWA 3NGLA 4MRAA 1JXAA 4X5OA 3A36A 4MCJA 1XC7A 2I2XB 3Q6NA 3A4VA 2ZJ6A 3WLLA 1TT7A 4RKYA 4BNGA 2AJBA 1Z2EA 3EGVA 4CMJA 5L45A 3AP3A 2F9LA 1T1IA 1R4ZA 1Z75A 4KE7A 2CJWA 2E1RA 3V00A 2A9FA 1GUZA 1GRVA 5DM2A 3KU4A 3H5TA 2C42A 1E99A 1TM4E 2CW5A 1SCUA 2P5SA 2QRGA 2F59A 1LSUA 5TRTA 4WACA 3KQMA 3K0BA 5L7TA 1LU9A 3OE5A 1LKZA 2VNHA 1VLHA 2YR0A 1SUCA 2YRWA 5KS2A 1L0BA 2GD6A 2VHXA 1C1DB 3C7CB 4ACBA 3Q8LA 5IK2D 3ME5A 4PO1A 3IDSA 3UNXA 2FPPA 5JCOA 4F5DA 1FDOA 4N7JA 4BQEA 1L4NA 1LA2A 2NUAA 2BR3A 2OXRA 1ORIA 2CD7A 2D62A 3N8GA 1R64A 4TYMA 2DFNA 3FXAA 1ZGBA 5DK6A 2AKYA 2QRJA 2V5VA 1RQNA 3EVDA 3PPYA 4LVCA 3Q5DA 4U2EA 2M6LA 5CYOA 4FYKA 5EJ5A 4FFRA 1UAGA 1ISMA 4OFWA 1XZKA 2C2YA 2Q2VA 2I8LA 2RGEA 4ZHQF 1HEYA 2G36A 1BDBA 5GV8A 1Y9AA 3X2SA 3UPTA 2BDEA 2D74A 1WXIA 1VP3A 3TDNA 5BUZA 3HYRA 1S3IA 2WDPA 2WWFA 2CC2A 2YS7A 4YJHA 3RS9A 1YB7A 4RL6A 1SNYA 1YONA 4K8RB 2G9NA 5AVXA 3NYQA 4I3GA 3GZNB 5C8XA 4ETIA 3B1VA 3G02A 2DT8A 3FYSA 5TEVA 4CG0A 1FIUA 2EW1A 4QDJA 1RM0A 2NXEA 2AQ8A 2XUGA 1NTOA 3JSXA 1P5JA 3HBNA 4TL8A 4WK2B 5B2EA 4JJ7A 4Z7NB 3BICA 2DKFA 3H2IA 4YI3A 3WB0A 3SQNA 1P74A 2PSJA 2CMKA 3AYXB 4Y7DA 3LM8A 2HNAA 3FTDA 3CF4G 3H2SA 4MKXA 3AB7A 5FF9A 1KVTA 4LXXA 3W0LB 1RLJA 4QUGA 3W2TA 4OBXA 1LI4A 2FUG6 1BU5A 2IOHA 4LFAB 4ZZ0A 2LKDA 1P17A 3MLBA 4V2UA 2EF0A 2H3HA 3CX4A 4PBSA 5F3RA 4YV1A 2WRZA 4LQ4A 2IZ6A 4KWIA 5AUQA 1MR3F 3R6LA 5B6PA 4B3GA 3CW2A 3AV0B 3ADDA 1KE1A 2OL4A 5B6JA 4ZTUB 1FPMA 4PX2A 4DM4A 3B5IA 4BTVA 4FNGA 1M76A 3QIAA 4FZRA 5BRAA 3FMOB 3RHSA 2I0FA 4J43A 3KWJA 2EJTA 1SKYB 4MRMA 3FWNA 4LZOA 4QNRA 1PYGA 2QMZA 2WU0A 4FHGA 2QA5A 2ZI3A 3CO0S 4LI3X 5DGHA 2P3LA 2GM9A 5H3HA 4N76A 2AN4A 3Q1LA 2H4FA 3M3PA 1E2QA 4DSUA 1MABB 1B14A 1TKCA 2FXIA 2HMWA 2NTEA 3PU6A 3I72A 2QTZA 3AF5A 3H97A 4OB6A 4RLFA 1P3Y1 