4DBHA

Crystal structure of cg1458 with inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
269
structure length
269
Chain Sequence
HMRFGRIATPDGMCFCSIEGEGDDVANLTAREIEGTPFTEPKFTGREWPLKDVRLLAPMLPSKVVAIGRNYADHVAEVFKKSAESLPPTLFLKPPTAVTGPESPIRIPSFATKVEFEGELAVVIGKPCKNVKADDWKSVVLGFTIINDVSSRDLQFADGQWARAKGIDTFGPIGPWIETDINSIDLDNLPIKARLTHDGETQLKQDSNSNQMIMKMGEIIEFITASMTLLPGDVIATGSPAGTEAMVDGDYIEIEIPGIGKLGNPVVDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HYDROXYHEPTA-2,4-DIENE-1,7-DIOATE ISOMERASE
publication title Crystal structures of Cg1458 reveal a catalytic lid domain and a common catalytic mechanism for FAH family.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Isomerase
total genus 76
structure length 269
sequence length 269
chains with identical sequence B
ec nomenclature ec 4.1.1.-:
pdb deposition date 2012-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01557 FAA_hydrolase Fumarylacetoacetate (FAA) hydrolase family
A PF10370 DUF2437 Domain of unknown function (DUF2437)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.370 Mainly Beta Roll SH3 type barrels. FAH 4dbhA01
3.90.850.10 Alpha Beta Alpha-Beta Complex Fumarylacetoacetate hydrolase; domain 2 Fumarylacetoacetase-like, C-terminal domain 4dbhA02
3V77A 4DBHA 1I7OA 5D2JA 5D2FA 2DFUA 2EB5A 1WZOA 2Q18X 3LZKA 3S52A 2EB6A 2Q1CX 4QKUA 2WQTA 3R6OA 1QCNA 3RR6A 4MAQA 5D2KA 1NR9A 5D2IA 2Q19X 2Q1DX 1NKQA 1SV6A 2HZYA 1GTTA 3QDFA 2Q1AX 3BQBA 1QCOA 4DBFA 1HYOA 5D2HA 1QQJA 2EB4A 4PFZA 1SAWA 5D2GA
chains in the Genus database with same CATH superfamily
1WYXA 3M0QA 4XTVA 2AKKA 1X2KA 5CKHA 3DLMA 2CDTA 5FRMA 2KBTA 2LDMA 2LQWA 1FX7A 1OULA 1RABB 1QVPA 2L3SA 3JCMf 3EHRA 2EIFA 4M77C 1K4US 1ZSZA 2K5IA 2XICA 2CUBA 3QKJA 4Z89A 3OYEA 4LDUA 1VQPA 2ZPEB 3LH0A 1YITT 2L0AA 1KHIA 2VVKA 1D0YA 1SG5A 1S72T 3CXCP 3HFOA 4IUPA 2DEUA 1NR9A 3CC2T 4LDYA 5LL6S 3T9NA 1WLPB 2XKOC 1JJ2P 1UJYA 1GBQA 1YI2T 1GCQC 3JB9D 3CMAQ 2JM9A 4DEXA 2E3HA 2JVVA 1OPKA 4LNPA 4DOWA 5IN1A 4RTXA 3OYDA 4KH1B 1YIJQ 4ELZC 4IIMA 1K0SA 2K3XA 1Q81U 4M78B 3CCUT 4LE9A 2JTFA 3REBB 3CCQA 3E2UA 2CREA 3EFRA 3UATA 1KHCA 2EW3A 2R5MA 3PMIA 2YXYA 4M78F 2CT3A 3JCMd 3U23A 2OTLT 3L42A 2V8KA 4X9DA 1SEMA 1QP3A 3PE0A 3KUFA 2F2XA 1Q86U 2FPDA 3NPFA 4EPCA 1B34B 2VXEA 2DE0X 3ER0A 2Q19X 3PT9A 2CP3A 3RKWA 1KD1R 2KI7A 2DERA 4ZN3A 4JJBA 3M0TA 4R56A 2ZZDA 2RPNA 3THKA 2K3YA 5LJ5h 5FROA 3ASKA 4M75C 2OAWA 3I56A 1K8AC 1PHTA 2DNUA 2RI2A 4Z88A 3VUZA 2L2PA 1Z9QA 3ZFJA 4N0AC 1YITQ 4EMHA 3BQBA 4DBRA 4D8DA 3QBYA 5CCAA 5I2MA 2QG9B 3BDUA 3PGGA 3TSWA 4RTZA 3G71T 1BI2A 2GTJA 3A8GB 3CC2Q 4V2SA 2RQVA 4XU2A 1YI2Q 1MHNA 1WHHA 4LXCA 3WXMB 3C94A 4CI0C 2EQMA 4OF1A 2A37A 2DZ9A 3DLLA 5A2QE 4GLMA 2M51A 1S1NA 3GLXA 1QQJA 2BTTA 3SEMA 4ELYC 2C06A 2EYZA 1FMKA 2OAUA 3QDRB 2ZAEA 3SFMA 2MOXA 4E6RA 1M1FA 4M78A 3CCUQ 1K9MR 2D6FA 2OX7A 3LGFA 3CBPA 3MEAA 2RK1A 2RJEA 1RACB 2X35A 2DMOA 4KGXB 1KC8U 1AVZC 3OS5A 2OTLQ 3VS4A 1MNDA 1G5VA 1ABQA 3D7SB 4OMLA 1B34A 1K73R 2DFUA 2EWNA 3QZ9B 3EFOB 1OX9A 1UTIA 3LW5E 2HKQB 5GAOr 1OI1A 2D8JA 5GAN7 2G3RA 1W1FA 1YFNA 5CKFA 2X3XD 4KGZB 2JZ2A 2EKHA 2EQUA 2EAYA 3SWNC 2E70A 2DYBA 2F2VA 2DETA 2DBKA 4RCBA 4BY6C 1BKBA 1SSFA 2IIMA 4CRIA 2FZKB 2HBPA 2RQRA 2EYWA 3H6ZA 1KQ1A 1RLQC 4KH0B 3OY9A 2QYZA 3UT1A 5GANh 1RLPC 2QQ9A 3E19A 2LJ3A 3REAB 4JZ4A 2CT4A 4XK8E 2KY9A 1VQPT 3G4ST 4RG8A 1VQNA 2E5KA 2KDSA 3S3NA 3CD6A 4FSSA 2CSIA 3QZ5B 3P8HA 3QHSA 4B6MA 1W2BP 4DEYA 4HCCA 2IG0A 5FU7B 5AT1B 2RMOA 2Z0WA 4EIKA 4BUGA 2J6FA 2RM4A 4XTXA 2QQAA 4RCCA 2D0QB 1UHFA 1QMCA 1KJWA 5FU6B 3ZL7C 1D0XA 2ECZA 1LCKA 2YRCA 2P0KA 4GLKA 1AEYA 3ZEHA 2DK3A 3CCQT 3EFOA 2PVDB 2XG8D 1K0XA 4C8QE 1KG1A 2CZ7B 1WNLA 1EX4A 5GAOm 3X28B 4M78D 3CMAA 1WX6A 2HBWA 2A0FB 4MDXA 5GMKl 4OGCA 4M77B 3CCST 3MJXA 3TVTA 2DIGA 4C92G 4IURA 3EG2A 5CVIA 2YLCA 2IPOB 2BZXA 2CKKA 2GQVA 1V1CA 4HKEA 2EGEA 1UG1A 3FJ5A 1XJWB 3MO8A 4F7UE 2W0ZA 3CPWA 2LCCA 1M1KC 1LNXA 3I56T 4HVVA 1WDXA 2P4RA 1TU0B 2B8AA 9ATCB 4M7DE 1IRXA 4L5GA 4J5YA 3RKYA 1VQPQ 3G4SQ 1UGVA 1NBEB 1UGQB 4OB3B 4FW1A 2MF2A 1QVGA 2CH4W 5GAOl 3M56A 3G7ZA 2V8IA 3QPHA 5GAN3 3NMZC 4J9HA 2ZPFB 1ARKA 3O8VA 1RAGB 2DXUA 4F7UG 2GQIA 5CKEA 5LJ5f 3EGDB 1KQSS 2XU8A 3BY7A 1H3HA 4LDWA 8AT1B 1Y57A 4FYVB 4IKFA 4Y28E 3X24B 2F69A 2DXBA 4RTUA 