4DBUA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 3-((4 -(trifluoromethyl)phenyl)amino)benzoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
b'QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of AKR1C3 containing an N-(aryl)amino-benzoate inhibitor and a bifunctional AKR1C3 inhibitor and androgen receptor antagonist. Therapeutic leads for castrate resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbuA00
3GUGA 2PDFA 4LBSA 1ZGDA 3UZXA 3GHUA 3NTYA 2PDHA 2IKJA 4F40A 1GVEA 4XAPA 3T42A 4IJRA 4GA8A 1ZQ5A 2IKHA 4HMNA 1ADSA 2PDIA 2BGQA 2C91A 4FA3A 5M2FX 1SM9A 4NKCA 3GHSA 4XK2A 1RALA 3LQLA 1J96A 4XZLX 2HV5A 2FZBA 2DUXA 4YVVA 2PFHA 3WBWA 5LIYX 4GACA 1IEIA 2FZDA 2NVCA 2PDKA 4WEVX 3R94A 3CAQA 1IHIA 3CV6A 3GHTA 1X97A 3GHRA 4DBWA 4R9OA 1PZ0A 2FZ8A 1XF0A 4JTDA 2PEVA 5HNUA 2BP1A 1Z9AA 1Q5MA 1M9HA 3LZ5A 2PDBA 4DBSA 4QBXA 4WDTA 4Q3MA 1PWLA 3LN3A 3R8HA 5HNTA 4GABA 2NVDA 3BV7A 3LUTA 2ACUA 3M0IA 1R38A 3H7RA 3R6IA 4PR4A 4Q7BA 4PMJA 3H7UA 5LIXX 3MC5A 4WGHA 3D3FA 4JIHA 3UP8A 3C3UA 1Z8AA 4AUBA 3G1RA 2PDQA 1MI3A 4LB4A 4XZIA 2PDYA 1S1PA 3CAVA 3N6QA 2BGSA 2IPGA 5LIKX 2ACSA 3BUVA 2INEA 4JQ3A 2HEJA 4H8NA 2PDLA 3LBOA 2INZA 2A79A 2IPWA 4ASTA 1PYFA 3LD5A 1EF3A 3DN5A 3UZYA 4LAUA 3O0KA 4JTRA 1PZ1A 3FJNA 4XVDA 4FAMA 3R43A 4XO6A 3LNMA 4XZHA 4WDXA 3V0TA 4JTQA 1MZRA 1T41A 1Z89A 3M64A 3UFYA 4YU1A 2PD9A 3ONCA 2DV0A 1K8CA 3V0SA 4LAZA 4MHBA 4IGSA 1YE6A 4PUUA 4XVEA 4G5DA 5HA7A 3B3DA 3LQGA 2IS7A 4GIEA 3LENA 2PDNA 1QRQA 2ACQA 3WCZA 1YNPA 2I16A 3M4HA 2VDGA 2DUZA 3CV7A 4JQ2A 4JIRA 5LIWX 2IQ0A 3VXGA 1VP5A 1X96A 3V35A 2F38A 3ERPA 3LZ3A 4L1XA 2PDMA 3R7MA 1RY8A 3UYIA 4EXBA 4GCAA 5JH2A 4FALA 2R9RA 4LBRA 2PF8A 2FZ9A 2R24A 4YVXA 3G5EA 2HVOA 4ICCX 3O3RA 3FX4A 3EB3A 1Z3NA 1ZUAX 4XO7A 2HE5A 1EL3A 2FGBA 2PDJA 4JTCA 1OG6A 2IPJA 4ZFCA 2I17A 3H4GA 3CMFA 1AH3A 2IQDA 2PD5A 2HE8A 3P2VA 1XJBA 1AZ2A 1JEZA 2IKIA 4I5XA 2WZMA 3F7JA 4JQAA 3UG8A 4XZNX 5JH1A 2IKGA 4IJCA 1X98A 1S2AA 4QX4A 2FVLA 3EB4A 1ZSXA 2P5NA 4WDUA 4H7CA 1FRBA 3R8GA 2F2KA 4JTAA 1EKOA 2PZNA 4HBKA 2PDXA 4FZIA 4RPQA 4JIIX 1PWMA 2PDGA 3Q67A 3UZWA 4YVPA 1HQTA 2AGTA 3R58A 1QWKA 3LEPA 3DOPA 1YNQA 1HW6A 4WRHA 1VBJA 3KRBA 1EXBA 3UZZA 2PDCA 3WBXA 4DZ5A 2ISFA 3COTA 5AZ0A 3ONBA 3EAUA 3MB9A 3RX3A 4DBUA 4L1WA 5AZ1A 1A80A 4JQ1A 2PDWA 3UWEA 1UR3M 5DANA 2ACRA 4QXIA 5LIUX 5KETA 4OTKA 2QXWA 4LB3A 1AH0A 3N2TA 2IPFA 4GQGA 3RX2A 5C7HA 3QKZA 3RX4A 3Q65A 4PRTA 4JQ4A 1AH4A 2CLPA 4WDWA 1LWIA 3S3GA 1C9WA 2HDJA 3CASA 1LQAA 1MRQA 4PRRA 3BCJA 1S1RA 3WG6A 2ALRA 1XGDA 1T40A 1US0A 4GQ0A 4PUWA 1AZ1A 2WZTA 3V0UA 2PDUA 2PDPA 4EXAA 3U2CA 1RY0A 1AFSA 3BURA 4XZMX 2J8TA 1S2CA 4YS1A 3V36A 3WBYA 3UGRA 1Q13A 1YE4A 4QR6A 2HVNA
chains in the Genus database with same CATH superfamily
4QE1A 3THQA 3VX1A 4B4HA 2WNNA 1DKWA 4TO8A 2HS8A 5DT7A 1CLVA 4UTWA 1B2YA 3R0KA 2IKJA 1LWJA 1PEZA 4GA8A 4H9TA 2GGGA 2GUYA 3WH9A 3R8RA 3K4WA 4ACYA 1R3WA 4IGMA 2WHKA 1EP1A 4CD6A 1TRIA 1C29A 3C2YA 3SIMA 1E6RA 1E55A 4N9CA 1R87A 3S2LA 1DBTA 5AYBA 2VZSA 4KS0A 1Y65A 2G3MA 3C61A 3JRKA 1XCFA 4WEVX 1ZJAA 1P0EA 4ORMA 1FUYA 3VIKA 3AZSA 4NAFB 2C16A 3BK0A 5G1YA 5LA2A 5CJ5A 1K6AA 5E9AA 3CHEA 3B0PA 1MO0A 1Q65A 4X0VA 4BJHA 1REQA 2XGBA 3WQOA 1XRVA 3QMRA 3GXNA 2R82A 2DT2A 2J47A 4C6CA 1PZ2A 3VM5A 4Q7BA 3DFNA 2X16A 3L4XA 2RAGA 3NOEA 2VWTA 1AMYA 1MUMA 2EO7A 3AXHA 1DJGA 1GOWA 4EK7A 2O56A 1G67A 2ICSA 2FZNA 4JYDA 1VFMA 1UUQA 2V2CA 1AW5A 4GNKB 1U33A 3ZZ1A 3PTDA 1KLYA 1XRTA 2C0AA 3AWNA 1EDGA 3R13A 2PGEA 1JCMP 3EX1A 3VIPA 1RQBA 3IRSA 4JKKA 1E6SM 1D3CA 4UOJA 3TYZA 3MI3A 2C0HA 3MSRA 2XISA 1VRXA 4C6BA 4IL2A 1DEDA 4AW7A 1GG0A 1AQHA 3SQSA 3E96A 2HWGA 3QZEA 2PGFA 3TTYA 1H4PA 4FOKA 1LCOA 5M1TA 5I77A 1F4AA 1Q6QA 4B3ZA 2QQ6A 2NWSA 5GPRA 1I75A 3SN4A 2BBFA 4P8XA 1TPH1 3VX0A 4AZBA 2YSWA 4JKMA 5AYYA 4L9YA 2V5LA 4XQ6A 2GJPA 2GQ9A 2VDGA 4IQLA 4N42A 4NZ5A 4JQ2A 4GY1A 4RV8A 4OT7A 3HG5A 1UCWA 2W4XA 5JIPA 1XKJA 3ERPA 4AHQA 4NYYA 1I0BA 4MKSA 3WLSA 2JEQA 2P0OA 3TN6A 3CHFA 3AYSA 3OBKA 1ITUA 4Z08A 4ZL1A 4W5UA 1LYXA 4KPLA 3AI0A 2R14A 1HJVA 4K1GA 2VRJA 3MSGA 1UQZA 1KQZA 1G1YA 3E0FA 3KUMA 5CPMA 3QHOA 2ZUUA 2TYSA 1UKQA 1J2WA 1EOKA 4KH2A 4Q8QA 2P1FA 3GG7A 3H7VA 1SO3A 1GYNA 1T8QA 1VBRA 3M47A 3BAYA 1ODZA 2OWWA 1W2PA 2X2GA 3GFYA 4Z17A 2ISWA 2XVNA 4LEFA 3P2VA 5MKGB 3E5BA 3HGJA 2ZRZA 5E93A 1C8XA 4UTTA 5FCZA 5KEZA 4L61A 1Q8JA 3NAVA 4N9EA 1XSKA 2DQXA 1YXCA 1CECA 1CT5A 3F5KA 3T9PA 2NQ5A 2VURA 3V75A 4M56A 1JL8A 3EKZA 4EWJA 4F66A 3U8GA 1QWGA 1BWVA 4ZSTA 1ZSXA 4O19A 1ALDA 3FIGA 3IUHA 1DTUA 1FRBA 1R5YA 1JCYA 1OFEA 4A3RA 3B4UA 1W5QA 1ZU8A 3JVAA 4LC8A 4QLLA 3L4WA 4AFYA 4UMBA 4KGJA 2E67A 4YVPA 4GINA 1L8NA 3FAWA 5GJPA 4HGXA 3ITTA 3T2PA 3L5MA 5GNXA 4FO4A 1UWAA 3II1A 3S5SA 3VNDA 3GXMA 2X40A 1TVNA 2JKPA 2XIIA 4IG2B 2W3ZA 1KWKA 1BWKA 2NUXA 4DBUA 5FF4A 2VC9A 3NNTA 4HT3A 1A0CA 1X6UA 3BTNA 5IOBA 3MHUA 1JQVA 2Y63A 3B0VC 4MAZA 2VEKA 1X7FA 2XIOA 5LIUX 4ZO8A 1GQNA 3CL6A 3AIRA 1F6PA 2OZ8A 4GQGA 1BRLA 3VU2A 3W73A 1TV4A 4QNWA 3VC6A 3DHUA 1A49A 2Y5EA 1RJRA 3S5ZA 4UMAA 5JBFA 3I3BA 1F2JA 3GDTA 4JNMA 4ZQRA 1VBUA 5DF0A 1IZJA 1QPNA 4UIOA 4S38A 4XAFA 