4DBFA

Crystal structures of cg1458
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
269
structure length
258
Chain Sequence
b'HMRFGRIATPDGMCFCSIEGEGDDVANLTAREIEGTPFTEPKFTGREWPLKDVRLLAPMLPSKVVAIGRNYADSLPPTLFLKPPTAVTGPESPIRIPSFATKVEFEGELAVVIGKPCKNVKADDWKSVVLGFTIINDVSSRDLQFADGQWARAKGIDTFGPIGPWIETDINSIDLDNLPIKARLTHDGETQLKQDSNSNQMIMKMGEIIEFITASMTLLPGDVIATGSPAGTEAMVDGDYIEIEIPGIGKLGNPVVDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE ISOMERASE
publication title Crystal structures of Cg1458 reveal a catalytic lid domain and a common catalytic mechanism for FAH family.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 66
structure length 258
sequence length 269
chains with identical sequence B
ec nomenclature ec 4.1.1.-:
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4dbfA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4dbfA02
3QDFA 1WZOA 4PFZA 1QCNA 2WQTA 1HYOA 3R6OA 2Q1DX 1NKQA 2EB5A 4QKUA 5D2IA 4MAQA 2Q1CX 2DFUA 4DBHA 3V77A 2EB4A 3LZKA 2Q18X 5D2HA 1SAWA 5D2GA 4DBFA 3S52A 1SV6A 5D2FA 5D2KA 1QCOA 1QQJA 1NR9A 3RR6A 2Q1AX 3BQBA 5D2JA 1GTTA 1I7OA 2Q19X 2HZYA 2EB6A
chains in the Genus database with same CATH superfamily
4JRKA 2XICA 1H641 1PRLC 4HCCA 2P84A 4IUVA 1ZSZC 3MP1A 1Z9QA 2LTOA 1D0XA 4DQ2A 3S52A 3UATA 1VOMA 4JZ3A 1VQ4A 3TQ7P 2X4XA 2QK0A 2DNUA 2LCCA 2DIQA 3CCMT 1VQ6T 3KUFA 3C12A 4HVUA 1XTDA 4HCKA 1DJ7B 3CCMQ 2CZ6B 3M53A 3QXEB 2MMPA 2BZXA 4C8QD 4XTXA 1PG5B 2Q1AX 3CXCA 2DVJA 1Q7YU 2IG0A 4Z89A 1KHCA 2GQVA 2Y4YA 2GFUA 3P8BB 4K11A 1NLOC 4DBHA 2E6ZA 1VQ5T 3HPWA 1ZQ1A 4IUTA 2P0PA 1YJNT 1UB4A 2K79A 5J26A 4AG1C 3H8ZA 1S72A 4HT8A 3A98A 4B6MA 5GAOr 1BYMA 2RF0A 5IT9E 1UTIA 2KT8A 4C92B 4BI3A 3QWYA 1VQNA 4M7DE 4J9DA 2QQ9A 2RI5A 3S3NA 3INZA 5LJ5h 1BI0A 3LWIA 1QCFA 4M7DC 2DL8A 2V1RA 4UC4A 2EVRA 2JJ9A 3EG3A 3RMSA 2E6NA 1KQSS 1M30A 3QG1A 1WHKA 1WYXA 3QJYA 5HY6A 3SFMA 4E47A 3L2RA 2M9UA 2ED0A 4J9HA 1Q86R 1AHJB 2E3IA 3G6EA 1JEGA 3RESA 4OMQA 3M59A 1VQ9T 4ZN3A 4M77A 3I56A 2ZPIB 2Q19X 3VYHB 3JCMe 3M55A 4ZN1A 4MZPA 2LX7A 3JCMc 1VQ9Q 1HYOA 5M9OA 1KD1U 1IO6A 1RACB 5IXFA 1GRIA 4WF2A 4BD3A 4M7DF 4RKUE 4D6WA 1G5VA 5CKBA 2QTXA 4BUGA 4Q5WA 1IGUA 2CS7A 4M7DG 1YI2A 5D2JA 3Q1JA 3E19A 2VVKA 3G4ST 2YSQA 4PFOA 4BI4A 2EKOA 1BCMA 4C5EA 1VQ8Q 1T3LA 2LCSA 1ZA2B 3NGPA 3G4SQ 1PD0A 1ZBJA 1NE8A 3META 1JRIA 1VQLA 1TG0A 3OSVA 3NTHA 3JCMb 4QW2A 3CMET 1WHJA 5LJ3e 1M1KU 2MWPA 3M57A 3BDLA 4KGVB 1HK9A 2HD0A 2JUFA 2A7YA 2YLBA 2AKLA 4M77B 1MV0B 2K3XA 4OB2B 1K4US 4II1A 4QT7A 2DBMA 3CMEQ 2COWA 2X4JA 4PKCC 4EIKA 2DX1A 3OY9A 1X27A 3NTIA 3QBYA 4N4HA 2E70A 3QUIA 3M0RA 4RCCA 2DD5A 1W70A 3VS6A 4BACA 3UWNA 4C8QF 3CCQT 1W6XA 2ROTA 4XU2A 2XDDA 1YJ9A 2W10A 3P8DA 2CZ7B 2BE9B 1X6GA 1Q86C 2C06A 3EG2A 1B7TA 3L1AA 3V8JA 3CEYA 3LWHA 3EGDA 1QWFA 1AZGB 2L5QA 2F69A 1HSQA 4PLLA 5LJ5f 1UEBA 5KYUA 3J7AF 1VQKA 2PVDB 3VS3A 3JB9D 2A08A 2CP7A 1YWOA 2E65A 2DRKA 2VXFA 1N9RA 1TUGB 3JCMg 3QZ5B 3CCUA 1VQOT 4JZ4A 1RAIB 2LX9A 2L3RA 3CD6A 3LH0A 2ZPHB 5J3BA 4KGZB 3G1JA 1QP3A 1WNLA 3ZBDA 8ATCB 3FJPA 2QEXT 2OX7A 1VQOQ 2D1XA 2PU9B 1Q82R 3MP6A 4OP0A 2Q18X 2P0QA 1SV6A 3ZL7C 2CP0A 1NM7A 2CT3A 2QEXQ 3CCVT 2FVUA 2LVMA 5CKHA 4FIBA 3C4SA 3PIPA 4Y92A 4QVDA 1NPPA 2XDPA 4NOYA 2CP2A 3MEWA 2X51A 5GAMd 2NYSA 3FDRA 2HL5C 3EGDB 2XG8D 3LLRA 3ME9A 1S1NA 3RMQA 1YWPA 5LJ3g 5GAOn 4FCYA 3CBMA 2KRNA 2JW4A 5CR2A 2IPOB 5KYUB 5GANd 1TU0B 4MZTA 1WGSA 5LJ3j 2CP6A 3OS0A 2RQRA 1BI2A 3KXTA 2MPXC 3PMIA 4PJOD 2YDLA 2EIFA 2DBKA 2A36A 2DRMA 1PRMC 1V29B 4FM4B 5CQYA 2DPPB 2PUOB 2G6FX 4J6WA 3NPFA 3SWNA 2WACA 5GAMh 2YLCA 2J05A 5GAOl 1XNIA 3PT9A 1M3AA 4FSXA 4C5HA 2K5LA 3NMZC 1KQSA 1KQSP 2JMAA 5GJWB 2RHZA 4Z88A 4AFZC 1NZ9A 5GANh 2YHTA 5IXBA 1K9MU 2RH2A 4IUPA 4XTZA 4EDUA 4A4HA 3CBPA 1WLPB 1H3ZA 2KNBB 2DJZA 3OA6A 2C0TA 3OMGA 2L3QA 2E41A 3CPWS 2DZCA 4JS4A 3ASKA 1G83A 3I55A 1T3SA 5CKDA 1W2BP 3HRTA 3OW2P 4N4IA 1WZOA 2JOYA 3TEEA 3V8LA 3HRUA 1LJOA 2J6FA 1Y96A 2FPDA 5C0MA 4E2FB 1K9AA 2CZ1B 1Q82C 3UPUA 3CCST 4DBFA 2PTKA 4HVVA 4IIMA 3TVTA 1KFZA 1QVFS 1QVGP 2KBTA 3GBQA 2EGCA 2OTLT 3SWNB 2JTMA 3CCSQ 1SSHA 1PSEA 3OYHA 2GTOA 2QYZA 4A4GA 4A4EA 5D2IA 1OOTA 2AIRB 5GAN4 1BIBA 2AZVA 1XQHA 5ECAA 4F7UF 1U8RA 2K57A 4KGXB 1NJIU 4A53A 3UF4A 1PWTA 2FG0A 1NYFA 2K2VA 