4DBUA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 3-((4 -(trifluoromethyl)phenyl)amino)benzoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of AKR1C3 containing an N-(aryl)amino-benzoate inhibitor and a bifunctional AKR1C3 inhibitor and androgen receptor antagonist. Therapeutic leads for castrate resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 114
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbuA00
1MZRA 2F38A 5JH2A 4LAUA 3UZZA 1JEZA 3V0SA 3BV7A 2PFHA 4PRTA 3S3GA 2IKHA 3UGRA 1HQTA 1AH0A 1M9HA 4YS1A 4XZLX 4GA8A 3CAQA 5JH1A 4XZMX 1PZ0A 4GIEA 1J96A 1VP5A 2DUZA 2PDKA 4QR6A 4XK2A 1RY8A 5DANA 4DBUA 4WDXA 2PDHA 4QXIA 3D3FA 2BGSA 2FZ9A 2F2KA 2PD5A 4XAPA 2IKIA 1LWIA 3CAVA 2J8TA 2FVLA 1Z89A 2IPGA 3G1RA 4F40A 1QWKA 2ACSA 4FA3A 3GHSA 2HVOA 3UP8A 2FZBA 4YVPA 1EL3A 3GUGA 4JTQA 3WG6A 2ACQA 3GHTA 4IGSA 2PDMA 2P5NA 4HMNA 2PDIA 2PF8A 3R94A 4XZNX 4Q3MA 1XF0A 1ZUAX 4GABA 2NVDA 2HV5A 1Z8AA 1S2CA 3WCZA 4OTKA 1YE6A 5LIWX 1R38A 3H7RA 3V0UA 4L1XA 1PWMA 3LN3A 4PR4A 1IHIA 3LBOA 3UZWA 3UYIA 4FALA 3UZYA 1X96A 4ICCX 3G5EA 3MC5A 1AH3A 2IKGA 4XZIA 4GQ0A 4JQAA 3H7UA 3M0IA 3RX4A 3LZ5A 1Z9AA 5M2FX 1FRBA 3DOPA 4JIRA 1UR3M 3QKZA 4LB4A 4XO6A 3CV6A 1S1PA 4YU1A 1ZSXA 3CV7A 5AZ1A 2PEVA 1RALA 1X97A 1S2AA 2IPJA 2AGTA 3Q65A 3H4GA 2DUXA 5LIUX 4QX4A 4IJRA 4Q7BA 3LNMA 1GVEA 3WBXA 4LBSA 3P2VA 1PZ1A 2PDJA 4XVEA 4JIHA 2IQDA 4H8NA 1Z3NA 4NKCA 2HE5A 5HA7A 3UWEA 1EXBA 2PDLA 3M64A 4R9OA 4HBKA 5LIXX 2HDJA 2ACUA 3R43A 1XJBA 4WGHA 4JTAA 3LQLA 4DBSA 2PDQA 3LEPA 4RPQA 1MRQA 4G5DA 3F7JA 1MI3A 4JQ3A 1X98A 2BP1A 2A79A 3O3RA 3RX2A 4YVVA 4H7CA 3R6IA 3WBWA 4GQGA 2VDGA 4JQ2A 3KRBA 2PDYA 4JIIX 4MHBA 1LQAA 4YVXA 2IKJA 1QRQA 2FZDA 1C9WA 1K8CA 3N2TA 4EXAA 2C91A 2FZ8A 4IJCA 4JQ1A 3LQGA 1S1RA 4PMJA 1YE4A 4WDUA 2NVCA 1YNPA 1VBJA 2R24A 1PYFA 4DBWA 1OG6A 2QXWA 2ISFA 4JQ4A 1EKOA 1Q13A 3R8HA 2PDUA 3O0KA 2PDPA 3UG8A 5HNTA 4LAZA 4XO7A 3ONCA 2I17A 3EAUA 4ZFCA 2PDNA 1T41A 2PDGA 3T42A 1IEIA 2PDWA 4I5XA 3EB3A 3BUVA 3ONBA 3V35A 3GHRA 2DV0A 1Q5MA 1ZQ5A 2CLPA 2BGQA 2HVNA 2PDFA 2PDXA 5KETA 1T40A 2WZTA 2ALRA 3BCJA 2PDCA 3LZ3A 3GHUA 3WBYA 3C3UA 4GACA 3LENA 1SM9A 3CASA 4LBRA 2IS7A 2PD9A 3FX4A 3N6QA 4XZHA 2WZMA 1A80A 4WEVX 4WDTA 5LIYX 2INEA 3V36A 3EB4A 2PZNA 3Q67A 3M4HA 1YNQA 2ACRA 3LD5A 3R58A 1AZ1A 3R8GA 3LUTA 1ZGDA 4XVDA 3RX3A 3UFYA 3UZXA 5HNUA 4FAMA 3R7MA 4JTDA 2IPFA 3ERPA 3DN5A 2HE8A 4PUWA 4WDWA 4WRHA 2IPWA 5C7HA 2FGBA 2IQ0A 1HW6A 1RY0A 4FZIA 3V0TA 2INZA 5LIKX 4JTRA 3VXGA 1AFSA 2HEJA 3COTA 4AUBA 4L1WA 1ADSA 2PDBA 3B3DA 1US0A 4ASTA 1PWLA 1AH4A 1AZ2A 4JTCA 4DZ5A 5AZ0A 3U2CA 3NTYA 3BURA 3MB9A 1EF3A 2I16A 4GCAA 4QBXA 4PUUA 2R9RA 4LB3A 1XGDA 3CMFA 3FJNA 4EXBA 4PRRA
chains in the Genus database with same CATH superfamily
3WQOA 3AXXA 3F4VA 4IMEA 3E0VA 5U7SA 3INPA 4BR1A 1ME9A 1UKSA 4NI8A 5HJLA 2V69A 1KFEA 3W81A 1UZ4A 2NSOA 3C86A 3BW4A 5AHMA 3UWVA 3TSDA 4W5ZA 1CNVA 4D6JA 2EG8A 3NZPA 4V27A 1OFEA 4UQAA 1J10A 1EP1A 4XZLX 4QLJA 4K8EA 1KKOA 4IMAA 1EHAA 1T96A 3KRSA 4IQEA 4M19A 1HP4A 4G9PA 1Q6EA 2AL2B 1G1YA 4IFRA 2O92A 2E25A 2IXUA 4O4VA 3FHQA 1OB0A 1RY8A 1XM3A 3G0UA 1UWQA 1AL7A 1VIWA 5EA9A 3SAZA 3MZNA 1HVQA 2C6QA 5LNUA 1WYIA 3AALA 3V7PA 4QE4A 4N42A 4CQ9A 2YW4A 4L4MA 2IPGA 2RFGA 1V3LA 4IT1A 4XBJA 1FWTA 5LYRA 2YOCA 2FPVA 3L4TA 3TN5A 3F4NA 1J12A 3W1XA 4ZFMA 3GUGA 4KT2A 3SY5A 1UWRA 4AMCA 4GBDA 2FJKA 4GYJA 1J0ZA 2RDUA 3EKGA 4CD5A 3NZGA 4AZGA 4UTWC 1ISYA 2DGAA 2ABBA 3GXNA 1RLDA 2CKRA 3KOZA 4TOQA 1LT7A 3BTNA 2P88A 4DYKA 2VZOA 4RNHA 2TAAA 5HPCA 1EBHA 4OWGA 3QFWA 3WDHA 1XDJA 4Z2IA 1C8VA 3D5HA 3CV2A 3UW6A 5I78A 1P0EA 3E0FA 3KOFA 5D9MA 1GZGA 2JIWA 3LZ5A 2WJFA 1NOUA 1M41A 2OQLA 3ORWA 2UY4A 3L65A 1E0WA 4FOKA 1G9HA 1UZHA 1XRSA 3FK4A 1POJA 1EA9C 3CV6A 4ZMGA 2EPOA 4Z2KA 2OKOA 4IIDA 5JIWA 2QIIA 3L7RA 1V3IA 4JKKA 2AGTA 4GXMA 1UASA 3CUHA 1FH9A 2ZX7A 3JUGA 2VO5A 3ITCA 3UA4A 3LRLA 1BVZA 4IJRA 3MTWA 1UIOA 4W89A 3UG5A 3F4WA 6ALDA 1TPB1 2C1HA 4BJHA 3VMPA 3UCCA 3T4WA 1A0DA 1R2SA 2YDAA 4AEEA 3MUY1 3GUWA 2EHHA 2WXDM 5KZ6A 1R3WA 9XIAA 3IAPA 5H6HA 3H22A 5SWUA 1QPNA 4UOJA 3LQLA 1R3SA 3M16A 4C6BA 3ABXA 2Y24A 3IVUA 1CLVA 4LV9A 1GCYA 1MSSA 1HF6A 3CUZA 2VD8A 2A79A 4CNTA 1RQBA 2R1MA 5G2WA 5HXMA 3W86A 4AY1A 2V67A 3FGCB 1XFBA 3OJGA 3R2GA 2YCLA 2QJJA 3ARVA 1R2TA 4HKPA 1MUWA 3S5ZA 4NZ5A 4H1ZA 3LCHA 1X1NA 3N2TA 8A3HA 2FTYA 3E02A 1TQXA 3MCNA 2PUZA 4U5IA 2CWXA 4LVBA 3LHVA 3FNDA 3MVTA 1TCDA 3SN1A 2CLEA 2PGEA 3IPWA 4QQ3A 2OVLA 5FEPA 2GK1A 3DKLA 4MZYA 1LP6A 3S8HA 2WBGA 3KWXA 4JQ4A 3WJXA 2OT1A 4ZEPA 1E1CB 1EP3A 2NQHA 2O4MA 4JNYA 1NDWA 1JQVA 1E43A 1HTIA 3IAQA 3OZPA 5AECA 4Q7NA 2VUNA 2DSWA 3I68A 1KBKA 1MZHA 1TTPA 3H12A 4TX6A 1JI1A 5IBXC 2PU1A 4Q4KA 4M3PA 1ZZMA 1FHVA 2OGJA 3NOYA 2ZDRA 2BGNE 5CLWA 1GORA 3Q4DA 1W5NA 2OXNA 2J9ZA 5BWAA 5RUBA 3GHRA 3QQ0A 3LNPA 5FF4A 3DFNA 3N3MA 1HL2A 1NSJA 3CO8A 3H2AA 1JZ8A 2CESA 1QO5A 3TYAA 3RF9A 1BHGA 7A3HA 4JCLA 2NV2A 2IS7A 5HWMA 3FX4A 4P8XA 3N6QA 2Z29A 3NL3A 2QJGA 4WDTA 4AZCB 5FL1A 4KPLA 5E0FA 1KC7A 1Q65A 4GY7A 1XGZA 1NDYA 1LORA 3EB4A 3HZ3A 4GNVA 5AYIA 5E70A 1TSIA 