4DB2A

Mss116p dead-box helicase domain 2 bound to an rna duplex
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
256
structure length
256
Chain Sequence
SIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKDLPILEFHGKITQNKRTSLVKRFKKDESGILVCTDVGARGMDFPNVHEVLQIGVPSELANYIHRIGRTARSGKEGSSVLFICKDELPFVRELEDAKNIVIAKQEKYEPSEEIKSEVLEAVTEEPEDISDIVISLISSYRSCIKEYRFSERRILPEIASTYGVLLNDPQLKIPVSRRFLDKLGLSRSPIGKAMFEIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for RNA-duplex recognition and unwinding by the DEAD-box helicase Mss116p.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein/rna
molecule keywords ATP-dependent RNA helicase MSS116, mitochondrial
total genus 85
structure length 256
sequence length 256
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2012-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4db2A00
4LY6A 3L8YA 2CEAA 4B3XA 2ZI3A 1GNQA 3ADBA 1DE0A 1U0LA 3ZS9A 1CJVC 3LRPA 2BBTA 2IXGA 5F9FA 2VPPA 2A7QA 3QI2A 3LX8A 1JECA 1NVVQ 1U8AA 4KCGA 5C4GB 1E9SA 1TNDA 3IEVA 1XP8A 5M04A 2B8TA 3WRXC 2F1RA 1F2UB 1NN1A 2GESA 2WJVA 4MYHA 1VYVA 1CRQA 3BS4A 821PA 1G5RA 1J90A 4G3XA 4BGDA 4NKRA 3Q9LA 4TTRA 2AL7A 3AUXA 3PITA 1K5GA 3QIAA 3U3JA 1SQ5A 3SS8A 1E0JA 5FR2A 2JEOA 4WXRA 2BJVA 1SKYB 1XTQA 4C2UA 2ATVA 3LQQA 2B8WA 3P26A 2FSIA 4XWAA 4LBVA 2W6IA 4ESVA 1OB2A 5AJXA 3BB4A 2D4HA 1ZP6A 2ZM5A 1P60A 2ZS8A 1Q1ZA 2RB4A 1ZM4A 2JGNA 4NU0A 4E09A 2OZEA 1QHYA 3IPYA 5L8VA 3QVVA 4A0RA 1SXJA 2AFHE 1KMHB 4JKYA 4K81B 3BORA 3EWSA 3TIFA 2PX0A 2N42A 1XX6A 2R62A 2WJGA 2RCNA 5LPNA 4TMWA 1E2MA 1E2QA 2ZRIA 3QKUA 1FL9A 4CVNA 1VG0B 1LF0A 4Q1AA 2G3YA 2J59A 2ZE8A 5JLJA 1W1WA 2I1QA 1GG2A 1KO4A 2H92A 2ZRLA 5TV2A 4AKHA 3O47A 3OIWA 1X8KA 4P4SA 3REGA 1SVOA 1E3MA 5KNDA 3X1ZA 2CHGA 5JRJA 2IS2A 1NF3A 3AVXA 3B9PA 3BGWA 3L43A 3NKVA 1T8UA 4NCKA 1VIAA 4A1FA 3VAAA 4V0NA 1XBTA 3TUZC 1HV8A 1VG1A 1XEWX 1RW4A 5ELXA 3TRFA 5FPKA 4DDTA 1KMHA 4HUTA 4KVGA 1HUQA 4JJZA 4JVSB 1CULC 3X1DA 3RS7A 4GRAA 4IOLA 4Q4HB 2ZI7A 2NO1A 4CEJB 4YMTA 2DBYA 3WYAA 5AUNB 3ZD7A 1SVLA 4Q1BA 5TMPA 3KFXA 4TT3D 1Z6AA 4P4TA 1F3OA 2DR3A 3SJCA 5G3YA 2RGBA 3DZ8A 1N6OA 1TQ6A 2G0TA 5KO2A 3QF4B 1ZNYA 1YVDA 1H65A 1P3JA 1ELOA 2FX3A 4JYCA 3FWYA 4G5GA 5CIQA 2XGJA 4OHZA 3U3OA 3K0SA 4A92A 1OHHA 3CB4A 3G82C 1LS6A 1RRGA 4P31A 4IXMA 3U3MA 4DRZA 3UMFA 3LVQE 1W7AA 2OCBA 1EFRD 1VCNA 2AXPA 4KVAA 2OBMA 4QGHA 3WHLA 3A4LA 4LYFA 2ZRFA 4B48A 2G6BA 3PXGA 1W36C 2QQ0A 4DUGA 4AKGA 3PG5A 1YU9A 5EZ5A 1YE8A 2RHMA 3FGNA 4OQMA 4LOAA 5JMTA 1XU4A 4KFRA 2FPMA 4V0OA 5JJIA 3AQ4A 1S1MA 4P32A 5GJVC 5J47A 1ESNA 2BM0A 4HAVA 2FNAA 1FQJA 1N0WA 2ZJAA 3QSYA 5AUQA 1CRPA 1CBUA 4OHWA 3SQXA 4XD7D 1EFUA 2MSDB 3SNHA 4RZ3A 4EPXA 1KY2A 2J46A 1CJKC 4D4JA 4H1UA 4Q1EA 1J70A 2G0NA 2C77A 1E98A 3GLIE 4M1SA 1ZU5A 2ATXA 2O0JA 3P1JA 1U8ZA 1KAGA 2Z0MA 1XEXB 1KI6A 3MG9A 3M4YA 4NH0A 1MO5A 2ZUCA 5EP3A 5EXXA 2IYLD 2ZEJA 1YR7A 3ADDA 4BFTA 4OQXA 3AEZA 1RC8A 3MRSA 4A0GA 4AYWA 2E87A 1IN4A 1ZUNB 4TL9A 3K70D 3AP1A 1XD9A 2ZJYA 1XPOA 1Z63A 1Z5ZA 3HU2A 3AB3A 3DMNA 4MYTA 4HB3A 1ZNWA 1LW7A 4RKEA 3CPHA 2ONJA 1E0KA 4UNQA 1TEXA 3K1JA 4I1OA 4G5OA 3CR7A 3TK1A 3QNUA 521PA 3MAAC 3A1VA 4MKHA 4JKIA 5CK4A 4TYNA 3THYB 3QKRA 2PCJA 1NIJA 2GTPA 2RGEA 3WMGA 2CCGA 3KFVA 3W6OA 4DDVA 2YWFA 4QOSA 2YC4C 3DVLA 3LBNA 4XJXA 1UKEA 2EWVA 5DE3A 4US0R 4URVR 1IHUA 4XSGA 2JJ1D 3QEOA 3ZZTA 2H17A 4XIGS 3OFND 1E79D 1MO6A 2XJ4A 4YXWD 3H2YA 4QHSA 1OKKA 1G3MA 2JIZA 3OIYA 4PPGA 2NGRA 5TARA 3SHWA 1QHHB 2DPXA 3PVSA 4XVUA 1E2EA 2ONKA 2XAUA 3DHWC 1RKBA 4BFSA 3MD0A 4NDZA 2ZVPX 1N0UA 4OJKA 1P9RA 3SN6A 4HATA 4BRWA 5KSYA 5IRCD 2OSBA 2ZYUX 3PR1A 4BFWA 5L3RA 5FOXA 1YJ5A 3FMIA 3E1SA 3U6BA 1EX6A 2P65A 4PC3A 1R2QA 4DEYA 2ZJ2A 2ZRNA 2RGXA 2NPIA 4DLZA 1YRBA 3QBVA 1DTSA 2A5FA 3LW8A 1L4UA 4WW0A 2RGNC 3B7GA 1Q1QA 2XNDA 5DI3A 5CDFA 2V4ZA 4PPFA 4JLVA 1T0JB 1W49A 2OAQ1 2GETA 2QNRA 2Z43A 3QQ5A 1GTVA 4M8NE 3OEEA 4PX9A 5DHFA 4BE7B 1P62B 2ZU0C 2CK3A 3WNBA 2J5XA 2WJIA 4Q47A 4JVMA 1VHLA 2CCKA 4MKFA 1WB9A 4CT5A 2JJ1A 3UK6A 2IHYA 3OHMA 1W44A 4FMBB 2A9KA 4DCVA 5TDHA 1N5LA 1U0HC 4A0FA 2PJZA 5HZKA 1ANKA 1YKSA 3U7HB 4HSEA 4OQLA 3KL4A 1DAKA 4N1AA 1OH8A 2WM9B 4CGZA 4AI6A 3ZS8A 3EIEA 3EZ2A 3AF0A 2JLVA 1GL9B 3I72A 4D25A 1G21E 3F5FA 1G8HA 1X3SA 3K0CC 4DCNA 3A1SA 1AKYA 4QKQA 4KFTA 1Z07A 2OT3B 2JLXA 4WBSA 1FW6A 1UEJA 2DWOA 2ORVA 2XOKD 1E9AA 1UADA 1Z0DA 2PZFA 3P4YA 4JVLA 2GXUA 3NVAA 1IN7A 4PTLA 5G41A 1N25A 5F3WB 4DLRA 1UJ2A 1WDTA 2GHIA 4TLBA 5DISB 2WIAA 3DOEA 3N2IA 3RC8A 2AWOA 3VR3A 5AR1A 5CJ2A 2CXXA 4R7ZA 2BM1A 2AN9A 2FE4A 3QG5A 1LNZA 2ZJOA 1JQJC 2XB4A 3AKYA 4M21A 1Q57A 2OBNA 3EZ6A 4M9ZA 4DLYA 5B64A 1Z29A 1Y3AA 4EIWA 5CLQA 1HEIA 2C78A 4LBZA 4DLWA 2F1JA 1E9DA 4JL6A 3QXCA 3D6TB 1DEKA 3WMEA 1A82A 1NVXQ 1CS4C 4Q4HA 5C4MA 2CLDX 1RRCA 3E70C 1KJZA 2WWWA 1ZUIA 3KTAA 2A5GA 2JDID 2IUSA 2FEMA 3IIJA 2CLSA 2WKPA 3ZIAA 3ASYA 5EE1A 3W9YA 4XWOA 3W5JA 5GJCA 2GDJA 1KK0A 1NVWQ 2RGDA 3PEVA 4LZZA 5DO9A 4Z1MA 1EX7A 1UKVY 4OJQA 4N0DA 1OIWA 421PA 1OXSC 1ZVQA 4H9GA 1G7CA 1XMIA 1Z2CA 2CHQA 2XITA 1SXJC 2QPOA 3EC1A 4P4SB 5FTJA 1U9IA 2QENA 4GNKA 3TR0A 2F43B 2NZ8A 3M6AA 4KBFA 1G8FA 1YR6A 4Z51A 1DELA 3VMFA 1KI3A 1ZNZA 1NBME 3K9HA 