4C8QA 2FL7A 3GPLA 4N4GA 2J7IA 4M77E 1K73U 3OYNA 2C0OA 2IIMA 2M0YA 2HQEA 4Z8AA 1RAFB 4AFSC 4M77C 1QW1A 2FRWA 2R5AA 4PJJA 2FPEA 4EMKA 1Y96B 2ZCFB 1G3WA 2ED1A 3CPFA 4M7AD 2XDBA 4CC4B 1IB8A 2AT1B 3HFNA 1BKBA 3NFCA 4OB0B 1I7OA 1JXOA 2YUNA 1UGSB 4J5YA 2PZ1A 1GFCA 2LQNA 2LQKA 4L59A 4XU1A 4DBQA 1EZZB 3LGLA 2KDSA 1AWWA 2HMAA 5D6YA 2JMCA 2EB4A 3J80E 1N8RR 1X2KA 3CBOA 3OQ5A 2FPFA 2A37A 1J3TA 1QKWA 5LJ5e 3M0PA 1B34A 2LDMA 4QQGA 5GMKi 2D0QB 4C8QB 3E9FA 3QPHA 2RM4A 2RO0A 4M77G 4CC2A 2XU8A 4BE1A 2FRYA 4OMNA 3G71T 5CKFA 1R8OB 3CCRT 4MZMA 5CKEA 4EMKB 1OEBA 2CUDA 1SSFA 2EYXA 2I0NA 3HSBA 2L3SA 1X43A 3RERA 3G71Q 1WHHA 3EG0A 1G3TA 1CKBA 3MPUB 2EYYA 5KCHA 3JCMW 4J9CA 2QQSA 1GFDA 4X9CA 2DXUA 1BB9A 1VQMA 2DERA 2LJ3A 7AT1B 1GTTA 3OYDA 1C0MA 4LE9A 3REBB 2XK0A 2CYZB 3VS0A 4D8DA 2MAMA 2KT1A 1G2BA 2X9HA 4LUDA 4OGEA 1B34B 1RLPC 3L2QA 4FU6A 5GAN3 1KC8C 4LUEA 2CP3A 4XK8E 3AHUA 4QVCA 2L3PA 6AT1B 1TSFA 3CC4T 2KGTA 1OI1A 1AT1B 3A5ZB 4EMGA 1I0CA 1WJSA 3DLLA 1MNEA 1WHMA 2EJFA 1PCXA 3CC4Q 1U1TA 2O9VA 1YP5A 4E7IA 3VJPA 2LT1A 1N5ZA 4N0AA 1VQ4Q 2EQMA 1N8RC 5LL6S 5CQXA 2XD0A 3WVDB 1H92A 4FYWB 1K8AU 1WQ7A 1UE9A 2ZZDA 2PUKB 2HNIA 4BE2A 4JJBA 2Q1DX 1WXTA 3M0UA 1JO8A 4EPCA 1UJYA 4M78D 4OMOA 4ZTJA 1SAWA 4ATOA 3CPWA 2DEUA 3E2UA 3H0IA 1QLYA 4A54A 3JB9I 1I07A 4HT9A 5LJ5g 1BIAA 3CXCP 4BDYA 1PSFA 2X3XD 5LJ5d 4JRIA 2K9GA 2QAZA 4F7UA 2DILA 2ZPGB 2OTJA 2EFIA 1SPKA 4AMCA 3CCMA 1HD3A 1VYTA 3PNWC 1VQ6A 4L5GA 5FW9A 1VQNT 1VQPA 1QVFA 2M0OA 2ZPFB 4FL6A 1RAAB 1NPRA 3PVQA 4ELZC 2KVQG 3QIIA 3SWNC 1VQNQ 3QSUA 2DXTA 4KH1B 2L89A 4Z02A 2OAWA 3A8MB 2QGGA 2GCXA 3G7ZA 2RA2A 2DL7A 2BTTA 4IIOA 2K5FA 3SDZA 2BIVA 3FC3A 1X75C 4M75D 1OZ3A 1VQ5A 4J9BA 1K0SA 2KY9A 1OX8A 1YJNA 2EJGA 2QI2A 1NEBA 1YFNA 1A0NB 1M1FA 1Q81U 1WIEA 4KUIA 1QMCA 3HKSA 1SEMA 4F7UB 5GAN5 4JRQA 2C0IA 3CCLA 4IUUA 3I56Q 3V7SA 2KMTA 4BY6B 2PVGB 1YJWT 4E7KA 2L8DA 3KFVA 4X34A 1MMNA 3QDFA 5GMKj 1XOVA 2RHYA 2DKGA 2QQAA 5KCOA 3GLXA 1O75A 1YJWQ 1AVZC 2E1HA 4PJOA 1M90U 3EG9A 4CI0C 4RCBA 4J9IA 1M3CA 1VQ8T 3VUBA 2Z0WA 2HAXA 3LYIA 1TTHB 4PJNA 1HXDA 2DL5A 1NR9A 3THKA 2KK4A 4NL3A 1U3OA 1BK2A 4C8QE 2X4YA 3OS5A 4LNPA 5GAMe 1N9SA 1W4SA 3L2UA 1VQ9A 4C8QC 1YIJT 3M4GA 2AK5A 4MAQA 3TSWA 5GANe 2A28A 1PD1A 4AFUC 1YIJQ 3RNJA 4FW2A 2WSCE 2R57A 4EMKC 2JS2A 4EMHA 1YITT 1T0HA 2COZA 4HKEA 3JCMX 3VYGA 4PLIA 1YCYA 3G4SA 2HBPA 2KROA 4OB1B 1UUEA 3LZKA 1YJ9T 1MMGA 1YITQ 4PJOB 3EG9B 4OF1A 4J7IA 2O01E 4LD6A 2EW3A 5AT1B 1VIFA 2RK1A 5KYXA 1AWOA 3M58A 2X4WA 4PL6A 3FRNA 1YJ9Q 1KQ1A 2B8AA 1EFNA 3VS1A 2YT6A 4C8QG 1FXXA 2GFAA 1IHWA 5DM7R 2V8JA 3X20B 5A0LA 3QYGB 1OU9A 4C92D 3GNFB 4DEXA 2CGHA 1JB0E 2F1LA 4J8OA 2LP5A 4OMPA 1GBRA 2ATCB 1OQKA 3SEMA 3HHTB 3CMAA 2YUQA 2EQIA 1BI1A 4E7JA 2EGEA 3A1PA 2Q1CX 2K2MA 4O6JA 4GBQA 5KYWA 3RIRA 1Y0MA 5I2SA 4RMOA 3CCQA 5DLQE 2ESWA 4ZGJB 5IAYA 4R55A 3CCUQ 5GAOm 1IZ6A 5AYFA 4M7AA 4MDXA 3CD6Q 4J9FA 2EYZA 4RG2A 2NWMA 1D1AA 3BE3A 1TXQA 4XAXB 3OYGA 1QCNA 2FZKB 5C6SA 5GAN6 1UHFA 2BZ8A 5I21A 5D6XA 3EFOA 1WA7A 5KYXB 1SF9A 3I5SA 5IHNA 3OYFA 3DKMA 3DB3A 1ZUYA 3FJ5A 4E7LA 1ZUKA 1GL5A 2KRMA 4HVWA 2FZCB 5GAMg 4KH0B 3LX7A 1IRXA 3RKYA 1I1JA 5GAMj 2FEIA 1KIKA 5GANg 1VQOA 1M2OA 4PK4A 2LJ1A 1U06A 3X24B 2AKKA 2EQKA 1PHTA 4C0ZA 3A8HB 5GANj 3M5AA 3EAEA 2D8HA 2FB7A 3BQBA 5KYWB 2QEXA 2VGNA 1X01A 3OYAA 3S3OA 5CCAA 1TUDA 4FW1A 1B07A 3L2ZA 3LGFA 5CVIA 4M7AB 4N0AC 3VKIA 1RADB 3ER0A 1Q7YR 3HFOA 4E6RA 4A63B 2ZPEB 3CCVA 2DA9A 3T9NA 4AFQC 4PJMA 2NUPA 3EFOB 1PKSA 1YNZA 2JS0A 2GBQA 3QKJA 5FWCA 1OX9A 3RR6A 2F2VA 4F17A 1D09B 2DK3A 4ME7A 2RHXA 2ZAEA 4FT2A 5A0GA 2CH4W 5FROA 4AT1B 3SD4A 3N5BB 2KR3A 2MYSA 3PVLA 2QTVA 2DYIA 4J83A 1ZLMA 3OYJA 2DJQA 2DFUA 4OMFB 4F7UE 2HBWA 2X3WD 4JRPA 2DTIA 3MHXA 4BB7A 3JB9J 2E5KA 2YWWA 2OAUA 3REAB 3I55Q 2RQTA 2KI7A 4ZTFA 4BY6C 2EB6A 4KBMB 1Y71A 4IKFA 1ZA1B 2DTHA 1V1CA 4RTWA 2XI9A 3C94A 2O2OA 4Y28E 2DL4A 3X26B 2GGRA 3QO3A 2MWOA 3E1SA 4MMKA 1KQ2A 4GLKA 5EG2A 5IHKA 2RJEA 2QDLA 2NUPB 1G3SA 2QA4A 2D0NA 5FU6B 2FHDA 1UFFA 3CC2A 1CSKA 5GMKl 3S3MA 3O8VA 5I11A 5KYNA 4M78A 3GIBA 2JN0A 2V26A 2HEQA 1KD1R 2RJCA 4KULA 3MEVA 4F7UG 3GNGA 3JB9F 1Q86U 1K76A 5IN1A 3PMTA 3CCSA 3JB9G 2MIOA 3AT1B 1RUWA 5I22A 3OB9A 4IURA 4JLGA 1Q7YC 4PJOE 2K6DA 2OTLA 3V7RA 3V7CA 2QASA 3VUZA 3ZFJA 4OVAA 