3P0XA 3NZQA 3U57A 4Y96A 1K7FA 3IRDA 3LXAA 2ZWZA 2X41A 5BOEA 2VZUA 2VC5A 4O1FA 3HGOA 3JS3A 1J0HA 3N1AA 2W63A 3W76A 1W17A 3RMJA 4M6VA 3EWDA 5C7VA 1ODZA 5I77A 1IXPA 5FCZA 1XICA 3F5LA 3E1F1 4OV9A 2DJLA 3KTXA 4C6NA 3GS6A 4GC4A 2WPBA 2NQLA 3B9EA 2VNCA 5MKGA 3OA5A 1FWAC 1V6TA 1FP8A 4Y9OA 4B5UA 4W84A 4NZJA 1ISWA 3WH8A 4HQVA 4UQEA 4Q8VA 4HNNA 4ORMA 3NEHA 4W7VA 2D2HA 2C0HA 2XIMA 1E6QM 2GVEA 2Z1VA 1TVPA 3A4JA 3GR7A 1QTWA 3P6LA 3W1UA 3EDJA 3UY7A 2P0OA 3ZOAA 2YXXA 1QW9A 3W83A 4MWAA 3B4YA 4UTJA 3V75A 2TSYA 3MKVA 5JU6A 4MWAC 3OLDA 3VNZA 2WNZA 2A3BA 2PWHA 4TX8A 3OYZA 5EMUA 3U6WA 2B7QA 3UJ2A 3NM1A 4QSFA 4MY9A 2XIBA 5AC5A 1EH9A 4BF7A 4S3BA 1CI1A 4NRRA 2MNRA 2PP1A 3BG3A 2E6AA 5EMJA 3BANA 3W7KA 1C90A 3TC3A 1OBAA 4O1DA 3TFCA 1TMQA 5CAHA 4RUBA 1GJWA 2Y8VA 1ZY9A 4B5SA 3IARA 4LUJA 4US5A 4DUVA 4HJWA 1NFGA 3LTYA 5FF0A 1F76A 2KX9A 4LV4A 3G1SA 3G1RA 3PTMA 2X2GA 1KFJA 4F3HA 1X8CA 1ME7A 4I5UA 3C52A 3ARXA 1UB3A 2G5WA 3N9SA 4IG2B 4C5YA 4QP0A 2QUNA 3E5BA 4D6EA 2QV5A 4N9CA 6ENLA 1G6CA 4O12A 3GH4A 1GPWA 3WO8A 1DIOA 1V08A 4ERGA 4H41A 2VFEA 4ICMA 3BAXA 1MEHA 3NO1A 3RK8A 2J9YA 1VF8A 1RQHA 2PTZA 4BI5A 2UY2A 4ZO9A 1O7AA 3B0UX 5D33A 3HPAA 3VCCA 2WHMA 3AHTA 1C7SA 4FALA 2WKGA 2PU0A 3ICJA 2PB1A 2IKGA 1EOMA 3O07A 2PBGA 1F8MA 5FOOA 3WLSA 1UA7A 3GW3A 2XZ9A 3UR7A 1LRNA 3AUJA 1U5HA 4GYPC 3HURA 4U10A 1JZ6A 4RDVA 3LOTA 1ZSXA 2PEVA 4PB3A 3QOMA 2CW6A 3FAWA 2JK2A 1V0KA 4FLQA 2ZX9A 3N9KA 4Y90A 2DUXA 2W9MA 5LIUX 5CG7A 3TJIA 2YR1A 1J0IA 4R34A 1XLGA 2VDHA 3P2VA 2GSJA 4JIHA 1N2VA 4S3DA 4XAGA 1UG6A 4HP5A 1S5VA 4O0ZA 3VE9A 3GKAA 5JXQA 3S5SA 2H90A 2PC8A 4UIOA 1IWAA 2CZEA 5C9UA 3IUHA 3R0UA 4D6HA 4DBSA 4UZUA 3C2EA 3LHTA 2GGHA 2XIOA 1YPIA 4G5DA 3TQKA 3A4AA 2OYLA 4J3ZA 2J7BA 3W23A 4CCDA 1XH1A 3K2GA 3CJPA 2A1YA 3HFYA 2OX1A 2GUYA 1ZJAA 3MSDA 1R3YA 4GINA 2GVJA 1CW2A 2WQPA 2NLYA 4DUOA 2V3GA 3GFZA 2ZRUA 4R88A 3QR1A 3A4WA 4JQ1A 3SY1A 3WELA 3PR2A 1XH0A 1BXCA 2XGBA 3OPSA 2DIEA 3BZJA 1EF2A 1VBJA 1Q6LA 1KB3A 2PI6A 5DCEA 5CZKA 2ZZ7A 5HAOA 1EJ7L 4O4WA 3K13A 1ZAIA 2Y8KA 4PMRA 2R6OA 4IIBA 3ITGA 3OQEA 1HJUA 2VEIA 4XO7A 3T0AA 4DX3A 4ML9A 4DM2A 3U0HA 1LF1A 1GZ1A 1UKTA 3QVQA 1REQB 1T41A 2XG9A 1TYGA 1MO0A 4NG3A 1HJVA 2ONEA 3CL7A 3ARRA 3P14A 3F4CA 1C8YA 4PMUA 3ABSA 4NXSA 2HS8A 3NVTA 3RPTA 1LWJA 4PMYA 4V28A 1H0IA 3AZRA 5HMDA 3OTRA 4JTUA 3VFCA 1A5BA 3EA2A 2BGQA 1WDSA 5H91A 4GIYA 2A5HA 4MGGA 3GG0A 5AHLA 2GYIA 2RGLA 3BH4A 2ABAA 3SR7A 2Y5EA 4GZIA 1KM4A 2CHRA 4LYKA 3T0BA 4GFSA 3LG3A 4JTJA 5REQB 3QZ6A 1QO2A 1TV8A 3HFTA 3OHMB 1LWHA 1IV8A 4BWLC 3NYZA 4FLRA 5C70A 3B8DA 3NL5A 1S3HA 1H4PA 2X1SA 1REQA 1TPVA 3VC5A 6XIMA 1E0UA 1LLWA 3DECA 1UP0A 4HPHA 1OSEA 3ERPA 3H7VA 5H8UA 3VYLA 4PTXA 4B2DA 3UR8A 4WRHA 4ZOBA 2FZMA 4CQCA 2ZC8A 5IM51 4H9MA 1RY0A 4GXPA 1V79A 4JTRA 1D3HA 1B0IA 5IBXA 3B0VC 3B8VA 1AMKA 3EMZA 1UQYA 1WDPA 2PDBA 5EPDA 4ERAA 1K9EA 4EIVA 4Z1AA 4ZQOA 1CTNA 1D9EA 1GVRA 4PTDA 3E2SA 2B7OA 1I2OA 2BG5A 1BQGA 3GYEA 3W2UA 3W00A 3LSCA 1CGYA 4YTQA 4IP7A 4QISA 4UZSA 2GJPA 2CWNA 1IEQA 4C90A 3VD4A 2Y2WA 2ZZ4A 3M43A 1JUBA 3EBVA 2F6UA 1US2A 3SFKA 3ZVHA 4O19A 3WMCA 3DG6A 3UGRA 2YPIA 2ZRXA 3W2NA 1HN1A 1XIMA 1TFVA 2XVGA 1BXNA 5MF5A 4PB5A 3LLDA 4BQ3A 1W1ZA 5HR6A 3DC0A 3VUSA 3EKLA 2J7GA 1F3EA 1GVQA 2HRWA 1TWWA 3E0LA 3TOPA 5JQ9A 3QMTA 2HXUA 4IQDA 3VNKA 3ZM8A 1BG4A 1P5BA 1V6YA 1FWFC 1KM3A 3CPUA 4I7VA 5A95A 5FJRA 4RXGA 3W02A 4XISA 4K7VA 1XGEA 1CXLA 3S5OA 2VRKA 3BG9A 3PZVA 1BYCA 5JBDA 3RR4A 3VNJA 3MMDA 2E3ZA 2OB3A 4ACYA 4A29A 1X6UA 4PTWA 1TPDA 3P93A 2Q01A 2FTWA 4HNLA 6TIMA 4LCRA 2HK0A 1SYTA 2PWUA 4QNEA 4F40A 1FWWA 4U33A 2ACSA 5A2CA 4HOZA 4A3YA 3EKZA 1XRFA 2NX3A 1V5XA 1W1PA 3VIGA 3WDJA 1QPQA 4NF7A 3M1ZA 1RV8A 4EWND 3QPYA 2J8FA 1R30A 3E5PA 2ACQA 3T9PA 2A0NA 2BY3A 3QV8A 1OJXA 1EZWA 1RBLA 5FJIA 3LGDA 2WB5A 1TR1A 3R94A 5A6TC 1Z8AA 1W8GA 1QHZA 1S2CA 2FGLA 2NUWA 4B92A 1EZ2A 4F4RA 4EPKA 3H7RA 2H8ZA 2I5GA 3KFTA 4IGMA 4Q8UA 3VFLA 3EDDA 5D09A 1DVJA 4JFTA 3L68A 3W7IA 1JRCA 1MXGA 3R1ZA 1FHUA 4GUGA 4CN1A 2J7EA 3TW6A 4HMDA 2X40A 3PNZA 2P50A 2WJDA 3DU0A 5CKSA 1J11A 1TPFA 2NUYA 4P7RA 2E5DA 1IEWA 1UR3M 4TXEA 3WLRA 3STCA 5M1TA 3QKZA 4WXZA 4TO8A 1E71M 4YU1A 3S2LA 5CPQA 1QW8A 3OVRA 3ZJ6A 4J9JA 4HPGA 1OABA 1IT0A 4XAZA 1BG9A 3BMXA 4MJMA 5A1AA 3WMSA 3POHA 4GE8A 1QI5A 3EMCA 1M5WA 3JZUA 1A5UA 1KBIA 4QITA 4PZVA 1I8JA 4W5UA 4L9YA 2RUSA 3W2JA 1YNYA 2WWDA 1JVNA 4TIMA 3VCRA 7TIMA 4G7EA 5JMUA 3MUCA 3MI3A 4UTTA 4NAFA 3NXFA 3W6MA 1JZ4A 3LEPA 2XWDA 3I3DA 4G1NA 3REQB 4QAIA 4Q8WA 4W88A 3A64A 2Z1KA 2W92A 4Z1CA 4H8VA 4H7CA 2GJXA 3GBEA 1SUXA 1GVYA 4KF1A 1A5MC 2JIEA 4C6JA 2EG6A 1CLKA 1Q63A 3DG7A 3SCVA 5BNKA 4OUIA 4GKTA 5DCBA 4FPSA 3G1YA 2WC4A 4AC7C 2PP3A 3NZ1A 4GZ7A 1G94A 1P1XA 5AHNA 5BRQA 2DT2A 3ZT7A 5EGRA 1FHLA 2NWSA 3K46A 3LGGA 1R9YA 2UY5A 1DWFM 3IIPA 3EWCA 3MPGA 4KQNA 2PDUA 1VKFA 2QLYA 3W1MA 2PDPA 3UBPC 4KRUA 5M5DA 1FH7A 2JGYA 3OG2A 4Z17A 1W56A 5AKQA 1VPYA 1UROA 1UIPA 2QCLA 1GJUA 3PSWA 1LG2A 4IJBA 3FXGA 3KS6A 3QYSA 4OBRA 3MW7A 1EUAA 3D6NA 1XPYA 4RE3A 3EOLA 3BUVA 3ONBA 1XYAA 3GAYA 1DEDA 2I9UA 4DJFD 1OF6A 1MXSA 4GZJA 5GVJA 4FSAA 