3KL3A 3ZT7A 4OV9A 1Q7MA 1M5WA 3S3GA 2DIJA 5D4YA 2GJXB 1EBHA 4UBPC 3RCYA 2OEJA 1OYBA 3PZNA 4TMCA 1QK0A 2ESCA 4JY9A 3DHDA 3MP5A 3FEQA 5C9RA 5C9WA 4P5UA 4F2TA 2OVLA 1OABA 5B80A 4YNGA 3UCCA 4XTIA 3GS6A 1QW7A 2VFIA 3R0DA 1GNXA 4UQ9A 3EEGA 4E4UA 4A29A 3UYCA 1BTCA 1EA9C 3FKKA 2GVYA 3BSHA 3N9KA 1GKPA 4GGHA 2UV8G 4ATLA 3CWOX 4Z42C 2YFOA 4XD5A 1FH8A 3VE7A 3S6TA 2D0FA 3NGFA 2Y24A 5LKYA 1ELSA 1A4MA 3LNPA 2EKCA 3G3MA 1QDSA 3RLGA 3GVRA 4ICMA 3AISA 1YTKA 5HWJA 4MUZA 5LSMA 3B9OA 3T42A 3AXKA 2BDQA 2IKHA 3SRDA 1PS9A 3EA1A 3ARPA 3TJLA 4LAKA 1PDZA 2RGLA 3WYZA 5AC4A 4CVWA 1B3WA 2J7FA 3UA4A 4G8TA 3DYMA 4JDYA 2AKZA 4LV4A 4DXKA 3SAZA 1EB3A 1R47A 1ONEA 3W7IA 1H51A 1N55A 1S5MA 3H6OA 3VIOA 1H11A 2CYGA 4FB7A 3BGJA 2CLFA 2FKPA 4J3WA 4PGLA 3TC7A 1U30A 3L7RA 1U1JA 1LDCA 3I4KA 4P61A 2OCZA 1Z9AA 1B3YA 2YDSA 5FL0A 4JFTA 4PUDA 4UCGA 1DWAM 2NX3A 2A21A 2J77A 1GVOA 2FIQA 2ACUA 1AW1A 1REQB 4TMBA 3R79A 3LU2A 3VFCA 1XIFA 1GVFA 4WJEA 4Q8TA 2VENA 2Y6ZA 2QUTA 3QSRA 1KM1A 3T2OA 4A8NA 3TR9A 3E0VA 3J7HA 4JXCA 2NV2A 3RGTA 3NFUA 1A5OC 2BX7A 3C8NA 4XIMA 1TG7A 1TV3A 4CQ8A 4YXGA 4D6IA 3NZ1A 3DGRA 2YOCA 4NJKA 2A7RA 4CUCA 3WDRA 3WF1A 4XKYA 3C52A 4WSKA 4GKTA 1J10A 3ELFA 4ALDA 4A2RA 5BNKA 4B16A 3EYPA 4J7RA 3STFA 3CZLA 3QY8A 3U4AA 3DHFA 1IXQA 5C9UA 3EDFA 1Z89A 3HBLA 5EBAA 4YU1A 2OGJA 1FWJC 1JUBA 1L6GA 3LGGA 4J2PA 1K1DA 3PZQA 3TSMA 4HTBA 1VJIA 1XIBA 4W8AA 4XVEA 1XL9A 3LV5A 4FLRA 3LQGA 4NIRA 5C55A 3A3XA 5AY7A 4WOZA 2ACQA 3H4WA 2W79A 4GVFA 4IXHA 1LUCB 1RCOB 4HU8A 1K4GA 4LCSA 4ERGA 1O95A 2J7GA 2AL2A 3CYJA 1OX4A 2XFFA 4NXKA 1J0JA 1XS2A 3ID7A 1RJPA 5E0CA 5LIWX 3SSZA 1J0KA 3QY6A 3MDUA 1KRCC 2OQYA 2Y5SA 1AMKA 2F38A 3LSBA 3DFQA 1FWRA 4JTSA 2CETA 1WB0A 5BWAA 4W8BA 2NXHA 5KTLA 3PANA 4NZ4A 3SZ8A 4UTUA 4LOCA 4UQAA 2R9RA 3DAQA 5HJLA 4WD0A 4WOQA 1DE6A 4LF2A 4R7OA 1KXQA 1WKDA 4Y6GA 4MMWA 2QGHA 4Y7EA 1GK8A 2GWGA 4QDMA 3AIUA 4LS1A 3TH6A 3QFWA 2Q8ZA 5BXPA 4FPSA 3NQDA 5CPOA 3BSMA 4J35A 1EIXA 1XJBA 3W6MA 3TYUA 1DIKA 4W4QA 4DJFD 3A4WA 3PNUA 1XH1A 5ECVA 1R3SA 1WZKA 4MPKA 3NQ6A 1TV7A 1QPKA 2BGNE 3FCPA 4NASA 3O0FA 2C15A 1MW3A 2WHMA 1S2AA 3QTPA 2FVLA 4GQBA 1U1HA 3A9BA 1MDLA 3TN4A 4H7CA 4OQVA 5AHEA 3N3MA 3AC0A 3Q37A 3HURA 2VD8A 5I06A 1TJ2A 1OVDA 2E68A 4RW3A 2YXOA 3B0UX 3BGAA 5G1MA 1X39A 4DUWA 3KVMA 2B4GA 2I5QA 5AHMA 4RXGA 1AJ2A 2WNQA 3VOIA 4AEEA 4XB3A 2W9MA 4JIEA 3W07A 4DYJA 2WBGA 2VVSA 4A2SA 1JZ2A 4JTJA 1HW6A 2J79A 5K9DA 2NV1A 1WNOA 3MKVA 4PN2A 2NV9A 2CBUA 3W87A 3EOEA 3SGGA 5DXXA 3RITA 3C8FA 4UZUA 4WKAA 3LA4A 2PDWA 3GW3A 3WZ0E 2QCDA 2CLLA 4J1OA 1DP0A 1QAPA 3RK8A 3DDMA 1LL7A 3L66A 2Z24A 3QR3A 2DH2A 5D32A 1O5KA 2GL5A 1NY1A 1PZ3A 1F6YA 2FB3A 1OFQA 4ZXLA 1Z32X 2BHYA 5RUBA 4ATWA 4D6HA 1UD6A 1BRLB 2RGMA 1TR9A 2ZX9A 3WLQA 3Q65A 4HHLA 3ABSA 1AH4A 3GE7A 2QJIA 1XUZA 3PWAA 1BXNA 4G1KA 3GD6A 4RXFA 1JYVA 1FCUA 3VZXA 1ISWA 1XIHA 1TB3A 1PHQA 3EMQA 4PTDA 1LQAA 2BXYA 1UC4A 5I3JA 4PCSA 1ZB5A 3QV8A 1JPMA 3GC5A 3WG6A 1A53A 2E3ZA 1T40A 4IGNA 4N6FA 3W2NA 2ALDA 3K46A 2YX0A 1IGWA 2GQ3A 4GYJA 3HGSA 1UR1A 3DXIA 4O1EA 4DJED 3E1F1 2PDUA 1OCBA 4LUSA 2ZA3A 4AISA 1RY0A 3TOPA 3QV6A 3PAJA 1XLFA 1TV8A 4Z2GA 5CPQA 1J01A 2A3EA 2CBVA 3OLGA 1ZLPA 3GG0A 4LCRA 4Q22A 4QR6A 2V2DA 1JVNA 2WK2A 3E2QA 5ABFA 3V1PA 3HPSA 1BXCA 3KBNA 3WJXA 4F40A 2EQDA 5E9XA 1LJYA 4QG8A 3WQ6A 1MEWA 1TWDA 3VD5A 4F0SA 7XIMA 4FA3A 1UZ4A 1B4EA 1N7KA 4IIBA 4C6EA 2H9AA 3BH4A 1E1EA 2OSWA 1Q2SA 1UBSA 2DUXA 3BZJA 6PTDA 2E6DA 3F4VA 5FAGA 3LV6A 2VVNA 3TLLA 3ZJ7A 5FJUA 3TYCA 2NVCA 2ZZ1A 3FGCA 2PDKA 3N14A 3BQ6A 4DIAA 2JE8A 3T8QA 3ZFHA 2FTPA 3GR8A 4FXFA 3BAIA 4JTDA 1MXDA 3GDMA 3R2GA 1KNWA 4DJDD 1OC6A 1JPDX 1EX1A 4HA4A 1EJSC 2HCVA 3H22A 5AC7A 4BI6A 3THDA 1R38A 4FP1A 2QEZA 3LXCA 1KV8A 4I90A 2ISDA 4WY0F 3VK5A 2PRHA 2W62A 4DXXA 3TEVA 3SFWA 5G5IA 1LQ2A 1R9XA 3PZGA 3WK2A 4US5A 3TSBA 4TVUA 3BOXA 3TYBA 3G1RA 2ZZ6A 5K4ZA 3GG8A 3OLIA 5A1AA 1W1TA 1JJKA 5A6BA 4ERIA 2V5CA 5CQ1A 2BGSA 3INPA 2IPGA 4ZZ9A 4NL1A 2CXEA 1TPFA 2H8XA 2INEA 5J04A 5I6SA 3VD7A 2CBIA 4A6GA 3LBMA 3PJTA 3N4EA 2ZUVA 3R5EA 3NQEA 1A5UA 1O66A 1F8MA 2J7CA 4ASTA 2Y62A 3H54A 4Q7IA 2Y61A 2OYKA 3W01A 4WXYA 3UZYA 2OMAA 3MTWA 3P60A 4XKYB 2OOGA 2V9DA 4MY8A 3QLDA 5AHNA 1IWBA 2QCMA 1XSIA 3EX2A 2Z1VA 2DP3A 3LNMA 4H6EA 3QPEA 1SPQA 3P61A 4HNTA 3KTSA 3M64A 1XM3A 2UY4A 5A8PA 3HGRA 2EHHA 4LTSA 4PRWA 4DJEC 5FSDC 3OG2A 4HU0A 1YE6A 3AMGA 3FHQA 4AWSA 5HA7A 4L4MA 3O05A 3AO0A 4IFKA 1DHKA 3DFPA 4YJ5A 2JKAA 3FY1A 1NH6A 1UR8A 1WDRA 3CV7A 1MEHA 5HR6A 2QAPA 2IQ0A 2AL2B 1OX4B 3WQ5A 2XM2A 1Q3NA 3NQ7A 3VIIA 5BMWA 4YWIA 5A6TC 4F8XA 4GJJA 5I09A 1Q66A 3UW6A 3N13A 1CGVA 1XX1A 1RY8A 4HD5A 3W7DA 1KWGA 3D47A 3ZVHA 3W1RA 1S3TC 4BF5A 4LBRA 4LRSA 3LMZA 3NSXA 3CO8A 4UTJA 1GEQA 2DJLA 4MY1A 3G5EA 2J74A 5C9XA 2JGQA 3SCVA 4NX0A 1CGXA 1E0TA 3DG6A 5G2WA 1IEXA 3O6AA 5M5DA 4M0XA 3F03K 4XBJA 1UOZA 1XYBA 3W1MA 2W63A 2YCIX 4UUIA 3THCA 7TAAA 1QU4A 3F4DA 2WSYA 4AWEA 2P3ZA 1GOXA 3A6OA 5IXEA 1S46A 4DJDC 3A64A 5HUPA 3A24A 4CNSA 1XYMA 2QMJA 1KTNA 3AQUA 3L21A 3M0YA 1B54A 4P8UA 3U0HA 1X98A 4CD8A 1W9DM 5BWFA 3M0XA 4QX4A 5D8WA 4Z2KA 4HN4A 4E3TA 4U31A 1TPUA 2WMJA 5LGZA 3VOJA 5FESA 