2ZJ5A 4Q1FA 3MWJA 2IEZA 4TSFA 4FMDB 3NEYA 1QDEA 1VDZA 5DLQC 4OHYA 2GXQA 3DDCA 3KKQA 4GOXA 3U61B 4UKDA 3RRMA 1A2BA 1E1QD 4PAOA 2ZITA 1J7KA 2ANCA 4QNMA 3KDSE 1DOAA 2YWEA 5EXPA 1C9KA 3QPVA 3KQUA 3ZZUA 3RDPA 5C18A 4D4MA 4L9WA 2WVJA 4IVQA 5FOSA 2VSOA 5EE0A 3LA6A 1D9XA 1NJFA 1XD8A 4JLBA 4EPWA 3EPJA 4TMTA 3OAAA 2F43A 1OKKD 5FBRB 2IL1A 3RAPR 4CEHB 2NG1A 3GMTA 3K53A 4A8JA 1KDPA 2CJWB 2IBMA 1MRSA 2PEYA 5HKKA 1DBSA 1KDTA 3IHWA 2FU5C 3TW8B 4PPQA 1NLYA 2BBOA 3SBEA 2ZJBA 3HP1A 3NG1A 3GPLA 4XD7A 3BFKA 1N6IA 3Q85A 4FD2A 4XOIA 4TYQA 2ZR9A 1R5NA 4MKIA 1YZLA 3FFAA 3AUYA 1EG7A 1Z6XA 2QSYA 4B76A 4RD1A 2WMNB 3Q7QA 2ZI4A 5TY0A 4DT1A 4MA4A 4LJYA 2PEZA 4Y0AA 4NHOA 4UNPA 2E1RA 1KJYA 3AVVA 2EFDB 4E07A 3IUYA 2GJ8A 3MMPA 2V6IA 5CIWA 1T5LA 1T5IA 5AJVB 2XJ9A 2JAQA 5SZKB 1PUIA 2GCOB 2RMKA 2QTFA 2GJAA 4R71A 1UKYA 1WRBA 5JI2E 3KQNA 1OH6A 1HE8B 1GP2A 3ICEA 4NCJA 3TNFA 2ZSDA 4FCVA 4D4LA 1KZGB 1Q3TA 2QZ4A 4FXPA 2VSXA 1Z22A 4DC9A 1TQ4A 4W7SA 1R6BX 4GI7A 1JB1A 1G8PA 1W36D 5F9HA 5E7IA 1TQDA 4LBWA 2OM2A 1KNXA 3T61A 4BFUA 1GFIA 4A6PA 5BYJA 4IFEA 4S2EA 2EFEB 2AFIE 4WA7A 3EWAA 4GL2A 2VP5A 1G291 3THOA 3R8FA 3AH8A 3GLHB 3OIVA 3CF6R 2L0XA 4I1UA 2J7PA 4GOKA 2ZYTX 1E1RA 5FTMA 5DN6A 2QSZA 4HAUA 2PJRA 2HF9A 2YOHA 4M1WA 4ZDJA 3KKOA 2B7BA 1XMVA 2X19A 5A5GA 5KPDA 2MMGA 4ERNA 1EXMA 121PA 3BH7A 3E2IA 3JVVA 4LPSA 1HURA 2ZIAA 4D0LB 2PX3A 1A7JA 4MRNA 2VO1A 2F1IA 3ZVRA 1KMQA 4CEIA 1K8RA 1EK0A 3QOFA 4LC1A 3GP8A 4TN1A 4JLKA 1MKYA 1ETUA 2QT0A 3PUXA 3KJHA 3A4NA 4B35A 4Q4AB 2GCPA 2ZRAA 3QF7A 2KWIA 4KYIB 1H8HD 1DAHA 3GLFE 1NN5A 2J3EA 4OQFA 2XOKA 1U8YA 1SULA 5FOTA 1XJ0A 2ODBA 4ZDWA 3CNNA 3O8BA 3LD9A 2GCOA 2X8AA 5GVSA 4JLMA 2XEXA 4O2LA 3UMSA 5L3QA 1NG9A 3LLUA 1E2FA 2J7KA 5E4FA 4BFZA 3VU9A 4BZXA 2NOAA 3THXA 4WZ6A 1Z6GA 2IYUA 4WZBE 3M0EA 1KIMA 4O0MA 4QM6A 1C4OA 2NO6A 1M1YE 3B9QA 4IDOA 5JRZA 2REXB 4KYUA 3ZDQA 1YHNA 4DSOA 2Z83A 3K0FB 4TQUS 4YMVA 2V54A 1CKEA 1DADA 1H8EA 5AJYA 3RYTC 1RRFA 3FKSD 2P0EA 4TYPA 2FH5B 4BLPA 2D2EA 4Q7MB 4Q4JB 4RD6A 1RPZA 1XJQA 3EPHA 1KGDA 1OH5A 2Z6VA 4ZDKA 1KYIA 5C2JB 3TR5A 3FDIA 3BERA 2IA5A 2XB2A 3L8ZA 3PEYA 5IK2A 1YZUA 1TQ2A 2OO7A 2FPKA 1FPMA 2CMKA 4HDCA 3A6PC 1CR4A 3TVDA 3FHOA 2VP9A 3MWKA 3VR2A 1BH2A 4HLCA 4B73A 1L4YA 2BMDA 1F2TB 1F6BA 2GJKA 2PT5A 5EP1A 4RVCA 3SHFA 3U5ZB 3UKDA 4R98A 5FPSA 1E9RA 3W8NA 2FSFA 5A4JA 3TQCA 2BIFA 2UKDA 5DH9A 1RYHA 1OF1A 1KAOA 1E2IA 2RGCA 1XTKA 3WXMA 5EE3A 3W3AA 4HUQA 1E94E 3CWQA 2HJGA 2QAGC 3CKLA 4Q5IA 2ZSFA 1KI2A 3B1ZA 3AF4A 5CM8B 5DI9A 4M9QA 3CM0A 4HB0A 4KJZA 4RCYA 1SVIA 4IFBA 3CF0A 3P27A 2GEUA 2YKGA 1YQTA 2NIPA 5FL7A 1CIPA 1R10A 5HTKA 4MRSA 4QG7A 4BEJA 2FMXA 5HE8A 1MV5A 1ZD8A 3OESA 4QJ3A 4JLNA 2Q0HA 1NNEA 3QUSA 3WNDA 1C1YA 3VFDA 3NBXX 4YDHB 4EJSC 3X1YA 1E4VA 3F8TA 3PEWA 3L0PA 3VR6A 5CITA 4EQ6B 4PQRA 3GFOA 1KK3A 1NVUQ 4LV6A 5K8UA 5FBLB 4HZUB 2RAPA 2G77B 2PZEA 2ZTSA 1QG4A 1SHZA 1LFDB 1QRAA 3SFVA 3KKNA 3K09C 4JJKA 3Q8XB 2C98A 5HCIA 3QENA 2FA9A 1G3RA 2OILA 4L5BA 3WYGA 5HZHA 5FOWA 1AZSC 2PBRA 3CX6A 2J0UA 2Y8EA 1CJMA 1UDXA 2KI5A 1OXXK 5BN4A 1LTQA 1DPFA 3U60B 4QGFA 4RKFA 2DWQA 2CDNA 2HJVA 4UJ3A 2WOJA 5HCNA 1TX4B 1Z0KA 1UAAA 4D80A 3VKGA 1QZXA 2WBLC 1YZTA 1TPZA 4CW7A 1OYWA 2P6NA 3SBDA 2O52A 3AVUA 2R6GA 2O5VA 1WF3A 2ZYVX 1FP6A 2IYRA 5GJWC 1FTSA 1WP9A 1IONA 3Q5DA 3GJ6A 1ZIPA 4D0NA 1Z28A 5AWFC 2IWRA 2Q6TA 1E1RD 1XWIA 3O8RA 1DAEA 1DAMA 1XTIA 3IEUA 4F4JA 2CL6X 5TXGA 4ZI3A 4ESHA 2VHTA 2IYZA 4DB2A 2BKEA 2BEKA 4B6FA 1N5IA 3ADKA 2R6FA 3U7FB 1M74A 3U7EB 3FMOB 2K5UA 4IEEA 4HDOB 4BLRA 1K6MA 3O8CA 4TMZA 2HDNB 1NMXA 5CB8A 1B0UA 1XTSA 2ERXA 4N3NA 4XVRA 4LI0A 4B34A 3SJZA 3GFPA 3K70B 1G8GA 4IDHA 4NYMR 1IXSB 2FG5A 2WWHA 5DIFA 1T0HB 4X8MA 2A30A 4MYCA 4EPVA 4C7OA 4PFSA 4LCBA 4CEIB 2W6ID 3WMFA 2IUTA 3ZGXA 1BYUA 1N6KA 3EA0A 1SVKA 2QL6A 3QPWA 2ZE7A 3AKEA 1G3QA 1KSJA 5JZVA 1DAFA 3ASZA 1YR9A 1R0WA 3JZMA 4A82A 4MDEA 1DS6A 1XJCA 4P33A 4TZ0A 4LWZA 2CL7X 1XTJA 3PFIA 1SXJD 3B1WA 1TF5A 2HYDA 5JSZA 2FSGA 1TUEA 3UG6A 5FUXA 2RGNA 4YC7A 1NSTA 1XMJA 5FTNA 4LYAA 4U5XA 1QVAA 2IYSA 1AKEA 1OT3A 2GRJA 1OFHA 3S1AA 3NBZC 3O8DA 2O0KA 1BIFA 4RD2A 3EG5A 3FHCB 3BAFA 4KV9A 1COWA 4N0EA 4C9BA 3QEJA 5DYGA 3ZD6A 3R20A 5TB5A 3RS2A 4O2RA 2O8DB 3B6EA 4CIDA 621PA 5KDLA 1II0A 1IN5A 2ANBA 1W2HA 2BCJQ 2BOVA 2ZRCA 4FCWA 2IWHA 4DUGD 1ODFA 3D8BA 3PEUA 3WBJA 1F60A 2DFLA 1BS1A 1FNNA 2N46A 3C15C 3SYLA 2O8CB 3A1WA 3KX2A 4TMKA 2ZRKA 1KSHA 2CE7A 4JT4A 3ZVNA 4DVGA 1XXHB 2D7DA 4PQYA 1Z3IX 3MJHA 3VR5A 2Q3FA 2XZPA 2PLRA 2JLSA 3H4MA 1GM5A 2IS4A 1ZC3A 4RD3A 2IYWA 1D5CA 3W34A 3AF1A 4ZKDA 2OFWA 5L3SB 4PAMA 4NYIR 1ZUHA 3FKSA 2OAP1 3I3SR 4BASA 2EFGA 2JLQA 1UF9A 2WJYA 1KKLA 4B47A 1U99A 3I1FA 1A1VA 1P2VA 1QVRA 1Z6YA 2J9RA 3VU9B 2VYFA 4F91B 5JECA 4ZV4A 1PLJA 1T6NA 2BVNA 2W2TA 5L3VA 3KQLA 1YR8A 1J8YF 5JS8A 2DFNA 1A2KC 2CBZA 2JJ8A 2V9PA 2F7SA 1NLFA 4TL8A 5CDFE 1ZW6A 5DYIA 3N70A 1WXQA 2OG2A 3BBPA 2QE7D 4CT4B 1IAQA 3EPKA 1JNYA 2W6JD 4M4SA 4RCZA 5B2ZA 1X86B 2OESA 3IIMA 4L16A 1NKTA 3SYKA 2OCAA 1U0JA 3T12A 3P4XA 1Q12A 1OHHD 1FOEB 2WWIA 5P21A 3ZVMA 1PV4A 1G9XA 3QKTA 4KITB 4AURA 4M22A 1ZM2A 3F3YA 1ZD1A 1OH7A 1QHSA 5A0FA 2W0MA 3U2QA 2CL0X 1XZQA 2I1VB 3IO3A 4LPKA 4JMPA 1W5TA 1BMFD 