4II1A 2B86A 3X25B 2HDAA 4C0ZA 1G2BA 2I0NA 3Q1JA 1YITA 1GFDA 1XTDA 2PUKB 2NYSA 4EMGA 3CCQQ 1S72A 2HEQA 1Q82C 4R55A 4ME7A 3JB9H 1UE9A 1X6GA 3PIPA 2F2WA 4L6V5 3RDVA 1BI0A 4M75B 2YUOA 2EB4A 4M77A 3CCSQ 5HCKA 3NGPA 2JTMA 2EPDA 4XU1A 2DTIA 4PJLA 2QQSA 4M75F 1AZGB 5KCHA 2YUPA 1YNZA 3MCAB 4J9CA 4J83A 1M90U 3JCMP 5FWBA 1O75A 2E10A 4FL6A 1WA7A 2EJ9A 4AFSC 3PIOA 3CCUA 2DL3A 2KRSA 1X6OA 4J7IA 1PKTA 3I56Q 1I4K1 5LJ5d 1TXQA 3PVQA 2LP5A 2E65A 2DL8A 2LTOA 5D2JA 2X3WD 1GCQA 2OTLA 3LLRA 3JSCA 4PLLA 4LD9K 2PQWA 3CEYA 4QQDA 3A8MB 3R6OA 1IREB 2VV5A 3TQ7P 1UGPB 5LJ3g 3OYLA 3L2UA 1YWPA 1G3YA 3H9NA 5I2SA 1Q7YC 1Y07A 1IO6A 3OSSC 2LNVA 1VQ4A 5I11A 1AD5A 1VYUA 2DPPB 3BFMA 4LUEA 1Q82U 4JRKA 1PCXA 3EGDA 4C8QC 1VYTA 3CCMT 1VQNT 2FYKA 4QKUA 3VS6A 3A5ZB 4XQ3A 1NLPC 2XDBA 1WJSA 2V1QA 1BCOA 4QW2A 3LX7A 2CSQA 5GANg 1JJ2S 3N5BB 3M54A 2JS2A 5IHNA 2F5TX 3G71A 2HMAA 2CZ0B 4FYWB 4EDUA 2JUFA 3C4SA 3E9FA 1NG2A 3M59A 3SWNB 2DJZA 6AT1B 4M75A 2JNGA 4M7DC 3QYGB 4JS5A 2EBPA 4OMNA 2BE9B 4GBQA 1Y96B 4C0DC 1SSHA 3LWIA 1UGRB 2RO0A 4N0AA 2KXDA 1M8VA 4JLGA 2C0IA 1T0HA 2XIDA 3OW2A 1WPYA 2LJ0A 2IVWA 3L2ZA 3VRYA 4MZTA 3TU4K 3C0CA 1UB4A 2OTJT 1AWOA 1Y71A 2VXFA 1EFNA 2ROTA 3ULRB 2DAQA 2PUOB 5I22A 2AK5A 3C12A 3FRNA 4M7AG 1UDLA 2RJCA 2NWMA 1CKBA 2EYQA 1VOMA 2K9GA 1AHJB 1G3TA 1VQKT 1JO8A 2QI2A 3QUIA 3CCMQ 1VQNQ 3OS0A 4B9WA 1BIAA 4UC4A 5KYYB 3S3OA 1K8AR 5A0GA 2HQHA 3HHTB 4C5GA 3CC7T 1Q81C 4OB1B 4E7HA 2GFAA 3M58A 3MEWA 4NL3A 3INZA 3A98A 4HCZA 4ZN1A 2DF6A 3J7AF 3KBGA 3GPLA 3QJYA 2QAZA 4PJOE 2E41A 2BKDN 5LJ3e 2DTHA 4JJCA 2K57A 1Q86C 5D2GA 2R58A 3JCMX 4N4GA 4OVAA 3SWNA 3G4SA 3MP1A 1UUEA 2HCKA 1WZOA 4J9IA 1Y96A 2KT1A 5GAN6 4J6YA 3HKSA 3L2VA 3CPWP 4E2FB 1WJQA 4OMMA 1UFFA 1VQLT 4PJOG 5KYUB 4BDZA 1G83A 2DKGA 4QQGA 1UEBA 3VRZA 5GANe 3M5AA 4NOYA 1QVGP 1M5Q1 2KXCA 4M75D 2OTJQ 4F16A 3DB4A 4JRQA 3VS0A 3CCVA 1YP5A 2EGAA 2HL5C 5KCOA 1JQQA 4PJNA 2KMTA 2X4WA 1BK2A 2KEAA 3UA6A 3P8BB 4ZGDB 3V7RA 3A8LB 4OB0B 3NTKA 4HVUA 2Q18X 3DKMA 2I2LA 2RHZA 1VQKQ 3CCSA 3UPUA 3P8DA 3F70A 4FYYB 3CMET 5KYWB 2DM1A 5KYYA 1XQHA 3CC7Q 1T3LA 2OI3A 1M3AA 1VQ4T 2GTOA 3OQ5A 1D1CA 4BB7A 1KC8C 3EH2A 3GF5A 1QKXA 1NJIC 1WHMA 1MMNA 1N8RU 4FW2A 4FCYA 1RI0A 2FB7A 1RAAB 2GNCA 4J7FA 2E64A 5IXFA 4ZNXA 3I5RA 3CC4A 1E7OA 3LWHA 2PVGB 4KRTA 1OZ3A 4CC3A 5LJ5j 2KGTA 1TUGB 1M1GA 2M02A 4PJJA 3VV0A 3OYAA 1S72Q 1RAEB 2QASA 4QVDA 1IB8A 4Z8AA 2YHTA 4IUTA 3BW1A 3V7SA 5KH6A 2ZPBB 2X9HA 2KNBB 2COZA 2ENMA 2FPFA 2LMJA 5KYUA 1FMWA 1U8RA 5CIUA 1ZLMA 1VQOT 2VGNA 3SD4A 2V26A 3MEVA 2DEQA 1OZ2A 2RJFA 1RAIB 2PU9B 1PM3A 2JOYA 2KYMA 2EJGA 3CCET 1G8XA 3I5SA 2DRMA 4JRIA 3VS1A 4LDXA 5DY9A 1I8FA 5EG2A 3UWNA 2QA4T 2GBQA 1IGQA 1SHGA 3JCMJ 4WF2A 1JEGA 1VA7A 1VQMA 3OMCA 1NJIU 3RNJA 2LCLA 4C8QB 2DO3A 4PJOC 2JXBA 1T3SA 4FU6A 5GAOp 1YHQT 3NTHA 5GAMg 2JT4A 4C8QF 5KYWA 3X20B 3CCLT 2EB5A 4BI8B 4HVWA 1NLOC 5DLQE 4B9XA 2DYIA 1R0BG 4ANJA 5LJ3h 5IXBA 3M0SA 4LN2A 1VQ4Q 3OSVA 1LPLA 2GGRA 1GTTA 3TREA 3JAME 3RMSA 1JU5C 4F7UB 4OGEA 1QVFS 1M1KR 3ZBDA 4E7ZA 3PFSA 2D0NA 3GOXA 4F7UF 4M7DB 2OJ2A 2WQTA 2HQXA 4C0DB 2M0YA 4F04B 4PK4A 3LH5A 3OW2P 1KQSA 3G71Q 1VQ8T 4M7DF 2JMAA 2MPXC 2K6DA 4M4ZA 1VUBA 3OA6A 4M78G 2O01E 3JCMW 2KROA 1N9RA 5L8RE 3CCMA 4MDWA 3FB9A 4X9CA 5GMKm 3RMQA 4JJNK 3FEOA 3CCEQ 5GANj 2HSEB 1BYMA 3KXTA 2AIRB 2MYSA 1RL2A 3FC3A 4XTYA 4O6JA 2QA4Q 2LVMA 2NUPB 1TTHB 3M0RA 1NPRA 1VYVA 1C1AA 5IAYA 1C6VX 4DA4A 4C92E 3FDRA 1YBYA 3VUBA 4C8QA 2FZCB 2X4XA 2AZVA 2RHXA 3CCVT 1YHQQ 2RNAA 2DL5A 2KYBA 2EQJA 5GMKe 3JB9I 3CCLQ 2JM8A 1ZUUA 3RIRA 3EG0A 3FLGA 2MIOA 4PLIA 1KD1U 1C0MA 3OBYA 1AWXA 1YCYA 1QWEA 3RR6A 4F7UA 3RBBB 1OQKA 1W4SA 1VIFA 2HZYA 2FHDA 4R0KA 2OTJA 2PTKA 2BUDA 2ESWA 1X6BA 2ROLA 4M7DA 2ZCFB 2DVJA 2HQEA 3KFVA 1ZQ1A 4FYXB 4KULA 1MV0B 3S52A 1K73C 1JB0E 1VQ8Q 1SF9A 5GAN5 2YRDA 2J7IA 1T0JA 3OMGA 1Q7YR 5GAMe 4A4GA 2LCSA 2JMCA 5GAN8 1VQKA 2HAXA 2Q1AX 4HT9A 3CC4T 4F14A 5D2HA 1PD0A 2RHIA 1M90C 1JJ2A 5FWCA 3CC7A 2A08A 3E1SA 4OMFB 4QQ6A 3NHNA 3L2WA 3OYNA 4C0FA 1P92A 2E6ZA 1Y0MA 1K76A 4N4IA 4XU0A 2RF0A 4FSXA 2RJDA 2M9UA 2E4HA 2F5KA 2VGMA 3FJPA 2NUPA 5KE2A 1SV6A 4ZTFA 3MPUB 2M0OA 1M30A 3VKIA 4OP0A 4QT7A 4WTOB 1KFZA 3MKDA 5EC7A 1K9MU 1EIFA 1M2OA 4EMKC 2CYZB 1W70A 5IHIA 2EJFA 2JTEA 4QVZA 2KRMA 1CKAA 2X4JA 3CCVQ 2P84A 3L2QA 2HL3A 4AMCA 2J6KA 3VU3C 1RI9A 