4Z9FA 5C4GB 3RYHA 3CVWA 2D7JA 3OFJA 5E4TA 2BGGA 2D2FA 1BHQ1 1LBEA 3D8TA 4JLUA 1U31A 3I6BA 3NQ41 4MGHA 5DNAA 4EFLA 4EQZA 5KTSA 1IN1A 1ZA1A 3WQSB 3LQ1A 1XMVA 1L7NA 3HM9A 1JEEA 4TTQA 3WQBA 1L5NA 1OWMA 3UIEA 3KCNA 2VWPA 4RDCA 2EWWA 4BCCA 4GX2A 1JYFA 2IHZA 3I0MA 3L8ZA 3SEZA 5JI3E 5LP6B 5IAAA 2QKYA 5FR2A 3SJAA 4C4ZA 1ZJWA 3QOWA 4MO2A 2RHMA 2OV6A 4H2DA 1QIDA 2H4ZA 4RVGA 1K66A 1T43A 5DF1A 3RAPR 2WWHA 1UFVA 1PQPA 4F1WA 1PLLA 1JH8A 2VBIA 3IQGX 4BFYA 3QKIA 1E7YA 3KQYA 3FF4A 3AEKA 3FJOA 1B8PA 1W52X 1CF2O 4GLOA 3SS8A 2CHEA 1XVTA 1TTPB 2HU8A 1R9NA 2QSYA 3GOHA 2RH9B 3ED1A 3M2TA 1I9CA 1Z37A 4YUWA 2EOAA 1TQ2A 3QXHA 4LGMA 3UB2A 4WI1A 2P35A 8ATCA 3U26A 2AHOA 5JC8A 2QT9A 5K03A 2Q2NA 4BNZA 4O4HB 1KAQA 5J1TB 3ZIUA 5I5EA 4QGBA 1IJFA 1FQJA 3DOFA 2YHIA 1CT9A 1G2OA 1GP2A 2NXJA 4F4CA 2FUG1 1QFYA 5HHTA 4W9NA 5J2TA 3BE4A 3BHNA 4QAQA 1JALA 4EOGA 3QVWA 1I1HA 2IPOA 3RVPA 4DR4B 1GYQA 2VRWA 2VZEA 3E81A 5JAMA 2J08A 2P2SA 4HH4A 4GP7A 2QK4A 2D54A 4ZJPA 3LA6A 4TZTA 1NVFA 1E66A 3HJRA 4RZ2A 1RXYA 3GAZA 5EWJB 3GA0A 1I0LA 5AVJA 2FRVA 2ETXA 2J85A 1R6AA 3DLCA 4B73A 4TWJA 2CF6A 4L2IB 4LVUA 3HDTA 4W7IA 3RRJA 2EGGA 4YROA 1C9KA 2EFHB 4OHBA 1YJ5A 3KUUA 4IDBA 5LA6B 3WX0A 2AOUA 5CJJA 4F5ZA 5KUTA 5EIOA 3B3FA 1P6XA 3CXRA 2YXDA 4FZVA 4HK4A 2YJ3A 4TXMA 1A50B 4V03A 1NP7A 5T41A 3RVRA 5KOHA 2ERYA 2FRDC 4RS4A 1EBFA 3GJ6A 1M7GA 1I3MA 3UOWA 2CL0X 5KQMA 1IJEA 5ICSA 5MFZA 4DLKA 1CRLA 3HA2A 2Q5EA 1AG9A 4R4JA 3WYAA 5L51A 2A78A 3ZY2A 4AY3A 4D9JA 4XZ3A 2JGNA 3F90A 4G0OA 3LSTA 5H81A 1ENYA 4JUFA 3R7NA 2HJRA 2HK9A 2ZB8A 2ZIXA 5DNCA 1CX9B 2B34A 4XX0B 4KO8A 3TZLA 5TQ2B 5HSGA 3QEBZ 4X1YB 4EA7A 1W0JD 1H5NA 4JU8A 2PGNA 1OBOA 1ST2A 4XASA 2H7VA 3MSCA 1H4SA 4EUHA 4M60A 3IIIA 1UPTA 3RFXA 2Y93A 3W7BA 1RBZA 3RS2A 3OIWA 4MXDA 3HYCA 4AICA 3O03A 