5FI0B 4AG6A 4GBMA 1TMKA 3GJ3A 3MUFA 2ECKA 3OIUA 5FPYA 1ZINA 3GEIA 4BUJA 3UPUA 2QGZA 3IILA 4KSBA 2C2HA 2JLYA 1E6CA 1OFIA 3EIQA 3GJXC 3GCGA 4B3GA 1E4YA 2LWIA 1XCMA 3LXXA 4K8OA 1I2DA 3I61A 2HCJB 2BBWA 3ND8A 3QXJA 3SOPA 3TBKA 5KNBA 221PA 1KI9A 4ZCMA 4RZUA 3DKVA 2D74A 3ECCA 2REOA 1W47A 4KAXA 5L3SA 3KJEA 3M1IA 4TMVA 3T15A 3GLIA 1AS2A 4XTCS 3BE4A 3GFTA 1TADA 5EP4A 1R0YA 4V03A 2LCFA 1G5PA 1Q1BA 2KBEA 4Q1DA 4XH9B 2WWGA 1OPXA 1EFRA 4MGIR 4PSKA 3G5UA 2XSZD 1NY5A 2ZE6A 4RFSA 4B2LA 1CJUC 1EWRA 1AN0A 4NPHA 1JR3D 4NYJR 1CR2A 1O3YA 4FIDA 3EXAA 1E99A 2GBLA 2ZYWX 3V00A 2CK3D 2GK6A 4Q9KA 1T4GA 4P4UA 1ZC4A 4DSNA 4ASUA 3NEJA 3GJ4A 3H86A 3VKHA 1G3UA 4QFMA 3P32A 1GKIA 3RSOA 2H1LA 1VHTA 3GJ0A 5E7MA 3E5HA 4MGYR 3VNUA 3ETLA 3AVYA 2JLZA 3SU8A 2NO9A 1W4BA 1WBBA 4Z8YA 1Y63A 1E2HA 3CX7A 4TLEA 3TQFA 1J99A 4EFNA 5JHGB 1II9A 3EPLA 4L4UA 1ZM7A 1W0KA 2VLIA 4MRRA 2QTVB 2C9CA 5KDOA 2WJHA 1IJFA 2A5DA 1Q3HA 1W0JA 2X2EA 4LRWA 1YZGA 2R6DA 3OZXA 3TMKA 4YQFA 1CJTC 1VMAA 5FBQB 1JAIA 3UMRA 3PUYA 1AIPA 2AWNA 3RANA 2IF2A 2LKCA 2P2LA 1RJ9B 1ZNXA 2ODEA 2NZJA 3QPUA 1W46A 1RRPA 1YRAA 1XEWY 4OKSA 4RD4A 5AUPB 3RVBA 2QAJA 2W0SA 2XSZA 2ZS7A 3B13B 4Q03A 2G9NA 4NYIQ 2F55A 3GJ7A 4ARZB 1R5OA 2V1XA 3B1XA 3KXKA 1NSFA 1FUKA 2QAGB 3FFBA 5FTLA 4AY2A 1E9BA 2YC2C 1I4LD 1NL3A 2VHJA 1S3SA 4U00A 4W5HA 5BXQC 3CH4B 3WYFA 4JLAA 1PZNA 2JASA 1ZCAA 1LY1A 1F48A 4RD0A 4NONA 4B32A 3B85A 3IBYA 1JJ7A 1SXJE 1TAGA 4IDPA 3RS4A 3DKPA 3IIKA 1ZRHA 4LYHA 1T9HA 1OB5A 4MRPA 2HF8A 2UZIR 2F6RA 1J8MF 1NBMD 5E95A 4F7WA 2D7CA 4POAA 3X2SA 4NBSA 1JALA 2VRWA 1SKYE 1G18A 3H84A 4HI0E 3LWNA 4KFSA 4LUCA 3T1OA 4C0BA 2I4IA 4UNNA 2JCSA 1KZ7B 4RY2A 1ZAKA 4LJAA 1D2NA 2WTUA 5EZ6B 4ZO4A 1SKQA 4M1MA 4QBIA 2XTNA 1Q22A 2SHKA 3NBYC 1KDRA 1V43A 4FI3C 4GFDA 4Y0VA 4B44A 3MWLA 3VNVA 1D6JA 1OJLA 1U81A 3FB4A 5ANRB 2VHQA 4HAYA 2ZJZA 3U7GA 2OFOA 4IOKA 2ZSEA 1GKYA 2B6HA 2VF7A 1QBKC 1VYTA 3B5JA 4HUQB 4LJ6A 4DLXA 1QHHA 2ZI5A 5DSZA 4DCTA 1MABB 3LVRE 1N6NA 3RRNA 4CYMA 2Z4SA 1PLLA 1KO1A 5KOYA 1M7GA 3LBIA 3CBQA 4DEXA 3K8YA 4IHQA 1AGPA 1W4AA 2H57A 3TUJC 2DWPA 2DY1A 1UDWA 4LHYA 3NC1C 1VG9B 2IYQA 4D2IA 2HV8A 5HR5A 1TEVA 4Q7KA 3R8CA 5EXTA 2IXFA 1L7VC 4CEJA 3GLGA 2CE2X 4O25A 2VL7A 2IYTA 4TTQA 1S9DA 1EFHA 1JPNA 2ZRDA 1IN6A 4KXFB 3T1TA 5DI3B 2VBCA 3ZH9B 3AKCA 2FFHA 3QF4A 4GZMA 4PR0A 1QHGA 1GAJA 1EWQA 2G1KA 4OK6A 3UANA 1WBDA 2QBYB 4GDFA 1GL6A 1U94A 1NP6A 1HY3A 2C8VA 2FZ4A 2H18A 4OI2A 4A4DA 5DN6D 2GF0A 2VF8A 4DBLC 1Z0FA 2ZUDA 4EPTA 4D26A 8OHMA 4C0KA 1II8A 2P5SA 2FPLA 2GJ9A 3HU3A 2F1HA 2ZREA 2WSSD 1A5TA 4MUBA 1AZTA 4ON9A 3WP1B 1HE1C 1NVVR 4LHZA 2FSHA 1KJWA 2VP2A 5KDDA 2AR7A 2QPAA 3I92A 3RWOA 1S1CA 2C04A 1JR3E 1CXZA 4BRUA 5FTKA 5D3MB 4QJ5A 2B7CA 2PCLA 3QVUA 3A58B 4EFMA 3UIEA 5LD2C 1IOZA 2GZAA 3CRQA 3AGQA 3T5GA 1K5DA 1FX0B 1G4AE 4I4LA 3TJZA 3I5XA 2OUKA 1YZNA 2KJQA 3TAUA 1TL7C 1NIPA 2GJSA 4C30A 4DLVA 5FOUA 1XRJA 4EJSB 5HKKD 3KB2A 4OI1A 1MT0A 2BDTA 3CRRA 5CK5A 2QMEA 2CLCX 4G1UC 4A36A 3A1UA 4DDUA 1KDOA 4IRUB 3W6NA 2Q3HA 1GDDA 1A4RA 4V0LA 1VCMA 4XWKA 2IYVA 2P3SA 5J4KA 5H8WA 3UATA 3NDPA 3SZRA 1D8TA 2ZRPA 1UBEA 1XB2A 4C0LA 5JJLA 4YDSA 3A1TA 5B58C 2YOGA 1XD2B 2H7VA 2J41A 4US1R 2PLFA 2EWWA 3MCAA 4PAQA 2O0HA 4KLNA 2MSEB 1F5NA 3VR1A 4Q00A 1UBCA 1VECA 5FUVA 2V55B 2ZROA 2QPTA 4LK2A 4C0AC 4M1YA 2QROA 3R7WA 2WICA 1PLKA 4NCIA 3A37A 4WOPA 1QHXA 1LVGA 3I32A 3TUIC 2DYKA 2WWFA 2ZETA 1S96A 2Z4RA 3TVTA 2VHUA 1U98A 4URWR 5JWOA 1GNRA 5B57C 3AP2A 4PSVA 1D9ZA 4M9SA 4D4KA 4TQ9A 1W2GA 3T34A 3THYA 3OEHD 4JLDA 1X8JA 4B33A 2W83A 4MDFA 2EVWX 4AWXA 3HDTA 2ZRHA 4YMSA 1E32A 3ND9A 1BYIA 4GT1A 4DDWA 3EA5A 4MRVA 4DSUA 3AF3A 2OCYC 5GVRA 1CEEA 1Z6TA 1Z47A 2F9LA 2WPDD 3CH5A 2H16A 2ZXUA 1HT2E 2PMKA 2BKUA 2GZDA 3KJIA 3SI7A 5JJKA 4GOJA 2BJWA 4QBGB 4ASUD 2HXYA 1IN8A 4RFVA 2NO7A 2C95A 4RZXA 3NTUA 2J0QA 2QQEA 2FV8A 3R9WA 1G7TA 5JHHB 2IT1A 3R9XA 4WVFA 3TH5A 2FFAA 3FHTA 1I4DD 1JXMA 5AJWA 4OHVA 2BMJA 4FWIB 5CYPA 4ARZA 2JJ2A 1QHNA 4OQNA 5BYKA 5K8IA 2D62A 2WSMA 1UFQA 4UXHA 1PVOA 3AF2A 4OI0A 1BO6A 3K9NA 2GVDC 3LW7A 2I3BA 1R8SA 2HEIA 4JL8A 1OW3B 4ZKEA 3DPUA 5FOVA 4LC0A 4UXJA 3DM5A 5FBWB 2C99A 2HT6A 1IY0A 2NMVA 2WWXA 1P2UA 2AD1A 1P2TA 3A8TA 5CJPA 4H1VA 1FP7A 1UKZA 1Z06A 3GQBA 5EUMA 3GD7A 5G40A 4Z8XA 1JEDA 4K46A 4HZIA 4D6PA 4ZIRB 3I5YA 4BECA 3THWA 4JLJA 1E2LA 3FMPB 4C3ZA 1W4CA 4D81A 3UXMA 1FMJA 1RJ9A 4QNRA 1ZMXA 3AVQA 4Q9JA 3ZYCA 3U44A 2MMCA 4DLSA 4B3DA 3KXIA 3MSXA 3QE0A 2FWRA 5JCZA 2D3WA 3MJRA 1JR3A 1XDBA 2OBLA 3NC0C 1L8QA 1TUIA 4J0QA 1Z08A 1QF9A 2IEYA 2QI9C 4M1OA 4GMDA 1EFTA 3BH6A 2ZQ5A 1R0XA 2O8FB 3KKMA 1MABA 4Q7JB 4C4PA 5G53C 5CLLA 1Q44A 2ZI6A 1XMSA 2V7QA 3C14C 5KYKA 1DVRA 3BJIC 3VX4A 3D31A 1Q20A 4GMXA 3W3ZB 4V0MA 4EPRA 2WHXA 3FMFA 3C8UA 4RSGA 1G7RA 3UWOA 2GAOA 3NH6A 2ZJ8A 3K09A 1ZYUA 3VHLB 5FR1A 3IO5A 4PZLA 5JI3E 2R65A 3X1WA 1H8HA 2ZUBA 2XTMA 3WY9A 1XNJA 4BFYA 4BLSA 2XNSA 4AIIA 3EC2A 2Q9CA 3NDBB 1NN3A 1ZM9A 4Q4LA 4OK3A 4D82A 2GVZC 4EUNA 721PA 3PV0A 2IS6A 1OFTA 2DFTA 2Q3MA 2AK3A 4M53A 1W48A 5EQTA 2ERYA 5JSZB 3ZZ0A 4MKGA 4US2R 4RZ2A 2VA8A 4OBEA 2QT1A 2X2FA 1OIXA 3IHLA 2QMHA 3RHFA 3KUCA 2BBSA 1VCIA 4KU4A 4BLTA 4RJLA 4L8GA 1OXVA 2QM7A 4TQAA 3U3RA 4PHTA 2DB3A 1HT1E 