3BE3A 2DD4A 2RH2A 1VQMT 2QQRA 4RKUE 1JXOA 2JW4A 4OMQA 3O5ZA 3OYKA 1K73U 2CP5A 3OYFA 4DBFA 2VB6A 3NTIA 4A54A 3HRTA 1YJWT 1VQLA 1NYFA 3HFNA 4RTVA 2W10A 1OYXA 4Y91A 3TEEA 4M7AF 4XTWA 2YRVA 3H0IA 4C8QD 1QCNA 1KIKA 3EH1A 3EGUA 3M9QA 2FO0A 2PZ1A 2RK2A 1N5ZA 4JLIA 4OMPA 1Z9ZA 2RHUA 2LRQA 3OYGA 1VQ7T 1MMDA 1HXDA 1IHWA 1KK7A 4C92C 4PKCC 3CC4Q 2J05A 2YUNA 5HK3A 1R8OB 1RAFB 1SPKA 4AFUC 3CMEA 2L5QA 5IT9E 3DB3A 2KK4A 5ECAA 4BACA 5LJ3f 4M7DD 1YJ9T 1Q81R 1X01A 1JXMA 3OYYA 1U3OA 1FWZA 1I7OA 2CGHA 1YN8A 1QP2A 1E6HA 1NYGA 2EYYA 3FIFA 4OMOA 4A4FA 2E12A 3E9GA 1WQWA 3RUXA 5GMKh 3QXEB 1D09B 2WACA 2DVEA 3CXCS 4E7IA 2QDLA 4HT8A 4PNOA 4PJOB 4M77G 4J9DA 4LD6A 1ZUKA 1Q86R 1QCOA 2XD0A 2RA2A 1NEGA 4J9GA 2A3LA 2EQIA 3G1JA 3MP8A 4PJOF 5GANf 2FEIA 1VQMQ 1PSFA 4KT0E 2KAFA 4MZPA 4BE2A 2CZ1B 2HD0A 5D6YA 1YJWQ 5GAN2 3PNWC 3CQTA 4BY6B 1E6GA 2V1RA 1NM7A 1VQOA 3TCJA 3VS2A 1WQ7A 3QG1A 2YSQA 2LQNA 1N9SA 4M7AE 2WSFE 3CCEA 1R77A 4ATOA 5GAMh 1ACMB 1K9AA 2C0OA 3EG1A 2E3IA 1AWWA 2K7AA 2QA4A 3CCRT 5LJ3d 1QLYA 3JB9J 2K2MA 3BDLA 1ZBXA 2D8HA 1NKQA 4DBQA 2QEXT 2X51A 1VQ7Q 1DJ7B 1OU8A 4IUQA 3V8KA 2J6OA 3QO3A 1UECA 5GAMj 5D2FA 5AYFA 1YHQA 3C95A 1I5LA 2KQWA 3CCLA 1UGSB 1G3WA 4A4HA 4J8OA 4Q5WA 1YJ9Q 4FT4A 5DM7R 1OV3A 1K1ZA 2CUDA 3JB9G 3GP8A 1OU9A 3JV3A 4BE1A 1NZ9A 5GANd 3RKXA 2DXTA 3H0FA 2RI5A 1KC8R 4PFPA 4AFQC 1WIEA 2CP6A 1YJNT 1SAWA 4QVCA 5IH2A 4CC4B 1BU1A 2P0QA 1SHFA 4X34A 4M75G 1H641 3UDCA 4LUDA 4PL6A 4PJOA 1ZHIA 3URGA 3ME9A 2RHYA 1MV3A 1I81A 1MNEA 1PWTA 1J3TA 1U1SA 1PSEA 3S3MA 1VQ8A 5HY6A 4ESRA 2FPEA 1ZSGA 4IUUA 3JCMg 1D1BA 5CKDA 1CSKA 3EAEA 2ZPIB 5D6WA 1M2VB 3EGXB 4E47A 3UF4A 4RG2A 4KUIA 3PMTA 2GFUA 2JS0A 3OYCA 3CCJT 2KR3A 3I35A 1N8RC 5D7UA 3CCRQ 2L3PA 1AZEA 2QDYB 2M1HA 1X69A 2FRWA 4J9EA 4XTZA 1BIBA 4ZGEB 2QTXA 3RERA 2QEXQ 1IHVA 3M57A 4M7AD 2YUQA 2MMPA 1U1TA 1X75C 4JPBW 4BD3A 4IIOA 2LT1A 3OBWA 2L3QA 3EG3A 2XI9A 3HRUA 4KBMB 8ATCB 1LVKA 3EG9B 3M55A 2H3EB 5KYXB 2K79A 1QVFA 2AHJB 3J80E 2L89A 1PC0A 2E6NA 2VKNA 2JN0A 1ZUYA 4PJMA 2ZPGB 3QYHB 1YJNQ 3EHQA 3G6ET 1PRLC 4D8KA 3OW2S 4EMKB 1GL5A 2EVRA 2XMFA 3RESA 1VQ9T 4L59A 3HSBA 1VQ5T 2KE9A 4AG1C 1WHLA 4M7AC 4FM4B 4DOVA 1TOVA 1SKUB 2EKOA 3L1AA 2LQ8A 4ZTJA 3GNFB 2QGFB 4JZ3A 2LC4A 2K3BA 2O2OA 7AT1B 1WXUA 2QXFA 2D9TA 4A4KA 1W2BS 1X43A 2G6FX 1M2VA 3EGXA 3V77A 4PFOA 2K4YA 2VC8A 4PJOD 2EB6A 3CCJQ 4NL2A 2DTOA 2EGCA 2Y4YA 2M16A 2KT8A 4BDYA 1BI3A 1VQLQ 4HCKA 4X1VA 5D6XA 2WSCE 2MWPA 3OS2A 1GFCA 1WGSA 2FRYA 3HPWA 1GXIE 2QTVA 1H3ZA 4C92B 3LYIA 4C5HA 4RMOA 2AKLA 2O4XB 3I9QA 2K2VA 2DA9A 2E5QA 3GNGA 1TS9A 4E7JA 1M27C 1PKSA 4C92F 3JCMe 1LOJA 3CPFA 1I0CA 1VIEA 1MMAA 5A0LA 3EG9A 3EFSA 2RQUA 5KYXA 4P5NA 1IXDA 5CQYA 3I55T 1YJWA 3MHXA 5FLXE 5J26A 2XDDA 1QW1A 2MAMA 4DBHA 1I07A 3G6EQ 1D3BB 3CMEQ 2MI6A 4EMKA 3QWXX 1ZA2B 1VQ9Q 2F1LA 3OYHA 5GAMf 2XHCA 1VQ5Q 1K8AU 2YDLA 2LJ1A 1D0ZA 4M78E 2A28A 1VQ6A 3META 2XDPA 2DIQA 1BBZA 1NPPA 4N4HA 3HRSA 1B07A 4CC2A 1VQ7A 3A8HB 1ZSZC 4J9FA 2CP0A 4K11A 3V8LA 2WSEE 3JCMb 5LJ3j 1I5OB 2RN8A 2X4YA 3VS5A 4ORZA 2EQKA 3L2RA 1M90R 4JDSA 1KD1C 1YJ9A 3GBQA 2DLPA 5L23A 3M0UA 1SRMA 4VUBA 3M0PA 1WHKA 3AT1B 4NS5A 2YWWA 3IQLA 4C5EA 4OB2B 1WI7A 2K5LA 3VJPA 2NUZA 3AHUA 2JJ9A 1VQOQ 1RAHB 3VYGA 1AOJA 1M3BA 3H41A 2CS7A 4C92A 4C5IA 2R57A 4E7LA 2O4XA 2PVOB 4PFZA 2CH4A 1PD1A 2DBMA 1BB9A 2AZSA 2DXCA 2K5FA 2VASA 1B7TA 1KSWA 1KQ2A 2XK0A 5GAMd 2HKNA 2RB6A 1RADB 1N6AA 1Q82R 1OPLA 4WCIA 3I55Q 3JRZA 1FMVA 4MMLA 4AT1B 2V8JA 1MGQA 4A63B 1BCMA 3JCMV 3QSUA 1UHCA 1D3BA 4E7KA 3PVLA 4XTUA 2BZYA 2L3RA 2L8DA 2AT1B 1HJDA 3CBOA 1M9SA 2DD5A 1GBRA 1Y7XA 3CCRA 1K9MC 2VWFA 2FZGB 2QK0A 5A0DA 5KE3A 2H8HA 2YT6A 4RTYA 3OYIA 4J6XA 4HCBA 2HNIA 2NLUA 4BI4A 2A36A 2QEXA 4LDVA 1X2QA 1OEBA 2KRNA 5CO7A 1AWJA 1X27A 4AG2C 4DQ2A 5HKCA 4RTTA 2SRCA 3LZKA 4CC7A 3NFCA 5CQXA 3MEUA 5D2KA 2CP2A 1D1AA 4GY5A 1XNIA 2Q1DX 1YIJA 1WXTA 4M77F 5IHKA 3V7CA 4A53A 3CXCA 1QCFA 2GF7A 1GCPA 1YJNA 2C0TA 1FXXA 3JCMh 1Q95G 4C8QG 2H3JA 5HK0A 3UA7A 1ZBJA 2HSPA 2Q1CX 2MWOA 2DZCA 3TSZA 2FL7A 3VS3A 1RUWA 3H8ZA 3QIIA 1TUDA 1I1JA 1ZX6A 1XOVA 5CR2A 2NUTB 1QVFP 2P4TA 2EYXA 2ABLA 2ZGWA 4M78C 2KVQG 4HXJA 5LJ5g 4MZMA 3OYBA 1PG5B 2FVUA 1H8KA 1U06A 3X26B 2E1HA 5GAOq 1R0CB 4Z02A 4J9BA 1PNJA 3A8OB 4M7DG 3GIBA 4HA8A 4C92D 3CCJA 1PRMC 4FIBA 5CKBA 4M7AB 1HD3A 2ED0A 2LZ6B 4FT2A 4JS4A 