2DTOA 4PJOC 2P4TA 2YUOA 1UGPB 2NLUA 1M1KR 1YN8A 3CC7T 3CCJA 2GQIA 2YXYA 3QHSA 1NBEB 4C5IA 1QWEA 2B86A 1E6HA 1M9SA 3CC7Q 1NLPC 1YHQA 2W0ZA 4WTOB 1N6AA 3JCMJ 3H6ZA 4M78B 2EWNA 3UA6A 2HKNA 3L42A 3EHQA 4Y91A 3EGUA 4M75A 2DL3A 5L23A 3VS5A 4L6V5 1I5OB 2M51A 1IGQA 3HP9A 2EB5A 2Y4XA 5GAOp 3HTRA 3OYMA 4PJOF 3CCET 2O88A 4FYYB 4E7SA 3WVEB 4FT4A 1M3BA 4PJOG 5D7UA 4CRIA 3OS1A 2EBPA 1WHLA 2G3RA 1QP2A 2DETA 4RTTA 1UDLA 3CCEQ 4C0DC 2LJ0A 1N27A 3A8OB 2JTFA 1SRLA 1QVPA 2RMOA 3EHRA 3HL8A 1Y57A 3U23A 3OYIA 4LDXA 2E12A 1KD1C 1IREB 3CQTA 2LZ6B 1VQ7T 1UGVA 1WXUA 2ZGWA 4QQDA 3FLGA 4HXJA 2Y90A 3H41A 3G71A 1SKUB 3CCRA 2RPNA 4M75B 2EAYA 1VQ7Q 3MEAA 4A4KA 1RL2A 1B3QA 4AG2C 2CDTA 1U1SA 1RLQC 2ZPBB 4CC7A 4OGCA 4J9EA 4JLIA 2LQWA 3HRSA 3MP8A 4M7AE 1M4ZA 2VV5A 4M7DD 3EG1A 1JBMA 3M54A 5FU7B 4P5NA 2RQVA 4E7ZA 1VQ4T 1M1KC 2VWFA 5KH6A 4M7AC 5HK0A 1UGQB 2CH4A 2WSFE 3GP8A 3RUXA 2DE0X 3JB9H 4WCIA 4IUQA 1G3YA 3C0CA 2EQJA 1UG1A 1SRMA 1Q82U 4DA4A 4LDUA 4JJCA 2M16A 3DB4A 2GTJA 1RI9A 4ESRA 4HCBA 1MMAA 3VRYA 3CC4A 3OYYA 3BY7A 1TH7A 1I8FA 2RI3A 3IQLA 5D2FA 3CPWP 4J6XA 2OTJT 5D2KA 4DBRA 1OV3A 4C92A 1AD5A 1ZUUA 4M7AF 3MO8A 2RJFA 1TWBA 5LJ5j 3OSSC 1VQPT 2V1QA 3SHWA 4C0FA 2OTJQ 4M7AG 3M0SA 1S72T 4LN2A 5KE2A 1FYNA 1VQ6Q 2A3LA 5EC7A 1VQPQ 1K9MR 4LD9K 4ZGEB 5KYYA 4RG8A 3OYBA 3VRZA 1QVFP 1ABQA 1S72Q 1UECA 3M0QA 1MV3A 4LXCA 1IHVA 1H3HA 2O31A 4RTXA 3UDCA 4DEYA 4A4FA 2H8HA 4J9GA 2O4XA 5FU6C 2H3EB 1WJQA 4QVZA 1BU1A 5CK9A 3EH2A 1AWJA 1WDXA 3BDUA 2DM1A 1VQ5Q 2VC8A 2RJDA 3G6ET 2KXDA 3CCLT 3H0HA 1LNXA 1OU8A 3C95A 1D3BA 2MF2A 1M1GA 1YJNQ 1JJ2S 3I56T 2RHUA 2XKOC 3G6EQ 3EH1A 3CCLQ 3NTKA 2RD1A 1KSWA 5CO7A 3QYHB 2AZSA 2M1HA 2L2PA 2LC4A 1U5SA 2CP5A 4KRTA 5GAN2 4ELYC 1NJIR 4RTVA 2R58A 4BE0A 5KYYB 2CSQA 1ABOA 1KHIA 1F1BB 4JJDA 1YI2T 4BDZA 1M2VA 3M0TA 1E7OA 3VV0A 1K73R 1WI7A 2LCLA 3TREA 1WFWA 5GJVB 3TU4K 2H3JA 3OMCA 4M78E 2O4XB 1YI2Q 2RNAA 2QXFA 4OMMA 3X28B 1WHGA 3I35A 1OPKA 1VQLT 1W2BS 3M9QA 3LW5E 2CUBA 3OW2S 4M78C 2DLPA 2VXEA 2FZGB 1X6BA 4HA8A 5I2MA 5GAN8 2BE7D 1PM3A 4C0GA 1YJWA 3OYLA 4YTLA 4XU0A 1D3BB 1ZBXA 2HCKA 1NYGA 1VQLQ 2HSEB 3JCMQ 5D2HA 3VU3C 3OYCA 4BI8B 4XTUA 1P92A 2BZYA 1PC0A 4RTZA 3JCMP 2QQBA 3JRZA 1K9MC 3LH5A 1QVGS 1TOVA 2HL3A 2DVEA 1ACMB 1KC8U 1FX7A 1PKTA 2DEQA 1NG2A 4B9XA 1VQ8A 1TS9A 5A2QE 3L2WA 2MCNA 5FWBA 4DOWA 1VYUA 2DMOA 4RUGA 2VGMA 5GMKh 4R0KA 1OYXA 1M2VB 1X6OA 4LDYA 4XQ3A 2QG9B 4GY5A 3RDVA 4M78F 4XTWA 1AEYA 3FB9A 1YIJA 8AT1B 3MEUA 1QKXA 2KSSA 3OBWA 4M78G 5DLOA 4PFZA 1V76A 4PNOA 1N8RU 3PE0A 2KYBA 3GF5A 4M75E 3OS2A 3S6WA 4RTYA 3CMEA 4QKUA 2E64A 1O9SA 3QDRB 2WSEE 2K3YA 3CMAT 1KG1A 2HQHA 4M75C 1E6GA 2EQUA 4KT0E 2QGFB 1FWZA 1EIFA 4NS5A 4RTUA 3A8LB 4D8KA 3I9QA 1YITA 2JM8A 1WPYA 1VQKT 5IHIA 3EGXA 2EJ9A 3RKWA 2L0AA 2DO3A 5HK3A 2PQWA 5HKCA 3L2VA 4OB3B 3CMAQ 2PVOB 1NJIC 2KAFA 5FRNA 3VS4A 2XMFA 3CCUT 5FU7C 1M5Q1 1VQKQ 1NKQA 2KXCA 2K5IA 3CD6T 3CCQQ 1K73C 3V77A 3R6NA 1GCQA 2V8IA 4FSSA 2XHCA 3MCAB 3TCJA 4JJNK 2IVWA 1VA7A 3E9GA 1I5LA 4C0DB 1LVKA 3BW1A 1M27C 5KE3A 1WQWA 2VKNA 4M75F 2A0FB 2KE9A 4M75G 2ECZA 1T0JA 2F2WA 1RABB 4X9DA 1Z9ZA 4MMLA 3D7SB 5IH2A 1ZSZA 2MI6A 2DF6A 2HZYA 3JCMd 1XJWB 3PIOA 3UT1A 1UHCA 3EGXB 4M4ZA 4XTVA 1TUCA 1K8AR 3QZ9B 1K0XA 1D1CA 1GBQA 1VUBA 1MGQA 3FIFA 4NL2A 2F5KA 3ZEHA 2K3BA 1PNJA 1NEGA 2DXCA 2DAQA 5DY9A 2HDAA 1BI3A 1WX6A 1MNDA 3TSZA 2RQUA 1I4K1 4CC3A 2P0KA 5GAN7 2LNHB 1AZEA 3EFSA 3CCVQ 1M8VA 1K1ZA 2E3HA 5GMKm 2DXBA 2KRSA 2RB6A 1OZ2A 1AOJA 4M77D 3JCMh 1RAEB 3EFRA 5LJ3d 5GAOq 2RQWA 1LCKA 4QQ6A 1D1BA 4MDWA 1YBYA 2OJ2A 3WXMB 1JXMA 3ULRB 4C92E 1JJ2P 1JJ2A 1R0CB 2SRCA 3R6OA 1ZSZB 3I55T 2NUTA 4C92C 3V8KA 2LRQA 2RHIA 1ZSGA 5D2GA 2JT4A 2J6KA 1MMDA 1SHGA 2MK5A 3O5ZA 2FO0A 1LPLA 2BKDN 4F16A 1UJ0A 1C1AA 1CKAA 5CAIA 2E10A 3PFSA 2RI2A 2CKKA 4M7DA 1Y07A 2JZ2A 1X69A 5LJ3h 2DZ9A 3RBBB 1VYVA 4JPBW 2QA4T 3QJ6A 2NUZA 2LT4A 1W1FA 1ZX6A 2F5TX 1M8MA 5J39A 3VS2A 4J7FA 3CC2T 2EYQA 4KUDK 1Q81R 3CXCS 3GOXA 2D8JA 1HJDA 3JCMV 3PGGA 4JDSA 3M4YA 2QA4Q 4E7HA 3OW2A 1W2BA 3UA7A 4O5VA 1JQQA 4JS5A 1RAGB 2EYWA 3M56A 3MJXA 4C92F 4JUVA 3CC2Q 2D6FA 3F70A 1K8AC 4C92G 3H0FA 1ZHIA 1LOJA 2VB6A 3X25B 1OPLA 2NUTB 2KYMA 1M90R 3QWXX 1QVGA 2KEAA 1KJWA 3KBGA 1R0BG 2OI3A 9ATCB 3URGA 1ARKA 3P8HA 1JU5C 1D0ZA 2CREA 3A8GB 2YRVA 