3RS3A 4ZCLA 3GLIB 1KI7A 1N5KA 2XXAA 3OFNA 4PC1A 4AYXA 1F2TA 3PJRA 4KSCA 4ABYA 5L3QB 4TSFD 1T91A 1AQUA 1ZCBA 4NTZA 3JVUA 4ACBA 4WZAE 4EJSA 1G64A 1J2JA 1COWD 3B8HA 2ZSAA 1US8B 2WWYA 2HLDA 5BWMA 1ZIOA 1MOZA 4DB4A 2O8FA 5J4HA 4TLDA 4PC6A 4FW9A 1DARA 3A36A 2PH1A 3CRW1 3UWKA 1Z2AA 4M2LA 4PANA 1P73A 2YOFA 3REFA 2CHVA 2QGNA 2J87A 1IY2A 1VCOA 1P9WA 2WZQA 3QXHA 3SJBA 5C46F 4DT1B 3AVWA 4URXR 2MSCB 3QKSA 3AVTA 4Q19A 1P7CA 3GLHE 4I1SA 1Z0AA 4AD8A 2CNWA 2D2FA 2FFBA 3ZQJA 2IX3A 5BW8A 1KSGA 2O8EB 4HEJA 4NL4H 2OLKA 1GKUB 1EESA 1UEIA 4IDQA 2O8BB 2VP6A 2BWJA 1X1RA 1Q0UA 1DO0A 4JBWA 2QP9X 2AK2A 2C03A 1TF2A 3HR8A 3EAQA 3TKLA 4PQFA 4HLUC 5C1BA 4MH0R 2IW3A 1RIFA 2CJWA 1HA3A 1FFHA 3FVQA 1XCPA 4TMXA 1NI3A 1GRQA 3VQTA 4QL3A 2BV3A 3CRVA 1N2CE 3MFYA 1H8ED 1Z83A 4HB4A 4P3YA 4KLZA 5G3ZA 4UNRA 3C4JA 2JATA 2AX4A 1GITA 3B1VA 1FMLA 2H8KA 2YINC 1PUJA 1T8TA 1ZD9A 4HDQB 1P9NA 3R7WB 3EZ9A 5JWHA 3HYTA 4ZDIA 3HR7A 3W90A 3AKDA 1SGWA 3BB3A 4KO8A 5F2EA 1T3LA 3ZJYA 5KHOC 1KI8A 3U4QB 3TSOA 2GEVA 4QJ4A 2HUPA 4BFXA 4Z54A 2OFXA 3CNLA 3R9IA 4DHEA 1S3GA 1BMFA 1UBFA 5AUOB 1VG8A 5H70A 4PZZA 5K8LA 1WCV1 3KXLA 1WE2A 4PO8A 3K70C 4JLOA 3I8XA 4A2QA 1MH1A 3B2EA 3LFUA 2OXCA 1OYYA 3A4MA 3IQXA 3ADCA 2QN6A 2R2AA 1UBGA 2QA5A 3F0TA 1QG2A 4KBGA 2FGJA 4HAXA 4KHZA 1YZKA 4P0TA 5FFMA 3NIBA 4W5JA 1P75A 1KY3A 5DHAA 3EZ7A 2DCUA 1G4UR 1N6LA 2C9OA 1GVNB 3ONWA 2GF9A 4GPTA 2REBA 5SZHB 1E9EA 4G01B 3CR8A 1HH4A 3CX8A 4G0NA 1IXZA 1M34E 2A2ZA 5JFGA 4AKIA 4QXAA 3BH0A 1JI0A 4E22A 2X1VA 4B43A 1AK2A 2W58A 1EGAA 4U7DA 3BIFA 2WV9A 2IXEA 5EE9A 4MYUA 4IVRA 3OF5A 3AVOA 3P20A 4QGGA 4ILEA 3WP0A 1D2MA 5HPYB 4B75A 3CRMA 1XEXA 1R0ZA 4PC7A 3D7MA 4DIEA 3QJYA 4FMCB 1EFCA 4CDGA 5IHPA 2QMOA 4PXAA 3LH5A 5E3HA 4O3MA 1E9CA 2EFHB 4JT2A 2WAXA 3EARA 4Q18A 3FTQA 1TTTA 1KK2A 4OL0A 3T5DA 1JXOA 3BWDD 2YVUA 1R4AA 4JVNA 4JSYA 4C0JA 5CB6A 1RZ3A 4YONB 2XTZA 4Q9HA 2VEDA 1SZPA 3X1XA 3U4QA 3RLFA 3RSLA 1CR1A 3SQWA 3FE2A 3Q3JB 3HPRA 4GP6A 1G3IA 4JLPA 4PHGA 4MGZR 3G0HA 3B60A 2B92A 4JSTA 1W0JD 3RC3A 2JLUA 4UXIA 2QRZA 3CONA 4FINA 4A2WA 1JPJA 2NTYC 4FMDF 1LB1B 5BQ5A 2G1JA 3QKRB 4TLAA 4AKEA 3L0SA 4A2PA 4V0KA 3W6PA 4A8JC 2QP4A 3RABA 1XF9A 1IY1A 2VQSA 2PMDA 3AVPA 5JCPA 2PZGA 3T06B 3KQHA 2HXSA 3TSWA 1OV4A 3L82B 2QTHA 3WBKA 4MGKR 2EU8A 1NRJB 4R9UC 1LS1A 3ZVLA 2ZU6A 1E1QA 4QHYA 1AJEA 3K0FA 3GJ5A 3SYNA 3SC3A 1E0AA 1XPUA 4XTRA 4B2IA 4TYYA 4QC2A 4Q4JA 1N6PA 5KNCA 5BN5A 4LX0A 1RVDA 2GK7A 1WQ1R 3I8SA 1TF7A 1GL7A 3L2OB 1DG3A 3OAAD 2Z5FA 4KFUA 3SE0A 5AK0A 1BKDR 2QE7A 2FN4A 5H1YA 3S1AB 2F3RA 1E96A 1HYQA 1V5WA 3C5CA 1NBMA 3CPJB 4LBYA 3I62A 4B6EA 2O8DA 4PZYA 5IDVA 4I1VA 1X8LA 4KI0A 4EPYA 2J1LA 3BK7A 5GADl 3TSZA 1TU4A 4LJ4A 1CU1A 4IDNA 4TYWA 1CP2A 1DG1G 1R7RA 5SZIA 4LYJA 2O8CA 2PL3A 2J7PD 2GAAA 4GP7A 1W5SA 4FCTA 3D3QA 4FN5A 4TTPA 2ZS9A 2XX3A 3HWSA 5FL7D 4IW3B 4S35A 4IEIA 1M8PA 1X1SA 1I2MA 3DOFA 2FEOA 1OE0A 4BQSA 1S4QA 4QBHA 3VTKA 4BEBA 2C96A 4TL7A 3BB1A 2FFQA 2IYYA 2KE5A 2A5YB 2ODWA 1GWNA 2V7QD 3KTAB 1NG1A 3CZPA 3TE6A 1VKJA 4DXAA 2XXAB 3Q72A 3EIHA 2O8EA 1X6VA 2G88A 4OK5A 1B23P 1GRRA 4DWJA 4TZ6A 2AD5A 3HPQA 3CLVA 1JR6A 3GLGE 1JBKA 1XZPA 3TGPA 2QP3A 4A6XA 1AM4D 2R6AA 3AP3A 2VP0A 3L0OA 4II7A 2N1BA 5EP2A 1N6HA 4C0SA 1E2PA 3QBTA 4F93B 1Q21A 3Q7PA 2QEQA 2JLWA 2WKRA 2WPDA 3CPEA 4YLGA 4X8HA 1SVWA 1AS3A 4Q66C 2B21A 3T35A 1KI6B 1JJVA 2IHBA 1M2OB 5E7JA 1IXRC 4BZPA 5D3MA 3IBGA 2CCJA 2EW1A 2R8RA 1AQYA 5JS7A 5LB2A 1G19A 1E79A 3LBHA 5FL3A 4BLQA 4HAWA 2RKOA 2AXNA 1G16A 1U2RA 3CWZA 2P6RA 1D2EA 4LHWA 1M6NA 2ZR0A 4NYJQ 3SR0A 4BFVA 3FPAA 4WAUA 3THXB 3DZDA 3MGCA 4QHTA 1VIYA 4PO1A 3IGFA 4NCHA 4B71A 2F9MA 2VP4A 2WSSA 3FYHA 4ZPXA 4IXNA 1KO5A 2YZ2A 2JA1A 3QXSA 4A8JB 6Q21A 4F4CA 4TL6A 3B1YA 1AS0A 1FTNA 4FMCF 4URYR 2ZR7A 2D06A 2UVQA 4LGMA 4PHHA 4HLUA 4CF7A 1BOFA 1ZM3A 3GLFB 5EE5B 1S2MA 2AKYA 4ACAA 1KKMA 2ZI9A 4A0HA 1S8FA 1OFUX 2Q21A 2RGAA 4HYYA 2GXSA 2ORIA 2OXRA 4LDJA 1HQCA 5KPJA 3B82A 4WIAA 1Z0JA 4NZYA 5LB4A 1Z0IA 2ZE5A 1KOFA 2BC9A 3IKJA 2ZANA 3GEEA 1GIAA 1NJGA 3SDZA 1VTKA 3J81k 1P2SA 4RFSB 1P4SA 3PUWA 1FQKA 1KO8A 2OV2A 1NKSA 3HJNA 4L15A 3VR4A 2YJTD 3L0IB 3RS0A 2A5JA 1E2KA 1IBRA 3Q5EA 4M1TA 4XSHA 3LX5A 4TT3A 2QM8A 4XVQA 4AC9A 3ZIAD 1KI1A 4I99A 2W2VA 3LAWA 3QY0A 2C5LA 4NYMQ 3W5IA 3H1TA 2QAGA 2XZLA 3NWJA 2DHRA 4F38A 5FBVB 5J4VA 1KNQA 1O87A 3GEHA 4MITA 1VPLA 2AKAB 4HB2A 3DL0A 3EZFA 4Q21A 3C7KA 3GJ8A 3LLMA 2UZ3A 4DIDA 2OHFA 3K0CA 1G6OA 3MWYW 3PCRB 4ITRC 1HQYE 2OLJA 1JEEA 2RH5A 3GLHA 1SVSA 3EX7C 2V8OA 4IOJA 1GRNA 5TVKA 1FUUA 3T1VA 4UQOA 3PUZA 3NHBA 4QBFA 4DCSA 5LD2B 2QORA 5JEDA 2R44A 4W9MC 5JWRA 4EQ6A 1R8QA 5CYOA 1ZBDA 4QRHA 3DO6A 2QU8A 4B3CA 2JDIA 4C0HA 3GLFA 2GEDA 1G7SA 1U9IC 4R2HA 3TW4A 2GA8A 4TWZA 2A3RA 3NBFA 2LKDA 2EFCB 4Z1MD 2F3TA 2XZOA 2YYZA 1DO2A 1NY6A 2KSQA 3NHAA 3K0AB 2ZRJA 2GKSA 2J0UB 2QY9A 3OE7A 4HAZA 2FF7A 3BXZA 5LBIA 1MO4A 2JJ2D 1T3HA 2XNDD 4M9XA 1IQPA 4YMUA 1MRNA 5FUWA 4NP6A 1G6HA 3AGPA 3OEED 2OCPA 3U44B 3VHXA 4CRWB 1GZSA 1RFLA 3KUDA 4JBYA 4U02A 3LXRA 2JLRA 3V9PA 3KZ1E 2W6JA 2WOOA 1VYUA 3NH9A 3WHKA 3SEAA 1PJRA 3DMDA 1NLZA 1XTRA 2IYXA 1HTWA 3VKWA 4YMWA 5J40A 3I73A 3I4LA 5HE9A 2HT1A 2OE2A 1GSIA 2C9YA 4B74A 2ODNA 4Q02A 2ZVQX 3ZLJA 4CZ2A 5KSPA 1W4RA 2CVFA 3PUVA 2IS1A 2EYUA 5IF9A 2QBYA 1M7BA 1OXTA 3SJAA 4C2TA 4Q48A 1NMYA 5KSZA 4JYBA 4PO9A 2PT7A 4Q4AA 2QG6A 3PENA 2J45A 3LNCA 2H5EA 4BLOA 4OI4A 2KB0A 3KQKA 5CM9C 2BCGY 2YWGA 1IM2A 4JS0A 1QHIA 2AHOA 2VIIA 4DLUA 4LJ8A 4PPNA 3IPXA 4BZQA 4ZIRA 2HCBA 3U3KA 2YV5A 4JIMA 4WXPA 4X8LA 4F92B 1CF4A 2J0SA 1NMZA 2QRNA 3LDAA 2BHRA 1E9FA 4AYTA 1P5ZB 4OYHA 4TLCA 2ZRGA 4LJ9A 3V4RA 4Q9IA 2V6JA 3GLGB 4DJTA 1Z8FA 2DFKB 1SVMA 2QMUA 5IT5A 4ZCIA 4G5QA 1CR0A 3H0KA 2GXAA 3BOSA 3BFXA 4IKEA 1F2UA 5FPTA 1DAIA 2ZSBA 3RRYA 2J0VA 1E2NA 3QKSB 4E5UA 4IOMA 2YWHA 3LV8A 1L2TA 4IVPA 4DLTA 5DNYB 1N3BA 4GZLA 4HLQB 3C41J 2KBFA 1UM8A 5AJZA 4L9SA 2GCNA 1OSNA 1T3SA 2ZRBA 5FI1B 1GNPA 1XD2A 2WMOB 5J4YA 4Q1CA 1CLUA 1LF5A 1WA5A 3OEHA 2JIZD 4AG5A 4LHVA 4A15A 5F98A 3C16C 2EYQA 4URUR 1ZU4A 1KSFX 3KB1A 4DKXA 3RRZA 1SXJB 2WAYA 2HYIC 1ONBA 1XXHE 5LDDC 1TU3A 5EUQB 1KO7A 1US8A 1FNMA 3K9LA 1W0KD 1WMSA 1JQLB 5KUTA 4NMMA 1FX0A 3U6KA 1ESMA 5D3QA 1MR3F 1FZQA 1NN0A 2FJUA 2VHCA 3N5CA 3HU1A 4Q7LA 3OE7D 1P72A 3B78A 4EAQA 2ZRMA 1G8YA 1KK1A 1CTQA 4JZKA 3LQRA 3TLXA 4EKDA 2QUZA 3WRYC 2W2XA 1E2GA 3FKQA 2GILA 3WNCA 2W00A 4FWTA 3VX3A 3AM1A 5GJBA 1U90A 4I81A 4JL5A 1KTVA 3PQCA 4MQBA 2NQ2C 4PHFA 1N0VC 4C0QC 3KJGA 3RWMB 3CW2A 4BWYA 2BEJA 4LV5B 4NE2A 2BMEA 2NPFA 4W5WA 1S9HA 2YHSA 3CUEF 1G41A 4LHXA 4LV8B 4PSAA 5J4LA 5J5CA 2WJJA 3EW9A 3QXXA 3K9GA 2GZHA 4AK9A 1S0UA 2FOLA 2WKQA 5SZJA 1AA9A 5B30A 2ZPTX 5BN3A 1IJEA 1XPRA 2TMKA 1KI4A 2G83A 3FOZA 3CO5A 2CNWD 4A9AA 2IC5A 1M7HA 1XEFA 3C5HA 3T1QA 4UNSA 2VH5R 4EFLA 4PC2A 1YZQA 3IDQA 4HZUA 5FPHA 4DCUA 4E03A 2P6UA 1G20E 3CZQA 3TAHA 1XFAA 4M1KA 1DAGA 3RNLA 2NO0A 1ZJ6A 2FGKA 1OIVA 3BRWD 3QG1A 3BFVA 3CNOA 3DEFA 2V1UA 1RE0A 2GNOA 4JBXA 2BMFA 3ICQB 2GWHA 2P67A 4Q9LA 2RGGA 2VTKA 4ZI2A 4MUAA 4DZZA 3LY5A 3AV0B 3THWB 4GSYA 4DSTA 4YXWA 5H68A 2ZAOA 1W36B 1MO3A 3BC1A 1E0SA 3ZQ6A 2O8BA 3DM9B 5UKDA 2HLDD 4LJ7A 2A78A 2Q9AA 1RYFA 5IK2D 2R9VA 2IF0A 4R2IA 2V3CC 4BPBA 1OXUA 1I4TD 2X77A 4F4IA 4EDHA 4C7OB 4OHXA 2Q9BA 1OLOA 4X8OA 2IK8A 2IUUA 2WIBA 2FDCA 4URZR 5KTYA 4LJ5A 2P5TB 3EASA 4G5SA 4UJ5A 3W8RA 1E69A 3RS5A 5K8TA 1E2JA 3HYRA 2ORWA 4HLDA 4LSGA 4B2PA 2ASEA 5KU1A 1E2DA 4V02A 2ZAMA 5FUYA 1II8B 1LV7A 4Q01A 1GUAA 5KSOA 5EJEA 2CVHA 2RHDA 3N2EA 3IQWA 1P6XA 3CF2A 4KODA 3UG7A 1G17A 4QM7A 2YNMA 3BD9A 1N5JA 4M0LA 1XCGB 1G5TA 3KKPA 1P61B 4QGAA 1UPTA 1GILA 3LO5A 1G1MA 4B3BA 4B3FX 4CEHA 2E9SA 1SHKA 3NXSA 2GBLC 5EXSA 1Q1EA 1R5BA 2FZLA 4D0GA 1AGRA 2EQBA 4V0ME 1GOTA 1KHTA 4G5RA 5JEEA 3MLEA 4NCNA 2R6CA 3PIRA 5DGXA 2VSFA 4IJMA 3SFZA 1JAHA 1N6RA 3K0AA 3V4FA 5FH9A 3JZAA 5JBQA 3CIOA 2OEPA 1XXHA 3K0EA
chains in the Genus database with same CATH superfamily
1U3UA 3KQPA 4WZZA 3AU8A 1I7PA 4MV6A 2G7ZA 2P1ZA 3H3XA 1D2RA 4N18A 5BNIA 3CYFA 2IXGA 3DEKA 5F9FA 1KEZA 4IJKA 1K6IA 4D9KA 4JYPA 3QI2A 1EGHA 1FLNA 4KCGA 1JECA 1NVVQ 1U8AA 2PGLA 4N8EA 4U0JA 5CR9A 5DGDA 3QTTA 1TNDA 4IUBS 1U1CA 3ZXYA 3IEVA 4HBGA 5B1YA 3C43A 4F3TA 2F1RA 1F2UB 2ZDQA 2X4GA 4RH3A 3F47A 1XHEA 4RV4A 1G5RA 3G5TA 1MJHA 3RM3A 4MWEA 4Z0TA 1LDBA 3BICA 3SS8A 3N76A 5DBEX 5FWDA 4EEKA 1CUGA 2DU8A 4C2UA 2BJVA 1SKYB 1XTQA 3GGOA 4I6GA 5LC1A 4Z9YA 3DJYA 1DKMA 3HB0A 3PKZA 4MUFA 5DRYA 3WGGA 2EJUA 3II6X 3W9SA 4HVLA 1DC3A 3VR4H 2VDWA 4YRDA 3GNLA 2ZKLA 4ZOQI 2FZVA 4RZQA 2ZM5A 2H6EA 1ZMBA 5BW4A 1Q1ZA 1D2GA 4ZT7A 4NU0A 2AEMA 1FXWF 5F7XA 3DDNA 2OZEA 1QHYA 1JT2A 3Q8KA 4OUKX 3CLRC 3COZA 3FRHA 3RG2A 5EWMA 1SXJA 3BEOA 1T43A 2CXNA 1OGYA 4K81B 4MDYA 3TVYA 1XDZA 2PX0A 1NU6A 1C7RA 1XX6A 2WJGA 3GFBA 2RCNA 3BGDA 1NUAA 2JZCA 3IVGA 1E2MA 4L3OA 3Q98A 3QKUA 5EYPB 4M86A 4A6DA 4EBFA 2IY7A 1NAHA 3WISA 3U7RA 4Y2YA 5F12A 5HEKA 4TKLA 3EGDA 3MRTA 4MGEA 5B2EA 1CYDA 5AVTA 4GKVA 1U11A 2I1QA 2QN8A 2ZRLA 5KJEA 5TV2A 3SIPA 3VR6H 4X95A 4C22A 3OIWA 3REGA 3FI9A 4IIEA 5KNDA 3WRXA 2CHGA 3OQJA 3M4XA 1ILEA 1XZDA 3AVXA 3BGWA 4N82A 4NCKA 3V8NA 4DAEA 1Y9JA 2KPOA 5LCXA 4PLGA 4A03A 3W8FA 1X9IA 2F8LA 2IRWA 4JSRA 4TQGA 4DDTA 1NYQA 1UDCA 3KEMA 1WY5A 2HNBA 2I8AA 2N0SA 2PRKA 1HUQA 4WX2B 2C4NA 3R7FA 3DEHA 1WOMA 3W7AA 3EBPA 3CLTD 2A1UB 3RS7A 5AW1A 3QWAA 3HYNA 2DBYA 4BO7A 3WYAA 5AUNB 3ZD7A 2DQSA 3LYUA 4Q1BA 4TT3D 1EBBA 2JG3A 2DR3A 2R7AA 1U3DA 3RJ9A 4HQLA 1QP0A 1P33A 5HKBA 2RGBA 2B69A 3HNPA 1N6OA 1OILA 4HWPA 3D6UA 3L1KA 3WGNA 1H65A 4Y2HA 2FX3A 5CIQA 4G5GA 4EMTA 2OFPA 3VVMA 3R3WA 3U62A 1RXCA 3BL6A 1OHHA 3CB4A 3ED1A 3G82C 4AMYA 1RRGA 3R77A 4UQPA 5BW5A 3BD7A 2ES4A 3GFGA 4KC0A 4MW5A 4D1YA 4DRZA 3D6VA 1W7AA 1HFWA 1RBZA 3GV0A 5KYGA 1EFRD 1G8SA 2BE9A 2N9UA 5SYAA 3W7BA 4YRCA 4EHDA 3A4LA 5EGNA 5HF6A 3WLFA 2O07A 4W5QA 4LYFA 1A9TA 1PJ4A 4BE4A 3AFMA 3R0XA 4XYBA 3PXGA 1LLCA 4J16A 4F8EA 1W36C 4B4UA 1D1SA 3GOQA 1DZ3A 4P2BA 3G6WA 1YE8A 1JU4A 2BR3A 3AKZA 1P45A 2FPMA 2G76A 4TWBA 2OPHA 3LWDA 1AXGA 4RVSA 3HA3A 3LDGA 4HD8A 1N0WA 1S8AA 3HKDA 3Q8WA 1AMUA 3QSYA 2UZAA 5AUQA 1RCFA 3D5QA 2W6ZA 2N47A 3O26A 2B1QA 2NUAA 3AUSA 3E61A 3EGWA 3SQXA 1M2GA 3SNHA 5IFLA 3R23A 3UT5B 1N5RA 2J46A 4BYMA 2C57A 4YP0A 3CUTA 5MFZA 2B5VA 1FYEA 1UMBB 1E98A 2VPYA 5T3YA 1RJGA 2X7XA 5AM1A 2OD2A 2BN4A 3NW9A 1Z2EA 1KAGA 2AKEA 2B61A 1DIHA 1KI6A 4KYTA 2A0XA 2XWQA 3M4YA 4NH0A 4UD6A 2ZUCA 5EXXA 