3M4GA 1TSFA 1V76A 4JUVA 2LT4A 2FG0A 1NE8A 1M4ZA 4Y92A 1BI1A 1TG0A 5M9OA 4C0GA 1MUZA 2LX7A 1JRIA 3CC2A 2LNHB 1B3QA 2A7YA 2COWA 1TUCA 3JB9F 1M1KU 2D1XA 1NEBA 1YI2A 3QJ6A 4TVRA 2GCXA 1AT1B 3HP9A 1VQ6T 4MAQA 2COYA 5GJWB 4O5VA 3OYJA 1M8MA 4AFZC 1FYNA 2MCNA 2O9SA 3V8JA 1OX8A 2J06A 4M77E 1ABOA 5D2IA 1G3SA 3G6EA 3WVEB 4BE0A 2VYTA 4XU3A 1WFWA 2RD1A 2BIVA 1VQ9A 3R6NA 1LJOA 1VQ5A 2ED1A 2BE7D 2O31A 2ZPHB 3JCMc 3VS7A 5FW9A 3LGLA 5GMKi 2ATCB 2QQBA 2Y4XA 4IUVA 4MMKA 3OS1A 2NUTA 2RI3A 5J3BA 2SEMA 3JCMQ 2DJQA 3SB2A 1UJ0A 4RTWA 1OOTA 5KYNA 3WVDB 1EZZB 2QGGA 1QKWA 1F1BB 4E7SA 4XAXB 4YTLA 1HYOA 1YWOA 3OYMA 5CK9A 3CPWS 1HSQA 2YLBA 4D6WA 1A0NB 2DL7A 5GMKj 3CD6T 1WJRA 2KSSA 2RQTA 1ZA1B 4RUGA 5DLOA 3PTAA 4M7AA 2DRKA 3MP6A 4JRPA 1QVGS 1U5SA 1JBMA 1N8RR 4A4EA 2O88A 2LX9A 3HL8A 5J39A 2O9VA 1HK9A 1ZSZB 1IGUA 2VUBA 3CBMA 1KQSP 4KGVB 2P0PA 5LJ5e 1M3CA 3SHWA 2MK5A 4JJDA 1VQ6Q 2CP7A 1YCSB 4KUDK 1QWFA 1TWBA 1GRIA 1V29B 3QWYA 2PNIA 3I55A 2DL4A 4M75E 1Q7YU 5C0MA 3CMAT 4ZGJB 3M4YA 3HTRA 3J81E 4BI3A 2Y90A 5GJVB 2LQKA 5I21A 1YIJT 2EFIA 4F17A 4M77D 1WHGA 1WHJA 5C6SA 5FU7C 1SRLA 1H92A 3A1PA 1W2BA 1N27A 2BZ8A 1NJIR 1WXBA 5CAIA 1MMGA 3SDZA 5FU6C 1TH7A 2DILA 3M53A 5GAOn 2R5AA 2CZ6B 2RQWA 3S6WA 3OB9A 3VYHB 4J6WA 1W6XA 5FRNA 2DX1A 3QDFA 1O9SA 5GAN4 3H0HA 1IZ6A 3CD6Q
chains in the Genus database with same CATH topology
3V77A 4DBHA 1I7OA 5D2JA 5D2FA 2DFUA 2EB5A 1WZOA 2Q18X 3LZKA 3S52A 2EB6A 2Q1CX 4QKUA 2WQTA 3R6OA 1QCNA 3RR6A 4MAQA 5D2KA 1NR9A 5D2IA 2Q19X 2Q1DX 1NKQA 1SV6A 2HZYA 1GTTA 3QDFA 2Q1AX 3BQBA 1QCOA 4DBFA 1HYOA 5D2HA 1QQJA 2EB4A 4PFZA 1SAWA 5D2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V77 A;  4DBH A;  1I7O A;  5D2J A;  5D2F A;  2DFU A;  2EB5 A;  1WZO A;  2Q18 X;  3LZK A;  3S52 A;  2EB6 A;  2Q1C X;  4QKU A;  2WQT A;  3R6O A;  1QCN A;  3RR6 A;  4MAQ A;  5D2K A;  1NR9 A;  5D2I A;  2Q19 X;  2Q1D X;  1NKQ A;  1SV6 A;  2HZY A;  1GTT A;  3QDF A;  2Q1A X;  3BQB A;  1QCO A;  4DBF A;  1HYO A;  5D2H A;  1QQJ A;  2EB4 A;  4PFZ A;  1SAW A;  5D2G A; 
#chains in the Genus database with same CATH topology
 1WYX A;  3M0Q A;  4XTV A;  2AKK A;  1X2K A;  5CKH A;  3DLM A;  2CDT A;  5FRM A;  2KBT A;  2LDM A;  2LQW A;  1FX7 A;  1OUL A;  1RAB B;  1QVP A;  2L3S A;  3JCM f;  3EHR A;  2EIF A;  4M77 C;  1K4U S;  1ZSZ A;  2K5I A;  2XIC A;  2CUB A;  3QKJ A;  4Z89 A;  3OYE A;  4LDU A;  1VQP A;  2ZPE B;  3LH0 A;  1YIT T;  2L0A A;  1KHI A;  2VVK A;  1D0Y A;  1SG5 A;  1S72 T;  3CXC P;  3HFO A;  4IUP A;  2DEU A;  1NR9 A;  3CC2 T;  4LDY A;  5LL6 S;  3T9N A;  1WLP B;  2XKO C;  1JJ2 P;  1UJY A;  1GBQ A;  1YI2 T;  1GCQ C;  3JB9 D;  3CMA Q;  2JM9 A;  4DEX A;  2E3H A;  2JVV A;  1OPK A;  4LNP A;  4DOW A;  5IN1 A;  4RTX A;  3OYD A;  4KH1 B;  1YIJ Q;  4ELZ C;  4IIM A;  1K0S A;  2K3X A;  1Q81 U;  4M78 B;  3CCU T;  4LE9 A;  2JTF A;  3REB B;  3CCQ A;  3E2U A;  2CRE A;  3EFR A;  3UAT A;  1KHC A;  2EW3 A;  2R5M A;  3PMI A;  2YXY A;  4M78 F;  2CT3 A;  3JCM d;  3U23 A;  2OTL T;  3L42 A;  2V8K A;  4X9D A;  1SEM A;  1QP3 A;  3PE0 A;  3KUF A;  2F2X A;  1Q86 U;  2FPD A;  3NPF A;  4EPC A;  1B34 B;  2VXE A;  2DE0 X;  3ER0 A;  2Q19 X;  3PT9 A;  2CP3 A;  3RKW A;  1KD1 R;  2KI7 A;  2DER A;  4ZN3 A;  4JJB A;  3M0T A;  4R56 A;  2ZZD A;  2RPN A;  3THK A;  2K3Y A;  5LJ5 h;  5FRO A;  3ASK A;  4M75 C;  2OAW A;  3I56 A;  1K8A C;  1PHT A;  2DNU A;  2RI2 A;  4Z88 A;  3VUZ A;  2L2P A;  1Z9Q A;  3ZFJ A;  4N0A C;  1YIT Q;  4EMH A;  3BQB A;  4DBR A;  4D8D A;  3QBY A;  5CCA A;  5I2M A;  2QG9 B;  3BDU A;  3PGG A;  3TSW A;  4RTZ A;  3G71 T;  1BI2 A;  2GTJ A;  3A8G B;  3CC2 Q;  4V2S A;  2RQV A;  4XU2 A;  1YI2 Q;  1MHN A;  1WHH A;  4LXC A;  3WXM B;  3C94 A;  4CI0 C;  2EQM A;  4OF1 A;  2A37 A;  2DZ9 A;  3DLL A;  5A2Q E;  4GLM A;  2M51 A;  1S1N A;  3GLX A;  1QQJ A;  2BTT A;  3SEM A;  4ELY C;  2C06 A;  2EYZ A;  1FMK A;  2OAU A;  3QDR B;  2ZAE A;  3SFM A;  2MOX A;  4E6R A;  1M1F A;  4M78 A;  3CCU Q;  1K9M R;  2D6F A;  2OX7 A;  3LGF A;  3CBP A;  3MEA A;  2RK1 A;  2RJE A;  1RAC B;  2X35 A;  2DMO A;  4KGX B;  1KC8 U;  1AVZ C;  3OS5 A;  2OTL Q;  3VS4 A;  1MND A;  1G5V A;  1ABQ A;  3D7S B;  4OML A;  1B34 A;  1K73 R;  2DFU A;  2EWN A;  3QZ9 B;  3EFO B;  1OX9 A;  1UTI A;  3LW5 E;  2HKQ B;  