4MDFA 3AUAA 2G7ZA 4FI3C 1VE5A 2LZ0A 5FRDA 5LXTF 1NE2A 5CM8B 4DARA 2WJGA 4LPKA 5IAJA 4PQYA 1A2KC 3SOZA 4BV2A 4FQ5A 3JQ7B 3W5VA 1WW2A 1KORA 5L4NA 3A1DA 4Q37A 2UZIR 3ZD6A 3OE1A 3R2JA 1O6GA 2C3YA 3R5FA 4BC0A 3L18A 5JXHA 1KQPA 5H80A 1JFSA 1LBQA 1MMFB 1KFBB 4B4KA 1IC6A 4M9XA 4R31A 4Y7CA 4BMVA 4E2ZA 4H1TA 2C2MA 3I30X 3U3DA 1UKYA 1SC9A 1GDDA 3O95A 1JJBA 1CVRA 3SMQA 2W71A 4IDQA 4S1WA 4I8DA 3U3ZA 3JQAB 2G5GX 4ZAFA 3TQFA 1G6HA 4AC9A 4JXXA 3G2OA 1C4XA 3S4YA 3DOEA 1K5PA 4PCVA 1F4VA 5JD3A 3REOA 1AK1A 2FLVA 3V80A 4JROA 4ZI7A 4CQNA 4RHEA 3RC8A 1SU6A 2J7KA 5GZ1A 1ZIXA 4RYLA 4EA6A 4LOIA 4JJZA 4YHBA 4ALMA 1O7JA 1NVXQ 5EJIA 1CWUA 2WD7A 3FYDA 5AW0A 1KZ9A 2ANBA 1FDWA 4JXZA 3ENKA 4JHXA 1A77A 3KHUA 4RETA 3F73A 1ZM3A 1OXSC 3A37A 4ENRA 1YMVA 1B3BA 2B83A 2Q46A 3FWHA 5AXDA 4N03A 4XI9A 3V1YA 4UTVA 2FR8A 1KEVA 3VR3D 2BBSA 1NBMD 1UBMS 1G9XA 3O6VA 2CVQA 5HK9A 3GEIA 4P5PA 2A59A 1Z0UA 2ZI7A 3ZE2B 2HX1A 1DLJA 1SUFA 1EDZA 1XRJA 2X9GA 2QUBA 3AFOA 5GQSA 2ETVA 4E08A 1F7VA 1M6VA 3G1TA 1WP4A 5DSTA 4AF6A 4CCWA 3E1KA 4YAGA 2O06A 3UFXA 1FTQA 2IXAA 1MA3A 3FLMA 3O8DA 1RXUA 1KVSA 2A4MA 1ODLA 4U7GA 2A92A 2OHVA 4JP3A 2BMWA 4XH9B 5HM6A 1XQ6A 2G76A 1UZLA 2IU0A 5MGBA 3QMWA 2IXDA 3IEKA 4G1CA 3MQ2A 1JJ7A 4V24A 1JEAA 2B8WA 2VUTA 2FFHA 4QGFA 1T2NA 1RD4A 3I62A 5ABPA 3IC5A 4C14A 1NLMA 2OAEA 4RFSA 4XB2A 3ITNA 2HLPA 4GOXA 5IVDA 3CSDA 4E21A 4GO1A 1BXRB 2MMCA 3V4LA 1RZUA 2ZJ0A 1T6NA 4BLQA 1MCZA 4XA8A 5IC6A 3ZHTA 1XQWA 4Z7OB 5AHKA 5C3UA 5TGZA 4NF2A 2WYWA 5THXA 1JSRA 1W30A 5ISMA 3MUNA 4LJAA 2GBIA 1X14A 1ZEMA 1FBNA 3QFFA 3QVJA 4QDOA 5CCXA 3GJ7A 1AM4D 4C1NA 2ZPUA 4TWAA 4MVXA 3U1VA 5CGZA 2C2XA 3GDWA 2AB0A 1ZUHA 2GBFA 3QHQA 3HHEA 1FUEA 3OAAA 3FBGA 4NOKA 1IHYA 4OHMA 5E6UB 2BDTA 4RQUA 4LF4B 3TI9A 4HFRA 1XZGA 1V11B 4LF9B 2OCPA 4HDQB 