2CLPA 3CH0A 4ZE5A 2XFYA 4MFEA 4C1KA 3BSMA 4NIRA 2WZTA 4R9XA 3LTPA 3NQBA 2ALRA 5ABFB 1K7EA 3GHUA 3C3UA 5LSMA 3BJSA 4HU4A 2F9RA 1ISVA 3WF0A 4DJFC 2D3LA 2G3JA 2WZMA 1TJ2A 2G4FA 3B9DA 1XLAA 2DU2A 3Q2DA 1UQZA 3GDBA 2XWEA 4UTUA 5D30A 3M7SA 2PZNA 1YRRA 1HO1A 3M0ZA 3S9ZA 3UJEA 2NUXA 3NURA 1YEYA 4D1IA 4IMDA 4RPPA 5I23A 3MYOA 4KS0A 3WEZA 4O52A 1B3WA 3F5KA 4R27A 4D2JA 1XIDA 3WUEA 1B3OA 3VIOA 1JRBA 4C7GA 1TCMA 3W72A 3EA1A 4F0LA 2A7RA 3QOKA 2XH2A 2W6RA 3THCA 1H1NA 4FNTA 1AFSA 3OA3A 4Y2WA 3GU2A 4AUBA 2V3EA 1GOXA 4C1LA 4CD8A 4JY8A 1JPKA 5CGTA 2E09A 4E2VA 2ESCA 1UC4A 4UMBA 5A8MA 5CQ1A 2C8NA 1EF3A 2VDIA 1AD4A 1JDDA 4W8LA 4HJFA 4I6KA 4AZCA 3W73A 3TEVA 3A3XA 5K4XA 3L2LA 3FJNA 4AWTA 2PC4A 4PRRA 3HPFA 2PWEA 3PZTA 1FWRA 4XTDA 1Q2SA 4KWOA 2P8CA 4P7OA 2F38A 4Q4OA 2DSKA 3UZZA 1B54A 1JEZA 3EWWA 1FX6A 4ADUA 4RZ5A 3TTOA 3GR8A 1B3XA 4EF9A 1RJPA 4OFCA 4K2SA 2J75A 1S5TA 4N4QA 3M0HA 4GBUA 1XLIA 1CLXA 5DMMA 1KGXA 4QSHA 3VKAA 3NQ8A 1E1EA 4F9JA 3TJ4A 3PZOA 4GRSA 3Q94A 1GTEA 2C19A 3CYVA 4H19A 2F8QA 1LYXA 3PTKA 4X0VA 4XD3A 2DW7A 2GSEA 2ZA1A 3N2OA 4U2ZA 5I3HA 3KE0A 3VZZA 1TPWA 4WDXA 2OZ8A 2PDHA 2J6VA 3CGTA 1PXGA 4O1AA 4LUIA 3TCSA 1WZLA 3HF3A 4HYVA 4M8UA 3PZ9A 4H8UA 5HK4A 1C29A 1HNYA 5LA1A 1NDZA 5FF3A 3M0YA 1M7OA 2ZZ2A 5A6KA 4J3XA 5BYWA 1UKPA 4XG1A 3MUXA 1LOQA 4EAMA 1NWSA 3UZ5A 4C6QA 3BLIA 3ANYA 4J27A 2G41A 4XZNX 3KTSA 4UTFA 2UWFA 3ZWTA 1OHLA 4Q8TA 4UNIA 3IJIA 5H1WA 5BMWA 4JTTA 3S4TA 4IHCA 4H7VA 3P74A 5BOOA 4PR4A 5ABTA 3VA8A 3UZWA 4J5NA 4LS1A 3UYIA 4GPNA 3W38A 3EX6A 4E3VA 5BWFA 5LA0A 2GDQA 1JDFA 3DAQA 2OCZA 2PS2A 4PCPA 1MEWA 3M0IA 4XKYA 4PMQA 2DQXA 2DH2A 1H51A 4AIEA 4MSSA 4Z0SA 3GK0A 3UF9A 4IFOA 3TTQA 3QF0A 4H01A 4JX6A 2VR4A 3ZVIA 3T0TA 4JTHA 5I3KA 4N9EA 1Z69A 4UQ9A 2J9XA 3HQ1A 4URIA 4N9BA 2HMCA 3EOOA 4PCFA 3LCLA 1ZRQA 3NQ2A 2D73A 5CSSA 2W27A 4JEJA 1EDGA 4ZSUA 2J66A 3FY1A 2JEPA 3C2FA 4CNSA 4TTGA 1ZJHA 3RJYA 3GNNA 1E0VA 1Z3NA 3I3BA 2VC9A 2Z25A 2ZYFA 1VS1A 1OG0A 2YCLB 1ZTVA 3FSTA 4KCUA 4G6CA 5HMFA 1K70A 1E73M 1V7AA 3FA3A 3GQYA 2C3ZA 2UV8G 2ZZ1A 3MZ2A 4CD4A 5J8LA 3PB0A 1WAUA 2BP1A 4F2BA 4R7JA 3BLFA 3LS9A 3GNOA 2Y4SA 1IXNA 1QOPA 1WXYA 4W7WA 3GTIA 4LU0A 1DJQA 3OB8A 2OOFA 4YVXA 1GQNA 1V0MA 2OZ3A 1OYAA 4S1FA 4H9ZA 5IDZA 1LQ0A 3NL2A 1R7OA 3R5EA 3BLEA 4Q4MA 5DLCA 1AD1A 3R0DA 2JBMA 4WDUA 4QRNA 2YA2A 3VNDA 4BQ5A 4PMVA 1GEQA 1L8NA 2ISFA 3KX6A 1Q13A 4Z08A 3M44A 5E6ZA 1P6CA 4YXGA 2XVKA 2PLCA 3EAUA 3JU2A 3S83A 3ZSTA 2WVVB 1A5LC 4JX4A 2FHFA 4DZIA 2V30A 2YXOA 1OT2A 3AIVA 4AXNA 4ML4A 3G1XA 3BPWA 1Q6QA 2YFOA 4DNHA 1FWHC 4I5XA 1XSJA 4PSPA 2BOGX 1TMLA 4J3VA 3MKCA 4FXFA 3FW6A 1ITQA 1XBZA 5C2CA 5FJJA 3QW3A 4L4PA 3V35A 3OEXA 1EWDA 4DQWA 4UFKA 4YIWA 4YN5A 2WW5A 3VM7A 2VI0A 3KXQA 2G97A 1KWGA 4FXSA 1BD0A 4I3GA 4IUGA 1XYLA 1RLCL 3I65A 5A6BD 1SO5A 2PD9A 3CZJA 1JUKA 4HU0A 4LAOA 1JCTA 3UJSA 1T8QA 4R3UA 1VEOA 4E6MA 3NQCA 4DPQA 3URAA 1F73A 1TV4A 4PGLA 1I0BA 5XIAA 5T8GA 2VOTA 3W1QA 3GW0A 1K8ZA 5A2AA 2Y61A 5DMLA 3UY8A 4BF5A 4D6GA 2YJQA 2BVTA 3GDLA 3QN3A 1A5SA 3LERA 4FR1A 4QJ4B 5KTLA 3FCPA 1HKWA 4M6QA 1RK5A 2CC0A 5GPRA 4S3CA 1ECQA 2BLEA 1QNRA 4E4PA 5A6MA 2MUCA 3M0VA 2IMRA 4UTIA 1UUQA 4P8UA 3P60A 2C0AA 3EX3A 1VEPA 4R53A 2OQYA 3HQPA 1NM9A 4WJEA 3UYCA 4PUEA 3B3DA 2Y62A 1A3WA 4Y6GA 4BEUA 4H7ZA 3RCMA 5FSEC 1RBOB 3T2OA 1VCGA 1H2JA 4DIAA 3C8FA 3PANA 3W84A 1MQPA 2Z1WA 4E5TA 3UJRA 4ZCWA 4A8LA 1V3JA 3BL3A 5KSWA 3L5AA 2R9RA 3CMFA 2HJPA 3AXMA 4O54A 4EXBA 4JHZA 1E6NA 4C7DA 3EOUA 4WZHA 4AHPA 1KTBA 2G50A 1HUVA 2PFHA 5H2ZA 1XKYA 1VJIA 1HQTA 3LRMA 1WPCA 3WUBA 1YYAA 1OFBA 4NXKA 4XAYA 2VZTA 3L21A 1K7XA 4HYRA 1K3UA 4Y7EA 2Z4GA 3NDOA 3IWPA 2NWRA 3WF2A 3S2JA 3G1AA 4XZMX 3A3WA 3SCWA 3G0SA 1H62A 2XIQA 4IGNA 1VHNA 3V4BA 2Y7DA 2VCCA 1W1YA 3MU7A 4B4FA 1ODUA 4AZ5A 3N14A 4MZ8A 4L9ZA 2B31A 4S3GA 1LRTA 5D8WA 2NV9A 4OVXA 3HPSA 5T91A 4Q4QA 3B0PA 2ADAA 4LYRA 1K9FA 2F2KA 3EPMA 1B5TA 1UH4A 4ZA0A 2ZQ0A 1TZZA 2IKIA 1CXFA 2CNCA 4JHOA 4U28A 1LL7A 1UOKA 3NA8A 3IJ6A 1E15A 5D38A 4H9XA 3IJQA 3CZGA 4HHPA 3GHSA 3QV7A 3TX9A 4BA0A 4K39A 1H0GA 2P5NA 3VUPA 2ZRVA 3AIEA 1B90A 3EX2A 1EDTA 1XLCA 1NQ6A 3K4AA 1V02A 1XF0A 1CECA 1GHRA 4YPJA 4TV6A 3ANVA 1ZUAX 2FKPA 3WD1A 5AHEA 3C8NA 3M0JA 3W7GA 2YXGA 3LPFA 4HZMA 2BV9A 3IJDA 2GGGA 2VD9A 5GJNA 3LCFA 3S46A 1K6WA 1LUCA 1ZP3A 1ZCOA 3LN3A 1EJTC 3KW3A 1E56A 4CVUA 2P3ZA 1QPOA 3RPMA 4ZGYA 3OVGA 4A8RA 3R13A 4KFPA 7REQB 3APGA 3H53A 2WVSA 3LHWA 2BVWA 3AYSA 1Z9AA 1SW0A 3M0LA 4GYFA 3RM9A 1YX1A 2JKPA 3GKFA 4XD6A 4ALDA 3W7EA 3GDTA 4PUJA 2RH9A 4HA1A 3NAVA 4K36A 4MKNA 1W3LA 2E8ZA 1RA5A 1KXVA 3G18A 1E9YB 1VQTA 2XISA 3RU8X 3P84A 3WBXA 1W37A 4A3QA 4KETA 3QFEA 1TO3A 1ZAJA 4RCXA 3URBA 3GVGA 3C2VA 3M5ZA 1A3HA 4K1WA 5EMMA 1KGUA 3PHAA 3HU7A 4C6KA 2AL2A 2H3BA 3G6LA 4ZB5A 3WK2A 3BLOA 4JTAA 4O8RA 3W26A 4C6DA 2VFGA 4RPQA 4D8ZA 2ZDSA 3GRIA 2FYMA 4JFUA 1SW7A 1KQZA 3BJTA 1XIEA 3TQ0A 3ES8A 3V18A 1AUSL 1E6PA 3P62A 1Z32X 3M41A 4GQGA 4Y9MA 1U83A 1O6IA 3GY1A 3GFXA 4MHBA 1DIKA 4OU1A 5AB3A 3TTEA 3C2YA 1EJUC 1IEVA 1LLOA 4YLWA 4K37A 4HHMA 2QULA 4POCA 3UXAA 3DUGA 3VOHA 4E2DA 1WZKA 3EB2A 4PEEA 4BZYA 