5GAO r;  1OI1 A;  2D8J A;  5GAN 7;  2G3R A;  1W1F A;  1YFN A;  5CKF A;  2X3X D;  4KGZ B;  2JZ2 A;  2EKH A;  2EQU A;  2EAY A;  3SWN C;  2E70 A;  2DYB A;  2F2V A;  2DET A;  2DBK A;  4RCB A;  4BY6 C;  1BKB A;  1SSF A;  2IIM A;  4CRI A;  2FZK B;  2HBP A;  2RQR A;  2EYW A;  3H6Z A;  1KQ1 A;  1RLQ C;  4KH0 B;  3OY9 A;  2QYZ A;  3UT1 A;  5GAN h;  1RLP C;  2QQ9 A;  3E19 A;  2LJ3 A;  3REA B;  4JZ4 A;  2CT4 A;  4XK8 E;  2KY9 A;  1VQP T;  3G4S T;  4RG8 A;  1VQN A;  2E5K A;  2KDS A;  3S3N A;  3CD6 A;  4FSS A;  2CSI A;  3QZ5 B;  3P8H A;  3QHS A;  4B6M A;  1W2B P;  4DEY A;  4HCC A;  2IG0 A;  5FU7 B;  5AT1 B;  2RMO A;  2Z0W A;  4EIK A;  4BUG A;  2J6F A;  2RM4 A;  4XTX A;  2QQA A;  4RCC A;  2D0Q B;  1UHF A;  1QMC A;  1KJW A;  5FU6 B;  3ZL7 C;  1D0X A;  2ECZ A;  1LCK A;  2YRC A;  2P0K A;  4GLK A;  1AEY A;  3ZEH A;  2DK3 A;  3CCQ T;  3EFO A;  2PVD B;  2XG8 D;  1K0X A;  4C8Q E;  1KG1 A;  2CZ7 B;  1WNL A;  1EX4 A;  5GAO m;  3X28 B;  4M78 D;  3CMA A;  1WX6 A;  2HBW A;  2A0F B;  4MDX A;  5GMK l;  4OGC A;  4M77 B;  3CCS T;  3MJX A;  3TVT A;  2DIG A;  4C92 G;  4IUR A;  3EG2 A;  5CVI A;  2YLC A;  2IPO B;  2BZX A;  2CKK A;  2GQV A;  1V1C A;  4HKE A;  2EGE A;  1UG1 A;  3FJ5 A;  1XJW B;  3MO8 A;  4F7U E;  2W0Z A;  3CPW A;  2LCC A;  1M1K C;  1LNX A;  3I56 T;  4HVV A;  1WDX A;  2P4R A;  1TU0 B;  2B8A A;  9ATC B;  4M7D E;  1IRX A;  4L5G A;  4J5Y A;  3RKY A;  1VQP Q;  3G4S Q;  1UGV A;  1NBE B;  1UGQ B;  4OB3 B;  4FW1 A;  2MF2 A;  1QVG A;  2CH4 W;  5GAO l;  3M56 A;  3G7Z A;  2V8I A;  3QPH A;  5GAN 3;  3NMZ C;  4J9H A;  2ZPF B;  1ARK A;  3O8V A;  1RAG B;  2DXU A;  4F7U G;  2GQI A;  5CKE A;  5LJ5 f;  3EGD B;  1KQS S;  2XU8 A;  3BY7 A;  1H3H A;  4LDW A;  8AT1 B;  1Y57 A;  4FYV B;  4IKF A;  4Y28 E;  3X24 B;  2F69 A;  2DXB A;  4RTU A;  4II1 A;  2B86 A;  3X25 B;  2HDA A;  4C0Z A;  1G2B A;  2I0N A;  3Q1J A;  1YIT A;  1GFD A;  1XTD A;  2PUK B;  2NYS A;  4EMG A;  3CCQ Q;  1S72 A;  2HEQ A;  1Q82 C;  4R55 A;  4ME7 A;  3JB9 H;  1UE9 A;  1X6G A;  3PIP A;  2F2W A;  4L6V 5;  3RDV A;  1BI0 A;  4M75 B;  2YUO A;  2EB4 A;  4M77 A;  3CCS Q;  5HCK A;  3NGP A;  2JTM A;  2EPD A;  4XU1 A;  2DTI A;  4PJL A;  2QQS A;  4M75 F;  1AZG B;  5KCH A;  2YUP A;  1YNZ A;  3MCA B;  4J9C A;  4J83 A;  1M90 U;  3JCM P;  5FWB A;  1O75 A;  2E10 A;  4FL6 A;  1WA7 A;  2EJ9 A;  4AFS C;  3PIO A;  3CCU A;  2DL3 A;  2KRS A;  1X6O A;  4J7I A;  1PKT A;  3I56 Q;  1I4K 1;  5LJ5 d;  1TXQ A;  3PVQ A;  2LP5 A;  2E65 A;  2DL8 A;  2LTO A;  5D2J A;  2X3W D;  1GCQ A;  2OTL A;  3LLR A;  3JSC A;  4PLL A;  4LD9 K;  2PQW A;  3CEY A;  4QQD A;  3A8M B;  3R6O A;  1IRE B;  2VV5 A;  3TQ7 P;  1UGP B;  5LJ3 g;  3OYL A;  3L2U A;  1YWP A;  1G3Y A;  3H9N A;  5I2S A;  1Q7Y C;  1Y07 A;  1IO6 A;  3OSS C;  2LNV A;  1VQ4 A;  5I11 A;  1AD5 A;  1VYU A;  2DPP B;  3BFM A;  4LUE A;  1Q82 U;  4JRK A;  1PCX A;  3EGD A;  4C8Q C;  1VYT A;  3CCM T;  1VQN T;  2FYK A;  4QKU A;  3VS6 A;  3A5Z B;  4XQ3 A;  1NLP C;  2XDB A;  1WJS A;  2V1Q A;  1BCO A;  4QW2 A;  3LX7 A;  2CSQ A;  5GAN g;  1JJ2 S;  3N5B B;  3M54 A;  2JS2 A;  5IHN A;  2F5T X;  3G71 A;  2HMA A;  2CZ0 B;  4FYW B;  4EDU A;  2JUF A;  3C4S A;  3E9F A;  1NG2 A;  3M59 A;  3SWN B;  2DJZ A;  6AT1 B;  4M75 A;  2JNG A;  4M7D C;  3QYG B;  4JS5 A;  2EBP A;  4OMN A;  2BE9 B;  4GBQ A;  1Y96 B;  4C0D C;  1SSH A;  3LWI A;  1UGR B;  2RO0 A;  4N0A A;  2KXD A;  1M8V A;  4JLG A;  2C0I A;  1T0H A;  2XID A;  3OW2 A;  1WPY A;  2LJ0 A;  2IVW A;  3L2Z A;  3VRY A;  4MZT A;  3TU4 K;  3C0C A;  1UB4 A;  2OTJ T;  1AWO A;  1Y71 A;  2VXF A;  1EFN A;  2ROT A;  3ULR B;  2DAQ A;  2PUO B;  5I22 A;  2AK5 A;  3C12 A;  3FRN A;  4M7A G;  1UDL A;  2RJC A;  2NWM A;  1CKB A;  2EYQ A;  1VOM A;  2K9G A;  1AHJ B;  1G3T A;  1VQK T;  1JO8 A;  2QI2 A;  3QUI A;  3CCM Q;  1VQN Q;  3OS0 A;  4B9W A;  1BIA A;  4UC4 A;  5KYY B;  3S3O A;  1K8A R;  5A0G A;  2HQH A;  3HHT B;  4C5G A;  3CC7 T;  1Q81 C;  4OB1 B;  4E7H A;  2GFA A;  3M58 A;  3MEW A;  4NL3 A;  3INZ A;  3A98 A;  4HCZ A;  4ZN1 A;  2DF6 A;  3J7A F;  3KBG A;  3GPL A;  3QJY A;  2QAZ A;  4PJO E;  2E41 A;  2BKD N;  5LJ3 e;  2DTH A;  4JJC A;  2K57 A;  1Q86 C;  5D2G A;  2R58 A;  3JCM X;  4N4G A;  4OVA A;  3SWN A;  3G4S A;  3MP1 A;  1UUE A;  2HCK