5LDDC 4OSEA 2GRUA 3HDHA 4NV3A 3ZHYA 1EZ1A 1MB9A 1FDVA 3LRPA 4G41A 4RE6A 1DO2A 4EYOA 4Z4IA 1KEUA 3OURA 5DT2A 1WA5A 3LNCA 1NTRA 4M0PA 1LF0A 3JR3A 4JLAA 3EMKA 3K0FB 4HAUA 4X20A 4N8EA 4ARSA 2AWOA 1EVEA 1ZK0A 3EGCA 3KTAA 1WWKA 4F04A 2PKYX 2I6FA 1XK7A 3E9CA 3MTDA 1VL8A 1E0JA 4PEVA 1UMCB 2UAGA 2A67A 4RU1A 5J47A 1ZY2A 3J7AC 4FN5A 3PC7A 1LBSA 1KH2A 3UMFA 1O0BA 1QP7A 4FOSA 3LLSA 1SVIA 4YT2A 2HV9A 3TSWA 2R84A 2LR0A 3OFNA 3K8ZA 3OU2A 3GRVA 3WYDA 4EL5A 2HI0A 2HC9A 1ZQ9A 4HGQA 4HZUA 4I5GA 4R2IA 2H07A 4U7DA 4BU0A 2HMVA 2HOQA 2X9NA 1R6BX 2YV5A 3B5EA 5E0OA 2ZUFA 1E0KA 1KK0A 1U8CB 5BW5A 5BT9A 4FSXA 3NIBA 4KXXA 4PY2A 1THGA 2J87A 1RAEA 1QMPA 2V7VA 4UVEA 4WFKA 2QQEA 1PYDA 4N01A 1BGWA 5TF4A 4BVEA 1XG5A 4E09A 1JKFA 3FY4A 3EQ9A 4MRPA 2QENA 3HI6A 4XLLA 5EUBA 5FXMA 4HAOA 3KVRA 2R68A 4ZV9A 5JAUA 3K8QA 2D0PB 1M1NB 1SBIA 4MUYA 2R1VB 3D6MA 6REQB 1M6HA 1DRVA 2DHDA 4QUHA 1QIHA 3HBAA 1E1QA 5CVUA 4HEHA 4ID3A 2AXQA 3OA0A 4X6XA 2DR3A 5LOVF 4C30A 4JOCA 2P90A 4RK6A 2ZBVA 3LG2A 3N6VA 4BLOA 1HG0A 3DMDA 3KKLA 3SU8A 3H4VA 4TL9A 3HVJA 3KOZA 1G38A 2J31A 1XN4A 1MPTA 2JBHA 3FZNA 1QV7A 4G0YA 4UEQA 5LD2C 3CSUA 3EG9A 4NEHB 3S44A 4RAQA 5F98A 1V7ZA 1UQTA 4KB5A 1R8XA 2ZIUB 2P2ZA 1N6PA 2WHRA 3DMRA 4ZODA 2D4HA 4S12A 5TB5A 1W75A 4M1KA 3THYA 5DRTA 2E89A 2Q6KA 3VHRA 2WKRA 4XWAA 2C7GA 3KDSE 1ZK3A 4WZAB 4ZOAA 2YXBA 4LK3A 4HQOA 1NLYA 1L7RA 2YWCA 4BWFB 2WIBA 2FPGA 1AJEA 3WRYA 5LYJF 2NVUA 3C48A 2XLCA 4OMCA 1VLJA 1HXHA 3A2KA 3RJ5A 1HA3A 1QO0D 1UDXA 4HXYA 4JC0A 2J4FA 4MQFA 3SM3A 3VH4A 4BU1A 2WPDA 4CCAA 1Z5UA 5DP1A 8ABPA 2CE2X 3LK6A 1P7WA 4B7AA 1S9DA 2J9XB 2G88A 2VNAA 3BX1A 3OPYB 5AI8A 3W7AA 4D8VA 3RSLA 1EYZA 3I1JA 3MLAA 4Q24A 3B2QA 4E30A 3DMGA 1LD3A 4IXMA 1PJSA 1HQKA 1NF3A 2R8EA 5IVIA 5BWBA 2G67A 3DCIA 3QX8A 4B6SA 3HG7A 5A7HA 