3O0KA 4X22A 2ZFAA 1EX5A 4XB3A 3QSTA 1AK5A 2D23A 4E2OA 4UQCA 4MTVA 3REQA 3QSRA 5GNZA 3MY9A 4HK7A 2V2CA 5F1UA 1RD6A 4O8AA 2X16A 3PZQA 1H7NA 1UD3A 4O57A 5I0DA 1OEPA 1G5AA 2WANA 3TN3A 3HG3A 2E9BA 2XJ7A 2BFGA 3EWYA 1EO7A 2VKZG 2D2GA 4AZHA 4O50A 3WQDA 3NOEA 1ZNNA 3U2EA 1VENA 1P7TB 2ZX5A 5HNNA 2XSBA 4HNCA 4QDMA 3S6OA 4XWUA 2XIIA 1ZQ5A 4QS6A 3GB6A 3VDGA 3KUMA 1VRDA 4GIAA 3BAYA 4DJFA 5FL0A 4W8AA 3TDFA 1F3XA 1CYGA 1OF8A 3AU6A 3SSZA 3LM7A 3GTFA 4XZHA 3AZTA 5LIYX 4LCSA 3MP5A 2CLHA 1P1MA 3GXIA 4N2YA 1BAGA 1ZU8A 2QCCA 4UBPC 3SCPA 4WOQA 4UNKA 3Q67A 3VABA 1QU4A 3EGJA 2BS9A 5LXEA 1YTDA 3W7QA 3W82A 3WNMA 3RXZA 1F6PA 3TNBA 3GXPA 3SGUA 4PMOA 5DY3A 4ORIA 3BLDA 5CXPA 3KEHA 4C6LA 2WYSA 3H2MA 1DJZA 3CL8A 3LMYA 4UR9A 4ZB0A 2O0TA 3QYQA 1HW6A 3LV5A 3ITYA 5D32A 3PJUA 3WKZA 2Z2AA 3BGAA 4E4UA 3TKFA 4L1WA 1B3YA 1US0A 1PWLA 3PBGA 1DL3A 3HOJA 4X9YA 4H2CA 2X7VA 3F1QA 4HNUA 1S46A 3DFOA 4FLSA 3BOXA 4GCAA 3WD3A 4UC5A 3V5OA 3TMLA 3ZR4A 3IIZA 2MANA 2Y6ZA 3RM8A 2O4QA 1VB9A 2XVNA 3EPOA 1OM0A 2G96A 4ENLA 5AYZA 1NWUA 3R11A 3H26A 2EO7A 2WM0A 1GPFA 1SR0A 3VAVA 1ZP4A 4L9XA 4HIBA 1XIIA 1TIMA 3AS0A 4DXVA 1E55A 4E8GA 3XIMA 3RM4A 3H21A 4HPNA 3BAWA 3VD5A 1CXIA 3E2RA 4YNGA 3QEZA 2WZIA 1GW9A 3ISIX 5A8PA 5IOBA 2WSPA 1E70M 4C7FA 4ZXLA 4MYAA 4H83A 4KWVA 4GO9A 4FXRA 2HBVA 3URNA 3N2MA 3DHDA 1VFUA 3JZEA 1Z41A 4M24A 4HPXA 1SFSA 2XZ7A 4MF4A 5FA5A 3ZLFA 3FDGA 1JUEA 1WE5A 4TVCA 3MANA 4IM4A 4KMQA 1DJNA 2X7WA 4CGTA 1UHVA 2PD5A 2FMOA 4KWWA 3R25A 2J8TA 1UUOA 2FVLA 1PB0A 2FH6A 2V81A 2FVKA 4L65A 3NQAA 1X7FA 3OBAA 1OWQA 4U31A 4XSLA 2ISDA 1FCVA 3YPIA 2NXHA 3MJYA 3WG6A 1OD0A 4B5XA 4EK7A 4HK5A 1OGGA 5IRPA 3K8MA 2DZTA 1R3VA 4Q3MA 2QCDA 2GGEA 5IFPA 2ATMA 4Q6JA 1XLBA 4PMNA 4JZ5A 3RIKA 2V5BA 1GZJA 1HGYA 3ID7A 5BOFA 5F1VA 4D8LA 2PSNA 4B3KA 2UY3A 4L80A 4LPCA 3NCOA 1DKWA 4AX7A 1NFPA 1JULA 1JAKA 1XCWA 2YGYA 4I6VA 4PSRA 2OEJA 1FRBA 4XSMA 3I6TA 1GG1A 4DY1A 4JIRA 3VDHA 2WCAA 2AQVA 1AQMA 3SGGA 4O16A 4MYXA 5I5RA 1SZEA 2Q8ZA 2G8ZA 1VPXA 1OFQA 3RGTA 3TW9A 2QCGA 5CSYA 1IZJA 3UCQA 1QATA 1WDDA 4N4PA 5F4XA 3BGGA 4W9TA 1WKDA 3S2CA 5LNWA 5C71A 2Y85A 3TV8A 3SSJA 3WF3A 4XTIA 3GXDA 4H9VA 3ARSA 4NKCA 3TYUA 1KM2A 3VIHA 4GQRA 2DZXA 1UUMA 4ATLA 3T8QA 2ACUA 3TZNA 3ZLGA 5LZLA 1MRQA 3WL0A 1AJ2A 3HV9A 4GYKA 3L2MA 2PWVA 1DP0A 4Z1BA 4HNTA 1GQJA 4W86A 2VT0A 4Y9AA 1OFPA 3CB8A 3O3RA 4E38A 3GVRA 1O5KA 4NP7A 5BW6A 4GX9A 3WDPP 4IXHA 4DJDD 3GWQA 1O66A 4NRSA 4NZFA 1XX1A 2H9AB 4ZO7A 1VCFA 5KINA 3M9YA 2RHGA 2QGYA 4Z2GA 1T99A 4A05A 2QT3A 4Y8FA 2Q02A 5I02A 3T1GA 3EOEA 1SPQA 3ITXA 4QE1A 1GOWA 3PUEA 2R94A 4UXDA 5A94A 3I10A 3CV1A 1DWAM 1HKJA 3HQOA 2JKAA 2O9PA 2QXWA 3N4AA 3OZOA 2F6XA 4PA8A 3BLKA 3ME3A 4MM1A 3CUGA 3VDAA 1FY6A 3IIOA 1R6WA 5HNRA 1VIZA 4LEFA 3EEGA 5C5YA 2NW0A 3W28A 3VX1A 5CC3A 1F2JA 3RPDA 4CU6A 2PDWA 3A6OA 5D04C 1UP3A 3MSGA 1LOSA 3SY8A 3UD6A 4JAWA 1A4MA 1KO0A 4HMEA 4CNPA 4XUYA 2HVNA 1TJ1A 1QBAA 4XKYB 5DRIA 1NP2A 4C1NA 3ARYA 3AZSA 5BXPA 3VMOA 3PTDA 3CEPA 1IZKA 2CLKA 3AUOA 3PZUA 4GACA 1Q66A 2OZTA 3SGZA 1TRIA 3CASA 3PB2A 1VHCA 4GUHA 2Z6IA 1E9LA 1MEIA 3L4ZA 4KEVA 5FKYA 3NIYA 4ROQA 5CZJA 4LAMA 5MHBA 4EPBC 3VOGA 3OGSA 1XL9A 2CLFA 5CZTA 3S47A 3GG1A 3VI2A 5DF0A 2VX6A 3AYVA 2BBFA 2OWCA 3TN6A 1YNQA 4IMFA 3R58A 2GQ8A 3RG6A 2Z2BA 3TUUA 1XIJA 1ZGDA 4XVDA 1UPPA 1RQEA 1H60A 4MUZA 1JCNA 3ANUA 2F7FA 2FDSA 3CS2A 2ZICA 2J47A 4B90A 3B97A 4WY0F 4W85A 3SCTA 4IF2A 4NJJA 1W5MA 2Z2UA 4JTLA 3HMJG 5ENLA 1RCOB 2H8XA 1TPC1 4A4AA 2CBJA 3HJEA 4PMXA 5C9RA 4G7FA 1F7BA 1S5NA 5CPOA 4XZBA 3GX9A 2G0WA 2DPEA 1TX2A 3BJFA 2HVMA 4JL2A 3PZGA 3G1DA 4YTUA 4JTKA 4QROA 3MB9A 1IQ8A 4JYFA 4FNSA 1E72M 2PLJA 2JQXA 1GKPA 4WHBA 3QMRA 4XZ9A 4LW7A 1JYNA 2VM8A 2OOGA 4AB4A 1NDVA 4ZTYA 4AYGA 2P10A 4XX6A 3RR1A 1UD4A 3CUFA 1RJQA 1S2UA 4B3ZA 3SJNA 4TQTA 3ABOA 4ECLA 4JY9A 3S2NA 1MYRA 2ZADA 3V0SA 3JRKA 4MZ1A 1JDCA 3P3BA 4HCLA 5AHIA 4W4QA 3MQTA 1Q6CA 2PZ0A 3BV7A 2FHBA 2QJNA 3B40A 1OCNA 5HQLA 1FWNA 4C6CA 4QCEA 1RH9A 2J79A 3R10A 1PDYA 2O55A 3J7HA 2GJLA 4TUFA 1TVNA 4FP1A 2DW6A 1IIHA 3PP7A 1V8EA 4QG6A 4UFHA 2UBPC 2OTDA 5KZEA 1J96A 4W93A 1TX0A 2V68A 3WQPA 4MLRA 3S5YA 3OG3A 4KWUA 3I4EA 1T5AA 1JNEA 2A3AA 4US6A 3QPEA 1UWIA 1UH2A 5FAGA 4WF7A 4P8WA 3TMQA 5AY7A 4V2XA 1QWKA 1L8PA 1JQXA 3EMQA 3KOYA 4K38A 1A53A 2VELA 2ZE3A 4ERIA 1P0BA 2EPNA 5K3VA 1K9DA 3FAXA 2J77A 3ITTA 1YPXA 1XG4A 4BI6A 1UC5A 3AI0A 3NM3A 4ZZ9A 5KMYA 4J28A 1E6ZA 3WZ0E 1HVXA 1PYMA 2GGIA 1A47A 3USBA 4I5RA 5BCAA 1QXLA 2YDSA 2NX9A 1XLKA 3MA8A 1R0MA 1KM0A 1V77A 1KKRA 4PL2A 1FCUA 4I7UA 1PSCA 3W87A 3CMGA 1QT1A 3OIXA 1E4LA 3ENLA 1RP9A 1JFXA 4Q22A 2QUUA 1XIFA 4WX2A 3HO8A 2QV4A 3L2IA 1ZLPA 5M2FX 2WCSA 5CPMA 4NASA 3RRXA 2O7QA 3PS7A 1OCQA 1W1VA 3DHUA 3ATYA 1S1PA 1E4NA 4E8DA 1KCZA 2GVGA 2BDQA 1S2AA 4GI6A 2ZZ6A 2Q09A 3R0KA 1PHWA 4QEHA 5EKYA 4DRSA 3TIMA 2QDDA 3VGHA 1UCWA 4QX4A 2G3FA 4HCDA 4N7QA 3WNNA 1PZ1A 4JL1A 5C54A 3VD3A 1TIWA 1BTMA 2PURA 2HE5A 1H09A 4AF0B 1XWYA 4GH3A 2ZIDA 3U8GA 4XV0A 1P43A 2WSRA 1W1B1 1GUVA 1CDGA 1E1FA 2YW3A 1QUMA 1OADA 4L7ZA 4NNAA 3S6TA 4UOZA 5G5IA 3SURA 1F3WA 1LUCB 1XYZA 2XIJA 3GZAA 