A;  1WZO A;  4J9I A;  1Y96 A;  2KT1 A;  5GAN 6;  4J6Y A;  3HKS A;  3L2V A;  3CPW P;  4E2F B;  1WJQ A;  4OMM A;  1UFF A;  1VQL T;  4PJO G;  5KYU B;  4BDZ A;  1G83 A;  2DKG A;  4QQG A;  1UEB A;  3VRZ A;  5GAN e;  3M5A A;  4NOY A;  1QVG P;  1M5Q 1;  2KXC A;  4M75 D;  2OTJ Q;  4F16 A;  3DB4 A;  4JRQ A;  3VS0 A;  3CCV A;  1YP5 A;  2EGA A;  2HL5 C;  5KCO A;  1JQQ A;  4PJN A;  2KMT A;  2X4W A;  1BK2 A;  2KEA A;  3UA6 A;  3P8B B;  4ZGD B;  3V7R A;  3A8L B;  4OB0 B;  3NTK A;  4HVU A;  2Q18 X;  3DKM A;  2I2L A;  2RHZ A;  1VQK Q;  3CCS A;  3UPU A;  3P8D A;  3F70 A;  4FYY B;  3CME T;  5KYW B;  2DM1 A;  5KYY A;  1XQH A;  3CC7 Q;  1T3L A;  2OI3 A;  1M3A A;  1VQ4 T;  2GTO A;  3OQ5 A;  1D1C A;  4BB7 A;  1KC8 C;  3EH2 A;  3GF5 A;  1QKX A;  1NJI C;  1WHM A;  1MMN A;  1N8R U;  4FW2 A;  4FCY A;  1RI0 A;  2FB7 A;  1RAA B;  2GNC A;  4J7F A;  2E64 A;  5IXF A;  4ZNX A;  3I5R A;  3CC4 A;  1E7O A;  3LWH A;  2PVG B;  4KRT A;  1OZ3 A;  4CC3 A;  5LJ5 j;  2KGT A;  1TUG B;  1M1G A;  2M02 A;  4PJJ A;  3VV0 A;  3OYA A;  1S72 Q;  1RAE B;  2QAS A;  4QVD A;  1IB8 A;  4Z8A A;  2YHT A;  4IUT A;  3BW1 A;  3V7S A;  5KH6 A;  2ZPB B;  2X9H A;  2KNB B;  2COZ A;  2ENM A;  2FPF A;  2LMJ A;  5KYU A;  1FMW A;  1U8R A;  5CIU A;  1ZLM A;  1VQO T;  2VGN A;  3SD4 A;  2V26 A;  3MEV A;  2DEQ A;  1OZ2 A;  2RJF A;  1RAI B;  2PU9 B;  1PM3 A;  2JOY A;  2KYM A;  2EJG A;  3CCE T;  1G8X A;  3I5S A;  2DRM A;  4JRI A;  3VS1 A;  4LDX A;  5DY9 A;  1I8F A;  5EG2 A;  3UWN A;  2QA4 T;  2GBQ A;  1IGQ A;  1SHG A;  3JCM J;  4WF2 A;  1JEG A;  1VA7 A;  1VQM A;  3OMC A;  1NJI U;  3RNJ A;  2LCL A;  4C8Q B;  2DO3 A;  4PJO C;  2JXB A;  1T3S A;  4FU6 A;  5GAO p;  1YHQ T;  3NTH A;  5GAM g;  2JT4 A;  4C8Q F;  5KYW A;  3X20 B;  3CCL T;  2EB5 A;  4BI8 B;  4HVW A;  1NLO C;  5DLQ E;  4B9X A;  2DYI A;  1R0B G;  4ANJ A;  5LJ3 h;  5IXB A;  3M0S A;  4LN2 A;  1VQ4 Q;  3OSV A;  1LPL A;  2GGR A;  1GTT A;  3TRE A;  3JAM E;  3RMS A;  1JU5 C;  4F7U B;  4OGE A;  1QVF S;  1M1K R;  3ZBD A;  4E7Z A;  3PFS A;  2D0N A;  3GOX A;  4F7U F;  4M7D B;  2OJ2 A;  2WQT A;  2HQX A;  4C0D B;  2M0Y A;  4F04 B;  4PK4 A;  3LH5 A;  3OW2 P;  1KQS A;  3G71 Q;  1VQ8 T;  4M7D F;  2JMA A;  2MPX C;  2K6D A;  4M4Z A;  1VUB A;  3OA6 A;  4M78 G;  2O01 E;  3JCM W;  2KRO A;  1N9R A;  5L8R E;  3CCM A;  4MDW A;  3FB9 A;  4X9C A;  5GMK m;  3RMQ A;  4JJN K;  3FEO A;  3CCE Q;  5GAN j;  2HSE B;  1BYM A;  3KXT A;  2AIR B;  2MYS A;  1RL2 A;  3FC3 A;  4XTY A;  4O6J A;  2QA4 Q;  2LVM A;  2NUP B;  1TTH B;  3M0R A;  1NPR A;  1VYV A;  1C1A A;  5IAY A;  1C6V X;  4DA4 A;  4C92 E;  3FDR A;  1YBY A;  3VUB A;  4C8Q A;  2FZC B;  2X4X A;  2AZV A;  2RHX A;  3CCV T;  1YHQ Q;  2RNA A;  2DL5 A;  2KYB A;  2EQJ A;  5GMK e;  3JB9 I;  3CCL Q;  2JM8 A;  1ZUU A;  3RIR A;  3EG0 A;  3FLG A;  2MIO A;  4PLI A;  1KD1 U;  1C0M A;  3OBY A;  1AWX A;  1YCY A;  1QWE A;  3RR6 A;  4F7U A;  3RBB B;  1OQK A;  1W4S A;  1VIF A;  2HZY A;  2FHD A;  4R0K A;  2OTJ A;  2PTK A;  2BUD A;  2ESW A;  1X6B A;  2ROL A;  4M7D A;  2ZCF B;  2DVJ A;  2HQE A;  3KFV A;  1ZQ1 A;  4FYX B;  4KUL A;  1MV0 B;  3S52 A;  1K73 C;  1JB0 E;  1VQ8 Q;  1SF9 A;  5GAN 5;  2YRD A;  2J7I A;  1T0J A;  3OMG A;  1Q7Y R;  5GAM e;  4A4G A;  2LCS A;  2JMC A;  5GAN 8;  1VQK A;  2HAX A;  2Q1A X;  4HT9 A;  3CC4 T;  4F14 A;  5D2H A;  1PD0 A;  2RHI A;  1M90 C;  1JJ2 A;  5FWC A;  3CC7 A;  2A08 A;  3E1S A;  4OMF B;  4QQ6 A;  3NHN A;  3L2W A;  3OYN A;  4C0F A;  1P92 A;  2E6Z A;  1Y0M A;  1K76 A;  4N4I A;  4XU0 A;  2RF0 A;  4FSX A;  2RJD A;  2M9U A;  2E4H A;  2F5K A;  2VGM A;  3FJP A;  2NUP A;  5KE2 A;  1SV6 A;  4ZTF A;  3MPU B;  2M0O A;  1M30 A;  3VKI A;  4OP0 A;  4QT7 A;  4WTO B;  1KFZ A;  3MKD A;  5EC7 A;  1K9M U;  1EIF A;  1M2O A;  4EMK C;  2CYZ B;  1W70 A;  5IHI A;  2EJF A;  2JTE A;  4QVZ A;  2KRM A;  1CKA A;  2X4J A;  3CCV Q;  2P84 A;  3L2Q A;  2HL3 A;  4AMC A;  2J6K A;  3VU3 C;  1RI9 A;  3BE3 A;  2DD4 A;  2RH2 A;  1VQM T;  2QQR A;  4RKU E;  1JXO A;  2JW4 A;  4OMQ A;  3O5Z A;  3OYK A;  1K73 U;  2CP5 A;  3OYF A;  4DBF A;  2VB6 A;  3NTI A;  4A54 A;  3HRT A;  1YJW T;  1VQL A;  1NYF A;  3HFN A;  4RTV A;  2W10 A;  1OYX A;  4Y91 A;  3TEE A;  4M7A F;  4XTW A;  2YRV A;  3H0I A;  4C8Q D;  1QCN A;  