2O7QA 1CTNA 5CZSA 4ROQA 1Q6LA 3OBEA 4KEZA 2ZZ3A 1FQ0A 1NVMA 3QZAA 2CITA 1PV8A 2XN1A 3FYPA 1AW2A 2E7FA 2VTFA 2L5HA 4GOAA 3RLUA 1MNZA 2LLEA 3O15A 3VNKA 1DIEA 2ZRVA 5FEWA 3DYPA 4QE4A 1QOQA 2C8NA 4AD4A 1EXBA 4QJ1A 2PDCA 2ISFA 3COTA 1A5AA 3L9CA 2WXDM 5AZ0A 3MB9A 4UTIA 3W7CA 5DEZA 4AMAA 4NAEA 4W8LA 1NDYA 1QI3A 1TX0A 3HFTA 1MXGA 1XLIA 5DMLA 1JYXA 3DC8A 3NJ3A 2PUZA 1J6OA 4U5KA 3TJIA 2XDFA 2QJNA 1A3WA 2G4JA 2JF7A 3VGHA 4AXNA 4MB4A 3RX2A 1CNVA 1DTNA 2Y5JA 3OTRA 2VGBA 5IDIA 3S1UA 1YQ2A 1XP3A 3PWGA 4RZ6A 4FXJA 3Q58A 1KFEA 1A50A 2DZBA 3GQYA 4J3ZA 1C9WA 3F4NA 3CASA 2V38A 3W7HA 4HTYA 1OF8A 3O8AA 3E38A 3CHCA 4DEFA 4Q4MA 4OBRA 3ATZA 1MSSA 3WDPP 4D72A 3E74A 4GUJA 4Z1BA 3REQA 4B5VA 1K8YA 4OECA 1LQ0A 3W82A 3E02A 4B5UA 2FVMA 1VFUA 4H2CA 5CKSA 5F1UA 2J88A 1GTEA 1I4NA 4F9JA 4LUSB 1KV5A 2VZUA 3C3NA 1HG3A 2WJZA 4S3GA 3BLOA 1TVPA 3PG8A 4TTGA 1UD2A 5KZMA 1QUMA 3CGTA 5I3KA 1V4YA 2ZTKA 3WFLA 4FXSA 5F2MA 1WYIA 3LS9A 5ABFB 3ES8A 3PSVA 3AALA 1XWYA 1I2OA 4DF0A 3PPCA 2XN2A 2DQWA 2WNWA 4RNIA 4Z1AA 1LG2A 4ADUA 4LUTA 4E2VA 3MO4A 3L67A 1XD1A 3RR4A 4CNNA 3U2EA 2DUAA 2DZUA 1RALA 4URIA 3KS5A 2WCAA 3LCFA 2H9AB 1L2QA 4BI7A 3I6RA 1V3JA 3F5JA 2J66A 4TQTA 1R8LA 3MSDA 1WOBA 4ZE5A 3M6DA 1JYNA 1ZAJA 3FGCB 1UD3A 3DKJA 4ATDA 3C2EA 4YN5A 1V51A 4JEJA 2XIJA 1IWPA 4EACA 2BY3A 3LZ5A 2J8GA 8A3HA 4TUFA 1PWLA 1VFLA 2VYOA 2NVDA 3SY5A 1QOXA 4DI8A 3VUPA 1JULA 1FH7A 3R6IA 3OW1A 2XSAA 4HPXA 3VA8A 1PXGA 1SFSA 4IPLA 4BEQA 4TX9A 1WAUA 3UXAA 1IZKA 3RMJA 4IHCA 1WQ5A 5E1QA 3UP8A 4DX3A 2G4FA 1W6TA 4F48A 4I7VA 3NVDA 3PTQA 2FZMA 5PTDA 1RPXA 1LT8A 2DT3A 1R85A 3D46A 3W2LA 3DGBA 3BUVA 1EJTC 1DE5A 3B8TA 3BG3A 4GI8A 2XFYA 3RG6A 3VD3A 1KCXA 1NEYA 4DLFA 5IM51 3TW7A 1DORA 3WNKA 3FJNA 1H3GA 3UJSA 5A6KA 3GC4A 2OX1A 1P4CA 4B4FA 4EPKA 4HMEA 3ARTA 5A3HA 4AG0A 4QHRA 3V0TA 3SBFA 4UFHA 4E2DA 2O9RA 2E9LA 1TREA 3IIZA 3EOLA 4FNRA 1BVWA 1NF7A 2VX4A 1UG6A 2CLIA 4LALA 4Q8PA 3MO7A 3QV9A 1WUEA 1WZAA 4RDWA 2B7QA 2QCCA 1YX1A 3VILA 4OBTA 1TJRA 3NXFA 1E56A 3W23A 3NQBA 1FCBA 4GXWA 3N15A 1TQJA 5A8OA 2I5IA 1V3KA 1VFFA 3I3DA 3ZLFA 3ARZA 1Q7QA 1V5XA 2CBJA 3WQDA 1F8IA 5LXEA 4LT9A 5K4XA 1QMLA 4LYKA 3TQPA 1EUNA 1K7EA 3WNMA 5XIMA 2DDXA 5M3WA 4CEXC 4OE7A 4QIUA 3ZVHB 4O54A 4H8VA 3IUDA 4CCCA 1UZDA 4DUOA 3UXIA 3WF4A 3GVGA 3LOTA 3E9AA 2BASA 3JW7A 4MB5A 4Z1CA 5BCAA 4UR9A 3ISIX 3SCWA 5HWNA 2VFDA 3S6DA 1ISVA 5I02A 5K9XA 2UBPC 4W5ZA 1JCTA 3MZNA 2OLSA 2ZXAA 2BOEX 5LA0A 3LBCA 3MCOA 1MEIA 1VR6A 1F05A 1J5SA 1M68A 5JH1A 4CCEA 4MOZA 2QCGA 1HJQA 4JX6A 1CXKA 3CEPA 1XLBA 2G3NA 3P8JA 2VCBA 1T5AA 3WQFA 4WDUA 4RL3A 4ECLA 1PE1A 1QI2A 4A21A 3QPYA 1AK5A 2Y7EA 4DO6A 4JTAA 2PZNA 4GYKA 4AC7C 4WF7A 2WWCA 1LOQA 2NT0A 2ZUWA 4HK6A 3IVTA 2AGTA 4AD5A 5FEZA 3ITYA 4LWWA 3N6JA 1K7FA 4UTWC 1UR9A 3KBSA 4PTWA 4I7WA 3MKKA 4GJIA 1B9BA 2I7GA 3GSMA 5IHRA 2CERA 1EFZA 3LRKA 1KFWA 4BWLA 1HJUA 4L1WA 1E9ZB 1W1PA 1EC8A 6REQB 4CNPA 2GVLA 3LHTA 4KWVA 1YRRA 3TYAA 3G1VA 3T44A 3SM0A 5AHFA 2ADAA 3LLDA 3KRUA 1F5ZA 3NZPA 4ILSA 3UEQA 4JY8A 2FHBA 4QSFA 9XIAA 3APGA 5BMXA 3PZUA 1NP0A 1YYAA 1HJXA 4I6KA 3MANA 1TO3A 4TTUA 5I7GA 3MMDA 1W1ZA 1OQFA 2FGLA 3VDAA 3BAXA 4WDWA 3FJ6A 3I6EA 4Z2HA 4I9AA 1TPDA 3Q94A 1THFD 1G4SA 4QISA 2AOSA 1AJZA 1OFRA 4ZB0A 1TCDA 5CCZA 1XLGA 2NSXA 1HJSA 2VXNA 2GDQA 3NQ2A 1BPLB 1DHPA 3REQB 4XG1A 3UVAA 3EDJA 1KR1A 3PS7A 3CQKA 3DI0A 2Q8LA 3IIOA 3A21A 3T07A 4I8DA 4Y8FA 4NX5A 3GXFA 4HZ6A 4H9ZA 4L56A 3OGRA 3GZAA 3RU8X 4NI3A 1W5MA 2G50A 2QYGA 2BVTA 3GYCA 1FHDA 4FOJA 3H4XA 5FACA 4FX8A 5A6JA 4ZO7A 3OA3A 2PF0A 4GYPA 2FGZA 4LANA 4ENLA 4U10A 3KOWA 1HP4A 1UHVA 1JZ5A 2QDDA 3UXDA 3TTQA 4CD5A 1D3HA 1E6QM 5CGTA 3ARUA 1SM9A 3NVTA 3M0JA 3LHZA 3UWQA 3BLIA 3M0HA 1I9CB 3B8WA 4X9SA 5I3GA 4H19A 2PFHA 4N4QA 1C3FA 1NFBA 4IPJA 4WVXA 3EOSA 1GOQA 2G95A 2W6RA 4O12A 2DZXA 3PUGA 1VKFA 3BE7A 4GXPA 2J7BA 1IHIA 4AX7A 1YPIA 1M53A 2OQLA 1H0IA 4KMQA 3IACA 5A95A 1GW1A 2H8ZA 2VX7A 1XF0A 4QBXA 4Q3MA 4K7VA 2RDTA 1CGTA 1KFBA 3MT1A 3NCOA 5CJMA 3N2BA 4O16A 2VO5A 3GX9A 2J7HA 3H7RA 1B90A 4PR4A 2GGHA 4GK8A 3GK0A 4L4PA 4IIFA 3TR2A 3W25A 1UH2A 3NXLA 1MYRA 1VB9A 2AMXA 2V0TA 3HQ1A 1EJ7L 3STCA 1CPUA 2PWGA 2NW0A 4RE4A 1HL9A 3T2QA 3PFRA 2OLAA 3W7OA 4PCFA 4H8NA 4MJ2A 2WW5A 4UTTC 5ABTA 1OFAA 4MDPA 5E70A 3W1NA 3RF9A 5CC6A 4O8RA 4S39A 2F7FA 2V3GA 2WVUA 2ZX7A 2OZ0A 4WQ6A 4NQ1A 3EDEA 3GR4A 1ITCA 4PYSA 2J9ZA 1IEWA 3HB9A 4CLMA 1R9ZA 1UQYA 4I5UA 1O12A 2BWGA 2YW3A 1UKSA 2J9YA 3WNPA 2WKGA 2ZUTA 3TE9A 3EWYA 1LORA 2WMFA 4H6RA 4PUEA 4DN1A 3B3DA 1W91A 4BEUA 3AOFA 1VYRA 2JFEX 5F4SA 1XYLA 1YBQB 4DWSA 4S3CA 5BOFA 4OOUA 2CKSA 4J3XA 4HPGA 1XR2A 3IS4A 3MYPA 3IGXA 1J8VA 4DI9A 2GUUA 1GT8A 1W1IE 4XISA 3LLFA 2YYTA 3TN3A 1EIBA 2WSRA 4PMOA 5A6SA 1M7PA 4Q6JA 2FH8A 2YKKA 1NQKA 1BSIA 1VHCA 1VFTA 1FWTA 2BS9A 4UQDA 1E4IA 4PMDA 4JN6A 4AC1X 1TIMA 3MUIA 1TKKA 1GUVA 3LRLA 4DPQA 1H7NA 2W67A 3E0WA 3M5ZA 1ZZMA 4GI6A 4GX9A 4M82A 3S1XA 3ZR6A 2QULA 1WDDA 3KDNA 1WBHA 1JCLA 1W37A 3UNDA 1V3IA 1VEMA 1JDDA 4UXDA 1BXBA 1JEZA 5ABGA 1RP9A 4IMAA 3CZJA 1UJPA 4KW2A 2WZMA 1V6YA 3G6MA 4QM1A 2FDMA 3UWWA 1FDYA 3GIYA 4WK9A 4IFRA 3N34A 2HSAA 4F0RA 4KEUA 5D2YA 4OUEA 3VIFA 