5C9XA 3IIVA 4IMGA 2VEFA 2DVUA 1M04A 1AL8A 1DJGA 3W24A 3RX2A 3VD7A 3FA5A 5HWJA 1QHOA 3PPGA 1PX8A 4QJ5B 2GK1B 5JBEA 2QUMA 4P8VA 3O9NA 4A3RA 2X09A 5D2XA 1V7YA 1CX9A 5I6SA 3H54A 1N8FA 2BHUA 1J2WA 2FZ8A 3ELFA 3QQ1A 3UERA 2YSWA 1GOKA 1S1RA 1YE4A 3RNDA 2E77A 4OV4A 5FEZA 4X0NA 1QFEA 3DH7A 1QNQA 3K1GA 4LSBA 1KLZA 1X38A 1BSIA 3KHDA 3TE9A 2C15A 2DZPA 3BMVA 1HP5A 3WX7A 3W6LA 1KW1A 2O9TA 2HK1A 3TN4A 2GQ9A 4DAIA 3C0SA 4AD4A 1HKVA 3JR2A 3UNDA 3WLQA 1PE1A 4IISA 4R5EA 1A3XA 4FOJA 3QJAA 2JF6A 2ZWYA 4ZTXA 3WMLA 2OJPA 4DF0A 4FI4A 4M6PA 4RW5A 3NGJA 1KR0A 3AOFA 3I6EA 4L6OA 3B4UA 3KBVA 5HPOA 3M07A 4JN6A 3CK5A 5ABFA 1YADA 1BWVA 3EB3A 1M03A 2RJHA 3ARPA 2HZGA 1Q3NA 4WY0A 1JCMP 3UWWA 5CCZA 3VZXA 1HKMA 3WL1A 1MRAA 3ZJKA 2V6AA 3HPXA 4AD5A 3RUBL 4IMCA 1R3QA 1UJPA 1TVLA 2PDFA 1LDCA 4CCEA 4MDOA 3QHNA 3WFLA 1SZRA 4YYFA 1FWDC 5HMEA 4PC8A 3ALGA 4KGLA 3T4CA 4LVAA 5LGXA 1WXZA 2P8BA 2BTMA 3GZ3A 4P7QA 6PTDA 3EWXA 1TWIA 1WB0A 1FOBA 2ZKMX 3D0CA 4H9TA 2TPSA 1CPUA 3QBUA 8XIAA 2W3ZA 1NU5A 4CEXC 1TTQA 3NFUA 5EY5A 3NJ3A 1TWZA 3O06A 5F2LA 2HS6A 3KRZA 3CM4A 3L4XA 4DJDC 2DEPA 4PUWA 3VM5A 5K7JA 4OHQA 4HOWA 4LEQA 3UWZA 2DZSA 1GK8A 4KFOA 3W53A 3BOFA 3NO5A 1KRCC 1H7PA 4MPQA 2VL4A 2P53A 1L6WA 1PDZA 2EG7A 4HU8A 1FHDA 4O0KA 4JPGA 4G8TA 1DHKA 1X1ZA 1IZCA 4HMCA 4BQ2A 4NX5A 4PUUA 2IQTA 1K4HA 4QJ1A 5EYWA 1A5NC 3AYTA 2H6RA 3KBMA 3THDA 2X1TA 2JALA 4AD1A 3GTXA 3LK6A 4UTWA 3N25A 5JH2A 2TRSA 4HU3A 4LC8A 3LCIA 3QR3A 3S3GA 3SUWA 3GYCA 4MUPA 1VFOA 1E9ZB 1GYLA 2WNNA 1XKJA 1XLHA 1G4SA 4GIRA 1SZFA 5T9BG 1OX5A 4YJ5A 3B8SA 4X61A 4NSBA 5HINA 2I7GA 3VX0A 1DIDA 2HPIA 4TR9A 2D3NA 3IVTA 2Z0IA 2AMXA 2EAWA 1DOSA 3G22A 4AMAA 1B57A 4Q8PA 1JYVA 1IR1A 3O15A 1WDRA 4M56A 2DUZA 4RNIA 4UWMA 3UXLA 4KEMA 5BMXA 1FWBC 1BKHA 3WNOA 3V1PA 3LHZA 3II1A 5C2XA 1GONA 2WJZA 3TLQA 4QQUA 3D3FA 2FZ9A 2PGRA 2X0YA 1Q6FA 3QV9A 3EWZA 1LWIA 1HZYA 1W2PA 4BFAA 2V5LA 3NQVA 2J4GA 4ZQPA 1J5SA 1XYCA 4B3LA 3UPMA 3W2KA 4YVPA 2F2HA 2DIKA 4LWWA 2JKEA 4RZBA 1O5XA 2POZA 3OLGA 1VEMA 5LA2A 4LS0A 5B7YA 4JICA 2FB2A 1D7KA 3B8IA 3U7VA 2HTMA 3GG7A 3F4DA 3LM3A 4GKLA 4ZR8A 1Q2RA 1Q6DA 1KCXA 3WLIA 3DEQA 4MNJA 3W85A 1TMHA 2WSQA 2QKFA 1O5QA 4M7TA 1U1JA 5LIWX 4I8DA 4Z2JA 1E0XA 1J6PA 2XH7A 2QUVA 3WQGA 3JW7A 3LBOA 1R46A 2VYOA 3CUIA 4H2HA 3LI0A 5C9WA 4JFWA 1CXEA 2AMGA 3ZR5A 4GVGA 1YDYA 2OYMA 3PZIA 1IGWA 1DTNA 3W1NA 5JIPA 2CCRA 1S2TA 1MW1A 3A5VA 1O1HA 1UWAA 3I6RA 1YKWA 5I3JA 3LMZA 1IWBA 2DVXA 4HZ8A 4KESA 4KIRA 1G01A 2VC7A 1ZFJA 4DYJA 1O5RA 4Z2HA 1SMAA 3USZA 4MWAD 4X3ZA 2VGIA 1L2QA 2ZA2A 2ZXBA 2O56A 2WO5A 2GWGA 3SECA 4GJ1A 4KCWA 3PC0A 1PHQA 1BVNP 3VTRA 4NAEA 1FWCC 5E93A 1W1A1 4QG9A 4C60A 1JF5A 1MNSA 5GNXA 3IK4A 4W87A 5A8QA 1MNZA 3N17A 2Y63A 3H24A 2WSYA 3PJXA 2OSYA 3VNMA 4BEQA 5CC7A 3WLLA 1VYSX 4JDBA 2GUUA 3PUGA 1GQKA 4M7SA 3QY7A 5J04A 1XUZA 3V1HA 2AAAA 1TE6A 1OIFA 3F7JA 1F5ZA 1ISXA 2E68A 2X30A 5FJUA 3B04A 4AG0A 4LFYA 3GC2A 4UR7A 5HBFA 1TR9A 3BAJA 1PKYA 1JXJA 3RLHA 1WBHA 2AL1A 4Q4PA 1OYCA 3IK2A 4RE2A 1TJ0A 3AWNA 4FOUA 7PTDA 4LUSA 1H49A 2BY2A 1OY0A 4JX5A 2PF0A 4O10A 3MP3A 1YDVA 1QNOA 2BOFX 2E6FA 3RCNA 3WQ6A 2BOEX 1JAEA 5M17A 3VNIA 4P5UA 3WH9A 5EMYA 4NJKA 5BU6A 1KXHA 1F6KA 2EJ1A 3T05A 4IZGA 3BSHA 3NYDA 1W3NA 2FDMA 3VOFA 3VIKA 4ZFCA 1E3ZA 5DXXA 1P48A 3CAKA 3N4FA 3N9RA 2VFFA 2OO0A 2R1NA 4GGHA 1YIXA 1YPFA 3G6MA 2Z27A 1BQCA 2GQ3A 3EPNA 1NEYA 4GUJA 4NYUA 2QGHA 5ABEA 1GJPA 3T0DA 1AW2A 2CU0A 1BLIA 2QVHA 4Q6XA 2FJUB 3P67A 1ZJBA 1U22A 5KETA 1JG9A 3UA3A 4JIPA 4X63A 4RZ4A 4PN2A 5IXEA 1TV2A 1IWPA 3M0KA 3OGRA 2Q8LA 2GQAA 3WFAA 2DORA 2V3FA 4JIQA 2A3HA 2ZVRA 4GNKB 1LTDA 3CWHA 3IGUA 1EPVA 1BWKA 5CC5A 3AIUA 3PPFA 4AVFA 3VDCA 1GKRA 1XLEA 4UFJA 3ZT5A 5JBFA 4NZ1A 3THQA 1CXHA 4DJEC 3AXHA 3EZ4A 3KP1A 1F6YA 3VIFA 3W7LA 2D1ZA 4Q8QA 1L6GA 1ZBWA 1W9XA 3RX3A 1K02A 4AW7A 2OR2A 4MADA 4DF1A 3BAIA 1CT5A 2GVYA 4S38A 1O68A 3U7BA 4MDPA 4RE4A 4UMAA 1TZ9A 3B03A 4EACA 3IJ8A 1OIMA 3FOKA 1ZBCA 3V0TA 2J7CA 2BODX 4FXJA 1UD5A 1JDAA 4LC6A 3MMUA 4AWEA 1MQRA 4JNMA 5KITA 4IQJA 4PMDA 4B2DD 3WMBA 1NOWA 4JTCA 3O8AA 1LROA 1TB3A 3GM8A 4HSNA 4KBXA 3NWRA 1H63A 3O6DA 3VGBA 2FMNA 1JIBA 4LTSA 1VPQA 4BS0A 3PAOA 4QFUA 3W29A 5EFFA 3VMNA 4OECA 2C16A 1RD5A 2CIPA 2YCIX 3C4UA 2PPGA 3L67A 1B9ZA 4DZHA 1P0NA 1JCXA 3RYSA 1AQ0A 4RJEA 1CZ1A 4MJ2A 4F8XA 3HIJA 4MB1A 4J4KA 1PAMA 3W3OA 4S3AA 1AH0A 4C6MA 3KZSA 1A0EA 4XUGA 4GFIA 3CAQA 5JH1A 2ZTJA 4G1KA 3UWQA 3NPXA 4LF1A 1IF2A 1S2VA 4XZWA 4NAEB 4Q4RA 1W3IA 3NL6A 2PDKA 2I5IA 1V03A 1GOIA 4XK2A 5DXYA 5HATA 2E9MA 4K6AA 2ZRWA 8TIMA 1TV5A 1J79A 3QZEA 3SIZA 3N2BA 2WNQA 3AS2A 3UVIA 1WV2A 3FJ6A 4LBUA 3GNRA 3QHMA 3E12A 3GH7A 4RDZA 3HQNA 1Z89A 3G1HA 4FA3A 4KEUA 4WKHA 5G1TA 1KCKA 3KBJA 2Y5JA 3C56A 4UFMA 2ZUTA 3DYMA 4DUXA 3TW7A 1EC9A 1RXOB 3I7RA 1E3XA 4JNZA 1L6SA 4JKMA 4MAVA 1O60A 1IXOA 1CGTA 4NNBA 4DWSA 3SM0A 4F0RA 3AISA 1PPIA 4NL1A 2W67A 2G37A 4LVDA 4IFKA 2ISWA 1IYXA 2PTXA 1BRLB 2ZE0A 3FIGA 3MHGA 3NDYA 4QAWA 3ZZ1A 3RN6A 3GTNA 3BSGA 1UWTA 1TG7A 3DGRA 2FQIA 5KEZA 4ZVJA 3UNTA 5FSDC 1DJYA 1GVFA 3ARTA 1ZS2A 1BYAA 4YWIA 7XIMA 4BWLA 5F4WA 5DO8A 3TFXA 1R9ZA 