4U2KA 1ZH4A 2ECOA 4HFJA 3JPYA 3UJAA 4E7OA 1P74A 5MN6A 1YR7A 3ADDA 5E4YA 1ADCA 4NDAA 3Q3HA 4MYDA 3UZUA 4C21A 1ZUNB 2CBGA 3R8XA 4Q16A 5A4MS 1OU4A 3WIUA 3K70D 3QE3A 3AP1A 4HEHA 4KB5A 4RL4A 4ZCQA 4UZSA 1EDZA 1N36B 3DTYA 3TZLA 2ZGVA 1VKZA 2HK6A 3DMNA 1ZNWA 2GN9A 4P81A 1LW7A 3WZMA 2I65A 3HBLA 4EI7A 4ZT5A 1JR4A 2J3IA 4G4SO 5IM4A 4I1OA 3MOGA 4G5OA 4MQ6A 4P83A 3CR7A 1DSSG 3MAAC 1Q3KA 4DOMA 3RG8A 4JKIA 4TYNA 1R3DA 3AFGA 3HCCA 4O5OA 1R0LA 3L1UA 1WMDA 3FSGA 3BWMA 2CCGA 4GPBA 2VJPA 4BQIA 4QEDA 4G07A 5A04A 2IHKA 5B12A 3TLJA 5K0JA 3LBNA 2DPLA 2I78A 4UUQA 4N3AA 3USES 5K6AC 4OHYA 3KKEA 2NNLD 4F9GA 4FQ7A 1N3LA 2BEWB 4LHEA 2WHQA 2H17A 5JCOA 3OFND 1E79D 3IR5A 2XJ4A 1B76A 4YXWD 1HC7A 2ZVDA 2C3OA 4QU9A 1G3MA 3TLGB 1SIWA 2XKBA 1PQYA 1QBGA 2DPXA 3RIGA 2AXEA 4NATA 3C8DA 2WW8A 3OJOA 2OYCA 4KNVA 5AQ1A 5DM2A 1N3IA 3P5SA 3T3NA 4NDZA 2RAUA 1YJBA 1RZUA 1ZX1A 2JCGA 2MWMA 4HATA 1LH0A 4BRWA 3C45A 5IRCD 1Z56C 2A0KA 2OSBA 1LVHA 3C3KA 3CXUA 3GCXA 3ZY4A 1R6VA 2HV9A 2ZYUX 2FPUA 2QX4A 3N87A 4N0PA 3PWSA 4YCJA 1JDBC 3AG6A 2DUMA 3H16A 5FOXA 5L3RA 1N2CB 1NXWA 2J3MA 2J5RA 1EX6A 3G2IA 4OAQA 4QSMA 1R2QA 3CGWA 2A35A 4L6CA 5EHNA 4D5GA 3RREA 2X8JB 2AOXA 1JFTA 1BH6A 4BVKA 3F90A 3QBVA 5IWAB 4KN5A 1C1DA 3B89A 1J2UA 1L4UA 1K5HA 2Z8XA 3EVFA 3W5HA 4ECEA 1NNI1 4G0WA 2FRVA 4ZCSA 5HS6A 4N03A 2BMWA 2XNDA 5TVGA 1AHNA 2VJMA 3MJDA 5CDFA 3M6MD 1K68A 2EG9A 1T0JB 4JLSA 2I9KA 4L08A 1H85A 4Z9FA 4AIRA 1P7YA 1XN1A 3ANMA 1B41A 4GE0A 3UAZA 5DYNA 2ZU0C 4JQCA 3DF9A 1B1CA 3N2ZB 3VPXA 3DZHA 2YHBA 2FPWA 5KREA 4MKFA 4CT5A 4Q3DA 5B53A 2NU8B 3BHIA 3HEBA 5AHRA 5EIEA 3RFUA 4MQEB 5FULA 3C2QA 5GM2A 2CJYA 2X3UA 1E4OA 2IPNA 1Z18A 4MK4A 3NORA 3ZWOA 3Q9SA 1PV2A 3QKIA 3BWCA 1U0HC 3VKVA 2PJZA 3FWZA 1UP6A 1YKSA 3U7HB 3PJDA 2TMYA 3L84A 2I71A 1PJ3A 2V5AA 4HSEA 1H2EA 4PONA 4F3KA 5B6IA 4Q3LA 2B3DA 4A5OA 1XELA 1B6SA 3DG9A 1Y98A 1I1QB 1B0ZA 1P2FA 2EJCA 4N8SA 1FS4A 3A1SA 1ZCFA 1YJ8A 5ALTA 1JAZA 1XO1A 2VYND 2JLXA 1XN4A 1UEJA 2NUPA 1HDIA 3I42A 1IMJA 2ORVA 2LP4Y 1U7XA 1GTZA 3CH6A 3P4YA 5C8YB 4IJVA 3GJTA 4NENA 1N2EA 4RE5A 5F3WB 1JNXX 3N86A 3C6QA 5JASA 1PZFA 5DISB 1ZXXA 2JANA 3LRTA 4EUSA 3CW9A 3OH8A 4GP9A 3ZDCA 2CXXA 2W2OA 4H3VA 3FM9A 2PX6A 5A4DA 1ST2A 2Q1UA 1JQJC 5B64A 4RK4A 4BAGA 4WZBA 5GOTA 2VVTA 1CERA 3QUQA 4CM3A 4I4CA 1Z29A 2B1IA 3S2ZA 1EB9A 3A2MA 3V2IA 2X5KO 5IH3A 4LBZA 2WR8A 1H93A 1YV9A 1IATA 2YICA 3D6TB 3IP8A 1DEKA 1JYFA 1UM9B 1NVXQ 1XRQA 2CLDX 1GYQA 1BHQ1 4W4TA 4Y67A 5IVDA 4A10A 1DFHA 2RHCA 1ZUIA 2FPGB 2FEMA 3T9CA 1N2SA 2CLSA 2PMWB 2WKPA 3V1KA 4EJFA 2MR5A 3W9YA 4EYKA 1EGQA 4DIKA 3RNOA 3MC1A 2RGDA 3ZGVA 2HH9A 3PEVA 4C07A 2JBAA 1RKQA 4LKRA 3JARA 3WBBA 1ODJA 421PA 1ZKMA 5D51S 1OXSC 1CQXA 2BHLA 2CHQA 4ER0A 2O4CA 2ZDGA 2IXDA 3DE1X 2E2WA 3Q7TA 2QENA 2ISQA 2DM6A 2QD1A 4F4FA 4GPEA 3M6AA 4B80A 3O6VA 2PUGA 4UAGA 4Z51A 2ICAA 4P4GA 4Q4CA 1ZNZA 3T0GA 3OLYA 3V3KA 2O5RA 3K9HA 3BIOA 4PLWA 4Q1FA 4Z9XA 4KXUA 2NP7A 3FH0A 1CEXA 3NEYA 1NYLA 1VDZA 1WSBA 3AU9A 3G68A 2FRDC 1OAOA 4IV0A 3CUVA 3U61B 4PFJA 1XRPA 2RGWA 2VT6A 4GHWA 1BU5A 4OD0A 2WD9A 2XEDA 4MR9A 5LYJB 2VJAA 2ANCA 4BWVA 2YWEA 5EXPA 1WZCA 4LFCB 2FTKE 3H7AA 4CL8A 4BNDB 3WLNA 1QFYA 5TGDA 4YRGA 2PX8A 5SY4A 3RTEA 1GZVA 1LLFA 3D4NA 5C18A 1Y89A 3VSAA 1EQUA 1SKAA 4ID9A 2ZM6B 1OX4B 4Q6BA 2R8XA 5EE0A 3LA6A 2HB6A 2YN2A 5DEIA 1D9XA 3DXYA 5EWLB 2YMLA 2BTOA 2Q7DA 3I8OA 3F6BX 3ZWBA 1K0FA 4EPWA 1NX9A 2PO5A 3PYXA 1PNRA 4YAEA 1QKJA 3GMTA 1A5AB 4CGYA 2PIAA 2Y0BA 2PZLA 5CA1A 2PEYA 4TZTA 1DBSA 3WX0A 4QXMA 3IHWA 2XZTA 4HWGA 4QTYA 2I87A 2FU5C 1YFZA 2H65A 2IPMA 3TW8B 1PFGA 1K5PA 2Q7XA 3NG1A 3SBEA 3SXJA 2Z2XA 3QVSA 1J6UA 3GPLA 2FHSA 4ZXFA 4XD7A 5EERA 3PGVA 1EUDB 1V7PC 3LOPA 1EWKA 3X1JA 1BE8A 5D7NA 4DLAA 2ZR8A 3BMOB 4S0XA 3Q9UA 4N9QA 3KHKA 3LK7A 1EG7A 3FZYA 1QZZA 1Y8RA 2YN0A 3Q7QA 1Y1QA 5TY0A 2EJVA 2AG5A 2PEZA 1NJ6A 3GAZA 4AAYA 1TCAA 2PQ6A 1OX4A 2HBRA 2EFDB 3EEQA 3ONEA 4O2AF 3IUYA 2GJ8A 5J1SB 1XQ1A 3VBCA 1V7CA 2C83A 5K3DA 4P5DA 4RC9A 1NRXA 5CIWA 4HDSB 3OP4A 1PGJA 5TMEA 2AZDA 1F17A 2GCOB 1WRBA 3WS7A 4YRNA 3EGEA 3H4VA 1OH6A 1HE8B 4JWKA 5JO0A 3DYBA 2VH2A 1KZGB 4G86A 4KXLA 4F5DA 1H69A 1WY7A 2QZ4A 3GCWA 1T2UA 3O3OB 3PL5A 4KIUA 4Q24A 1WSAA 4W7SA 2P1RA 3J81A 5LQCA 4GI7A 4UTPA 1G8PA 3SC6A 3W5VA 4BNTA 1AUQA 2OM2A 4UBIA 4S1VA 4WHMA 3T61A 2O23A 3OTIA 1NI4B 3NRBA 1Z8NA 3LQKA 3TMYA 4A6PA 5BYJA 2HK8A 4G5HA 4S2EA 2DHDA 3IB3A 1RQNA 1VP3A 3CRNA 1OA1A 4CIWA 4GL2A 3PD1A 4TWJA 3W8EA 1KMCA 1QLJA 1Q0PA 3BRSA 4RPCA 4CFSA 5CEEA 5LZ7A 5JSUA 2ET6A 3I4CA 4G1MB 1GA6A 3TSCA 3ZW8A 1SC9A 1SOVA 4QUAA 4Z4FA 3OIVA 3LBAA 2CXPA 1N2CA 1RAEA 2J7PA 2WF6A 4GOKA 3AHIA 4R2MA 5SYNA 4XWTA 1I32A 2VZ8A 3KU1A 4QFCA 1QQ6A 1ZZEA 3K7EA 5FTMA 3SMQA 2Z5VA 1VHWA 2WJAA 3P97A 1X7DA 5CBPA 4ZDJA 5EJ6A 5EA2A 5CFLA 1VJDA 4MMYB 5GAJA 1BVRA 1OTHA 3IIIA 3E48A 1Y3IA 3U0VA 2AQHA 4C7KA 4ERNA 1BXRB 3JVVA 3KV3O 4LPSA 4D0LB 2C9DA 5CA1B 3LLVA 3JQAA 4HFMA 3SQOA 4F72A 4FUQA 4GC5A 2F9FA 1CDOA 3NOOA 3U80A 4CMAA 1RNLA 1RBQA 1TK9A 2VO1A 3N0VA 4XX0B 4D43A 1K8ZB 3VI3B 1E7RA 3FYSA 3C74A 5L45A 2B20A 4MS3B 1K8RA 5IT9A 3OUTA 4CEIA 3H8SA 1MKYA 4P34A 4WKBA 3D59A 2NPOA 3MEQA 4J7AA 2QT0A 3PUXA 5E3IA 3DFIA 3NP9A 4EK9A 1HLPA 5A1TA 2Q6IA 1NT2A 