1FMKA 2OTLQ 1AWXA 4LDVA 4M7DB 3MKDA 3NHNA 3JV3A 2MOXA 3CCJT 1G8XA 5HCKA 1QQJA 4XTYA 1C6VX 4FYXB 2ABLA 1GXIE 4TVRA 3CCJQ 1YHQT 2BUDA 2KQWA 1EX4A 2QQRA 1KC8R 3I5RA 4X1VA 2VYTA 3DLMA 2E4HA 1OULA 1YHQQ 3PTAA 2HKQB 4ZNXA 2DIGA 4DOVA 3SB2A 2GNCA 4F04B 4J6YA 4ORZA 2PNIA 1WJRA 1UGRB 2CZ0B 2X35A 2V8KA 2HQXA 3JCMf 2O9SA 2YRCA 3JSCA 2GF7A 2DD4A 1Q95G 1KK7A 1SG5A 2AHJB 2LNVA 2EPDA 4ZGDB 3CC7A 2FYKA 2R5MA 3BFMA 2JTEA 2EKHA 2EGAA 4GLMA 4M77F 5CIUA 4ANJA 1Q81C 1IXDA 1VQMT 1RAHB 3OBYA 2WQTA 5FLXE 2JXBA 4OMLA 1MUZA 3OYKA 5L8RE 3VS7A 5GAMf 2JNGA 3J81E 1SHFA 1D0YA 2LQ8A 2XIDA 2DYBA 1VQMQ 2J06A 3FEOA 2SEMA 5GANf 1BCOA 1M90C 4PJLA 2ENMA 1H8KA 5LJ3f 1WXBA 2D9TA 2HSPA 4FYVB 2QDYB 4F14A 2ROLA 2M02A 4V2SA 4LDWA 3CCRQ 3CCEA 2CSIA 1RI0A 1Y7XA 2JM9A 2I2LA 4HCZA 3JAME 2F2XA 3H9NA 1GCPA 1I81A 2K4YA 2JVVA 4VUBA 4XU3A 1MHNA 4PFPA 2RN8A 2YRDA 2COYA 1BBZA 1YCSB 3RKXA 1X2QA 1GCQC 1R77A 3OYEA 2YUPA 2VUBA 2K7AA 4B9WA 2RK2A 2E5QA 2LMJA 2P4RA 2J6OA 1FMWA 4C5GA 1VQ7A 5A0DA 1VIEA 4R56A 1QCOA 1FMVA 2VASA 2CT4A 5D6WA 5FRMA 5GMKe
chains in the Genus database with same CATH topology
3QDFA 1WZOA 4PFZA 1QCNA 2WQTA 1HYOA 3R6OA 2Q1DX 1NKQA 2EB5A 4QKUA 5D2IA 4MAQA 2Q1CX 2DFUA 4DBHA 3V77A 2EB4A 3LZKA 2Q18X 5D2HA 1SAWA 5D2GA 4DBFA 3S52A 1SV6A 5D2FA 5D2KA 1QCOA 1QQJA 1NR9A 3RR6A 2Q1AX 3BQBA 5D2JA 1GTTA 1I7OA 2Q19X 2HZYA 2EB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QDF A;  1WZO A;  4PFZ A;  1QCN A;  2WQT A;  1HYO A;  3R6O A;  2Q1D X;  1NKQ A;  2EB5 A;  4QKU A;  5D2I A;  4MAQ A;  2Q1C X;  2DFU A;  4DBH A;  3V77 A;  2EB4 A;  3LZK A;  2Q18 X;  5D2H A;  1SAW A;  5D2G A;  4DBF A;  3S52 A;  1SV6 A;  5D2F A;  5D2K A;  1QCO A;  1QQJ A;  1NR9 A;  3RR6 A;  2Q1A X;  3BQB A;  5D2J A;  1GTT A;  1I7O A;  2Q19 X;  2HZY A;  2EB6 A; 
#chains in the Genus database with same CATH topology
 4JRK A;  2XIC A;  1H64 1;  1PRL C;  4HCC A;  2P84 A;  4IUV A;  1ZSZ C;  3MP1 A;  1Z9Q A;  2LTO A;  1D0X A;  4DQ2 A;  3S52 A;  3UAT A;  1VOM A;  4JZ3 A;  1VQ4 A;  3TQ7 P;  2X4X A;  2QK0 A;  2DNU A;  2LCC A;  2DIQ A;  3CCM T;  1VQ6 T;  3KUF A;  3C12 A;  4HVU A;  1XTD A;  4HCK A;  1DJ7 B;  3CCM Q;  2CZ6 B;  3M53 A;  3QXE B;  2MMP A;  2BZX A;  4C8Q D;  4XTX A;  1PG5 B;  2Q1A X;  3CXC A;  2DVJ A;  1Q7Y U;  2IG0 A;  4Z89 A;  1KHC A;  2GQV A;  2Y4Y A;  2GFU A;  3P8B B;  4K11 A;  1NLO C;  4DBH A;  2E6Z A;  1VQ5 T;  3HPW A;  1ZQ1 A;  4IUT A;  2P0P A;  1YJN T;  1UB4 A;  2K79 A;  5J26 A;  4AG1 C;  3H8Z A;  1S72 A;  4HT8 A;  3A98 A;  4B6M A;  5GAO r;  1BYM A;  2RF0 A;  5IT9 E;  1UTI A;  2KT8 A;  4C92 B;  4BI3 A;  3QWY A;  1VQN A;  4M7D E;  4J9D A;  2QQ9 A;  2RI5 A;  3S3N A;  3INZ A;  5LJ5 h;  1BI0 A;  3LWI A;  1QCF A;  4M7D C;  2DL8 A;  2V1R A;  4UC4 A;  2EVR A;  2JJ9 A;  3EG3 A;  3RMS A;  2E6N A;  1KQS S;  1M30 A;  3QG1 A;  1WHK A;  1WYX A;  3QJY A;  5HY6 A;  3SFM A;  4E47 A;  3L2R A;  2M9U A;  2ED0 A;  4J9H A;  1Q86 R;  1AHJ B;  2E3I A;  3G6E A;  1JEG A;  3RES A;  4OMQ A;  3M59 A;  1VQ9 T;  4ZN3 A;  4M77 A;  3I56 A;  2ZPI B;  2Q19 X;  3VYH B;  3JCM e;  3M55 A;  4ZN1 A;  4MZP A;  2LX7 A;  3JCM c;  1VQ9 Q;  1HYO A;  5M9O A;  1KD1 U;  1IO6 A;  1RAC B;  5IXF A;  1GRI A;  4WF2 A;  4BD3 A;  4M7D F;  4RKU E;  4D6W A;  1G5V A;  5CKB A;  2QTX A;  4BUG A;  4Q5W A;  1IGU A;  2CS7 A;  4M7D G;  1YI2 A;  5D2J A;  3Q1J A;  3E19 A;  2VVK A;  3G4S T;  2YSQ A;  4PFO A;  4BI4 A;  2EKO A;  1BCM A;  4C5E A;  1VQ8 Q;  1T3L A;  2LCS A;  1ZA2 B;  3NGP A;  3G4S Q;  1PD0 A;  1ZBJ A;  1NE8 A;  3MET A;  1JRI A;  1VQL A;  1TG0 A;  3OSV A;  3NTH A;  3JCM b;  4QW2 A;  3CME T;  1WHJ A;  5LJ3 e;  1M1K U;  2MWP A;  3M57 A;  3BDL A;  4KGV B;  1HK9 A;  2HD0 A;  2JUF A;  2A7Y A;  2YLB A;  2AKL A;  4M77 B;  1MV0 B;  2K3X A;  4OB2 B;  1K4U S;  4II1 A;  4QT7 A;  2DBM A;  3CME Q;  2COW A;  2X4J A;  4PKC C;  4EIK A;  2DX1 A;  3OY9 A;  1X27 A;  3NTI A;  3QBY A;  4N4H A;  2E70 A;  3QUI A;  3M0R A;  4RCC A;  2DD5 A;  1W70 A;  3VS6 A;  4BAC A;  3UWN A;  4C8Q F;  3CCQ T;  1W6X A;  2ROT A;  4XU2 A;  2XDD A;  1YJ9 A;  2W10 A;  3P8D A;  2CZ7 B;  2BE9 B;  1X6G A;  1Q86 C;  2C06 A;  3EG2 A;  1B7T A;  3L1A A;  3V8J A;  3CEY A;  3LWH A;  3EGD A;  1QWF A;  1AZG B;  2L5Q