4U2YA 4AHQA 1Q8AA 1IIGA 4DM1A 3U2ZA 3PPHA 3HPZA 1PO9A 4F2TA 6CGTA 1EYWA 3GDRA 2ALDA 1XC6A 3EEZA 2WZEA 4HB7A 3O6CA 3CIVA 4LB4A 4J3WA 3W7HA 1K4GA 1SO3A 3NQEA 4TMBA 1JI2A 1G4TA 3TYCA 2REQB 3TK7A 3KL0A 2WAGA 3WENA 3W7CA 1N7KA 3W7NA 1TJPA 5B7ZA 1VBRA 4IX2A 3LNMA 2WLYA 1GOQA 1GVEA 2XGIA 4AISA 2DZAA 2EKGA 2PDJA 4OGZA 4EOUA 4N9DA 1QHPA 4IFKB 4IPIA 1ICSA 1EXBA 4GJJA 4TV5A 4D6DA 4AIOA 3OZYA 3OZMA 4HSOA 2VP8A 3T08A 3GD6A 3WEOA 4K8HA 3P8IA 3SO7A 3L4YA 2BHYA 3N04A 3LHUA 3LLFA 1DQWA 3AO0A 1R8LA 3N18A 4G2DA 1KCLA 1VRXA 1MI3A 3WQ5A 4FF5A 1O1ZA 1UKQA 2BSLA 3UCDA 3P5ZA 2AAMA 2GWNA 3AMDA 1P4CA 3HB9A 2X2YA 4DPPA 3R6IA 3TOYA 1NVMA 4M51A 3G3DA 1A5CA 4S23A 4GUFA 4CQAA 2DP3A 4JIIX 3VGFA 4JR5A 2FVMA 3ZXWA 4KRTA 1GVSA 1VBHA 3U5UA 2FZDA 1XDMA 3WF4A 2C91A 3RAOA 1W9VA 2CBVA 3SADA 3L5MA 2BVYA 3WNPA 3W75A 5LHFA 3HTWA 3LQGA 3DBPA 1KD0A 4HZ7A 1D2KA 1I2RA 3IUIA 4GVHA 4WVXA 4M6UA 1K9TA 3GXFA 3IGXA 3TROA 4X2PA 4MB3A 1P6BA 3ES7A 1YBQB 4JFVA 3STEA 2YA1A 1BFNA 2BXVA 1DTUA 4AWUA 5ECUA 1B4KA 2I17A 2Z1XA 1UWSA 3AROA 1H1YA 4F79A 2ISSA 1L2UA 3H2FA 1UOZA 3EDEA 3UEQA 1OX4B 2XDFA 1BSLA 3DG3A 1ZALA 4Z1YA 3AMCA 3DZ1A 1H3GA 2G3IA 4WR3A 4CD7A 2DUAA 3MYPA 4M29A 3VNLA 3A47A 3WLTA 4C65A 2WQDA 4HD5A 2ZZ3A 1XH2A 3GSMA 3B9NA 5K2ZA 2YBVA 1MVYA 1V6VA 4BCEA 4E2BA 5BRPA 4TMCA 2HWGA 1H7RA 1GNXA 1C91A 4O1EA 3ZO9A 4WEVX 3VKDA 1KBBA 3T0CA 1YW1A 2IXVA 4QIUA 4W8BA 2INEA 5D8ZA 4S3FA 1M1BA 4GI4A 3VOJA 3MP4A 5LKYA 3TYZA 3W88A 4JDYA 3WJZA 3PUOA 4GOAA 1XD0A 2Q6ZA 3QC0A 4Z0JA 1GW1A 3N15A 5CPTA 7TAAA 1HT6A 3SB0A 1FQ0A 4JIEA 2V2HA 2CKSA 3UZXA 2V5JA 1OINA 2D20A 1OFRA 3NSXA 2IPFA 3VNYA 4GG9A 3SUTA 4DUWA 1XSKA 3B8UA 5DN1A 4DEFA 1TV7A 3WNKA 3QGKC 3N13A 2IQ0A 2QCHA 3P80A 1QI2A 4S3JA 3NEVA 4WUIA 4KGJA 4ASTA 2OSXA 2L5HA 2ZCGA 1AH4A 4AD3A 2X1UA 4DWDA 1WO2A 4FK9A 2O7SA 1FXPA 1DV7A 1DJHA 2PAJA 3BC9A 4DWSC 2BXYA 3P5YA 5D03A 1RCQA 4A2RA 1RBAA 5A8OA 3NPVA 2OMAA 2ZXQA 1MZRA 4ZO6A 3VIJA 3BAKA 3O6YX 3BQ6A 1TWDA 1WQ5A 2QZRA 4LOCA 2ON3A 1W5PA 4QNWA 3KAOA 3B8WA 4FNPA 5AVHA 1U5JA 2IKHA 4KH2A 1HJSA 3W7PA 3N34A 1Q6OA 2V9DA 4FMVA 2BNJA 1VZWA 2A7PA 2VRQA 4DO5A 3GNDA 3QY6A 2XTKA 5EL1A 1TQJA 1XDLA 4MKSA 4YCPA 3SCUA 1W8SA 3CXOA 2XM1A 4GIEA 1QK2A 1Q4NX 2DZWA 1UZDA 4P7LA 3DCPA 2QMJA 4WGXA 2EKCA 2PMQA 3PN8A 3F2CA 1VP5A 1WDQA 5CZSA 1X7IA 2C1IA 5CBIA 2Y7FA 1RJRA 5DANA 3SQLA 1MDLA 2WVUA 3TJLA 4O14A 1KLYA 5ABHA 1SJAA 4U5KA 4FB7A 1QNVA 5E0KA 4P7NA 5I7GA 2WHJA 3VE7A 1RR2A 5TIMA 4GI9A 1WZAA 1J2BA 4JYDA 3NDZA 3OIHA 1U30A 3M6YA 2QDEA 4GVFA 1XYBA 3QQWA 3O7UA 4R85A 3B8TA 1Z42A 3WH5A 2HV5A 3S1GA 2RDTA 3W27A 2C71A 2ZVIA 2VC6A 3IUDA 2R82A 4OTKA 2G3NA 3S5NA 5I2UA 3PULA 3V0UA 4Q8NA 1CENA 3VZYA 1E6SM 4LYQA 4TX9A 3STGA 3O16A 1IHIA 3UVAA 4RE0A 2DT0A 2YZRA 3CEUA 1EO5A 3W1PA 2OFJA 3MUZ1 4IL0A 3MC5A 4AVOA 4XZIA 3ZS4A 2E1DA 1S3TC 1JFHA 1XXXA 4K1GA 3TU9A 1VFSA 4D6FA 1UW9A 3PJTA 5CZ0A 2D2OA 1V6UA 2QCFA 1DQUA 1THFD 2VFDA 4QE5A 2ZTKA 3CV7A 3A12A 3UPBA 2TODA 2J8GA 2E67A 3W1AA 3CHCA 1Y5XA 1CGVA 1TKKA 1OGBA 5C8BB 4IG2A 4JHMA 3Q37A 3CB3A 5DMYA 1PKLA 3WIJA 2REQA 4XVEA 2FH8A 2IQDA 3KVLA 1UP2A 5HANA 2Q3RA 4J7RA 2AKMA 3M64A 3DDMA 3SRFA 3BW3A 3WQCA 3BMWA 6REQB 4WGHA 1PKNA 2OPJA 4DN1A 2F84A 4N6EA 4CU7A 2PDQA 1SFTA 3W70A 1RA0A 2ZRYA 1T6MA 2QW5A 1W54A 4A3HA 4D8AA 4A6GA 4ZSTA 2D0FA 1EYEA 4LT9A 1SGJA 4IICA 2ANUA 2VQTA 3FV9A 3MCMA 5FF7A 4YVVA 1S5WA 3WBWA 2FFCA 1VYPX 1U1HA 2NXIA 4DYEA 3WH6A 1TUXA 4UQBA 1W31A 5DFAA 3CUXA 3ITOA 4UCFA 2FPYA 4IPNB 2VGBA 3MVIA 5EBAA 1CGXA 2NVCA 4REQB 2PA6A 3MV11 2X05A 3SZ8A 1R47A 1KFBA 1JCYA 2CFFA 2CLIA 4HA4A 4LAZA 2WHLA 1JXKA 5AVNA 2QCNA 1EJVC 4TTUA 4A8IA 1SVDA 1BTCA 1J8VA 1C92A 5CPSA 3HG5A 1V3MA 3ITVA 6REQA 4PFHA 1HL8A 3T7VA 3QC3A 1XYMA 2W62A 1UD2A 1IEIA 3U3HA 3LYEA 3CAWA 1GGOA 2WOQA 4EF8A 1QWGA 2E40A 3S1VA 2DV0A 2AKZA 2PTDA 2E7FA 3OLEA 5I03A 1ITUA 3IRSA 4HN4A 1PX4A 1TTJA 4RNFA 3BCJA 2PDCA 4ZBCA 3WBYA 5G4WA 4JOMA 4CEUC 3EX4A 3LENA 1KBJA 4PCTA 3U48A 3VKJA 2RAGA 3W7JA 2IUZA 3VIMA 2OT0A 1EHNA 2VWSA 3AIQA 3AMKA 3WLOA 1KV5A 3AXIA 4LNYA 2BWGA 1KFLA 3CQJA 1WKEA 4DO6A 3LD5A 1PCWA 2DQWA 3TTYA 1AZ1A 3ZYZA 2A3EA 3BZGA 3W0KA 4JKLA 1XBXA 4DLMA 3KCLA 4CD6A 2PODA 3RITA 2QEZA 4CQDA 3VGDA 3R7MA 1GOOA 1VYRA 3V16A 2V0TA 3DI1A 5FEXA 2WK2A 1JCLA 4MOZA 3WSUA 1SFJA 4KEZA 2EXOA 4LQ1A 3SN4A 3DI0A 1C8QA 1B31A 1SJCA 4PTNA 1RK6A 4U3AA 3HBLA 4AD0A 4S39A 4LVGA 4EPEC 3ZJ7A 1LLZA 1YBQA 4NI3A 3O05A 3P81A 4B9YA 3QM3A 5AZ0A 2ISVA 3R4IA 1DQXA 1VLWA 4GH1A 2V38A 1FH8A 1UH3A 2EJAA 4H8HA 2WV8A 2J27A 3W74A 3E96A 4UTMA 4JBRA 2VOMA 2YL8A 1HJXA 3WLKX 4LAUA 3CPGA 5E1QA 1DYSA 3WDQA 4RDWA 2WVTA 3DFSA 3RMEA 3D47A 3TC6A 3UZJA 3VKCA 3LPOA 4PUMA 3S1UA 2FZNA 3FYOA 1E6RA 4GA8A 4CNUA 1B3VA 1KGWA 4MNKA 1RUSA 1OYBA 3NSNA 3VU2A 5CGQA 4HHLA 4MJZA 2A7NA 2Y89A 1YQ2A 1UA3A 4K7YA 4H9YA 4ZOEA 2D69A 2PP0A 4PBEA 3GTHA 2R1PA 4CU8A 1WNOA 3FS2A 2JF7A 1PTDA 1OD8A 4DBUA 4F48A 1XI3A 2PCEA 2ZRZA 1QDSA 1KFCA 2BXZA 3KOXA 1EP2A 3PJWA 4ZOCA 5BROA 4L4OA 5DBUA 1FA2A 5K9XA 1V4YA 2V5CA 1I4NA 1FTXA 3EDFA 1JL8A 4K3ZA 4O17A 2R1LA 3NQFA 3DENA 3PNUA 3QKEA 1DJWA 2PWFA 1H41A 1UBSA 