3NHKA 4UHFA 5JY1A 1ZA2A 5F1YA 1X7ZB 1EQ2A 3B3QA 1J9ZA 2PSHA 4YJ2B 3VV3A 2DC1A 1DRWA 1BE1A 1TVEA 4OK3A 2IF2A 2VIIA 4H0CA 1B26A 5EJAA 5FV7A 3SCZA 4ARAA 1KI1A 3LX4A 3R76A 1YULA 5T4FA 3W05A 1KH3A 3RF6A 7MDHA 1ONSA 3M4ZA 1EWTA 3GJ5A 1NMYA 2ZSDA 3DEFA 1SCQA 3LYUA 2O8CA 1RW4A 4R54A 3MTJA 2BYTA 2HA0A 2QRVB 3VJMA 4MPTA 2QUHA 3FNHA 2NSDA 1CLEA 4TT3A 5JJKA 2YW9A 2WJYA 3L4EA 4MRSA 2PKWA 2RD2A 3NKLA 3W8EA 1Z4KA 4FT4A 1NMEA 4P86A 1H4QA 3HKDA 4MPRA 2XB8A 1HTBA 3LGSA 5M3BA 1T3TA 1ZOOA 3JQEA 2DPGA 3ZV5A 2PUFA 3T6KA 2XYHA 3OF3A 4I46A 2DB3A 2IXFA 4K6KA 3T0FA 3ROEA 2VDRB 5I8ZA 1JMVA 2CB9A 4URHA 1Y3BE 2Q28A 4BJHB 2RAFA 1A8UA 2ATCA 3DJYA 1K5GA 2V3VA 1Q11A 4KJZA 4B2LA 3KOYA 3BK1A 2Q5CA 2RB5A 4U63A 2B9VA 3PGLA 3G8BA 1TZBA 2B20A 2J0EA 4K1LA 4UPDA 3WHIA 4MS3A 4MCHA 3TIIA 4DCCA 5JY6A 2ODEA 4QLOA 4ANFA 3LC1O 1XZFA 1Z5VA 5CLGA 3ZVKA 3T1TA 4FJ1A 2NO4A 3N2NA 3AHDA 3W6UA 1XRLA 3FTPA 2GEBA 4Y2XA 1OKKA 3D3JA 3KV1A 1DX4A 1Z73A 2BM0A 1R9JA 2R3SA 2XTNA 5C51B 1U0GA 4QFDA 4BFLA 1OI7A 1DUIA 1UFKA 2MOKA 1MV8A 2P1DA 2JJ2A 5B36A 3ROTA 5IDQA 3CUKA 1RZ3A 2HPZA 2VTBB 1DIAA 2AOTA 2FPKA 2GA9A 3VX3A 2O8BA 3KB2A 4R9UC 2C8JA 2PZMA 3TRIA 3RFFA 5HQ3B 4V1CB 4DWOA 4MVJP 4BZXA 4GX1A 5KSOA 1UK6A 2PQ2A 2VPIA 1SG0A 2MJLA 3PR3A 1ZCJA 2OTCA 3UENA 4JYZA 1COZA 1HYBA 1OOEA 1TQDA 4PYMA 4P81A 4QGSA 3E4DA 1DAPA 2HWKA 2YHUA 3DQQA 5DW0A 3SKVA 4Y6SA 3UAZA 3ABOB 4GMDA 1ZOPA 1UBSB 4CDGA 1IDOA 4RKFA 3J81k 2BJVA 2VHCA 2W6QA 4BQFA 4KN9S 2P6OA 3UQYS 5HKAA 2XDQA 1G3MA 3T3NA 2JFBA 3NIGB 4KQJA 4WHMA 1GUAA 5EIXA 1GGMA 4N47A 3T9FA 1E5XA 2PRSA 4MZXA 1AUVA 4F2GA 2RI6A 1EFTA 3CUEF 2FZ5A 2GCEA 2VDVE 2VH5R 2HRBA 1T5LA 3G88A 3GQBA 3H6GA 1H9BA 2OZEA 3B8HA 3SXJA 4UEWA 4FYYA 3URKA 1KDRA 1NNLA 1WF3A 2IZ1A 3UGQA 2VF5X 1YR3A 1YQWA 3WYBA 3KKKA 4H7EA 4P3NA 