1KIK A;  3EH1 A;  3EGU A;  3M9Q A;  2FO0 A;  2PZ1 A;  2RK2 A;  1N5Z A;  4JLI A;  4OMP A;  1Z9Z A;  2RHU A;  2LRQ A;  3OYG A;  1VQ7 T;  1MMD A;  1HXD A;  1IHW A;  1KK7 A;  4C92 C;  4PKC C;  3CC4 Q;  2J05 A;  2YUN A;  5HK3 A;  1R8O B;  1RAF B;  1SPK A;  4AFU C;  3CME A;  2L5Q A;  5IT9 E;  3DB3 A;  2KK4 A;  5ECA A;  4BAC A;  5LJ3 f;  4M7D D;  1YJ9 T;  1Q81 R;  1X01 A;  1JXM A;  3OYY A;  1U3O A;  1FWZ A;  1I7O A;  2CGH A;  1YN8 A;  1QP2 A;  1E6H A;  1NYG A;  2EYY A;  3FIF A;  4OMO A;  4A4F A;  2E12 A;  3E9G A;  1WQW A;  3RUX A;  5GMK h;  3QXE B;  1D09 B;  2WAC A;  2DVE A;  3CXC S;  4E7I A;  2QDL A;  4HT8 A;  4PNO A;  4PJO B;  4M77 G;  4J9D A;  4LD6 A;  1ZUK A;  1Q86 R;  1QCO A;  2XD0 A;  2RA2 A;  1NEG A;  4J9G A;  2A3L A;  2EQI A;  3G1J A;  3MP8 A;  4PJO F;  5GAN f;  2FEI A;  1VQM Q;  1PSF A;  4KT0 E;  2KAF A;  4MZP A;  4BE2 A;  2CZ1 B;  2HD0 A;  5D6Y A;  1YJW Q;  5GAN 2;  3PNW C;  3CQT A;  4BY6 B;  1E6G A;  2V1R A;  1NM7 A;  1VQO A;  3TCJ A;  3VS2 A;  1WQ7 A;  3QG1 A;  2YSQ A;  2LQN A;  1N9S A;  4M7A E;  2WSF E;  3CCE A;  1R77 A;  4ATO A;  5GAM h;  1ACM B;  1K9A A;  2C0O A;  3EG1 A;  2E3I A;  1AWW A;  2K7A A;  2QA4 A;  3CCR T;  5LJ3 d;  1QLY A;  3JB9 J;  2K2M A;  3BDL A;  1ZBX A;  2D8H A;  1NKQ A;  4DBQ A;  2QEX T;  2X51 A;  1VQ7 Q;  1DJ7 B;  1OU8 A;  4IUQ A;  3V8K A;  2J6O A;  3QO3 A;  1UEC A;  5GAM j;  5D2F A;  5AYF A;  1YHQ A;  3C95 A;  1I5L A;  2KQW A;  3CCL A;  1UGS B;  1G3W A;  4A4H A;  4J8O A;  4Q5W A;  1YJ9 Q;  4FT4 A;  5DM7 R;  1OV3 A;  1K1Z A;  2CUD A;  3JB9 G;  3GP8 A;  1OU9 A;  3JV3 A;  4BE1 A;  1NZ9 A;  5GAN d;  3RKX A;  2DXT A;  3H0F A;  2RI5 A;  1KC8 R;  4PFP A;  4AFQ C;  1WIE A;  2CP6 A;  1YJN T;  1SAW A;  4QVC A;  5IH2 A;  4CC4 B;  1BU1 A;  2P0Q A;  1SHF A;  4X34 A;  4M75 G;  1H64 1;  3UDC A;  4LUD A;  4PL6 A;  4PJO A;  1ZHI A;  3URG A;  3ME9 A;  2RHY A;  1MV3 A;  1I81 A;  1MNE A;  1PWT A;  1J3T A;  1U1S A;  1PSE A;  3S3M A;  1VQ8 A;  5HY6 A;  4ESR A;  2FPE A;  1ZSG A;  4IUU A;  3JCM g;  1D1B A;  5CKD A;  1CSK A;  3EAE A;  2ZPI B;  5D6W A;  1M2V B;  3EGX B;  4E47 A;  3UF4 A;  4RG2 A;  4KUI A;  3PMT A;  2GFU A;  2JS0 A;  3OYC A;  3CCJ T;  2KR3 A;  3I35 A;  1N8R C;  5D7U A;  3CCR Q;  2L3P A;  1AZE A;  2QDY B;  2M1H A;  1X69 A;  2FRW A;  4J9E A;  4XTZ A;  1BIB A;  4ZGE B;  2QTX A;  3RER A;  2QEX Q;  1IHV A;  3M57 A;  4M7A D;  2YUQ A;  2MMP A;  1U1T A;  1X75 C;  4JPB W;  4BD3 A;  4IIO A;  2LT1 A;  3OBW A;  2L3Q A;  3EG3 A;  2XI9 A;  3HRU A;  4KBM B;  8ATC B;  1LVK A;  3EG9 B;  3M55 A;  2H3E B;  5KYX B;  2K79 A;  1QVF A;  2AHJ B;  3J80 E;  2L89 A;  1PC0 A;  2E6N A;  2VKN A;  2JN0 A;  1ZUY A;  4PJM A;  2ZPG B;  3QYH B;  1YJN Q;  3EHQ A;  3G6E T;  1PRL C;  4D8K A;  3OW2 S;  4EMK B;  1GL5 A;  2EVR A;  2XMF A;  3RES A;  1VQ9 T;  4L59 A;  3HSB A;  1VQ5 T;  2KE9 A;  4AG1 C;  1WHL A;  4M7A C;  4FM4 B;  4DOV A;  1TOV A;  1SKU B;  2EKO A;  3L1A A;  2LQ8 A;  4ZTJ A;  3GNF B;  2QGF B;  4JZ3 A;  2LC4 A;  2K3B A;  2O2O A;  7AT1 B;  1WXU A;  2QXF A;  2D9T A;  4A4K A;  1W2B S;  1X43 A;  2G6F X;  1M2V A;  3EGX A;  3V77 A;  4PFO A;  2K4Y A;  2VC8 A;  4PJO D;  2EB6 A;  3CCJ Q;  4NL2 A;  2DTO A;  2EGC A;  2Y4Y A;  2M16 A;  2KT8 A;  4BDY A;  1BI3 A;  1VQL Q;  4HCK A;  4X1V A;  5D6X A;  2WSC E;  2MWP A;  3OS2 A;  1GFC A;  1WGS A;  2FRY A;  3HPW A;  1GXI E;  2QTV A;  1H3Z A;  4C92 B;  3LYI A;  4C5H A;  4RMO A;  2AKL A;  2O4X B;  3I9Q A;  2K2V A;  2DA9 A;  2E5Q A;  3GNG A;  1TS9 A;  4E7J A;  1M27 C;  1PKS A;  4C92 F;  3JCM e;  1LOJ A;  3CPF A;  1I0C A;  1VIE A;  1MMA A;  5A0L A;  3EG9 A;  3EFS A;  2RQU A;  5KYX A;  4P5N A;  1IXD A;  5CQY A;  3I55 T;  1YJW A;  3MHX A;  5FLX E;  5J26 A;  2XDD A;  1QW1 A;  2MAM A;  4DBH A;  1I07 A;  3G6E Q;  1D3B B;  3CME Q;  2MI6 A;  4EMK A;  3QWX X;  1ZA2 B;  1VQ9 Q;  2F1L A;  3OYH A;  5GAM f;  2XHC A;  1VQ5 Q;  1K8A U;  2YDL A;  2LJ1 A;  1D0Z A;  4M78 E;  2A28 A;  1VQ6 A;  3MET A;  2XDP A;  2DIQ A;  1BBZ A;  1NPP A;  4N4H A;  3HRS A;  1B07 A;  4CC2 A;  1VQ7 A;  3A8H B;  1ZSZ C;  4J9F A;  2CP0 A;  4K11 A;  3V8L A;  2WSE E;  3JCM b;  5LJ3 j;  1I5O B;  2RN8 A;  2X4Y A;  3VS5 A;  4ORZ A;  2EQK A;  3L2R A;  1M90 R;  4JDS A;  1KD1 C;  1YJ9 A;  3GBQ A;  2DLP A;  