3DFHA 2FIQA 1A5KC 4O15A 4YHGA 3F2BA 2QQ6A 1CB2A 4OQVA 3FGCA 4DVOA 1GQIA 2YBUA 4IPPA 1XPGA 3MI6A 3WQ4A 2WBKA 4JS3A 4MPKA 5A6AA 2NVDA 4OBSA 2XYLA 3NVDA 5FJTA 1OC7A 4PBGA 1VFHA 1OZMA 5DEZA 2ZUWA 4R33A 4ZO8A 1WX0A 4ZQMA 1A4LA 4MAZA 4XIAA 5EFDA 2R8WA 3DESA 4EKJA 1XRTA 1UWUA 3DYOA 2E5BA 4ICCX 4F0SA 4ATDA 4JTEA 2NXGA 4PUDA 2PTYA 5HQEA 4PULA 2FPTA 2RDWA 4HGXA 5XINA 2WMHA 2VVSA 1AQHA 2NT1A 2VXNA 3DFQA 5AC6A 4PEKA 1O12A 1GYMA 2DZUA 3GE7A 2DJXA 3AIWA 1X97A 1JZ3A 5C9ZA 4N02A 1M53A 1U2YA 3TA9A 4YCOA 3H4GA 5CGMA 3B9OA 1B4EA 3BK0A 3F5JA 4HZ6A 2Z24A 1EUNA 4UOQA 4O11A 3UWYA 1AG1O 4B4HA 1F4HA 2Z26A 3GH5A 2Z1SA 4MY8A 1XG3A 3RO8A 1ZAHA 3N19B 3R43A 4GQQA 2VEGA 3LV6A 3WLJA 3MS8A 3MHUA 3CQKA 2VCAA 3DHFA 2C1GA 2QCEA 4O1CA 1I9CB 2VX4A 4EANA 4AF0A 4S2CA 2ZUSA 3CC1A 4UTHA 3R12A 3MBDA 3FDKA 4JQ2A 1WOBA 3KRBA 1KXTA 2PGWA 1LQAA 5CC6A 3KWSA 1NP0A 3E0WA 3LBCA 3QPZA 2VGFA 1MFVA 1J5TA 2BB0A 4LNCA 1DWHM 1U1UA 3ARUA 1UR2A 4D71A 1ONXA 2XSXA 1Q7MA 3OOQA 2X1IA 4PCNA 4X9SA 3CHDA 1XISA 1YNPA 2GSHA 2QS8A 4WKFA 2QDGA 3B0YA 3CUJA 2IW0A 2JFEX 3H8AA 4V15A 3NO3A 1DJXA 3PUDA 1GEHA 1JR1A 3T40A 2Y1HA 4NT0A 4E0CA 2OSWA 2ZZ5A 5I06A 4REQA 4EWJA 3QLLA 6XIAA 4IXXA 5F2IA 2PDNA 4ZE4A 4INFA 3TJXA 4NX0A 3TNOA 3GAKA 4HTYA 5I3FA 4EVZA 1B30A 3GC5A 3A13A 4IPJA 5G1YA 1VH7A 5A6SA 4QGCA 4BQ4A 1UR8A 4WSHA 4G56A 1EIXA 3A23A 2XHYA 3WFZA 3C6CA 1TA3B 4JTFA 4CUCA 2HSAA 3E0IA 2GUBA 3CZKA 2CXEA 4GD0A 1W9DM 4AXKA 1F3TA 3LY0A 4GISA 1TELA 3KP0A 4B16A 4WJXA 4H9UA 4LJ3A 1V6WA 4LRSA 3PZNA 4M5PA 5I79A 3CLMA 3XISA 1O94A 3C2RA 3N2XA 1QPRA 4ZOAA 5C6MA 4M81A 3B06A 4GY1A 1J0YA 2EPKX 2YX0A 2WZHA 2Z7KA 3SI9A 4NNCA 4CVWA 4B9ZA 4S3KA 1MUCA 4MLJA 2CZDA 3A22A 1CIUA 3BARA 5FEWA 4J2MA 1A50A 1FKXA 1HO4A 3G77A 1SO4A 4EXQA 3BCFA 4IL2A 3WQEA 3QHOA 1RPXA 4FS9A 4LALA 5HR7A 1YDNA 3MO4A 4QLKA 3UT0A 1E5JA 1AVAA 1W3TA 4V1YA 2YZ5A 4TVUA 4XBSA 1EJXC 4FX6M 4FZIA 1H5VA 2F61A 1JCJA 5LIKX 2HEJA 3TR2A 1HX0A 5I24A 4AC1X 1EIBA 1WA3A 2BY0A 3ABQA 4XIMA 1ITCA 3P8JA 2ASHA 2I16A 4GWEA 1JYXA 2V5KA 3RLVA 4CCCA 1VD6A 1I75A 4WJ8A 4LB3A 3RU6A 4I9JA 3CH9A 3K8KA 2QAFA 3QTGA 1I1WA 4UFLA 2ZUMA 4O18A 3LCGA 5HUPA 3PM6A 3K5XA 3N4EA 4PBFA 1ZBKA 1PKMA 2DSVA 4WQ6A 1G7UA 3PK7A 4GNJA 2Z28A 1B1YA 1XBVA 3KDNA 5CBBA 1R86A 2NQ9A 4DLFA 1SSGA 2X8RA 4MNLA 1NIUA 3GG8A 3ECQA 4IWWA 4PB4A 3ZT6A 4YTSA 4AZ7A 3EWUA 3Q58A 3GXMA 3VIIA 1PJ9A 4YYCA 5C0QA 5AFDA 1HJWA 3WK1A 1QK0A 5FD0A 3LLXA 1Q7ZA 5T9CE 2P3EA 1W5QA 3GNXA 1SSDA 4P61A 2NQ5A 3TLLA 1K8YA 2WMJA 3TC7A 1K6AA 1QASA 2BGSA 3LSBA 4N6FA 2XU2A 3ZSSA 1Q6RA 5ABGA 1R85A 2J62A 1MW3A 4RV3A 2QPUA 2RKXA 1E40A 2QYGA 2OLHA 3PWAA 8CGTA 1TJRA 3TZFA 4YMZA 5CSUA 3IGSA 2Y8UA 5IHSA 2FZBA 2CYGA 4TU1A 3NPUA 5U4NA 3W7OA 2QJHA 1OVDA 1EL3A 1QMLA 3OODA 4GO8A 3ZQ9A 1LZOA 3DHPA 3FVDA 3N6HA 5EMKA 3AS1A 3AWOA 3UU0A 5D4YA 1LL4A 1UBPC 1IE7C 2VX7A 1GTHA 4UTTC 3RRAA 1LL6A 2P76A 5CJ5A 4AD2A 2HNHA 1WAWA 1QNSA 3A4XA 1EFZA 1PBGA 1EB3A 5DT7A 4FF7A 2PWGA 2QJMA 3S2MA 4FR6A 2D2JA 1R38A 1X6LA 1SZNA 1VFLA 5BXTA 3S0CA 3KHJA 3UZYA 2R91A 3WD0A 4UR8A 1W0MA 1QI0A 4C1NB 5FESA 2CLLA 3CIWA 4CNOA 1I45A 3QXBA 5MKGB 1N82A 1QW7A 2WSKA 1EJSC 5FAJA 3F03K 3XINA 1V0NA 1WDWA 3CZLA 2QUTA 2G95A 2D0GA 3AAMA 1WOAA 3A9BA 3GU9A 3M5YA 1W2VA 2IPJA 3FVMA 3GLCA 4MVAA 3NUKA 4Q7BA 2CLMA 4WY0B 2YBTA 1TPH1 1W9PA 2YIHA 3H2NA 3UR2A 1V3KA 1FBAA 1YHTA 2SFPA 3FA4A 4GX8A 3A5FA 4NQ1A 3UWEA 4DI9A 4RK8A 4JTGA 3IIXA 3C0JA 3SDOA 1XR2A 3CHVA 1FWEC 4OT7A 3UJFA 2WMIA 1XJBA 4OE7A 2FTPA 4RNJA 4IIGA 3LI1A 1RSCA 1DE6A 2JE8A 2PRMA 1EJWC 3POCA 3SCNA 5KZMA 1AA1B 1PX3A 4WCJA 4CKQA 3ALFA 5T26A 4H4IA 4KRZA 4ATWA 5CEWA 4NJIA 1EXPA 1YDOA 4PH6A 1PEZA 1TWSA 3JVAA 2IKJA 3WLPA 5C55A 2AGKA 1K8CA 1QOXA 4EXAA 2HROA 3O63A 3GVVA 3H4XA 3H55A 1ONEA 2X0HA 1SZGA 1BPLB 3PBUA 4IH3A 4AY7A 2XINA 1NF0A 5A8GA 3MI2A 1E51A 3IACA 3QGVA 3WQFA 4DBWA 1MQQA 5TAOA 1JGMA 3NPWA 1XRVA 4C5ZA 4AWSA 1OT1A 2GPTA 1PZ3A 4WD0A 3S9IA 1WUFA 5CPLA 2VEKA 1W32A 3M0XA 3AMLA 3U2OA 1I60A 1TREA 1TPUA 3NGFA 1NJJA 4R7WA 3IJ9A 3WYZA 1LT8A 5TNVA 4Q8MA 4DO4A 3T2QA 3MWAA 1V51A 4MJ4A 5F2MA 4K8GA 3NXLA 1CCWB 3MKKA 3T42A 3H6OA 2PE4A 4A3UA 1C3FA 3CQ0A 3DBNA 3PG9A 2A21A 5A6LA 1QR7A 1S38A 4WKAA 3WH7A 4XD5A 1WKYA 2VENA 1BGGA 1V3HA 1VFMA 3OLIA 3TA6A 1FFRA 4YTRA 1MW0A 1S2WA 4W7UA 1NH6A 4QM1A 4FIQA 1GHSA 1UR4A 2VZSA 1T40A 1K1DA 2XN2A 2EBNA 1DHPA 1DWJM 3HG4A 1TUFA 3LDVA 1KTNA 5A8NA 2EPHA 2B7NA 3TWAA 3ABZA 3M47A 3CT7A 3FHAA 2VTFA 1PCKA 1WKFA 2WJEA 3SQMA 4QHRA 4DXKA 4AH7A 4UB9A 1UKOA 3U4AA 1XSIA 3SW6A 4WSJA 1M7XA 4WSKA 5H8MA 2XM2A 1H50A 1QPKA 4H6QA 2ACRA 2YCJA 2NZLA 1R9XA 4MIMA 5AOUA 3FLUA 3R8GA 4IP5A 1DXIA 1XYFA 4IOTA 1JGIA 5M3WA 4RXFA 3OO2A 1FP9A 2WM1A 2FHCA 3E49A 4MB5A 1LG1A 3C0LA 2QIWA 4J3UA 3GO2A 3OVQA 4J3TA 1FDJA 4D9PA 1FWGC 4XQ6A 2C18A 1NQKA 3O6AA 5ECVA 1OK4A 2HPMA 1UD8A 4S2BA 3LXCA 3W4RA 4MWAB 1DXFA 3M46A 3QRHA 1BYDA 2RGMA 4FNUA 3W9ZA 3WLMA 3FFSA 5HDRA 3L5LA 2VMFA 4UCGA 3U2CA 3NQGA 3H2OA 2OGYA 3S1WA 2CEQA 3WNLA 2J13A 3RFAA 5CAKA 1ICPA 3OGVA 4A35A 1F74A 2NX1A 1OFOA 4GZEA 1ME8A 4YWSA 2Y5SA 3LTSA 4RKAA 5CLTA 5K9DA 5TQLA 1PZ2A 