2I2DA 4R8MA 3RVMA 2I67A 1S6YA 2BHTA 2R7AA 3K92A 4DDMA 5CBKA 5G1OA 2C3UA 3TNJA 1ODCA 2OCXA 3W9SA 3ZE1B 3M6XA 1SKQA 2YJ5A 4OX9Y 5SY6A 3QEMA 3RG8A 5FOQA 4PAWA 1PCXA 3GX1A 2XQVA 1CB7A 2ZDHA 3W2GA 2DBRA 1M8GA 3V32A 3VDMA 1VYTA 2WK1A 1XZDA 2ZWOA 3AEYA 5LB2A 1PVVA 3O92A 4FOOA 2AG0A 3HXMA 1U0BB 1EWKA 3L41A 2CHVA 3Q2KA 1I4OA 4HB4A 3HUTA 3ISJA 1LH0A 1TW2A 2BMFA 3Q6MA 3AB8A 4JGGA 3WA6A 1D9XA 2DFTA 4AUNA 2Z57A 5JMOA 3QI2A 5ICCA 2IPMA 1NV9A 3INRA 1V5FA 1HYEA 4NRDA 3DLHA 2QR2A 2VF7A 1EZZA 3R7SA 4DBLC 2Z9DA 3TTXA 2CLDX 1KL7A 3FW1A 1KYYA 1R4MA 2OFXA 5L3SB 3OLWA 4D6YA 4S24A 5FL7A 1AGNA 1GQOA 1R0BA 1G60A 1OUMA 1PT8A 3IQWA 4YP5A 1G16A 5TIIA 4PS1A 5FPQA 4KDFA 2JLSA 4MI6A 4YREA 5DYIA 3MGCA 1QFZA 2IU6A 4RM2A 3S2IA 2P2DA 4FGLA 1ZGHA 4KIFA 5BUSA 1C4KA 5M29A 1ZNQO 2YDYA 1WD5A 1A3CA 2AS0A 2X1MA 3BBPA 3I0ZA 3WO0A 4TTTS 3R24A 1ZVJA 3CWZA 5GMOA 4DCOA 1QS0B 3EXEA 4HDAA 4KE6A 4AJOA 4FYWA 4YMTA 1GYRA 3D7LA 2XPCA 3HN7A 3UWOA 4B48A 2ZE5A 3TRDA 4G5XA 4L5IA 4BVGA 2QYHA 1G8FA 1N6LA 3UGTA 2YX1A 1FFWA 1P9NA 3OWOA 5HF6A 3OLQA 2WINI 4A0FA 2ECKA 3VPGA 4CMIA 1EFVA 1E0DA 1G6KA 5HTOA 2OY0A 3PIDA 2B30A 4M7PA 2VYNA 5ESDA 2HA7A 2GSWA 5EJ2A 3ILXA 4MUEA 1TMKA 4HLDA 3WDKA 4HTFB 2HYDA 4Q7MB 2JEYA 1E9VA 2NO5A 3HXKA 5DIFA 5KYVA 3D4BA 3FF1A 1RIFA 3WGTA 1IY1A 3CVUA 5D84A 4LSZA 1G20A 1ZK1A 2WVJA 2IYPA 5EMMA 4HCJA 2VDWA 1Z5OA 3DVRX 2FF7A 1IXYA 2PX6A 4C0KA 1E6WA 1T15A 1T9AA 2FZWA 2I29A 1AQUA 3AUYA 3OC6A 4ESOA 2W6CX 3G23A 5B64A 3OCUA 5C8VA 2FEWB 4IZHA 5LLDA 3FOEC 3L7NA 4B80A 4G24A 2KM1A 1O95C 1IXSB 1WCYA 1VJCA 1BMTA 3EPPA 2RHDA 4MV7A 4YV2A 1L8AA 1G8JA 3AUXA 5KYYA 6ABPA 8MHTA 4HGNA 3KAJA 1CZKA 1T0BA 2ZXFA 3DZDA 2EZTA 2PLFA 1N8NA 5IJAA 1M1YA 3LXXA 4I6JA 1LLUA 4EPYA 4IW3B 5CDUA 4MKHA 4MV9A 1SXJD 4U3JA 4OBBA 3ZWDA 1LB1B 2HN9A 