4AB4A 1RK6A 3WD1A 1IT7A 3CB3A 3BO9A 2P5NA 4JTTA 2QCFA 1R9YA 3KP0A 4G2DA 4PUJA 1OFDA 3CT7A 3FN9A 4M8UA 2DSVA 2NT1A 2X41A 3OJGA 4JFSA 3WQVA 4Z2JA 3UA3A 1K6WA 1DL3A 2C14A 1M1BA 2W27A 2QPUA 1UWRA 3HQNA 3QHNA 4GZJA 2ZX6A 3MMWA 3KWXA 2D24A 1YLVA 2BTMA 3S1WA 3OVPA 3WK0A 2DW7A 3WLIA 3P81A 3UWZA 1W9BM 2YZRA 3O7UA 5GVJA 1SO6A 4QROA 4IIHA 5G4HC 4DQWA 2CHNA 2G0WA 1OC5A 2J13A 2WMIA 1CXFA 3EX4A 3CH0A 4Y9MA 1Q4WA 3KHJA 5ABHA 2YL8A 2WJFA 2D2GA 4ML9A 3RAOA 2X0SA 5CZJA 3JZEA 1KM3A 1LRNA 3T81A 5FD0A 4RZ5A 3UNTA 3P82A 2OO6A 3RYSA 5GJNA 3ZJ6A 1DQUA 4AMCA 4BF9A 5AFDA 2V6AA 4PUKA 4I9JA 2YCJA 1XG3A 4HK5A 1POJA 3K5XA 5G2IA 2HDJA 3BLDA 5F2GA 2VUYA 4DUVA 2XIMA 1P0BA 4OIFA 3CEUA 3CC1A 3PBGA 3WL0A 1US2A 3MHFA 4O57A 3W2MA 3N4AA 2REQA 3LI0A 3MU7A 3AU6A 4MAVA 5J5DA 5HMEA 4DF2A 4CN4A 3K8LA 4M19A 1WKEA 1EC7A 4GC4A 3L4YA 5FI8A 1KM6A 1J0ZA 3SQLA 1KXHA 4CU8A 3BURA 1I6NA 2J8TA 1UB3A 5C54A 2ZRYA 3GH4A 4GHRA 1RA0A 1NOUA 3K1GA 1GKQA 4ZOCA 3UGRA 1HKWA 4WSHA 3AXMA 1PIIA 3KE0A 3KCJA 4H8HA 4P7QA 2XGIA 4MKVA 1HO1A 4ML4A 4DJFA 1PX3A 1XLHA 2VZOA 1NU5A 2PC4A 4I8YA 1TUFA 2J78A 4HSOA 2J75A 2WKLA 5LGXA 2Z2BA 3VMNA 4ZCWA 3CWNA 4GLEA 2J9XA 2ZUNA 4P7LA 3I7RA 4M7SA 2BGQA 4OGZA 5I23A 1MZHA 3KAOA 4EPEC 3AJXA 3NPWA 2Q8XA 3V18A 4N9DA 4CN1A 5BXTA 1DQXA 3PPHA 4GG9A 3MUCA 1LTDA 3ZLGA 1CIUA 4NRRA 3HTWA 5CLTA 4WR3A 1ONXA 2VEGA 2XHYA 1W32A 1MMFA 2Y70A 3GO2A 4UTHA 4JGDA 2DIKA 1ZBWA 5GQBA 4R9OA 2UY5A 3WUFA 1ZALA 3DENA 1J0IA 3ANYA 2CLHA 3E49A 4DBSA 1WDQA 3LN3A 3BV7A 1XV8A 3R12A 1F4HA 1NDZA 1V8EA 2RJHA 1RA5A 5CPLA 4XD4A 3E0LA 2WV8A 4QDPA 1RZMA 4NNBA 3WLHA 3CLMA 4GC3A 4UTLA 4AIOA 1IGSA 4YHGA 3USBA 2GYIA 3MW7A 3EX6A 5XINA 4AY1A 4XSMA 3VGEA 3TP4A 3WEZA 3ZVIA 4PMRA 2J7EA 3IPWA 1UP0A 4XAZA 4IF2A 4A22A 3NPUA 2PWVA 3CAKA 1KKOA 4XBKA 1H5YA 1PYFA 1ZPTA 4B9ZA 3UERA 2P8CA 2PP0A 1L6YA 3DN5A 5B7YA 1QNSA 1QW8A 3PSWA 3AS3A 1GOMA 4XVDA 1OADA 4GQRA 2BVYA 3RO8A 4S3DA 3UR8A 3LTPA 2INFA 3W1XA 4C6NA 1MZRA 1BYBA 2EGZA 3M7SA 3F2DA 1CEOA 4EPBC 3N2OA 4OHQA 1WBJA 4MG4A 3S83A 3U48A 4IGSA 3BXWA 4X61A 1O6IA 1EP3A 2IS7A 4O14A 3S1GA 1ML1A 1YEYA 4GUGA 5EKYA 1HX0A 3CV1A 3B8IA 4NJJA 4LPCA 3M4HA 1IE7C 2WO5A 2RH9A 2G3IA 4JIRA 3GAYA 1PIGA 1YW1A 1P7TB 2BOFX 3QR0A 2FHCA 3O6YX 3W7JA 2DH3A 2WYSA 3OPSA 1XYZA 4JFUA 2V67A 4GKLA 4GCAA 3G3DA 4WY0A 3FA3A 3OYXA 4N7QA 5CBIA 2QUUA 2DT1A 1HL8A 1Q6GA 2XZ9A 1ZAIA 1A4LA 4DRSA 3W38A 2CHRA 1Z3NA 4B2DD 1EL3A 4C5YA 4M51A 1ZP3A 1Y0EA 3KCLA 5H91A 2RKXA 2IPJA 3W7EA 3L23A 3QGKC 3U3HA 4N9BA 3W1UA 1CZ1A 1EZWA 4C6FA 3ARSA 2ZXQA 4BKNA 1WZLA 3K2GA 4DJDA 3KL5A 4CQAA 3DHPA 2YCKX 2VD9A 1D2KA 1JUEA 3UG8A 2VM8A 3OO2A 5CBJA 2VT0A 5BXRA 3WKZA 3A5VA 4J27A 4RNJA 3VCCA 3TCSA 4F0LA 1OB0A 2EPLX 3EB4A 1OK4A 2C7FA 4BCEA 2YJQA 2VOTA 3GZ3A 1GW9A 3SRFA 2CC0A 1P5BA 2YIHA 2NX1A 5D09A 1HNYA 4A3UA 1HKVA 5HQLA 4O53A 3UZWA 4WSJA 1C8VA 3R58A 4HCDA 2ZA1A 1ODUA 3FJ4A 1XGEA 4UR7A 2VC5A 2PI6A 3NOYA 1EDQA 1EO7A 1VCGA 4W9TA 1D8CA 1NDVA 2JF6A 1TMHA 4B5TA 4BFAA 4JHZA 6CGTA 1C92A 3GNDA 3NZRA 2CCRA 1OD8A 4OU1A 3OU8A 4RNFA 3TZFA 1FXPA 4JTKA 2ACRA 2V3FA 2PRMA 2YCLA 2WMIB 2DIEA 3G1YA 1NM9A 3CPUA 4KWOA 3P84A 1CLKA 4RJEA 4K36A 1M7OA 2RDXA 1ZJIA 2DPEA 1IWAA 1X1ZA 3PAOA 1QPRA 1A3XA 1OIFA 1GZ1A 4LBUA 2EPNA 4KFNA 3W7LA 3GH5A 3S8HA 3PUOA 3VGGA 4RE3A 3CLWA 4AY7A 5I00A 4YYFA 3WN6A 2ZC8A 2Z1SA 4JDBA 3N19B 3HMJG 2V63A 4LS0A 2REQB 3V0UA 1I1WA 1QCWA 2B7NA 1FKWA 1TPWA 3BOFA 3CBWA 3R1ZA 3NM1A 5LNUA 1C90A 4JL2A 3WD0A 1BEUA 3VOCA 3AZRA 1D8WA 1FCQA 3V1HA 5H8UA 5E0KA 3LXBA 1UWTA 1GQIA 1UUMA 4IGHA 1MXSA 3QQ1A 2SFPA 3B4YA 2C71A 1PTAA 3WK3A 2ONEA 3OA5A 3M5VA 5EMJA 3XISA 4GNVA 4I3GA 1EEXA 2HPIA 3NTYA 2HPMA 3AXIA 1VC4A 3VMPA 3SIZA 1ZQ5A 3AIQA 3W29A 1MVYA 1OX6A 1RD5A 1ADSA 5DMNA 3TIMA 3IEBA 3IJIA 1LF1A 5D9MA 3P62A 5CGMA 3UBPC 1FKXA 2FZBA 7ODCA 3M44A 3QR1A 2ZCGA 4D6EA 2J27A 3QRHA 1QNQA 5FOOA 3WBWA 3UPMA 3EWCA 4A8IA 2QUMA 4HPJA 3PR2A 1M41A 4E0CA 1BF2A 3NEVA 3UR5A 1CWYA 2WJDA 1LG1A 1D9EA 3GHTA 2WCGA 3AIVA 3SCPA 1O1HA 5JMUA 1X97A 1V77A 3S2NA 2V68A 2ZADA 3MWCA 1OZMA 4GXMA 3S46A 4N4PA 3U7BA 4N2YA 2OB3A 4LV9A 4Q8UA 5CH9A 1Q8AA 3WLLA 5C2CA 1SFLA 1BD0A 5F1VA 2W0UA 4JAWA 4HNLA 4PZVA 4Q32A 4H6KA 3N17A 2ZZ4A 3KBVA 3AJ7A 1JQXA 4M3PA 3O63A 4WJ8A 3VKKA 4HJFA 3TMLA 1U1UA 2PDYA 3S2JA 4IXXA 1B5TA 3CQIA 1E4LA 3W02A 4C7FA 1XIJA 2HEJA 3F2CA 1GOKA 2RHGA 3EA3A 3T1GA 4M80A 2BB0A 1F61A 3UZ5A 4AZHA 3P6LA 3LD5A 3GBEA 2VC6A 5BU9A 3OEXA 4YWSA 3BJTA 1W8SA 2VHLA 2IUZA 1MQQA 3IJQA 3OGSA 4JKLA 2XGZA 3MJYA 3BLPX 3W1TA 1W56A 1EF2A 3PJUA 1SMAA 3FYOA 3SUTA 2ODOA 2BY2A 3C4UA 4MWAE 1NWRA 1T41A 4GMEA 1GJWA 5CSUA 4ZQMA 5HJXA 3VNIA 1TUXA 4XZ9A 2HVMA 4JCLA 1L0PA 4GWEA 4HB7A 4O0ZA 1PKYA 4QGCA 4REQA 1D7KA 3ATYA 3GR7A 1LBLA 3QMTA 3DBNA 3BAJA 2OLHA 4PSRA 2ZTJA 5AYXA 6TIMA 1EDTA 4CNTA 1R30A 1PKLA 4HNUA 4GUIA 4L7ZA 3IVUA 5HAOA 1WV2A 2YDQA 1BKSA 1X7IA 2QV4A 5HWMA 3MYOA 2CW6A 4JYEA 2VGFA 4BR1A 2AMGA 4LAMA 5ABEA 3G8EA 2O9PA 3CK5A 1F9CA 2PDMA 5JXQA 4NILA 3PULA 1YTEA 4S3FA 5G2HA 3FXGA 4Q8OA 4X2PA 5U7SA 1HJWA 1I1XA 1NP2A 4WY0B 4X9YA 3N18A 4CCDA 1MRAA 4L9XA 1ZUAX 1T7LA 4J4KA 2VWSA 3N2CA 5DRCA 1POKA 3ALFA 4B92A 