3H9GA 3LX6A 1OQAA 3TO5A 1CVIA 1E1NA 2KWIA 3WLLA 2H1SA 3DBOB 2IZ6A 2ZTVA 2B36A 2L17A 1IRIA 2P0YA 8GPBA 1QGOA 2NU7B 2XOKA 1KAMA 1ZO8A 2RK6A 3O4HA 2C4VA 4PYMA 5HF5A 4WD3A 2ILVA 2P2DA 3T52A 4ZAZA 2ZJ3A 3O8QB 4ZDWA 1RTKA 3LD9A 3ZV5A 2GCOA 1VLLA 2X8AA 4KTVE 4RGYA 2H3EA 2BRUA 3GUUA 1E3EA 1NG9A 3S8MA 4ZOLF 3CN7A 4RQBA 3TOSA 5JY1A 1E63A 3KLMX 1E2FA 2J7KA 4BFZA 3MYYA 2IKSA 4JB0A 3ZY6A 5L9AA 2IUYA 3PT5A 1Y4AE 2Y92A 5AI4A 3V1UA 4XJSA 1ODSA 4POOA 4UC0A 1GLNA 3CCCA 3O7MA 1C4OA 1QGYA 1UBSB 4GQAA 4O0MA 4PE5B 1M1YE 2JK1A 3IOEA 4J0JA 3ZDQA 1YHNA 3HYCA 3QVKA 3PLNA 3JAWB 1HYHA 1NBIA 1EIZA 1T3TA 1Z4MA 3TBFA 5JPIA 3ESYA 1H3EA 3QHAA 4TYPA 3P2MA 2HGSA 2FH5B 2IZOA 4BLPA 3PWKA 2D2EA 2BFEB 4Q4JB 2NUTA 4AICA 1LZLA 2GO7A 4RD6A 3RI3A 3ZJ5A 4HNVA 3VHQA 4EB8A 2AR9A 1FFGA 4GYWA 5LUBA 1FDRA 5IKEA 3AL0C 2HIMA 1WW8A 4ZTBA 4RPLA 2AFIA 3ZHZA 3QA9A 3PEYA 4LMBA 3HUTA 2XCRB 1XAJA 1TQ2A 2OO7A 4BDTA 1UT8A 4F5YA 1Z2NX 3FHOA 3MWKA 4G84A 5I01A 1QU2A 1L4YA 3OZAA 1IDN1 3D0OA 3GZNB 2H52A 4M9RA 4UUPA 3AJEA 3D64A 1HETA 1ENOA 1F6BA 3GLUA 3SHFA 4IZIA 3UKDA 2GM3A 3MCUA 3QX8A 5BPFA 5KKCA 5FPSA 3ZHSA 4Z0HO 1NZJA 3RQSA 1NVEA 3PJEA 2LGJA 3Q0TA 3TQCA 1C8KA 5DH9A 1U80A 5JCOC 1N5DA 4OXIA 5F4BA 4LISA 5MGNA 2I6GA 3PS9A 1Y81A 1CQWA 1EX9A 3GP5A 5CM8B 2M1ZA 3H2BA 5CDTA 5JD4A 4LYDA 4ZO6A 4U8HA 3BD8A 3CM0A 2CLLB 1OI4A 3P71T 2VLBA 4ZYXA 5JADA 1HXHA 3M81A 5KHLB 2XRMA 2XE8A 3RC1A 3IDSA 3LKBA 3WLAA 4G63A 3RJZA 2IEGA 3P27A 3AERA 4ARVA 3NNNA 3EVZA 2GEUA 3D3KA 2B34A 4D5EA 2P5YA 1UFOA 1R10A 3CISA 4QG7A 2O7QA 3G2NA 1N34B 3MXOA 5HE8A 5CDSA 1GFZA 1MV5A 2VZEA 2VXOA 3A3KA 3OESA 1L5KA 2DRIA 4QJ3A 1L1QA 2BD0A 3GUZA 5IYZB 1J2EA 1GRVA 1MEOA 2WRZA 3FLAA 1VCHA 1LDMA 2D5CA 1W73A 3L9WA 1X19A 1B93A 3QUSA 1C1YA 4EJSC 3DZGA 3RVLA 2UYYA 4BCBA 4YHHB 5TNXA 4YRMA 5EIBD 1RE1A 1M8GA 4Y6RA 1PSDA 2GH1A 1V16A 5DW3A 5CITA 4PQRA 4P2GA 5LA6F 4DA9A 1HZZA 4E21A 2YL2A 5FBLB 1DTWB 1NAIA 3G9XA 4QVKA 4R1NA 3VDXA 3OLWA 1XKXA 4YAOA 2ZTSA 3JXEA 3PYLA 5EPUA 3FPHA 5H9WA 1KVSA 1QG4A 1LFDB 4P80A 2C4MA 3E7PA 5C81A 3ISJA 1PW7A 3K09C 3P2JA 2VAPA 3Q8XB 1F0YA 2B0CA 3MMSA 5DP1A 1WXFA 3OOHA 2FA9A 4OQEA 3UUGA 2Y6VA 4TVOA 1EUDA 5HZHA 1AZSC 2YHIB 3AEUB 3R7SA 1X80A 3WSVA 4L75A 1UDXA 2KI5A 3OF2A 2DQYA 2OCKA 4WOKA 5BN4A 3QU7A 3EODA 5AVOA 4XQCA 4WK0B 5AKGA 3NP7A 3U60B 1RC0A 5EMJA 2H5JA 3OZRA 2DWQA 2BFOA 2HJVA 2PS0A 4WESB 4BMYA 5HCNA 2Q3DA 3KBOA 3L3BA 4NFYA 2OCGA 1GTJ1 1XEAA 1CY0A 1QZXA 3GGJA 3I30X 4D80A 8AT1A 2X7JA 1W35A 1ISSA 4XGQA 1I24A 1TPZA 5INTA 1NXPA 1L7PA 4EKNB 5E8RA 3QGMA 2O52A 2QX8A 3SBDA 4CM6A 2R6GA 2AT1A 3IDZA 1WF3A 3F8WA 2ZYVX 3TI9A 1KEEA 1JXQA 4QSHA 1DV1A 2Q0SA 4JLWA 2IOHA 5EVJA 2EIXA 1CUFA 4OSOA 1M2OA 2FSPA 4BP1A 1OV6A 2R3SA 3AUAA 4KR6A 1YULA 4X1YA 2WTEA 4AF7A 3ILXA 4WFKA 4F4JA 1SQFA 4F3CA 2WFMA 3DOHA 2VHTA 3L4EA 3A25A 2BKEA 5FEUA 1ZRMA 1E5TA 2GPJA 3PC2A 1N5IA 3ADKA 4OYLA 3LF2A 3TMAA 3WWOA 5CG2A 4I66A 4J3FA 2J3JA 4DFDA 4ZA2A 1BOOA 1U1DA 5EKXA 3U7EB 3FMOB 3IDAA 2IXTA 5ENDA 2X0NA 2XTJA 1X2BA 4CIBA 1IRXA 2Y1GA 1K3FA 2F1KA 4H7HA 4A0QA 4BVGA 4S1PA 1B0UA 2WINI 1XTSA 1IZYA 4KIWA 3TIIA 2ERXA 4HH0A 2Q27A 1ISRA 5L4NA 3LUCA 4GC9A 4O4LF 4E4TA 2ZTUA 2VPQA 4LI0A 4B34A 1QVVA 1AK1A 3GFPA 3CUKA 2V6MA 1TC1A 3HEAA 3WOHA 1BGXT 4LOJA 5KX5F 1ULHA 1O7JA 3GAMA 4X8MA 1U8CB 4ZC8A 1SCIA 2XUAA 2YUIA 4DRYA 3QYJA 2FAXA 4CL3A 3WMRA 4YQEA 1S2GA 1ADJA 1ODCA 4ITUA 4ZP1A 1CF2O 3R09A 3LY7A 3QPWA 2PNFA 4N7BA 1QXSA 2ZE7A 1SMKA 1RZRD 3OCZA 3PUJA 1SB8A 3BCUA 5E1OA 2H2WA 4DLBA 3ELDA 3PNQA 2BGNA 4FR5A 4PYOA 2HHAA 1RXIA 5TT0A 4J1QA 4JY7A 4N7RA 1D8AA 3L01A 3WYDA 3IAAA 1XJCA 1U2GA 2BFCA 4LWZA 3UOAB 3PFIA 4IUDS 4C4YA 1RKUA 3HFGA 1PR0A 2DHCA 3A32A 3QV1A 3E5NA 4R1SA 2BGIA 2NN3C 3GGSA 4WESA 5ALQA 4I6EA 4LYAA 1WZUA 3CNQS 2GPSA 1EA5A 1SEVA 1OT3A 2DE0X 2HRCA 3QVTA 2FR1A 5K3EA 3O8DA 3V8MA 2NX2A 2FSSA 4RD2A 3CWCA 3FHCB 3ZD9A 1VM6A 3BXXA 1RABA 4QOFA 4C9BA 3OCYA 4R2KA 3NT2A 4U7WA 4RHXA 4CU5A 5KNBH 1DCTA 3VOAA 1MJGM 3O7WA 5HFJA 1Q11A 2ORED 4M8SA 1T2EA 3DLAA 4YJ2B 3X1MA 2CXQA 4KMSA 4L4ZA 2K2QB 4N3CA 1W2HA 2IIVA 4JBGA 2PKXA 2G6TA 3OJFA 1KOGA 3PEUA 5JDIC 2R4UA 3WBJA 1F60A 3AF5A 2AQ8A 3O4IA 5FJIA 3H75A 5A9TA 3A1WA 2VDWB 3H5OA 3KX2A 4K6KA 4TMKA 5D7BA 1WSWA 3ZVNA 3FFTA 3I9LA 4M1EA 3MJHA 5D85A 3VR5A 4KEAA 4TT8A 1GUFA 1NDUA 4E1VA 1XDDA 2JLSA 2O4UX 4H1TA 3ROPA 5C7LO 4P5PA 1ZC3A 3M5CA 4RD3A 3K4HA 5DCUA 1I2ZA 1PGOA 3W34A 2OXFA 2PGIA 3FX2A 2HD4A 3DQQA 4NYIR 1JHZA 1TM1E 3EPRA 6GPBA 2BLLA 4RY8A 4ZV9A 4X62B 3PUHA 3OURA 4BASA 4YJHA 2ZWAA 1UF9A 4LVUA 4ZOBA 2WJYA 2CL5A 1YS7A 3DULA 1Y4SA 5KNLA 1CUAA 4B47A 4MPPA 3KD2A 3I1FA 3VU3A 3F74A 1S2IA 1JIJA 1T2VA 2A92A 4WGFA 2VYFA 4WJKB 3VU9B 5EUBA 1PLJA 1T6NA 3EGDB 3CU5A 2GUGA 4FFOA 4NARA 3TIGA 5L3VA 1J8YF 3KQLA 3TZQA 1IN1A 1CS0B 4I50A 1UWKA 3TZKA 3ZV7A 2LRHA 1UXKA 4M7OA 3SC2A 3ZDEA 1BA2A 3BGSA 2GO1A 3EGIA 1GY8A 3N70A 5DYIA 3SLRA 2QE7D 4CF4A 5AKJA 2C9BA 1GNVA 2Z2KA 1XPJA 2AW3A 1LA2A 1PNTA 3EXFA 2Z9DA 3IX7A 2R8OA 3IIMA 4L16A 2GZMA 3CEMA 4PLHA 5ECGC 3R5KA 3ZXUB 1QPZA 2L69A 2OCAA 2EKZA 4FYHA 2LIPA 4YPVA 1TZJA 2NTVA 1Q12A 3KHSA 1FOEB 5DWQA 3TL2A 1CV2A 4NJMB 2JS7A 3IBCA 3C3WA 4LYYA 5P21A 3ZVMA 1L5HA 2XYRA 1G9XA 1YB1A 2JHPA 