2NACA 2W2KB 2CUTA 3NORA 4LY3A 1UWLA 1NC1A 4FW8A 5G53C 3L1HA 2G40A 3ETJA 1D1QA 5C8DA 4UE3S 1X87A 4TKUB 2HYIC 5ICFA 4DNPA 1AV6A 3PPXA 4OP3A 5B2ZA 1CY1A 3QPCA 1SVNA 1A9PA 2W2MA 1O6FA 1GNTA 1DX9A 1VSTA 4Q7EA 1KYQA 2PX5A 1QPGA 3Q3JB 3E5NA 2XXBA 3EIXA 5CVTA 2GJ4A 1W96A 3DBVO 2J9FA 2VK4A 3ORYA 3LK7A 5A2QA 4JEIA 1F0NA 3RR2A 1NQ5A 1B8VA 1O6ZA 1TXGA 1Z8DA 2FPLA 1ZUNA 3NBUA 3ONWA 4NEQA 3RTBA 5D5QA 2HWWA 2QW8A 3A7EA 1JUDA 4E07A 2YIMA 5HZGA 1FOEB 3LBNA 4P4SB 1OFVA 1T5OA 1RYFA 4LHXA 4MW9A 3FOAA 1Q0HA 1KU0A 2RGBA 1Y5IA 2WMNB 2ZS9A 3MD9A 1PSDA 4AKTA 2IBTA 2AN3A 5F52A 1A97A 2QTHA 1GGEA 4YRIA 4FPXA 4UDXX 1VIAA 2LCQA 3VNRA 5LQDA 1FPQA 2A5GA 4X00A 3W2FA 1P7CA 2PWYA 3NOQA 3QPAA 2G71A 2VDOB 4KKXB 1PR1A 4J7XA 1CJCA 1J2RA 2BFPA 1DIHA 1PK9A 1VJDA 3H8WA 4O4JB 3OOWA 1RM5A 2LTAA 2O7QA 4KNYA 4XD7A 3AM1A 3ACCA 3DNPA 1X7YB 3IO5A 3NI2A 1XT6A 4KW7A 3RTEA 1A88A 4K2HA 3U4QA 2R11A 4RPLA 3O93A 3X1MA 1PV2A 1Y8CA 3PQ2A 1XJ0A 1T5BA 3O82A 3EFOA 1XZQA 1BEEA 3R77A 5B2FA 3N5CA 3KZ1E 1H3EA 4KXFB 3RJ9A 3DMPA 1KRWA 2VAMA 1Y9EA 1O0SA 3JQGA 2J59A 2PT6A 1XD8A 1PNRA 4ARUA 4HV4A 4NCAA 1OBCA 1NF9A 4FWIB 4CT0A 4JV5B 2X9QA 4B5KA 1TK9A 4P8RA 5AKHA 5JALA 1GZ7A 3Q12A 2YWEA 5DM60 4EYKA 5IC4A 4LG1A 4YWJA 4FHZA 2V8OA 3V8PA 4R8KA 2WE7A 1S0UA 1T3SA 1WPXA 1DVRA 1ZVKA 2BR5A 1IWBB 1ULHA 2L0XA 3CRVA 3QX3A 1XZ8A 4K28A 3EGWA 2XMBA 4CKWA 2D1YA 1KI9A 4JJIA 4B81A 3FZYA 3IPAA 1TUBB 1QV6A 4EY7A 1FLAA 1U5CA 8OHMA 4OKIA 1CR6A 1KHTA 1CUYA 3ICVA 3RT9A 4EUEA 2O8EA 1HPLA 2PJZA 5FWYA 2HJ9A 4FOTA 4Y2SA 3L07A 4JI5B 5A6SA 4JMPA 2XGJA 4I5EA 2ZUDA 1ZAYA 3P9CA 2J41A 5FTWA 1C30B 1IB6A 3EQZA 4B47A 1SCBA 3S1AA 2WMOB 1EFPA 2JFHA 2P0YA 5FPTA 1X7GA 4DLWA 2WM3A 2GBCA 4M21A 4AO6A 3IUBA 2LV8A 1OIVA 3UAYA 4BNDB 3H11A 4W9MC 3K70D 2O2YA 3IO3A 1JDBB 2N75A 3EDOA 