A;  2F69 A;  1HSQ A;  4PLL A;  5LJ5 f;  1UEB A;  5KYU A;  3J7A F;  1VQK A;  2PVD B;  3VS3 A;  3JB9 D;  2A08 A;  2CP7 A;  1YWO A;  2E65 A;  2DRK A;  2VXF A;  1N9R A;  1TUG B;  3JCM g;  3QZ5 B;  3CCU A;  1VQO T;  4JZ4 A;  1RAI B;  2LX9 A;  2L3R A;  3CD6 A;  3LH0 A;  2ZPH B;  5J3B A;  4KGZ B;  3G1J A;  1QP3 A;  1WNL A;  3ZBD A;  8ATC B;  3FJP A;  2QEX T;  2OX7 A;  1VQO Q;  2D1X A;  2PU9 B;  1Q82 R;  3MP6 A;  4OP0 A;  2Q18 X;  2P0Q A;  1SV6 A;  3ZL7 C;  2CP0 A;  1NM7 A;  2CT3 A;  2QEX Q;  3CCV T;  2FVU A;  2LVM A;  5CKH A;  4FIB A;  3C4S A;  3PIP A;  4Y92 A;  4QVD A;  1NPP A;  2XDP A;  4NOY A;  2CP2 A;  3MEW A;  2X51 A;  5GAM d;  2NYS A;  3FDR A;  2HL5 C;  3EGD B;  2XG8 D;  3LLR A;  3ME9 A;  1S1N A;  3RMQ A;  1YWP A;  5LJ3 g;  5GAO n;  4FCY A;  3CBM A;  2KRN A;  2JW4 A;  5CR2 A;  2IPO B;  5KYU B;  5GAN d;  1TU0 B;  4MZT A;  1WGS A;  5LJ3 j;  2CP6 A;  3OS0 A;  2RQR A;  1BI2 A;  3KXT A;  2MPX C;  3PMI A;  4PJO D;  2YDL A;  2EIF A;  2DBK A;  2A36 A;  2DRM A;  1PRM C;  1V29 B;  4FM4 B;  5CQY A;  2DPP B;  2PUO B;  2G6F X;  4J6W A;  3NPF A;  3SWN A;  2WAC A;  5GAM h;  2YLC A;  2J05 A;  5GAO l;  1XNI A;  3PT9 A;  1M3A A;  4FSX A;  4C5H A;  2K5L A;  3NMZ C;  1KQS A;  1KQS P;  2JMA A;  5GJW B;  2RHZ A;  4Z88 A;  4AFZ C;  1NZ9 A;  5GAN h;  2YHT A;  5IXB A;  1K9M U;  2RH2 A;  4IUP A;  4XTZ A;  4EDU A;  4A4H A;  3CBP A;  1WLP B;  1H3Z A;  2KNB B;  2DJZ A;  3OA6 A;  2C0T A;  3OMG A;  2L3Q A;  2E41 A;  3CPW S;  2DZC A;  4JS4 A;  3ASK A;  1G83 A;  3I55 A;  1T3S A;  5CKD A;  1W2B P;  3HRT A;  3OW2 P;  4N4I A;  1WZO A;  2JOY A;  3TEE A;  3V8L A;  3HRU A;  1LJO A;  2J6F A;  1Y96 A;  2FPD A;  5C0M A;  4E2F B;  1K9A A;  2CZ1 B;  1Q82 C;  3UPU A;  3CCS T;  4DBF A;  2PTK A;  4HVV A;  4IIM A;  3TVT A;  1KFZ A;  1QVF S;  1QVG P;  2KBT A;  3GBQ A;  2EGC A;  2OTL T;  3SWN B;  2JTM A;  3CCS Q;  1SSH A;  1PSE A;  3OYH A;  2GTO A;  2QYZ A;  4A4G A;  4A4E A;  5D2I A;  1OOT A;  2AIR B;  5GAN 4;  1BIB A;  2AZV A;  1XQH A;  5ECA A;  4F7U F;  1U8R A;  2K57 A;  4KGX B;  1NJI U;  4A53 A;  3UF4 A;  1PWT A;  2FG0 A;  1NYF A;  2K2V A;  4C8Q A;  2FL7 A;  3GPL A;  4N4G A;  2J7I A;  4M77 E;  1K73 U;  3OYN A;  2C0O A;  2IIM A;  2M0Y A;  2HQE A;  4Z8A A;  1RAF B;  4AFS C;  4M77 C;  1QW1 A;  2FRW A;  2R5A A;  4PJJ A;  2FPE A;  4EMK A;  1Y96 B;  2ZCF B;  1G3W A;  2ED1 A;  3CPF A;  4M7A D;  2XDB A;  4CC4 B;  1IB8 A;  2AT1 B;  3HFN A;  1BKB A;  3NFC A;  4OB0 B;  1I7O A;  1JXO A;  2YUN A;  1UGS B;  4J5Y A;  2PZ1 A;  1GFC A;  2LQN A;  2LQK A;  4L59 A;  4XU1 A;  4DBQ A;  1EZZ B;  3LGL A;  2KDS A;  1AWW A;  2HMA A;  5D6Y A;  2JMC A;  2EB4 A;  3J80 E;  1N8R R;  1X2K A;  3CBO A;  3OQ5 A;  2FPF A;  2A37 A;  1J3T A;  1QKW A;  5LJ5 e;  3M0P A;  1B34 A;  2LDM A;  4QQG A;  5GMK i;  2D0Q B;  4C8Q B;  3E9F A;  3QPH A;  2RM4 A;  2RO0 A;  4M77 G;  4CC2 A;  2XU8 A;  4BE1 A;  2FRY A;  4OMN A;  3G71 T;  5CKF A;  1R8O B;  3CCR T;  4MZM A;  5CKE A;  4EMK B;  1OEB A;  2CUD A;  1SSF A;  2EYX A;  2I0N A;  3HSB A;  2L3S A;  1X43 A;  3RER A;  3G71 Q;  1WHH A;  3EG0 A;  1G3T A;  1CKB A;  3MPU B;  2EYY A;  5KCH A;  3JCM W;  4J9C A;  2QQS A;  1GFD A;  4X9C A;  2DXU A;  1BB9 A;  1VQM A;  2DER A;  2LJ3 A;  7AT1 B;  1GTT A;  3OYD A;  1C0M A;  4LE9 A;  3REB B;  2XK0 A;  2CYZ B;  3VS0 A;  4D8D A;  2MAM A;  2KT1 A;  1G2B A;  2X9H A;  4LUD A;  4OGE A;  1B34 B;  1RLP C;  3L2Q A;  4FU6 A;  5GAN 3;  1KC8 C;  4LUE A;  2CP3 A;  4XK8 E;  3AHU A;  4QVC A;  2L3P A;  6AT1 B;  1TSF A;  3CC4 T;  2KGT A;  1OI1 A;  1AT1 B;  3A5Z B;  4EMG A;  1I0C A;  1WJS A;  3DLL A;  1MNE A;  1WHM A;  2EJF A;  1PCX A;  3CC4 Q;  1U1T A;  2O9V A;  1YP5 A;  4E7I A;  3VJP A;  2LT1 A;  1N5Z A;  4N0A A;  1VQ4 Q;  2EQM A;  1N8R C;  5LL6 S;  5CQX A;  2XD0 A;  3WVD B;  1H92 A;  4FYW B;  1K8A U;  1WQ7 A;  1UE9 A;  2ZZD A;  2PUK B;  2HNI A;  4BE2 A;  4JJB A;  2Q1D X;  1WXT A;  3M0U A;  1JO8 A;  4EPC A;  1UJY A;  4M78 D;  4OMO A;  4ZTJ A;  1SAW A;  4ATO A;  3CPW A;  2DEU A;  3E2U A;  3H0I A;  1QLY A;  4A54 A;  3JB9 I;  1I07 A;  4HT9 A;  5LJ5 g;  1BIA A;  3CXC P;  4BDY A;  1PSF A;  2X3X D;  5LJ5 d;  4JRI A;  2K9G A;  2QAZ A;  4F7U A;  2DIL A;  2ZPG B;  2OTJ A;  2EFI A;  1SPK A;  4AMC A;  3CCM A;  1HD3 A;  1VYT A;  3PNW C;  1VQ6 A;  4L5G A;  5FW9 A;  1VQN T;  1VQP A;  1QVF A;  2M0O A;  2ZPF B;  4FL6 A;  1RAA B;  1NPR A;  3PVQ A;  4ELZ C;  2KVQ G;  3QII A;  3SWN C;  1VQN Q;  3QSU A;  2DXT A;  4KH1 B;  2L89 A;  4Z02 A;  2OAW A;  3A8M B;  2QGG A;  2GCX A;  3G7Z A;  2RA2 A;  2DL7 A;  2BTT A;  4IIO A;  2K5F A;  3SDZ A;  2BIV A;  3FC3 A;  1X75 C;  4M75 D;  1OZ3 A;  1VQ5 A;  4J9B A;  1K0S A;  2KY9 A;  1OX8 A;  1YJN A;  2EJG A;  2QI2 A;  1NEB A;  1YFN A;  1A0N B;  1M1F A;  1Q81 U;  1WIE A;  4KUI A;  1QMC A;  3HKS A;  1SEM A;  4F7U B;  5GAN 5;  4JRQ A;  2C0I A;  3CCL A;  4IUU A;  3I56 Q;  3V7S A;  2KMT A;  4BY6 B;  2PVG B;  1YJW T;  4E7K A;  2L8D A;  3KFV A;  4X34 A;  1MMN A;  3QDF A;  5GMK j;  1XOV A;  2RHY A;  2DKG A;  2QQA A;  5KCO A;  3GLX A;  1O75 A;  1YJW Q;  1AVZ C;  2E1H A;  4PJO A;  1M90 U;  3EG9 A;  4CI0 C;  4RCB A;  4J9I A;  1M3C A;  1VQ8 T;  3VUB A;  2Z0W A;  2HAX A;  3LYI A;  1TTH B;  4PJN A;  1HXD A;  2DL5 A;  1NR9 A;  3THK A;  2KK4 A;  4NL3 A;  1U3O A;  1BK2 A;  4C8Q E;  2X4Y A;  3OS5 A;  4LNP A;  5GAM e;  1N9S A;  1W4S A;  3L2U A;  1VQ9 A;  4C8Q C;  1YIJ T;  3M4G A;  2AK5 A;  4MAQ A;  3TSW A;  5GAN e;  2A28 A;  1PD1 A;  4AFU C;  1YIJ Q;  3RNJ A;  4FW2 A;  2WSC E;  2R57 A;  4EMK C;  2JS2 A;  4EMH A;  1YIT T;  1T0H A;  2COZ A;  4HKE A;  3JCM X;  3VYG A;  4PLI A;  1YCY A;  3G4S A;  2HBP A;  2KRO A;  4OB1 B;  1UUE A;  3LZK A;  1YJ9 T;  1MMG A;  1YIT Q;  4PJO B;  3EG9 B;  4OF1 A;  4J7I A;  2O01 E;  4LD6 A;  2EW3 A;  5AT1 B;  1VIF A;  2RK1 A;  5KYX A;  1AWO A;  3M58 A;  2X4W A;  4PL6 A;  3FRN A;  1YJ9 Q;  1KQ1 A;  2B8A A;  1EFN A;  3VS1 A;  2YT6 A;  4C8Q G;  1FXX A;  2GFA A;  1IHW A;  5DM7 R;  2V8J A;  3X20 B;  5A0L A;  3QYG B;  1OU9 A;  4C92 D;  3GNF B;  4DEX A;  2CGH A;  1JB0 E;  2F1L A;  4J8O A;  2LP5 A;  4OMP A;  1GBR A;  2ATC B;  1OQK A;  3SEM A;  3HHT B;  3CMA A;  2YUQ A;  2EQI A;  1BI1 A;  4E7J A;  2EGE A;  3A1P A;  2Q1C X;  2K2M A;  4O6J A;  4GBQ A;  5KYW A;  3RIR A;  1Y0M A;  5I2S A;  4RMO A;  3CCQ A;  5DLQ E;  2ESW A;  4ZGJ B;  5IAY A;  4R55 A;  3CCU Q;  5GAO m;  1IZ6 A;  5AYF A;  4M7A A;  4MDX A;  3CD6 Q;  4J9F A;  2EYZ A;  4RG2 A;  2NWM A;  1D1A A;  3BE3 A;  1TXQ A;  4XAX B;  3OYG A;  1QCN A;  2FZK B;  5C6S A;  5GAN 6;  1UHF A;  2BZ8 A;  5I21 A;  5D6X A;  3EFO A;  1WA7 A;  5KYX B;  1SF9 A;  3I5S A;  5IHN A;  3OYF A;  3DKM A;  3DB3 A;  1ZUY A;  3FJ5 A;  4E7L A;  1ZUK A;  1GL5 A;  2KRM A;  4HVW A;  2FZC B;  5GAM g;  4KH0 B;  3LX7 A;  1IRX A;  3RKY A;  1I1J A;  5GAM j;  2FEI A;  1KIK A;  5GAN g;  1VQO A;  1M2O A;  4PK4 A;  2LJ1 A;  1U06 A;  3X24 B;  2AKK A;  2EQK A;  1PHT A;  4C0Z A;  3A8H B;  5GAN j;  3M5A A;  3EAE A;  2D8H A;  2FB7 A;  3BQB A;  5KYW B;  2QEX A;  2VGN A;  1X01 A;  3OYA A;  3S3O A;  5CCA A;  1TUD A;  4FW1 A;  1B07 A;  3L2Z A;  3LGF A;  5CVI A;  4M7A B;  4N0A C;  3VKI A;  1RAD B;  3ER0 A;  1Q7Y R;  3HFO A;  4E6R A;  4A63 B;  2ZPE B;  3CCV A;  2DA9 A;  3T9N A;  4AFQ C;  4PJM A;  2NUP A;  3EFO B;  1PKS A;  1YNZ A;  2JS0 A;  2GBQ A;  3QKJ A;  5FWC A;  1OX9 A;  3RR6 A;  2F2V A;  4F17 A;  1D09 B;  2DK3 A;  4ME7 A;  2RHX A;  2ZAE A;  4FT2 A;  5A0G A;  2CH4 W;  5FRO A;  4AT1 B;  3SD4 A;  3N5B B;  2KR3 A;  2MYS A;  3PVL A;  2QTV A;  2DYI A;  4J83 A;  1ZLM A;  3OYJ A;  2DJQ A;  2DFU A;  4OMF B;  4F7U E;  2HBW A;  2X3W D;  4JRP A;  2DTI A;  3MHX A;  4BB7 A;  3JB9 J;  2E5K A;  2YWW A;  2OAU A;  3REA B;  3I55 Q;  2RQT A;  2KI7 A;  4ZTF A;  4BY6 C;  2EB6 A;  4KBM B;  1Y71 A;  4IKF A;  1ZA1 B;  2DTH A;  1V1C A;  4RTW A;  2XI9 A;  3C94 A;  2O2O A;  4Y28 E;  2DL4 A;  3X26 B;  2GGR A;  3QO3 A;  2MWO A;  3E1S A;  4MMK A;  1KQ2 A;  4GLK A;  5EG2 A;  5IHK A;  2RJE A;  2QDL A;  2NUP B;  1G3S A;  2QA4 A;  2D0N A;  5FU6 B;  2FHD A;  1UFF A;  3CC2 A;  1CSK A;  5GMK l;  3S3M A;  3O8V A;  5I11 A;  5KYN A;  4M78 A;  3GIB A;  2JN0 A;  2V26 A;  2HEQ A;  1KD1 R;  2RJC A;  4KUL A;  3MEV A;  4F7U G;  3GNG A;  3JB9 F;  1Q86 U;  1K76 A;  5IN1 A;  3PMT A;  3CCS A;  3JB9 G;  2MIO A;  3AT1 B;  1RUW A;  5I22 A;  3OB9 A;  4IUR A;  4JLG A;  1Q7Y C;  4PJO E;  2K6D A;  2OTL A;  3V7R A;  3V7C A;  2QAS