4QEHA 4LYQA 4GPNA 5DXYA 3SEPA 4GI4A 1DOSA 4B90A 3TCEA 1OM0A 2YBVA 4B5NA 4ZTXA 1YDVA 3O6DA 3F7JA 1VPQA 2CLEA 3ABQA 5AVHA 3CUFA 3UD6A 2PTDA 2X7WA 4INFA 1IT8A 3Q2DA 4XAGA 4IOTA 3SB0A 3SUVA 2QLYA 2Z1BA 4AF0A 4LRTA 1A5SA 3WLKX 1TA3A 2VRQA 3H2MA 3BZGA 4E6MA 3ZXWA 1VGAA 2VCAA 4M6UA 1PIFA 2QPXA 4MB3A 4ZQPA 4K6AA 3KOZA 5AB3A 1XUUA 4HNNA 3Q67A 1S5VA 4EPDC 4GZEA 3T78A 1XFCA 3UESA 3G1AA 1QK2A 1JCNA 5C70A 2VP8A 4MTVA 4JTFA 4QTGA 5CPSA 5HK4A 3P0WA 3V4BA 2CXGA 3D0CA 1G6CA 4BK9A 1GVQA 4X3ZA 3E6EA 1XFBA 2MUCA 2CFFA 1J18A 4DBDA 1QASA 3ZS4A 1V02A 1H50A 5K2ZA 2BOGX 1KTCA 2QDHA 3SUWA 1FH9A 4TX6A 4ZSUA 1JF5A 3P80A 2YCLB 2XVGA 2HK0A 4RUBA 5GNYA 2Z4GA 1S38A 3KBJA 1D3GA 1ZFJA 2GVGA 3SY1A 2IW0A 3AHXA 4AHOA 3IGUA 1HN1A 5D9NA 3THUA 2BLEA 1KFCA 2ABBA 3L4TA 1XBXA 2Y7FA 3NQGA 1IEQA 1UR4A 2NQ9A 1G4TA 3LHUA 5CC5A 1DWGM 3UY7A 2C6QA 1XLLA 2CIPA 4XD3A 3LCLA 1Y5WA 2E4TA 1TPC1 4XZWA 3FEMA 3IRDA 3WMBA 3ABZA 1DJWA 2EJ1A 3QMSA 3KS6A 4IMEA 2Y7GA 1OCQA 2MNRA 3APYA 3OHIA 3W76A 5DMMA 1V0KA 3RRAA 1XBVA 4GO8A 3AICA 4LC6A 1BQCA 1V02E 2G41A 2ZKMX 3GTXA 1AFSA 4HMCA 5REQA 3CUGA 2D73A 1BFNA 2WBKA 4D1IA 1Q13A 3G18A 3RILA 3GUGA 1H7RA 2D2JA 3JUGA 2DZSA 3WQEA 2PMQA 4HJWA 4BHYA 4Q6XA 3WH5A 5JIWA 2OT0A 1TTQA 1A0EA 1FFQA 4R27A 5DX7A 3A13A 4O1CA 3OZMA 1SZRA 1DJYA 5M2FX 3AU2A 3ZIZA 1PO9A 1JDEA 1LROA 3M43A 3CNYA 5BRPA 4J3VA 3TSDA 3IV3A 3LY0A 3AMDA 3K8KA 4IUGA 4CQCA 4XKMA 3V3WA 4PTXA 3MUZ1 1IV8A 5CPTA 3SECA 1BVZA 2PCQA 4PUMA 4PMNA 1W3HA 3M7WA 1JPHA 3M16A 5HNTA 1XKYA 3LUTA 1W17A 4ZQCA 2HMCA 2Z6JA 3UF9A 4S3JA 1J4EA 1H61A 3N9RA 5BOEA 1DWJM 4I9TA 5DCBA 4J28A 3JR2A 1WKYA 3OODA 2YL6A 3FVDA 1K70A 1KXVA 2EF9A 1DXIA 5IDZA 4AUBA 2XH7A 3STPA 5HQMA 1UH4A 1UJQA 5LXXA 1DWHM 4LB4A 1E3XA 4XZIA 1S1PA 3PZTA 3IGSA 1WKFA 4Q8NA 4RE2A 1IT0A 4JX5A 1M01A 3LBOA 4C60A 1M7XA 1MNSA 3AIBA 2BY1A 4ZENA 1JI1A 2Z2AA 4YPJA 1QHOA 4YTUA 3C0QA 1I2RA 1V7YA 3E2VA 2WVSA 1ZJHA 2J6XA 4OUIA 2VEPA 3L12A 1KFLA 3ITVA 1Q6RA 3HQPA 1JI2A 3ITXA 1I60A 1GVIA 2C19A 1JNDA 1GGOA 2R1LA 2YL5A 4FNTA 3HF3A 1CGYA 3PBMA 1WDWA 3B06A 2PWDA 4G56A 1VIWA 4DNHA 3MUY1 1OX5A 3L0GA 3OVGA 3JU2A 2C79A 4N6EA 3PWIA 4QS5A 3SQMA 2F6UA 4Y9OA 4RLIA 1HKKA 3NYZA 4UNIA 4JPGA 2VGIA 4O17A 3MWAA 1CGUA 6ENLA 1M04A 3IAPA 3ZMRA 1Z42A 2VC7A 1OIMA 2D0GA 3SJNA 3GKFA 3IJ9A 1G0CA 4REQB 3DI1A 3EWDA 3M5XA 1IXNA 1FBAA 1BTMA 1XI3A 4E2OA 2OO0A 3M9YA 4CQDA 1P48A 1JXKA 4BWLC 3W6YA 1FA2A 5IFPA 1R3TA 1Q6EA 4IICA 1VFSA 1H7OA 4NG3A 3LZ3A 3IGHX 1HIZA 3M5YA 1W1YA 1QW9A 3UCDA 3PJXA 3UYIA 4A4AA 1NQ6A 1TPEA 3DC0A 2IQTA 3HG4A 3FLUA 1WAWA 4H8UA 3QOKA 1LP6A 3LCIA 4GUHA 1GYLA 1LWHA 4J40A 1B9ZA 2FPYA 3CMJA 1E9LA 2D3NA 1VFOA 3VOFA 3KVJA 1UZ1A 2HE5A 1UH3A 2E0PA 3K8MA 4M1RA 3EWZA 1HVQA 1VZWA 2PTZA 3KFTA 1JZ8A 2ZXBA 1W9UA 4BQ2A 2VQTA 2G37A 1AH3A 2IQDA 3UJEA 1BYDA 2XSBA 2DU2A 3D6NA 1XLMA 4M7TA 3OBAA 4C6JA 5AYZA 1G7VA 1I0DA 3TYDA 1ZCCA 3I6TA 1K03A 3ARRA 1RAKA 5LNSA 3EOUA 4NU7A 3WLJA 2OX4A 2BVDA 4RDYA 4NY2A 2YLAA 2ABAA 5HXMA 3RIKA 1JAEA 2WMKA 4JFVA 1JZ3A 2FTYA 4AF0B 2Y2WA 3FNDA 1TA3B 4DWSD 3R10A 4HBKA 4Q8MA 1W31A 3TVAA 2WB5A 1O1ZA 6A3HA 3NSMA 4A3QA 4Q8WA 2JQXA 4NSBA 4KWUA 3TROA 3DOPA 4GYPC 4L64A 1DJXA 3D3AA 5LNWA 2AAAA 2EBNA 5A6MA 1O7AA 2YB4A 3CT2A 1SZNA 3N4FA 4AZGA 5FSEC 5F2LA 3RX3A 3T0CA 3K1DA 3GLCA 4Y9PA 4JQ1A 4QJ5B 1O5QA 4PBFA 3TN5A 5AYIA 1G4PA 1TFVA 4X22A 4HHPA 3LRMA 3GVQA 3NGJA 5I3HA 1CI1A 4AIBA 4S3KA 4OTKA 1SW0A 5LHEA 3CIVA 2QNEA 3N12A 1MFUA 3THAA 3ABXA 2GJRA 1A5NC 3RJXA 3I4EA 1KCLA 3LHYA 4R85A 2RDWA 2E1DA 3TXZA 4OWGA 2A7NA 2TAAA 1H5VA 1LLZA 1SO5A 2GK1A 1V79A 4PB4A 4KCVA 4LY8A 4R5EA 1TZ9A 2CLPA 1E6XM 1YNYA 3BW3A 4PCNA 3KHDA 5A2BA 3GU9A 4ZA0A 3OVQA 2DSWA 3G1SA 4KESA 4OOZA 4ZOAA 4B5WA 3VINA 4EX4A 2PTWA 1XQLA 3QSTA 1RLDA 2GSHA 5H8MA 2OKOA 3L65A 1W3NA 1TZZA 1ENUA 3AHZA 3QYSA 2FTWA 5EPDA 4O0KA 4ES4A 3LLXA 2QF7A 4KWSA 3UG5A 2VCCA 3AHYA 2WMHA 1PB0A 5BRBA 4AIEA 1N82A 5REQB 4ZFMA 4CNOA 3UZJA 4C6KA 1QBAA 3UR2A 4UNLA 1FX6A 3IJ7A 1M6JA 1ZL1A 1NF0A 2WVVA 3DH7A 4XAPA 1VYSX 2ZZ5A 2E5CA 4X2RA 1V6XA 2DSKA 2PDIA 2C91A 4IISA 1J6PA 1YPXA 3HO8A 4IPNB 3NDYA 3K4AA 1RBOB 1V0LA 3CTLA 4E8DA 1ZBVA 2WAGA 1HT6A 1Q6FA 2ZZ2A 4DWSC 2R91A 5EFDA 1DV7A 3GXTA 2OFJA 3CV6A 4KERA 4P7OA 1AL7A 1LL4A 3CS2A 3NPXA 3STGA 3HV8A 3W88A 3BW4A 3TV8A 4B5XA 3QHMA 4GI9A 4I7UA 3TKFA 3QEZA 3W4RA 5FF3A 2BZNA 4JBRA 3HG2A 3ARQA 1FWDC 5CAHA 2A3LA 5CLWA 1UWQA 5CJNA 3H7UA 3CIWA 4W84A 1GYMA 2E1WA 3KDOA 3KX6A 4LU0A 4R9XA 5G4WA 1BAGA 4MNMA 2NWRA 2HROA 1BKHA 2WC3A 3WLPA 1X8FA 3S5YA 2ACSA 3H2NA 4MNKA 1W9XA 1H7WA 3EXTA 3BARA 3MP3A 4LXFA 1CLXA 5AVNA 1XC6A 4KKXA 4JTUA 3FVMA 3KOFA 4DO4A 2O92A 4WUIA 3VDHA 1EF3A 2O55A 3RFAA 4HSNA 4JNZA 3O0KA 1BF6A 4FX6M 2VEIA 2GGIA 1WE5A 4P8WA 2O0TA 4W89A 4U5IA 4CCZA 2WMGA 3LTYA 3E2RA 3M0VA 5JQ9A 2RUSA 2AAMA 4HVXA 4EOUA 3HJEA 3VMOA 1NOWA 1U5HA 4V2XA 4F3HA 2YDRA 4ICNA 3MY9A 4HCHA 2CZFA 3ONCA 4Q33A 5AKQA 3VDCA 1KXTA 4X0NA 2CZDA 1TJ0A 1S3HA 4MF4A 4G9PA 4PE8A 4PUUA 5I78A 5CSSA 4WIWA 3GIQA 4H83A 3N2XA 4P8VA 4HK7A 4MJZA 1XHGA 1UKPA 1EXPA 3TWBA 3CL7A 3BWWA 1NFGA 3RNDA 3KZPA 3TFXA 3L5LA 1VP5A 2HQAA 2Z25A 1PX4A 1UMLA 4GFIA 3EDKA 