1PV4A 1KJNA 2FUNB 3QYPA 2G25A 1XMOB 5K20A 3Q2KA 1W2WB 4JIGA 2CL0X 2I1VB 1MOPA 1IQ0A 2WT8A 3KSMA 4L7QA 1BMFD 2WFLA 2ZIGA 4YRQA 2PT6A 1GV1A 2YDXA 1TMKA 4ZHQB 1DIAA 2PFGA 5C8DA 1ZINA 5KKNB 3IESA 1UKBA 4IDDA 4OQYA 2C2HA 2D5AA 3ZCXA 1E6CA 1EQAA 5ERXA 4M49A 1OFIA 4HNUA 2AJ8A 2O2ZA 4UFNA 3FSRA 5A3QA 5JALA 4NCAA 3A9CA 2BFNA 2LWIA 3LXXA 1I2DA 2PRIA 3BMQA 3I61A 1I30A 2PKEA 3D54D 3QXJA 3AC0A 1E5QA 3SOPA 3RIMA 4FGLA 4A7PA 4RJIA 4ZD6A 1W88B 2ZIUB 1G2OA 1NX6A 1D5WA 5DMHA 4F9FA 3CX3A 4YUZA 4IS3A 1ZGCA 1C7IA 3H9JA 1W47A 4O2BF 4C78A 4DSZA 4KAXA 3A6GA 3HKCA 3G49A 1T9GS 3GLIA 1NVDA 2JI4A 1WCWA 3KS9A 5F7ZA 5B7QA 2AH5A 5EP4A 4MHTA 4BCCA 2ZUSA 1G5PA 2KBEA 3HR4A 1F12A 3NHSA 4INOA 2FR0A 2XUOA 3GELA 1EFRA 4IMPA 5I47A 2VCYA 4EB0A 3MHTA 3G5UA 4MI3A 3HVKA 3EWNA 3OE4A 3SM9A 1NSYA 4XVCA 3S70A 1N1EA 5JUWA 2DTEA 1MC1A 4NYJR 4O29A 1O3YA 3O4RA 4QPZA 1WVMA 1JKJA 1Z63A 4QBKA 2FN9A 5CB4F 2C3PA 1I5EA 4YJFB 1OUMA 4REQA 4DSNA 4HK4A 3CMCO 2UYOA 2XQVA 4J3NA 3NYWA 1G3UA 1SC6A 3EVTA 4C2BA 4QFMA 1QYIA 1P18A 3A9WA 1K08A 3L8DA 4LOHA 3UAWA 3ZXIA 4JKOA 5K5EA 2LV8A 2R7LA 4LHSA 2XE4A 3VO1A 3AVYA 3VNUA 1V8DA 1BW9B 4X1YB 1FYFA 2NO9A 3SU8A 4UM5A 4W1PA 3EBOA 4Z8YA 5KS2A 1E2HA 1YDFA 4TV9B 3WOVA 1J99A 3CJTA 4JEHA 1TYBE 1Z7BA 2MSLA 4P98A 1EJ2A 4UAJA 5AVZA 2QTVB 1B8PA 3L40A 4RK0A 3IQHX 3P0FA 3ZU3A 4IJUA 5A3RA 5ED4A 2F4VB 3IVMA 2XECA 4PSDA 5J2UB 4Z6KA 2C84A 4KPYA 1GKKA 4H4EA 3PKJA 4UDNA 4G0ZA 4U8GA 3QP9A 2RIRA 4GI1A 5I9BA 3RANA 2A0YA 5EN4A 4EBBA 2P2LA 2W2LA 4F3RA 3IEMA 4J1TC 4QASA 3FPLA 4UFOA 4KWEA 2XLCA 3ORSA 4EEZA 4ZEOA 4EATA 1P3DA 1W46A 1RRPA 1WW3A 1O57A 1BHSA 1QE0A 1YRAA 2Q49A 1SUIA 3IS3A 3LPCA 3RVBA 1XOIA 3B13B 4OMUA 3UT0A 3OVMA 3LDUA 1LTHR 2JI8A 4TV9F 3R5FA 5JJCA 4RTOA 2F55A 4JOQA 5CX1B 5B3JA 2V1XA 1SCAA 3KXKA 3Q41A 1MIOB 3OD5A 1ISIA 5BNTA 1PAUA 2PWYA 1Z4KA 2VHJA 3I2YX 3MCZA 4KWCA 1NA5A 1TJ3A 3LUGA 5AK4A 1ZH6A 5DK6A 4BNYA 3R7LA 1PHRA 3NJ8A 4B83A 1T1GA 4BUZA 2PJUA 2VPIA 4GI5A 4MINA 4RD0A 1N7JA 1E2BA 1TZKA 3FCAA 3IBYA 3KYBA 3VZPA 1EP1B 3ILVA 3FNRA 3DKPA 1ZSYA 4MV4A 1ZRHA 2KQUA 4LYHA 4NVRA 4ZQBA 1OB5A 2HF8A 2PXAA 2VR1A 3M2TA 2ZIXB 1R6XA 1IFXA 1YIDA 1I7LA 3KZVA 4DNOA 2VRWA 4UZFA 3R44A 3W2TA 1XLUA 1G18A 4YJFA 1IPFA 3LWNA 4KFSA 5DHSA 1BVYF 2Q0XA 1JDBB 2I4IA 3LFHA 2QRMA 3T1OA 3ZX4A 4RY2A 1D2NA 4IIBA 1SQ0A 3I5UA 1K98A 2KMLA 3NGLA 1U7WA 1VI2A 3JQBA 4NZ9A 5TT1A 2SHKA 4DIEA 4Y0VA 1V43A 1FLAA 4B44A 2I4NA 1QH8A 3GNSA 1Z6ZA 3WWCA 3RADC 2I4TA 1MNAA 4ZOAA 5ANRB 4F12A 3LUKA 4KO2S 2GPAA 2Q5CA 4HUTA 2WTXA 4CLRA 4L8WB 3U7GA 4WNAA 4N5DA 2OFOA 2XUIA 3WFJA 1GKYA 3EDMA 1QBKC 1ESEA 1E3QA 5IDWA 4ZHQF 2ZI5A 4DCTA 1S2OA 4W6QA 5CVCA 1N6NA 4L76A 2Z4SA 3BMNA 1KO1A 1JMYA 3FR8A 3NEPX 2JH3A 4HXYA 5CPFA 5JYEA 4G56A 2FXVA 3T3EA 4EG0A 4YT2A 2NAFA 5JNUA 2DY1A 3IT2A 4ZAGA 1RM4A 1BROA 1IZ8A 2OB1A 3LCCA 2HV8A 2QRGA 2H9YA 4I3GA 3E0QA 5LZ4A 1FW8A 1ZJ4A 2DFDA 4L5IA 1FFXA 4N6NA 1XVTA 2CE2X 3M1LA 3SQMA 2VL7A 4C4ZA 4E3ZA 2N75A 2G04A 4MB0A 1MT3A 4B6RA 1I7DA 2DR2A 3B3QA 4FQ5A 3O4FA 4TTQA 3PRJA 4D97A 4QDJA 1THZA 2C5HA 5ECDA 3T4UA 3ZH9B 4JHLA 4Y18A 2HW8A 2CYBA 1A50B 1GAJA 2P62A 4FOSA 4H35A 1QU3A 1EWQA 4Z3DA 3DBHB 4GPD1 2QBYB 2FZ4A 2FUKA 1HY3A 3ICPA 1YE3A 3B9BA 1VI6A 4OI2A 5ALZA 5C8VA 4WNCA 1FTWA 2VF8A 2EEZA 2ZUDA 5DM1A 5LYYA 8OHMA 3RSQA 4R0MA 3VPFA 1II8A 2P5SA 3TRIA 1KP3A 3ND7A 4MKXA 2WSSD 1A5TA 3DMTA 4MVXA 4NHEA 1DKLA 3G2LA 4PCLA 1AZTA 1LPAB 2WZBA 3RVSA 3U9SA 1L7XA 3LK6A 1CE8B 2FSHA 2F3PA 5KDDA 2QPAA 3I92A 4HS4A 3RWOA 1V5EA 2F90A 3AFHA 5AM4A 1TYEB 4JI4B 2CY0A 2D00A 2VNJA 2YHIA 1MRZA 3LNTA 4H59A 4OB6A 3S5JA 3UH1A 3IKTA 2Z57A 3EDQA 4CFZA 1A4IA 2XUJA 2ENWA 2JCVA 4P58A 3RSHA 3UIEA 2QHXA 1ZJZA 4AZ3A 4YAUA 1ML4A 1T4CB 2DLCX 3T5GA 1E20A 4XUCA 1TO1E 4NMXB 4BMSA 2PS9A 5E6RB 5EFZA 3TAUA 2GJSA 4DQLA 3T4EA 1VDMA 3AUTA 4DLVA 4EJSB 5HKKD 3H0CA 1THTA 3K6SA 4N7JA 2GAFA 3CRRA 5CK5A 2EZTA 2QMEA 2CLCX 1J5XA 1VL2A 1ZUWA 2OMEA 3IUPA 4K86A 4FYIA 1Z5NA 4IRUB 4MI6A 1GGHA 3W6NA 5MDHA 3TINA 2Q07A 4XWKA 1VCMA 5AI6A 1C0KA 1MAHA 1E8MA 4X1IA 4ZJZA 4OJTA 2O8NA 3E9QA 1HE3A 4P7GA 3TRKA 4F11A 1D8TA 1XROA 3OPMA 1GXSA 1UBRS 4C0LA 5B58C 3A1TA 4LXQA 1QRSA 1H9CA 2POQX 2H7VA 3AI3A 4MRMA 3E7FA 4P93A 4S35A 2O0HA 1WHTA 5FAKA 1YZYA 4NC9A 5A6SA 1MPXA 4ENTA 2IUFA 2YXDA 1UBCA 5D6OA 1V47A 5FHRA 5LOVF 3S1SA 4AMGA 2FPIA 3OZSA 5JD3A 4D42A 2YQ4A 3JQGA 4LK2A 2HRQA 4ZQIA 1X9HA 4M1YA 4R5MA 3WAKA 1VLJA 3ZOKA 1HI9A 1ZSNA 5G0VA 4BLUA 4NCIA 2FLWA 2YX1A 3VDQA 5BN4B 2FWNA 3A37A 3ZWWA 4TWRA 1QHXA 1EXWA 1RI4A 1AKNA 4JBNA 5EI5A 3KVVA 2DYKA 2WWFA 1CC1S 5J2TF 2HZ7A 4GYJA 3U17A 4AROA 3ZHOA 4OP2A 3RK4A 5B57C 2JNWA 3V48A 4D4KA 3JD3A 5K0EA 4DWWA 2ZXFA 2JGMA 3QVXA 2W83A 1U7HA 4OLAA 2GAIA 2QW8A 5CVUA 2PIDA 1KFJB 4AJHA 4XCXA 4AWXA 3IPAA 2D1QA 3RTDA 4A2CA 2J9FB 1JKXA 1HKHA 4WERA 4MRVA 1U2ZA 5IKXA 2OGZA 1X7HA 5JAUA 2FEAA 1VOTA 1CYEA 3WFZA 2FW9A 1C3LA 1T9KA 2PMKA 5HKLA 2JH9A 4KE6A 1NONA 3O2SB 4TN5A 1WF6A 5K3BA 4F2HA 5JJKA 1U2DA 1IN8A 4RZXA 5CU7A 4CG0A 3A1FA 3NTUA 4AJOA 3RSFA 3KZOA 3W1WA 1QIJA 3BWYA 2ONZA 2VQFB 3R9WA 1G7TA 2V6FA 4HYQA 1DQZA 1H42A 1QIEA 5B36A 1UIRA 3L7IA 4Q82A 1E9VA 3EXHB 4IIYA 2X40A 4MVCA 4WVFA 2FFAA 2ZB2A 3G0BA 2UUOA 4C4OA 4OQDA 3CINA