A;  3VUZ A;  3ZFJ A;  4OVA A;  2DTO A;  4PJO C;  2P4T A;  2YUO A;  1UGP B;  2NLU A;  1M1K R;  1YN8 A;  3CC7 T;  3CCJ A;  2GQI A;  2YXY A;  3QHS A;  1NBE B;  4C5I A;  1QWE A;  2B86 A;  1E6H A;  1M9S A;  3CC7 Q;  1NLP C;  1YHQ A;  2W0Z A;  4WTO B;  1N6A A;  3JCM J;  3H6Z A;  4M78 B;  2EWN A;  3UA6 A;  2HKN A;  3L42 A;  3EHQ A;  4Y91 A;  3EGU A;  4M75 A;  2DL3 A;  5L23 A;  3VS5 A;  4L6V 5;  1I5O B;  2M51 A;  1IGQ A;  3HP9 A;  2EB5 A;  2Y4X A;  5GAO p;  3HTR A;  3OYM A;  4PJO F;  3CCE T;  2O88 A;  4FYY B;  4E7S A;  3WVE B;  4FT4 A;  1M3B A;  4PJO G;  5D7U A;  4CRI A;  3OS1 A;  2EBP A;  1WHL A;  2G3R A;  1QP2 A;  2DET A;  4RTT A;  1UDL A;  3CCE Q;  4C0D C;  2LJ0 A;  1N27 A;  3A8O B;  2JTF A;  1SRL A;  1QVP A;  2RMO A;  3EHR A;  3HL8 A;  1Y57 A;  3U23 A;  3OYI A;  4LDX A;  2E12 A;  1KD1 C;  1IRE B;  3CQT A;  2LZ6 B;  1VQ7 T;  1UGV A;  1WXU A;  2ZGW A;  4QQD A;  3FLG A;  4HXJ A;  2Y90 A;  3H41 A;  3G71 A;  1SKU B;  3CCR A;  2RPN A;  4M75 B;  2EAY A;  1VQ7 Q;  3MEA A;  4A4K A;  1RL2 A;  1B3Q A;  4AG2 C;  2CDT A;  1U1S A;  1RLQ C;  2ZPB B;  4CC7 A;  4OGC A;  4J9E A;  4JLI A;  2LQW A;  3HRS A;  3MP8 A;  4M7A E;  1M4Z A;  2VV5 A;  4M7D D;  3EG1 A;  1JBM A;  3M54 A;  5FU7 B;  4P5N A;  2RQV A;  4E7Z A;  1VQ4 T;  1M1K C;  2VWF A;  5KH6 A;  4M7A C;  5HK0 A;  1UGQ B;  2CH4 A;  2WSF E;  3GP8 A;  3RUX A;  2DE0 X;  3JB9 H;  4WCI A;  4IUQ A;  1G3Y A;  3C0C A;  2EQJ A;  1UG1 A;  1SRM A;  1Q82 U;  4DA4 A;  4LDU A;  4JJC A;  2M16 A;  3DB4 A;  2GTJ A;  1RI9 A;  4ESR A;  4HCB A;  1MMA A;  3VRY A;  3CC4 A;  3OYY A;  3BY7 A;  1TH7 A;  1I8F A;  2RI3 A;  3IQL A;  5D2F A;  3CPW P;  4J6X A;  2OTJ T;  5D2K A;  4DBR A;  1OV3 A;  4C92 A;  1AD5 A;  1ZUU A;  4M7A F;  3MO8 A;  2RJF A;  1TWB A;  5LJ5 j;  3OSS C;  1VQP T;  2V1Q A;  3SHW A;  4C0F A;  2OTJ Q;  4M7A G;  3M0S A;  1S72 T;  4LN2 A;  5KE2 A;  1FYN A;  1VQ6 Q;  2A3L A;  5EC7 A;  1VQP Q;  1K9M R;  4LD9 K;  4ZGE B;  5KYY A;  4RG8 A;  3OYB A;  3VRZ A;  1QVF P;  1ABQ A;  1S72 Q;  1UEC A;  3M0Q A;  1MV3 A;  4LXC A;  1IHV A;  1H3H A;  2O31 A;  4RTX A;  3UDC A;  4DEY A;  4A4F A;  2H8H A;  4J9G A;  2O4X A;  5FU6 C;  2H3E B;  1WJQ A;  4QVZ A;  1BU1 A;  5CK9 A;  3EH2 A;  1AWJ A;  1WDX A;  3BDU A;  2DM1 A;  1VQ5 Q;  2VC8 A;  2RJD A;  3G6E T;  2KXD A;  3CCL T;  3H0H A;  1LNX A;  1OU8 A;  3C95 A;  1D3B A;  2MF2 A;  1M1G A;  1YJN Q;  1JJ2 S;  3I56 T;  2RHU A;  2XKO C;  3G6E Q;  3EH1 A;  3CCL Q;  3NTK A;  2RD1 A;  1KSW A;  5CO7 A;  3QYH B;  2AZS A;  2M1H A;  2L2P A;  2LC4 A;  1U5S A;  2CP5 A;  4KRT A;  5GAN 2;  4ELY C;  1NJI R;  4RTV A;  2R58 A;  4BE0 A;  5KYY B;  2CSQ A;  1ABO A;  1KHI A;  1F1B B;  4JJD A;  1YI2 T;  4BDZ A;  1M2V A;  3M0T A;  1E7O A;  3VV0 A;  1K73 R;  1WI7 A;  2LCL A;  3TRE A;  1WFW A;  5GJV B;  3TU4 K;  2H3J A;  3OMC A;  4M78 E;  2O4X B;  1YI2 Q;  2RNA A;  2QXF A;  4OMM A;  3X28 B;  1WHG A;  3I35 A;  1OPK A;  1VQL T;  1W2B S;  3M9Q A;  3LW5 E;  2CUB A;  3OW2 S;  4M78 C;  2DLP A;  2VXE A;  2FZG B;  1X6B A;  4HA8 A;  5I2M A;  5GAN 8;  2BE7 D;  1PM3 A;  4C0G A;  1YJW A;  3OYL A;  4YTL A;  4XU0 A;  1D3B B;  1ZBX A;  2HCK A;  1NYG A;  1VQL Q;  2HSE B;  3JCM Q;  5D2H A;  3VU3 C;  3OYC A;  4BI8 B;  4XTU A;  1P92 A;  2BZY A;  1PC0 A;  4RTZ A;  3JCM P;  2QQB A;  3JRZ A;  1K9M C;  3LH5 A;  1QVG S;  1TOV A;  2HL3 A;  2DVE A;  1ACM B;  1KC8 U;  1FX7 A;  1PKT A;  2DEQ A;  1NG2 A;  4B9X A;  1VQ8 A;  1TS9 A;  5A2Q E;  3L2W A;  2MCN A;  5FWB A;  4DOW A;  1VYU A;  2DMO A;  4RUG A;  2VGM A;  5GMK h;  4R0K A;  1OYX A;  1M2V B;  1X6O A;  4LDY A;  4XQ3 A;  2QG9 B;  4GY5 A;  3RDV A;  4M78 F;  4XTW A;  1AEY A;  3FB9 A;  1YIJ A;  8AT1 B;  3MEU A;  1QKX A;  2KSS A;  3OBW A;  4M78 G;  5DLO A;  4PFZ A;  1V76 A;  4PNO A;  1N8R U;  3PE0 A;  2KYB A;  3GF5 A;  4M75 E;  3OS2 A;  3S6W A;  4RTY A;  3CME A;  4QKU A;  2E64 A;  1O9S A;  3QDR B;  2WSE E;  2K3Y A;  3CMA T;  1KG1 A;  2HQH A;  4M75 C;  1E6G A;  2EQU A;  4KT0 E;  2QGF B;  1FWZ A;  1EIF A;  4NS5 A;  4RTU A;  3A8L B;  4D8K A;  3I9Q A;  1YIT A;  2JM8 A;  1WPY A;  1VQK T;  5IHI A;  3EGX A;  2EJ9 A;  3RKW A;  2L0A A;  2DO3 A;  5HK3 A;  2PQW A;  5HKC A;  3L2V A;  4OB3 B;  3CMA Q;  2PVO