1W5NA 3C2VA 3O16A 2QGYA 5LYRA 3WD2A 1K8XA 1A5MC 4PTNA 3GBDA 3KRZA 3RM4A 4C5ZA 1PTDA 4FNQA 4QJ3B 4GBDA 1UPPA 1WPCA 2EG6A 3EGJA 2HVOA 2OPJA 1VLIA 4R33A 1Q2RA 1JXJA 4JTCA 1FDJA 2ANUA 3CU2A 1NAL1 2ZBTA 2O9TA 1VJZA 3AUJA 3CHVA 4OVXA 3W7PA 2VOMA 4OJYA 3WNOA 1ONRA 5BRQA 3BL3A 4M6PA 2YA2A 1ZHAA 1EJVC 3EKGA 1P0KA 1XIIA 2IKGA 4QS6A 1OFBA 4MUPA 4PB3A 1ME9A 1Q6CA 1WZMA 2ATMA 2X7VA 2GDVA 3LB0A 5HULA 3VNJA 3T0TA 4IX2A 2OZTA 3QH2A 3PY2A 5HUOA 1W1VA 1UPMB 5AHIA 4L4LA 2CEQA 3ZOAA 2Z7KA 2P3EA 3VGBA 4FSAA 1H62A 4E38A 3C56A 1EYWA 2F2KA 3LGEA 2OG9A 4U3CA 4JTGA 1ZNNA 3WH8A 1XDLA 2G97A 1XRSA 4NZ3A 1PWMA 3A3WA 2QJGA 3H53A 2B31A 4PB5A 3F4CA 4ZO9A 3KLLA 4DJFC 3QOMA 2QJHA 1G69A 4G6CA 1F7BA 1NSJA 4GUFA 4W93A 2XU2A 3MHGA 4Z1DA 4RZ4A 1H2JA 1A0DA 4GIAA 4MJ4A 4DYEA 3FS2A 4PTMA 5C2XA 1EBGA 3ITGA 2OGYA 1V6TA 4PCTA 2YR1A 2PLMA 3TQ0A 1RH9A 3KTCA 1DJQA 2WHJA 2MANA 3UWEA 1RVGA 2XZ7A 3VPLA 1UASA 2D2OA 3HM7A 3TLQA 4U4MA 3BSGA 5KETA 4MYXA 3SI9A 4IP5A 3W75A 4S3AA 2IPFA 4O50A 1UWSA 1KBJA 3RXZA 3UPBA 2UZ9A 1FP8A 3QXBA 4NYUA 4K8EA 4PMUA 1AA1B 1E4MM 1WXJA 2WSKA 3E0IA 3FAXA 1GHSA 1GEHA 5A6AA 3WSUA 4FNUA 2CZ5A 3NQMA 3QQ0A 3GAKA 2V8ZA 4PUNA 5D2XA 3N6HA 4GH3A 4QP0A 3N25A 2Y1HA 5D37A 3UJ2A 3V7PA 5HR7A 2G3JA 1I45A 3KBWA 3PPGA 5BU6A 2Q71A 3BCJA 4Y8EA 3S9YA 2NQJA 2X1RA 2GGJA 4K8HA 3OZYA 4F0KA 3WBAA 1CW2A 4HPNA 4IJBA 4V27A 1AZ1A 4ZVJA 4G7EA 1B4KA 2J8FA 4AD2A 5H2ZA 4B2DA 3LX9A 5DELA 2I56A 4N0RA 4UFMA 3W7QA 3UR7A 4LH8A 3PZOA 2YCEA 3BW2A 3BLFA 1MQRA 3TFCA 3W72A 2PDFA 2VGGA 3OYZA 1IEVA 2Z6IA 1GOOA 4CKQA 1P6BA 3G0SA 4IG2A 3FOKA 3KZSA 2PLKA 3ZYZA 4MZ1A 1TR1A 4AD0A 2WVVB 2OODA 1VBHA 3FJLA 2C18A 1V6WA 4NKCA 3T8LA 1RV8A 1HGWA 2WNZA 4H9XA 1V0MA 2QUNA 4U2ZA 2WZEA 3KOYA 4PTVA 4HNVA 4UFJA 4XZLX 1J93A 1W5OA 1R3QA 3L5AA 1XBYA 1HFBA 2CKRA 4OFCA 4XD6A 4GACA 1VENA 2FZDA 1EZ2A 4IQDA 1XDMA 3W1QA 9XIMA 5FJJA 2YLLA 2E9BA 4L1GA 3KRSA 5CSRA 1QPOA 2DSZA 1ADOA 2EXOA 4S3BA 4UFLA 3WMSA 2QJJA 1SZEA 4D6CA 1K4HA 5FF0A 4K3ZA 2HTMA 3MVTA 5DMYA 4C65A 5EMYA 3C2OA 4MNJA 3S5OA 4BZYA 2QHAA 4LYPA 2QIWA 4IPPA 1TPVA 3W53A 1XYCA 3NUKA 1Z8AA 1UD5A 3SN1A 3WMLA 1UZHA 4D8ZA 1I2QA 1XLDA 3EKLA 3ZT5A 2B7OA 3WY1A 3CAVA 1R2SA 1H1ZA 4RR4A 4V33A 2YA0A 1B30A 2PDLA 3H2AA 5BYWA 4B5SA 1V6VA 1P6WA 3MBFA 2AL1A 2PWFA 3OHMB 3BMXA 5A69A 3VIJA 2CESA 3NZQA 5D2WA 5EL1A 4YMZA 1PTGA 3VGFA 1KBIA 3A5FA 3WMCA 1J11A 2VL4A 4DPPA 1FWBC 2CPUA 3BCDA 2DGAA 2GPTA 2XFWA 3OP2A 2C3ZA 2GZXA 1NWTA 2EEXA 1G01A 3MI6A 4QJ4B 2BSLA 1FFRA 3WDHA 3GM8A 1G4EA 3V0SA 3ZR5A 3CTTA 2Z0IA 1SYTA 1PSCA 1CB2A 3TWAA 4G5DA 1ECEA 3WJZA 1PX8A 3HU7A 3O6CA 2EJAA 1JCXA 3UWYA 2JKEA 1S5TA 2JIWA 3SADA 4PMYA 3BICA 4QE5A 4FK9A 4MWAD 3SW6A 3DERA 3FW6A 4YIWA 2DW6A 3GYEA 4FI4A 1C7SA 1NFPA 2PODA 1AQFA 5D9OA 3ANVA 1X96A 1FWNA 2VR2A 2GQ8A 2D20A 4QNEA 3P74A 2QCDB 2VRKA 3H55A 3AHVA 1SJBA 2YL9A 2ZUSA 4E4PA 1MUWA 2DZAA 1SR0A 1FWIC 2GVJA 2BNJA 3BANA 1GPWA 3S4TA 5LHFA 3PBYA 3GWQA 3O07A 4HZ8A 1QHZA 4ICCX 1KM2A 3UJFA 3O2LA 3B8DA 5FJPA 1OG6A 1B0IA 1HP5A 1Z41A 3CMFA 2XUCA 4UOZA 2PRLA 4F4RA 1GVSA 5I3IA 3EB2A 4O15A 1XIMA 4FXRA 4O28A 4AHPA 4S2BA 3W7MA 3WO8A 4IP7A 4ZR8A 3W81A 2VX6A 2Z7GA 4PH6A 2HXTA 5D9PA 2KZHA 2QDGA 1TPB1 3RMEA 5L6UA 4FF7A 5ENLA 4MNLA 1I2NA 3DUGA 4IFOA 3CMGA 3URBA 4DNMA 3HIJA 2X05A 3B8SA 2F6KA 3R25A 3NQCA 4TOQA 2CU0A 3DG7A 2Y8VA 3CJPA 2EAWA 1G9HA 3NO5A 1KBKA 1NJJA 3KVLA 3BV4A 1YNQA 3VE9A 3ZSTA 1LUCA 2PPGA 4WRHA 1VBJA 2Q3RA 1ISYA 3KRBA 2JEPA 4LVAA 3PBUA 3UZZA 4MB1A 3U2ZA 1RQEA 4EE9A 4LSBA 3P93A 3VDGA 4N02A 1W3TA 3WQGA 3S1VA 5CAKA 3IANA 4JX4A 2FYMA 3VKCA 3AIWA 1NELA 1QO2A 1TV2A 2GSJA 3MUAA 2DFAA 3U57A 3VCNA 3DFHA 4C6MA 2ZX5A 1BHGA 2QXWA 1EP2A 3TC6A 1AH0A 5D05A 3NL3A 3WX7A 4H04A 1GTHA 1ZCOA 1FVPA 3A4AA 3QTGA 3F1QA 1B31A 4H01A 4YYCA 3MPGA 3PC0A 4PRTA 1Z48A 8TIMA 4JHOA 2QR6A 3VCRA 3VTRA 3PB0A 3W84A 2OR2A 2OYMA 4LNCA 3M6YA 4MWAC 1G94A 4M29A 3VKBA 1B57A 2OSXA 4WX2A 5LA1A 2VNCA 2ZE3A 4QAIA 3WQCA 1UP3A 1F3XA 2PA6A 4GQ0A 3HPFA 4EANA 1ICSA 1DWIM 1GORA 5CSYA 1QFEA 1J12A 2PDPA 3WDQA 4FX7A 5LNVA 2PLJA 4G7EB 3A3HA 5CZTA 1H60A 1XIGA 3AYVA 2P50A 4BY3A 2OWCA 2A85A 4HZMA 4GNJA 2OOFA 1E0VA 1P43A 3WQ8A 5KMYA 2OU4A 3FHAA 3VAVA 4L80A 3KXQA 2PLCA 2GUBA 4H3DA 3TOYA 1E51A 1CXLA 4TXEA 1ZGDA 3UZXA 4MY9A 4PC8A 3LHWA 1DVJA 4C1NA 3HN3A 3S2CA 3T0DA 1OD0A 3L4ZA 1UMYA 1T96A 5KZEA 1EQPA 1KFKA 1LOLA 5T26A 2FFIA 3QGAC 3S6OA 2PWHA 5EYWA 1SSDA 2R6OA 3C2FA 1J5TA 2CLOA 3A4JA 3DFOA 4F79A 2YFNA 3QGVA 1UW9A 3GDLA 3TZNA 1FWWA 3TYEA 4RKAA 3RU6A 3GTIA 4IFKB 1AG1O 1NWUA 1L8PA 1RD6A 3E3HA 3R11A 2QIIA 2Y0FA 4M5PA 3LPPA 4DZHA 4QSHA 5C71A 3B9NA 3GHRA 4HA0A 2WQDA 2FZ8A 5DCDA 5HNUA 2GQAA 1WXZA 4AVOA 1IF2A 3U6WA 3VD9A 4MGGA 1ESWA 2VFGA 4AD3A 3IWPA 3M0IA 1OF6A 4C7GA 1US3A 4WHBA 5C6MA 1W3LA 3QC3A 1UKTA 4HU3A 3G1HA 3AROA 3USZA 3D5HA 4GISA 4BA0A 5LIXX 2D22A 4EAMA 4RZBA 1OC7A 3SURA 3GU1A 4AY8A 1BSLA 2VEFA 8CGTA 3NWRA 3QW4B 3MQTA 3WF3A 4L6OA 3WJWA 5TBOA 5T91A 2ZE0A 3B9EA 1K02A 3KW3A 4OKDA 2FH6A 3TONA 1PKMA 4XUGA 1Y7VA 2E6FA 3L2LA 5LIKX 2EG7A 4J3SA 1JYWA 2INZA 2Y7DA 2IPWA 1TJPA 3H26A 1M7JA 1XYFA 1LT7A 4AZ7A 4JTRA 5CBBA 1C8YA 5A2AA 1P1XA 3ES7A 