4HX5A 4YXWD 3R7LA 1YQEA 2OT3B 3EIEA 3QUQA 2A1TR 3MELA 4Q4LA 5AJXA 2G1AA 2VSXA 1MP0A 5L3ZA 4J1QA 3ZHCA 3L8HA 1UJNA 1NP6A 2O8FA 1A9XB 5EE9A 1EUYA 3H9JA 1GGFA 2YCLA 2VQSA 2W2VA 3OUTA 1XTUA 3PEEA 2LKCA 2VN8A 5J5CA 3UN1A 4CT4B 2IEIA 5LZ5A 1PSZA 1U2DA 2A5LA 3N8HA 1QBGA 1U2RA 4KI0A 1G0OA 4Y30A 5FWXB 2XX3A 2ROQA 2XCTB 3ANTA 2GILA 1L4MA 1QXSA 3F7MA 3OM9A 4F45A 5BSKA 1E1MA 3KTOA 4BO9A 1WOMA 3SEAA 3UXEA 4TYPA 1I6LA 1EDOA 3O8OA 2PJUA 2WTNA 5BSGA 2JAUA 2H08A 4Z2AA 4GZLA 3A8TA 1U3DA 5EZYA 4Z54A 4MVJM 4U9IS 1NXSA 3ZNQA 4TVSA 3ISVA 5AW3A 3F6BX 3PTAA 2FOLA 4G07A 3MTIA 3I42A 4DLNA 1E6LA 2RGGA 4FE3A 3WGJA 2P6MA 1EXWA 1FDTA 4O4IB 3LKBA 1K97A 4L95C 4LHWA 1B7GO 1D2EA 1M1UA 2AFIE 2OVBA 1Y3AA 2PV0A 1ZMOA 3QPVA 5G0SA 3T34A 2RONA 3TRHA 1PBNA 3IJ5A 5EKUA 3SC2A 5ALFA 2VZLA 1QE0A 1FFXB 1L5HB 1UFRA 2ZJAA 3I4LA 3KYDB 4U4AA 3UJHA 2W6JD 4Y18A 1DOZA 7REQB 1Y8ZA 1QIIA 3AUFA 1NOIA 3NXKA 4DIUA 3ZWCA 5CNIA 3A70A 3JTEA 4BHTA 1WS6A 1EJBA 1Q19A 4RF2A 5F1OA 2HA5A 5E95A 2PUGA 1KDPA 3G7UA 2PX0A 1Y9ZA 1WTCA 3CLKA 3DKPA 4HZGA 4KGVA 4KLAA 2YY5A 1GL7A 3H3FA 3WGZA 4X62B 3GW8A 3LV8A 1LEHA 3UT5B 4I5DA 4KWTA 1YZTA 4L4SA 1G6Q1 4WASA 1UUFA 1VOTA 3EGDA 1NXOA 5REQA 1PFYA 3AK4A 4NICA 121PA 4J0JA 3G82C 1UM9B 4BE9A 4MAAA 5LQJA 4DV5B 3R44A 4NARA 1G3IA 2ADFA 2RAVA 5B3JA 4BV9A 4CKCA 2YOFA 2PGLA 1KYWA 3LZ6A 1UXJA 3AXSA 3BXHA 2FMXA 4UXJA 5KKCA 4KRGA 3RHTA 1AURA 4CV0A 3P19A 2BVNA 3CVVA 5B58C 4FT2A 4L28A 1C3XA 5IUKC 3DMFA 1GZHB 1RLUA 3V2HA 1C9EA 3AKZA 1RFLA 5KSWB 1SUEA 5CLIA 4HVAA 4B6PA 4AP6A 1TRHA 4LTMA 3Q7PA 4HYTA 2A0KA 3BT7A 4NONA 4ML3A 2VA8A 3V4FA 1KNQA 4CF4A 1L5SA 1QE3A 2ZG6A 4IVQA 4QNMA 3T9AA 3IUQA 4I55B 5KYTA 5CA0B 3PA6A 4HNGA 4BZWA 4TS1A 1W35A 5JHGB 2JFOA 4URWR 3B60A 3QQ5A 1NIJA 2CUKA 4QQKA 3AJAA 3PE6A 3S7TA 2P4SA 4ZDKA