B;  1NJI C;  2KAF A;  5FRN A;  3VS4 A;  2XMF A;  3CCU T;  5FU7 C;  1M5Q 1;  1VQK Q;  1NKQ A;  2KXC A;  2K5I A;  3CD6 T;  3CCQ Q;  1K73 C;  3V77 A;  3R6N A;  1GCQ A;  2V8I A;  4FSS A;  2XHC A;  3MCA B;  3TCJ A;  4JJN K;  2IVW A;  1VA7 A;  3E9G A;  1I5L A;  4C0D B;  1LVK A;  3BW1 A;  1M27 C;  5KE3 A;  1WQW A;  2VKN A;  4M75 F;  2A0F B;  2KE9 A;  4M75 G;  2ECZ A;  1T0J A;  2F2W A;  1RAB B;  4X9D A;  1Z9Z A;  4MML A;  3D7S B;  5IH2 A;  1ZSZ A;  2MI6 A;  2DF6 A;  2HZY A;  3JCM d;  1XJW B;  3PIO A;  3UT1 A;  1UHC A;  3EGX B;  4M4Z A;  4XTV A;  1TUC A;  1K8A R;  3QZ9 B;  1K0X A;  1D1C A;  1GBQ A;  1VUB A;  1MGQ A;  3FIF A;  4NL2 A;  2F5K A;  3ZEH A;  2K3B A;  1PNJ A;  1NEG A;  2DXC A;  2DAQ A;  5DY9 A;  2HDA A;  1BI3 A;  1WX6 A;  1MND A;  3TSZ A;  2RQU A;  1I4K 1;  4CC3 A;  2P0K A;  5GAN 7;  2LNH B;  1AZE A;  3EFS A;  3CCV Q;  1M8V A;  1K1Z A;  2E3H A;  5GMK m;  2DXB A;  2KRS A;  2RB6 A;  1OZ2 A;  1AOJ A;  4M77 D;  3JCM h;  1RAE B;  3EFR A;  5LJ3 d;  5GAO q;  2RQW A;  1LCK A;  4QQ6 A;  1D1B A;  4MDW A;  1YBY A;  2OJ2 A;  3WXM B;  1JXM A;  3ULR B;  4C92 E;  1JJ2 P;  1JJ2 A;  1R0C B;  2SRC A;  3R6O A;  1ZSZ B;  3I55 T;  2NUT A;  4C92 C;  3V8K A;  2LRQ A;  2RHI A;  1ZSG A;  5D2G A;  2JT4 A;  2J6K A;  1MMD A;  1SHG A;  2MK5 A;  3O5Z A;  2FO0 A;  1LPL A;  2BKD N;  4F16 A;  1UJ0 A;  1C1A A;  1CKA A;  5CAI A;  2E10 A;  3PFS A;  2RI2 A;  2CKK A;  4M7D A;  1Y07 A;  2JZ2 A;  1X69 A;  5LJ3 h;  2DZ9 A;  3RBB B;  1VYV A;  4JPB W;  2QA4 T;  3QJ6 A;  2NUZ A;  2LT4 A;  1W1F A;  1ZX6 A;  2F5T X;  1M8M A;  5J39 A;  3VS2 A;  4J7F A;  3CC2 T;  2EYQ A;  4KUD K;  1Q81 R;  3CXC S;  3GOX A;  2D8J A;  1HJD A;  3JCM V;  3PGG A;  4JDS A;  3M4Y A;  2QA4 Q;  4E7H A;  3OW2 A;  1W2B A;  3UA7 A;  4O5V A;  1JQQ A;  4JS5 A;  1RAG B;  2EYW A;  3M56 A;  3MJX A;  4C92 F;  4JUV A;  3CC2 Q;  2D6F A;  3F70 A;  1K8A C;  4C92 G;  3H0F A;  1ZHI A;  1LOJ A;  2VB6 A;  3X25 B;  1OPL A;  2NUT B;  2KYM A;  1M90 R;  3QWX X;  1QVG A;  2KEA A;  1KJW A;  3KBG A;  1R0B G;  2OI3 A;  9ATC B;  3URG A;  1ARK A;  3P8H A;  1JU5 C;  1D0Z A;  2CRE A;  3A8G B;  2YRV A;  1FMK A;  2OTL Q;  1AWX A;  4LDV A;  4M7D B;  3MKD A;  3NHN A;  3JV3 A;  2MOX A;  3CCJ T;  1G8X A;  5HCK A;  1QQJ A;  4XTY A;  1C6V X;  4FYX B;  2ABL A;  1GXI E;  4TVR A;  3CCJ Q;  1YHQ T;  2BUD A;  2KQW A;  1EX4 A;  2QQR A;  1KC8 R;  3I5R A;  4X1V A;  2VYT A;  3DLM A;  2E4H A;  1OUL A;  1YHQ Q;  3PTA A;  2HKQ B;  4ZNX A;  2DIG A;  4DOV A;  3SB2 A;  2GNC A;  4F04 B;  4J6Y A;  4ORZ A;  2PNI A;  1WJR A;  1UGR B;  2CZ0 B;  2X35 A;  2V8K A;  2HQX A;  3JCM f;  2O9S A;  2YRC A;  3JSC A;  2GF7 A;  2DD4 A;  1Q95 G;  1KK7 A;  1SG5 A;  2AHJ B;  2LNV A;  2EPD A;  4ZGD B;  3CC7 A;  2FYK A;  2R5M A;  3BFM A;  2JTE A;  2EKH A;  2EGA A;  4GLM A;  4M77 F;  5CIU A;  4ANJ A;  1Q81 C;  1IXD A;  1VQM T;  1RAH B;  3OBY A;  2WQT A;  5FLX E;  2JXB A;  4OML A;  1MUZ A;  3OYK A;  5L8R E;  3VS7 A;  5GAM f;  2JNG A;  3J81 E;  1SHF A;  1D0Y A;  2LQ8 A;  2XID A;  2DYB A;  1VQM Q;  2J06 A;  3FEO A;  2SEM A;  5GAN f;  1BCO A;  1M90 C;  4PJL A;  2ENM A;  1H8K A;  5LJ3 f;  1WXB A;  2D9T A;  2HSP A;  4FYV B;  2QDY B;  4F14 A;  2ROL A;  2M02 A;  4V2S A;  4LDW A;  3CCR Q;  3CCE A;  2CSI A;  1RI0 A;  1Y7X A;  2JM9 A;  2I2L A;  4HCZ A;  3JAM E;  2F2X A;  3H9N A;  1GCP A;  1I81 A;  2K4Y A;  2JVV A;  4VUB A;  4XU3 A;  1MHN A;  4PFP A;  2RN8 A;  2YRD A;  2COY A;  1BBZ A;  1YCS B;  3RKX A;  1X2Q A;  1GCQ C;  1R77 A;  3OYE A;  2YUP A;  2VUB A;  2K7A A;  4B9W A;  2RK2 A;  2E5Q A;  2LMJ A;  2P4R A;  2J6O A;  1FMW A;  4C5G A;  1VQ7 A;  5A0D A;  1VIE A;  4R56 A;  1QCO A;  1FMV A;  2VAS A;  2CT4 A;  5D6W A;  5FRM A;  5GMK e; 
#chains in the Genus database with same CATH homology
 3QDF A;  1WZO A;  4PFZ A;  1QCN A;  2WQT A;  1HYO A;  3R6O A;  2Q1D X;  1NKQ A;  2EB5 A;  4QKU A;  5D2I A;  4MAQ A;  2Q1C X;  2DFU A;  4DBH A;  3V77 A;  2EB4 A;  3LZK A;  2Q18 X;  5D2H A;  1SAW A;  5D2G A;  4DBF A;  3S52 A;  1SV6 A;  5D2F A;  5D2K A;  1QCO A;  1QQJ A;  1NR9 A;  3RR6 A;  2Q1A X;  3BQB A;  5D2J A;  1GTT A;  1I7O A;  2Q19 X;  2HZY A;  2EB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...