1VD6A 1CGWA 1TE1A 3N2MA 2BHUA 5SWUA 1K9FA 4HHHA 5C2GA 3P0XA 7A3HA 4JTQA 5F4WA 2E9MA 3UFYA 1ZY9A 1K3UA 1P1MA 2Q02A 1I8JA 2ISSA 1E0WA 5E09A 4PA8A 3FV9A 4UFKA 4OBSA 1K77A 4HYRA 4FNSA 2P53A 2PCEA 3W83A 3AMKA 1VLWA 3DIPA 2NXIA 3UGVA 1JAKA 3U9IA 2H6RA 1PL9A 1TWWA 1SJAA 5FAJA 4JHMA 4Q4RA 4YCPA 3G0XA 1KKRA 5AECA 2WOQA 4QAWA 3T0AA 3IIVA 1DJHA 1JFXA 3B03A 2RDUA 4C6PA 5D38A 1L2UA 3AHTA 2A5HA 4CU7A 1ZTVA 4ZE4A 3SN0A 5J5RA 4AD1A 3RJYA 4NAEB 3L2MA 3A22A 3GFZA 2HS6A 1E5JA 1S2TA 3NG3A 4DZAA 3ZR4A 2PF8A 4BQ3A 2PSNA 5D2TA 3DEQA 3QN3A 4YVXA 3CHDA 3CO4A 3QJAA 5H8PA 3EB3A 4Y9NA 1FY6A 5F2IA 3OVRA 2A3AA 2OXNA 1TMQA 2V3EA 2BG5A 3CB8A 3MMUA 3MVIA 3CZKA 4E2BA 1TRDA 2X1SA 4PMZA 3ALGA 3VO0A 5IBXC 1OK6A 7TIMA 3LMYA 2V81A 4HU4A 4MVAA 2ZC1A 1BG4A 1A47A 4JQAA 3GY1A 5E5CA 4XZNX 4NI8A 5EMLA 3L2IA 4XWUA 1W5PA 3B9AA 4H41A 4MFEA 2Q01A 1TELA 3CZ8A 4NHVA 4FR1A 3KM8A 1SQ7A 2O9OA 3TC3A 3W6LA 2E09A 4IIGA 2X42A 4CEUC 3VI2A 3SR7A 4G1NA 3PBWA 2I5GA 4LQ1A 4DM1A 1SJCA 4ZQOA 3AS0A 4D9PA 1CYGA 4FZIA 5LNRA 3PTKA 2QCLA 1HQTA 3LEPA 4JNYA 4LVDA 1OSEA 3SJ3A 4U2YA 4IUOA 3GTFA 5D33A 1EX5A 3G8RA 3PK7A 3CQ0A 4MFDA 1HL2A 3G1DA 3WBXA 3JZUA 3UWVA 1V08A 3ITOA 2E6AA 1DQWA 3TDFA 6ALDA 3GNOA 2G5WA 4AZCA 1TV5A 4LUTB 1EOMA 4FLSA 4XV0A 4CNUA 3NL5A 3A4XA 3CUJA 4AAJA 2WC4A 3VC5A 1Q4NX 2DT0A 5DANA 3SRKA 1E1FA 1TTIA 3WL1A 4KIEA 3NURA 4BI5A 5ECUA 1B3ZA 2P10A 4ZEPA 3CL8A 3M07A 1Q45A 1GPFA 1E9IA 5J8LA 3SCRA 1KA9F 2WWDA 1K9DA 4CQBA 4LVFA 5HMDA 1VS1A 1S2UA 3U5UA 3ZJKA 2P76A 3SCUA 2AKMA 2VKZG 2X2YA 1LLOA 3TQKA 1K9TA 1TE6A 3G1XA 3N73A 3GNPA 4DVOA 4MM1A 2P88A 1ISXA 3T6CA 1ADDA 3V5CA 2FB2A 3G0UA 2JK2A 2Z1XA 3KOXA 1BWLA 2POZA 2WSQA 3UT0A 1F3TA 1E6ZA 1JR1A 3MCMA 3H2FA 4UTKA 5DBUA 3FXYA 3U2CA 4HOWA 1JGMA 3L68A 2J6VA 2VDHA 1GVRA 4KWWA 3V36A 3FSUA 1WA3A 4JTLA 2PE4A 1ISZA 1C91A 5CZKA 3FK4A 1VCFA 4FHAA 3LXAA 4HNOA 4GGBA 4NJGA 3PHAA 3PFMA 3QVQA 4S23A 1YXDA 2ON3A 1N8WA 1GVEA 3PZMA 3WJSA 4C1NB 2GGEA 1SFJA 5A8NA 5CC3A 4GIYA 1GKRA 5TNVA 3BGGA 1RBAA 2DJXA 3V16A 3VOGA 3LCGA 3GHSA 3EXRA 3NQVA 1WCGA 2PWUA 4YVVA 3HV9A 2POTA 1TTPA 1UR2A 1XIEA 4KBXA 1RPKA 5EMMA 1IEIA 2A3CA 3CZEA 3IJ6A 2OTDA 1P0NA 5T9CE 5H1WA 5I3DA 2HZGA 1R0MA 1QBBA 2RFGA 3AXXA 1KGWA 2OYLA 4PULA 3U2OA 1VCVA 4YLWA 3W7NA 4AH7A 1Q5MA 3A23A 3PP7A 1M9HA 2V5JA 4GX8A 2QW5A 1F6KA 5A6LA 4IMGA 1F3WA 4ZGYA 5E0FA 4PEEA 2XWEA 3EWWA 4BS0A 3W22A 4HA3A 4J3UA 3LPGA 3FDGA 2J24A 2CNCA 2Q6ZA 3WK1A 3KLKA 5BOOA 3N04A 3IAQA 4QCEA 3ZO9A 2OEMA 2YPIA 3DX5A 1NIUA 1MI3A 3EBVA 3GH7A 1Q6DA 4M6VA 4KF1A 3WLOA 1HTIA 3K30A 5BZAA 4PSPA 4L65A 2FFCA 3PVFA 4WZHA 2GFTA 2UY2A 2CZVA 3W37A 2DZPA 4ACZA 3P8IA 4UC5A 3GKAA 3R43A 4JFWA 4I5RA 1O5RA 4OV4A 1EH9A 4JS3A 1ZP4A 4XZHA 4WDXA 1OWQA 3GNXA 2WZHA 3UG4A 1KD0A 3DECA 2PD9A 3UVIA 4GY0A 1KQYA 4P2VA 3CXOA 4UOQA 1F07A 4HCLA 2Z1WA 4JTHA 2DZWA 4YHEA 2FJKA 1YHTA 3A47A 2NVAA 4GIEA 1SUXA 3LHVA 3UG3A 4D6DA 1KM0A 3RRXA 3BMVA 3AZTA 2X8RA 4FR6A 4EWND 1SGJA 3XINA 4E8CA 1CXHA 4K8GA 3R4IA 2I14A 1VYPX 4ERAA 4UTMA 1EHAA 1Q85A 4H7VA 2OEKA 1ICQA 3RCNA 1DYSA 4QCFA 2VELA 1N2VA 3R7MA 2Z29A 4EXBA 1E1CA 3WFAA 3PBVA 1KM4A 2QCHA 3QM3A 2B0MA 1RXOB 3TTSA 4FS9A 3TU9A 1OY0A 1PUDA 2Z00A 4UMCA 3BQ5A 1FTXA 5EGRA 4I6VA 3O3RA 1BLIA 4D6GA 1W2VA 1SW7A 2PDJA 1O60A 1GQKA 2XH4A 2FVKA 3NIYA 1F76A 5KZ6A 1DJNA 1S2VA 4IMCA 1W9PA 2Q09A 1AODA 1RCQA 3GNRA 1XRFA 1JFHA 4CVUA 2QVHA 5HBFA 4HKPA 4XIAA 3QYQA 3CM4A 4A8RA 1HKIA 2DSUA 3MV11 1EEPA 5BROA 3CUHA 4M6QA 1OT1A 4AYGA 3RCMA 4D2JA 3RN6A 1XLJA 2ZVRA 4AQLA 2DVTA 1TIWA 1XPYA 1T6MA 2R1PA 4FOUA 1MW0A 5HQEA 1QJWA 1DJZA 2PGWA 3DU0A 5K9CA 5BXSA 4JD4A 3WH6A 1EKOA 1JPKA 1X1NA 4O8AA 2H3BA 3Q4DA 5HNNA 2X1UA 4HN8A 4J9JA 5I03A 4GD0A 4AIUA 1H63A 4LUYA 2ZRXA 3VNLA 2UWFA 1X6NA 2BY0A 2WPBA 2H90A 4FLOA 1YMYA 3WF0A 4NVTA 2QMKA 3ONBA 2QS8A 4GH1A 3DESA 4D8AA 5FF7A 2I9EA 4BF7A 2QDEA 4AZCB 1XGZA 3AWOA 1LRTA 3NYDA 1CX9A 3WEOA 3M0KA 5L9FA 3S0CA 1EPXA 1C9DA 2B81A 3N2TA 5AOUA 4ZODA 3B8VA 4F2UA 3W70A 4RV3A 1V0NA 3NQFA 1UBPC 1QXLA 1E43A 4LFYA 4Z0JA 4TV5A 1VPXA 2AQOA 3GDKA 8XIAA 4WJXA 1Z6KA 1RCXB 3HPAA 3EDDA 2A0NA 3URNA 1JRCA 4B15A 4QQUA 5A2CA 1LBMA 3CZGA 2XM1A 4PRRA 1PPIA 4H7ZA 1VEOA 2VUNA 4JYFA 5EY5A 3TUUA 1DXEA 1AQ0A 1J79A 3TX9A 1XLAA 1HXJA 3CWHA 4Q4QA 4PFHA 3BAWA 1QO5A 3R89A 2FPTA 4GRSA 1DXFA 5HINA 2V69A 3M0ZA 3S42A 2YZ5A 3TNBA 3G77A 3H24A 5EA9A 5F4XA 4A35A 2WVTA 4A05A 1D7FA 2E8YA 2NUYA 3I7SA 1S5NA 2YW4A 1XBZA 1UWIA 4ADSA 3ZSSA 3NO3A 4QFUA 3L4VA 4O13A 3VKAA 3WQ4A 3GHUA 1EPVA 2G8ZA 1W0MA 1VF8A 1VQTA 4H6QA 2ZUMA 2YBTA 3WJYA 2X1TA 1R3VA 4NNAA 3CPRA 3ZLHA 3EEZA 1JG9A 2NLIA 1SW3A 2DVUA 4G7FA 3H2OA 5KINA 3XIMA 4W85A 2F6XA 1KC7A 6REQA 4LNYA 1BQGA 2VR4A 3GXPA 4MADA 2DY3A 3TJXA 1YDYA 1TVLA 4AWUA 4GE8A 3PNZA 4AYSA 4GCXA 5IRPA 2AGKA 5LIYX 4C1KA 5I2UA 1YDNA 4ORIA 4DWSB 3R94A 1V3HA 3KCOA 4QG6A 2I9UA 2ZQ0A 5CXPA 1OJXA 1MDRA 1AD1A 1XDJA 3LGDA 4EKJA 4ZB5A 1XQKA 3RLVA 2Q3OA 4C6OA 3NQAA 4DLMA 3T7VA 1JPIA 5TF0A 2W92A 3EOOA 4R34A 4R7JA 2ZOXA 1GHRA 1W3IA 3R8HA 2OWXA 4GABA 3C0LA 1W3JA 1WDPA 3PTMA 1YPFA 4A3YA 4D1JA 4IX0A 3UCQA 2HRWA 1XG4A 1EJRC 1W1A1 4HIBA 1F74A 1UA3A 4PMJA 3QZ6A 4W87A 