5L23 A;  3M0U A;  1SRM A;  4VUB A;  3M0P A;  1WHK A;  3AT1 B;  4NS5 A;  2YWW A;  3IQL A;  4C5E A;  4OB2 B;  1WI7 A;  2K5L A;  3VJP A;  2NUZ A;  3AHU A;  2JJ9 A;  1VQO Q;  1RAH B;  3VYG A;  1AOJ A;  1M3B A;  3H41 A;  2CS7 A;  4C92 A;  4C5I A;  2R57 A;  4E7L A;  2O4X A;  2PVO B;  4PFZ A;  2CH4 A;  1PD1 A;  2DBM A;  1BB9 A;  2AZS A;  2DXC A;  2K5F A;  2VAS A;  1B7T A;  1KSW A;  1KQ2 A;  2XK0 A;  5GAM d;  2HKN A;  2RB6 A;  1RAD B;  1N6A A;  1Q82 R;  1OPL A;  4WCI A;  3I55 Q;  3JRZ A;  1FMV A;  4MML A;  4AT1 B;  2V8J A;  1MGQ A;  4A63 B;  1BCM A;  3JCM V;  3QSU A;  1UHC A;  1D3B A;  4E7K A;  3PVL A;  4XTU A;  2BZY A;  2L3R A;  2L8D A;  2AT1 B;  1HJD A;  3CBO A;  1M9S A;  2DD5 A;  1GBR A;  1Y7X A;  3CCR A;  1K9M C;  2VWF A;  2FZG B;  2QK0 A;  5A0D A;  5KE3 A;  2H8H A;  2YT6 A;  4RTY A;  3OYI A;  4J6X A;  4HCB A;  2HNI A;  2NLU A;  4BI4 A;  2A36 A;  2QEX A;  4LDV A;  1X2Q A;  1OEB A;  2KRN A;  5CO7 A;  1AWJ A;  1X27 A;  4AG2 C;  4DQ2 A;  5HKC A;  4RTT A;  2SRC A;  3LZK A;  4CC7 A;  3NFC A;  5CQX A;  3MEU A;  5D2K A;  2CP2 A;  1D1A A;  4GY5 A;  1XNI A;  2Q1D X;  1YIJ A;  1WXT A;  4M77 F;  5IHK A;  3V7C A;  4A53 A;  3CXC A;  1QCF A;  2GF7 A;  1GCP A;  1YJN A;  2C0T A;  1FXX A;  3JCM h;  1Q95 G;  4C8Q G;  2H3J A;  5HK0 A;  3UA7 A;  1ZBJ A;  2HSP A;  2Q1C X;  2MWO A;  2DZC A;  3TSZ A;  2FL7 A;  3VS3 A;  1RUW A;  3H8Z A;  3QII A;  1TUD A;  1I1J A;  1ZX6 A;  1XOV A;  5CR2 A;  2NUT B;  1QVF P;  2P4T A;  2EYX A;  2ABL A;  2ZGW A;  4M78 C;  2KVQ G;  4HXJ A;  5LJ5 g;  4MZM A;  3OYB A;  1PG5 B;  2FVU A;  1H8K A;  1U06 A;  3X26 B;  2E1H A;  5GAO q;  1R0C B;  4Z02 A;  4J9B A;  1PNJ A;  3A8O B;  4M7D G;  3GIB A;  4HA8 A;  4C92 D;  3CCJ A;  1PRM C;  4FIB A;  5CKB A;  4M7A B;  1HD3 A;  2ED0 A;  2LZ6 B;  4FT2 A;  4JS4 A;  3M4G A;  1TSF A;  1V76 A;  4JUV A;  2LT4 A;  2FG0 A;  1NE8 A;  1M4Z A;  4Y92 A;  1BI1 A;  1TG0 A;  5M9O A;  4C0G A;  1MUZ A;  2LX7 A;  1JRI A;  3CC2 A;  2LNH B;  1B3Q A;  2A7Y A;  2COW A;  1TUC A;  3JB9 F;  1M1K U;  2D1X A;  1NEB A;  1YI2 A;  3QJ6 A;  4TVR A;  2GCX A;  1AT1 B;  3HP9 A;  1VQ6 T;  4MAQ A;  2COY A;  5GJW B;  4O5V A;  3OYJ A;  1M8M A;  4AFZ C;  1FYN A;  2MCN A;  2O9S A;  3V8J A;  1OX8 A;  2J06 A;  4M77 E;  1ABO A;  5D2I A;  1G3S A;  3G6E A;  3WVE B;  4BE0 A;  2VYT A;  4XU3 A;  1WFW A;  2RD1 A;  2BIV A;  1VQ9 A;  3R6N A;  1LJO A;  1VQ5 A;  2ED1 A;  2BE7 D;  2O31 A;  2ZPH B;  3JCM c;  3VS7 A;  5FW9 A;  3LGL A;  5GMK i;  2ATC B;  2QQB A;  2Y4X A;  4IUV A;  4MMK A;  3OS1 A;  2NUT A;  2RI3 A;  5J3B A;  2SEM A;  3JCM Q;  2DJQ A;  3SB2 A;  1UJ0 A;  4RTW A;  1OOT A;  5KYN A;  3WVD B;  1EZZ B;  2QGG A;  1QKW A;  1F1B B;  4E7S A;  4XAX B;  4YTL A;  1HYO A;  1YWO A;  3OYM A;  5CK9 A;  3CPW S;  1HSQ A;  2YLB A;  4D6W A;  1A0N B;  2DL7 A;  5GMK j;  3CD6 T;  1WJR A;  2KSS A;  2RQT A;  1ZA1 B;  4RUG A;  5DLO A;  3PTA A;  4M7A A;  2DRK A;  3MP6 A;  4JRP A;  1QVG S;  1U5S A;  1JBM A;  1N8R R;  4A4E A;  2O88 A;  2LX9 A;  3HL8 A;  5J39 A;  2O9V A;  1HK9 A;  1ZSZ B;  1IGU A;  2VUB A;  3CBM A;  1KQS P;  4KGV B;  2P0P A;  5LJ5 e;  1M3C A;  3SHW A;  2MK5 A;  4JJD A;  1VQ6 Q;  2CP7 A;  1YCS B;  4KUD K;  1QWF A;  1TWB A;  1GRI A;  1V29 B;  3QWY A;  2PNI A;  3I55 A;  2DL4 A;  4M75 E;  1Q7Y U;  5C0M A;  3CMA T;  4ZGJ B;  3M4Y A;  3HTR A;  3J81 E;  4BI3 A;  2Y90 A;  5GJV B;  2LQK A;  5I21 A;  1YIJ T;  2EFI A;  4F17 A;  4M77 D;  1WHG A;  1WHJ A;  5C6S A;  5FU7 C;  1SRL A;  1H92 A;  3A1P A;  1W2B A;  1N27 A;  2BZ8 A;  1NJI R;  1WXB A;  5CAI A;  1MMG A;  3SDZ A;  5FU6 C;  1TH7 A;  2DIL A;  3M53 A;  5GAO n;  2R5A A;  2CZ6 B;  2RQW A;  3S6W A;  3OB9 A;  3VYH B;  4J6W A;  1W6X A;  5FRN A;  2DX1 A;  3QDF A;  1O9S A;  5GAN 4;  3H0H A;  1IZ6 A;  3CD6 Q; 
#chains in the Genus database with same CATH homology
 3V77 A;  4DBH A;  1I7O A;  5D2J A;  5D2F A;  2DFU A;  2EB5 A;  1WZO A;  2Q18 X;  3LZK A;  3S52 A;  2EB6 A;  2Q1C X;  4QKU A;  2WQT A;  3R6O A;  1QCN A;  3RR6 A;  4MAQ A;  5D2K A;  1NR9 A;  5D2I A;  2Q19 X;  2Q1D X;  1NKQ A;  1SV6 A;  2HZY A;  1GTT A;  3QDF A;  2Q1A X;  3BQB A;  1QCO A;  4DBF A;  1HYO A;  5D2H A;  1QQJ A;  2EB4 A;  4PFZ A;  1SAW A;  5D2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...