4WGHA 4RX0A 2DZTA 1IQ8A 3D3FA 1R7OA 2E40A 4CGTA 1ICPA 3IARA 1GVYA 1E0XA 3H23A 2ZWYA 2PDQA 5JBDA 4UQBA 1XW8A 3U4FA 3WUEA 3LG3A 4JQ3A 2GLKA 1R3RA 1T0OA 3VNZA 2E25A 3RPDA 3OZOA 4DYKA 3E12A 3MZ2A 3NSNA 1E73M 1QNVA 5FJTA 4NNCA 4PBGA 3RLHA 4IWWA 2NQLA 5DRIA 3BDKA 3LYEA 4FAMA 2D23A 3ZM8A 2ZDSA 9CGTA 3L0NA 4QEEA 4ACZB 1Q7ZA 3ORWA 2YYUA 1IXOA 3QBUA 5DFAA 4JIPA 4F2BA 3PZIA 1XLEA 2DV0A 2VX5A 2H3DA 3FA4A 3B0XA 4NXSA 3ME3A 4DUXA 3NR0A 1WO2A 3NM3A 1EJUC 3S9ZA 1YIXA 3VD4A 2V82A 4HP5A 5KZDA 3CAWA 3HGOA 3WCZA 4YTSA 1SMDA 4IIDA 4BQ5A 1QT1A 3W00A 3KTXA 2CLMA 1TSIA 1RP8A 1QI5A 1SVDA 3HOJA 2DUZA 1JZ4A 2E5DA 3FDKA 1NDWA 1HKMA 4UNKA 5HPOA 4XUYA 3SO7A 4XSLA 3NQ8A 3V35A 1EQCA 4L1XA 1E0UA 2PZ0A 3QFEA 3G2GA 2GJLA 4LY4A 1X1OA 2W66A 1NTHA 4I9MA 1CXEA 4PODA 3LM7A 3UPWA 4IM4A 3SUSA 4Z0SA 1XD0A 4LF1A 1E1CB 2XTKA 4CN6A 5JU6A 1HZYA 1EWEA 1W8GA 3MCNA 5U4NA 1BGAA 3O1NA 1KRAC 3OIXA 3WLTA 3YPIA 4P7RA 3FX4A 3CQHA 1XCWA 2XN0A 1UR0A 1LL6A 3QV7A 2R1MA 4C6QA 2JALA 4YTRA 1QNPA 1U5VA 1JUKA 5M17A 4JIQA 4UB9A 4DO7A 2FQIA 2IKIA 5FJOA 4LJ3A 4U3AA 1UIOA 2C1GA 3DCPA 1Y5XA 4AXKA 4F0HA 2HXUA 4IL0A 2QAFA 2OKTA 1B1YA 3SGZA 2XVPA 2ASHA 4MZYA 3VM7A 5I5RA 4WXZA 1U22A 3TAOA 2WHLA 1RK5A 4NJIA 1UIPA 1KGXA 2JIEA 1S5WA 1S39A 4O1BA 3R8GA 2QT3A 1FXQA 3EPOA 4O1FA 1PHWA 2V5DA 2W5FA 4KETA 1C8QA 3HG3A 4JN7A 3NZGA 4DHGA 4M81A 3DYOA 1YBQA 1IR2A 4JN8A 1OEPA 1WXYA 1OZQA 4NZFA 3L4UA 3WH7A 3VOHA 2PTYA 3B8UA 2O7SA 3PZ9A 2NQHA 4J5NA 3C0JA 3HFYA 4KIRA 2J25A 3WLNA 2D69A 1B3VA 4GBUA 4LUIA 4HYVA 4K68A 1L6WA 3TAKA 3ZJ8A 4K1WA 1UR3M 3N3TA 2BVWA 2ZWZA 1H49A 4GVGA 3WDJA 1OFOA 1SSGA 1E70M 3CUXA 1E71M 3OOQA 5M03A 1AVAA 1ONWA 4W86A 2E77A 2XG9A 4YTTA 3WQPA 3IVSA 1FHLA 3F2BA 1WP6A 4S3EA 3LM3A 3QKZA 4CD4A 2X30A 4GIRA 1AD4A 3LTSA 4PMQA 3W7GA 3GRIA 4MLRA 4MWAA 2IMRA 3ICJA 5EMUA 4V1YA 1LWIA 2OSYA 1MRQA 1XH0A 4JTEA 3MDWA 1N8IA 3LK6A 1N8FA 5FJIA 1S1RA 2VMFA 1UROA 4GY7A 4P7NA 1XGDA 3T55A 3GC2A 1TWIA 2A3HA 3PJWA 4J2MA 5EB8A 1V3LA 4H00A 4KEVA 2QVNA 2D3LA 3OLEA 3GDBA 3I68A 1V93A 3G6LA 2E5BA 3ABRA 3I3EA 2VFEA 1EGMA 1KFJA 4UQEA 3IJLA 2GOUA 4R53A 2ZRUA 3VZZA 1BG9A 3QKEA 4L6DA 1Y5VA 4KFPA 3EWBX 1KGUA 4M1BA 1E9YB 1YTDA 2PDHA 3FA5A 4IQJA 2PAJA 4ROPA 3ZQ9A 4QLKA 4CQ9A 3SCOA 4QQ3A 1XLKA 3NDZA 1DPMA 3W2UA 2Y4SA 3AMLA 3W7RA 3SSJA 1R86A 3GW0A 3BOLA 3GTHA 4D6FA 3S5NA 3FYYA 1J96A 2ZXDA 4MSSA 1AL8A 5K3VA 3QY7A 3BJFA 1KW1A 1QI0A 1FWSA 6TAAA 4HNCA 5DCEA 1DWFM 4GZ7A 4R7WA 3ECQA 4RDZA 5AC8A 1GJPA 3T09A 1FHVA 4HOZA 5DN1A 4HQVA 3EXSA 1DIOA 1EO5A 3URQA 1KB3A 3UXLA 1JZ7A 1PZ0A 3MI2A 2J7DA 2PEVA 4GZIA 4B3KA 5AC6A 3TK7A 1IIGA 3TNOA 2OT1A 2PDBA 3QPZA 1OCNA 3KVKA 1W1B1 4MZ8A 1ZENA 4JICA 1ZS2A 4ZOBA 1HGYA 2DEPA 5GNZA 4GFSA 5D2VA 1TQXA 2ZZ7A 2EG8A 3K13A 1JIBA 3IIXA 3VIGA 4IMDA 3WNLA 2DZVA 3A12A 4JIHA 5A5WA 1EGZA 1SJDA 4JTIA 1SU5A 2WM0A 2UY3A 2VZVA 4FIRA 4E3VA 4ZQNA 2QKFA 3N6QA 1YDOA 1W9VA 3AFBA 4C6LA 4HZ7A 5E6YA 5EFFA 4A3HA 5CEWA 2A79A 3OIHA 1FDZA 3ABOA 3B04A 4WCJA 2WM1A 4Z2LA 4DAIA 4KCUA 1J2BA 5B7ZA 1TJ1A 4NZJA 1PAMA 4LAUA 4PCPA 2HNEA 2QZRA 3EPNA 4AX6A 1FWHC 1XISA 1QNRA 1MW2A 5HATA 3M41A 4QLJA 3AYRA 5G4EA 1JF6A 1E6NA 2R94A 5I07A 1AQMA 2VZTA 1GZGA 3ZT6A 2PU0A 4KCWA 1XC4A 3W2KA 5TD4A 4X63A 4MHBA 2EPMX 4OZOA 1QTWA 3F5LA 4FIQA 2XVLA 2OJPA 5I24A 2ISVA 1A3HA 1YNPA 4AEOA 4K7YA 4LCQA 3MMTA 2GVEA 2V30A 3M0MA 3OQ8A 1CBGA 4UR8A 5D30A 3VZYA 3LPFA 4O10A 3WELA 2WKJA 3QQWA 3FFSA 2A7PA 5EMKA 3AUOA 4J3TA 7CGTA 3PPFA 1O68A 1EHNA 2V5KA 2BV9A 5HOSA 1M3UA 3W74A 2ZFAA 5JH2A 2PP3A 1SO4A 4MYAA 3HPZA 1PYMA 3W2JA 1ME7A 3ARYA 3NEHA 2R24A 2BXVA 4LVGA 3VVGA 2EPOA 3R0UA 5HMFA 2A3BA 1M03A 4KRTA 1F3EA 3LPOA 1FWAC 4JR5A 3EPMA 4MJMA 4IP4A 3T40A 1S2WA 4S1FA 4RW5A 4ZO6A 1Q6OA 2Z1KA 5HJYA 1FWCC 3T4CA 3V5FA 3WUBA 3O06A 5DY2A 2PD5A 3T4WA 5IBXA 7REQA 2YB1A 4YTQA 5JBEA 4PBEA 4X60A 2WLYA 3MSYA 4H2HA 1KRBC 2RJGA 3CUIA 4HOXA 2QV5A 4E8GA 4UCFA 3IUIA 1GZJA 4WKHA 3N9SA 2Y88A 4DO5A 1YKWA 3GG1A 1H09A 5C8BB 3AS2A 4L6HA 1FWEC 3WNNA 4EXQA 2AQWA 3C5QA 2FMOA 3RUBL 1Y8BA 4TVDA 3KEHA 4KT2A 3ARXA 5FEXA 2PDGA 4TIMA 3MKCA 3QW3A 1BYAA 3P67A 4PL1A 3NA8A 4WGXA 4E4FA 2ZVIA 2D1ZA 4BQ4A 1XINA 1OGGA 2KAUC 1ITXA 1H7PA 1KBLA 3WDIA 3MS8A 1IIHA 3ANUA 4XAYA 5I3FA 1UUOA 4DZ5A 3WLRA 3WQWA 2ZX8A 3EAUA 3LERA 1P7TA 3S2MA 2OQHA 4WKFA 4C6IA 4Q7NA 4L5ZA 1A80A 3POHA 5E6ZA 1CB7B 4C91A 5CPNA 1XLCA 1WDSA 3B9DA 1E4NA 3C2RA 5FF2A 1EYEA 3M0LA 3EMZA 2NX9A 3UQNA 3OG3A 5DBTA 3DFYA 1GONA 2WLZA 2O4MA 3TA6A 1W3KA 2VQUA 1VBGA 4MLJA 2ZICA 3WF2A 1RBLA 1EJWC 2FLIA 2G96A 1A5KC 3VNYA 1TZ7A 5JVLA 1R46A 4LW7A 4O4VA 1UD4A 3BAKA 3IJ8A 2A4AA 3SDOA 4MWAB 1XH2A 2XPKA 4C1LA 4XTDA 4FNPA 1FOBA 3LCHA 1QVBA 3N11A 1RQHA 2WZIA 3PUDA 1US0A 1CCWB 3P7YA 4PL2A 3VDBA 1SR9A 1JD7A 5IHSA 3ITLA 3TJ4A 4TV6A 2YDAA 1WOAA 1PKNA 1XIDA 2PURA 1OCJA 2DVXA 3W3OA 1XYAA 4Q4SA 4B91A 3QLLA 4XZMX 3UJRA 3UETA 1O94A 3LCWA 2P0IA 3WBYA 1LM1A 1HF6A 4JZ5A 2WANA 2GWNA 3HPXA 5CG7A 3EX3A 6XIAA 4RNHA 2XFRA 1K8ZA 3W27A 3TQVA 3W1AA 4Z1YA 5DQPA 2C1HA 1EWDA 3TW9A 8XIMA 3W0KA 4US6A 3WIJA 1X6LA 1O4UA 1C7TA 2A2IA 5FKYA 2EPHA 4AEFA 2QPSA 2VFFA 3LSCA 1B3OA 1MWOA 3OB8A 4XK2A 3LQLA 4V15A