1JPMA 2J78A 1I0DA 3IV8A 5CSRA 7ENLA 1V93A 1QVBA 3MT1A 2D24A 1V0LA 2O9RA 5D9NA 2ZX6A 3UR5A 2OEMA 1XLFA 3E2QA 5I3GA 3AXKA 1C7TA 3VILA 3NQMA 1K03A 3T8LA 1YMYA 4NY2A 1YTKA 4I90A 3AHVA 3R79A 4DBEA 4B5NA 2J88A 3BGJA 2PBOA 3UG3A 2HISA 3SJ3A 3LXBA 2R14A 4RLIA 3TAOA 3BLPX 1DWGM 3DIPA 1E0TA 4Z1DA 3BVJA 3RO6A 5PTDA 1RVGA 1XLMA 4QXIA 1LJYA 5LNVA 1R87A 4XAPA 1H7OA 3OHIA 3NSMA 3CAVA 1BWLA 5TD4A 3PY2A 4F0MA 4NZ4A 3VO0A 3VGGA 5D37A 3T81A 5FACA 5FIPA 1EEXA 4C6OA 3CL6A 1VAHA 2WHKA 2DT3A 3MUAA 2WKLA 1JPIA 2NSXA 3C61A 3UXIA 2VGGA 4I8YA 5E5CA 3VK5A 4PMZA 4HMNA 5HJYA 3DGBA 3CNYA 2CPUA 3W7DA 3QTPA 4GABA 3K4DA 3L12A 4PUNA 5I3DA 4GVIA 4GXWA 4RV8A 1KM6A 3E9AA 3WCZA 1YE6A 3MBFA 1MFUA 1DWIM 4L1XA 3BW2A 3VGEA 1PWMA 3LCXA 1FDYA 1KR1A 3H2CA 5LHEA 1GVOA 3K30A 1WUEA 2QF7A 1HKIA 3FSUA 5BXSA 3KTCA 3HGJA 3CTTA 5REQA 3BG5A 2OLAA 2XFRA 1OCJA 1IT8A 1TZ7A 1P6WA 1VR6A 1RHCA 4LX4A 4H3DA 4AEFA 1K8XA 2NQJA 4F0KA 3SCOA 3N11A 2PLKA 1EBGA 4AU0A 5AZ1A 1AJZA 4L6DA 1XD1A 3GDKA 3NZRA 1JD7A 5EU9A 3NQ7A 1ADOA 2YCKX 2ZUNA 3VKBA 1KWKA 2XN0A 4AFYA 1E9IA 3SCQA 3MJMA 3DC8A 5I00A 3AHYA 2NV1A 4UQDA 3WK3A 3MCOA 3D46A 1M7JA 4DXXA 3APYA 2CBUA 3GNPA 2DSUA 5CH9A 3CBWA 2E1WA 1KM1A 1KV8A 2A85A 4JN7A 1EGMA 5LIXX 2HDJA 1Q8JA 3ZIZA 4RZ6A 3HM7A 4QCFA 2VWTA 3PBVA 4J35A 4ROPA 2DSZA 3PG8A 2I1OA 4RX0A 7REQA 1CWYA 2J25A 5D2VA 5FJOA 3MHFA 1YXDA 4XD4A 3AICA 4FO4A 3B9AA 1KBLA 3HMCA 3MO7A 2VDGA 4HVXA 1MMFA 2CBIA 2V5DA 3W25A 2E28A 3T09A 1LQ2A 1KM5A 2XVPA 9RUBA 1EOKA 1C9WA 1CXKA 4KCTA 4L56A 3L0GA 3L23A 3NQDA 4P2VA 1RVKA 5BRBA 4IJCA 9XIMA 7CGTA 3SIMA 3H2EA 3PSVA 1QCWA 3WDIA 2DZVA 3KOWA 3G3MA 5LNRA 2H9AA 4AQLA 1GYNA 4GY0A 4AIBA 4C6EA 1PYFA 1OG6A 4B5TA 1KFKA 2G3MA 1A5OC 1Q4WA 3KL3A 1G4PA 3OW1A 3GXTA 4PE8A 3I4KA 4WK9A 2XVLA 3QR0A 3FN9A 3TWBA 4IPLA 3NR0A 4G7EB 3D3AA 1NWTA 4BF9A 5AC8A 2PDGA 3ZLHA 1N8WA 4DAFA 1OFDA 1GWJA 1D7FA 1A5AA 3P82A 1LBLA 3E6EA 3ZJ8A 1CEOA 2QF8A 4OZOA 3IVSA 1W9BM 2D22A 1XS2A 3MDUA 3AFBA 5G2IA 4YHEA 2VJXA 1BF6A 2GVLA 5A69A 3WUFA 3STPA 1I2PA 1Q5MA 4FLOA 3H23A 1ZHAA 4L4LA 3FEQA 3OBEA 4Q8OA 4FEZA 1G67A 4LXFA 2GJNA 4LAKA 2DDXA 2GDVA 4CLMA 2VRJA 1I2QA 1A80A 3S1XA 3VOCA 4Z42C 3EWBX 3AYRA 2EPLX 3CHFA 1IEXA 1M01A 2X1RA 3C2OA 4BY3A 1DORA 1M6JA 2YDRA 3CQHA 3MUIA 1YTEA 3N2CA 4A22A 2AQOA 1TV3A 2CERA 2WVVA 1MWOA 3W07A 1PTGA 4UNLA 2E5CA 3BV4A 3W2MA 5CJNA 1ECEA 1VJZA 1VC4A 1ESWA 3BWWA 4CCZA 2E9LA 1HXJA 4JN8A 4Y9NA 4FNRA 1XCXA 3MWCA 1ONWA 3AC0A 2QCMA 3EOSA 3SUSA 3IJ7A 1ADDA 2E6YA 3W7MA 1VFFA 2B0MA 4B15A 2I14A 2OYKA 1KXQA 1M65A 1ONRA 3NTYA 2J6XA 3T78A 4R7OA 2B81A 1VCVA 1YLVA 1SR9A 1XGDA 3WLNA 3WEMA 2QVNA 2H3DA 1UJQA 3U9IA 2OQHA 2F6KA 2CHOA 1HJQA 3FYPA 2E0PA 2ICSA 2W91A 4PRTA 1XC4A 2YCEA 4NILA 3VOIA 5GNYA 3DFPA 3LB0A 4NZ3A 4B91A 3GR4A 4HNVA 3KCJA 2DT1A 1M9HA 4YS1A 3CQIA 2KZHA 1E1CA 3KZPA 1EJRC 4MG4A 3PWGA 3WY1A 1R7AA 3A3HA 3KS5A 3E74A 1AMYA 3WQWA 3M0MA 4YTTA 1KFWA 2A6LA 1KRMA 4H00A 1CGWA 5D05A 2WKJA 1EEPA 1GKQA 1GOMA 3KDOA 1EX1A 1XIGA 1OFAA 3OYXA 3H70A 4OOZA 1UPMB 1IGSA 4C6PA 1UD6A 3BOLA 1TA3A 4DB7A 3A24A 2Q71A 4JTSA 1W1IE 2GOUA 8RUCA 2ZXAA 2WMIB 3WD2A 2JGQA 1T8XA 2A3LA 1DBTA 2CLOA 4QTGA 3MMWA 4LH8A 2Z7GA 3T2PA 5L6UA 4LRTA 2HXTA 2VR5A 5BXRA 4RL3A 5FI8A 2ZUUA 1SW3A 3GHTA 1GG0A 4AEOA 1J6OA 3FEMA 2J24A 5HOSA 2PDIA 3OP2A 3PFRA 3WLHA 4FX7A 2OG9A 5F2GA 1W9UA 2B7PA 1W6TA 2CZVA 3K1DA 4WOZA 1I6NA 5HQMA 3GC4A 3IS4A 3PBMA 4E3TA 2NLIA 1Q7QA 4FNQA 2FFIA 4F0HA 3UESA 1IR2A 2DH3A 3TH6A 3FXYA 1AH3A 4LYPA 3KBWA 1UZ1A 2XSAA 3P61A 2XH4A 1Y65A 4QJ3B 1ZBVA 4ACZB 5DX7A 2YLAA 4DHGA 2RJGA 5M03A 3N12A 1AW5A 3N73A 4TVDA 4E4FA 3R89A 4HNOA 3SEPA 3L66A 1W3JA 3QH2A 1D3GA 1UMLA 4AZIA 1QOQA 2HQAA 3V3WA 4IIHA 1XLJA 3KRUA 5L9FA 2V8ZA 3EXRA 5GJMA 3VINA 4LBSA 4US5D 4C6FA 5D2YA 1ZENA 1OX6A 3AJ7A 1J93A 2TYSA 1O4UA 4J3SA 3PFMA 2AOSA 4A21A 4R9OA 4LGXA 1FKWA 2DIJA 3P7YA 3N3TA 2VUYA 1L6FA 4L64A 2A4AA 4NVTA 4F66A 3C3NA 2X0SA 3TP4A 2YYUA 2QJIA 5BU9A 1VJSA 1EC8A 5FF2A 2GOKA 3TQPA 1LCOA 2XUCA 2POTA 4KFNA 1GVIA 3WK0A 1EWEA 2V82A 2OEKA 5FJPA 1ZJIA 1NARA 2Q3OA 4B5WA 1FXQA 2J7HA 1B2YA 3I7QA 3MV01 1QRQA 3C5QA 3WUGA 3ARZA 1SO6A 3UGVA 4J2PA 3WF1A 2J7DA 5HULA 3SCRA 3N29A 3SN0A 4PMJA 1WP6A 2C13A 3WQVA 3NG3A 3PPCA 3ZVHB 3NQ6A 1QJWA 4IGHA 5F4SA 4BHYA 1EPXA 4IUOA 3R8HA 1QI4A 1AQFA 3VDBA 1XIBA 4LUYA 3STFA 1Z6KA 3TYBA 2PRLA 2VEPA 3ARWA 3GVQA 2I5QA 2FGZA 1HGWA 4HA3A 3LPPA 3QY8A 5CG0A 3K8LA 1W5OA 1PIIA 3G0XA 4GC3A 3TYDA 2VURA 3TCEA 4BK9A 3GU1A 4FX8A 3LX9A 3FKKA 4JYEA 2OZ0A 3WQ8A 1JNDA 4NU7A 5I3IA 3TXZA 3SFWA 4Q7IA 3W1RA 4AIUA 2XN1A 2V63A 2GJXB 2PGFA 4O28A 4ZL1A 1P0DA 3LU2A 1XP3A 1XINA 3A21A 1GT8A 1PV8A 4AAJA 1OC5A 5DY2A 2ZX8A 1SM9A 2X42A 1E6XM 4JGDA 1KA9F 2NT0A 1U33A 3G1VA 4KWSA 1US3A 1R3RA 2QHAA 5AC7A 5LGZA 4JD4A 3AU2A 1DPMA 4N0RA 1EQPA 1XQLA 2GZXA 3QLDA 3ZMRA 3HGRA 3OQ8A 3WBAA 5E6YA 4DJED 1FCQA 3L4VA 4BKNA 4HCHA 3THAA 1M7PA 5HNUA 4LUTA 3CWNA 4JTDA 4L61A 5F7UA 3TR9A 2YB1A 1PUDA 3ZFHA 4O0QA 4O1BA 3FKRA 4LANA 1TRDA 3KVMA 1Y5WA 3L0KA 2FGBA 4FIRA 1UR1A 3COTA 1F61A 3L4WA 4AY8A 1KQYA 1J01A 3SRHA 1N55A 3HN3A 1I2NA 1EC7A 1AZ2A 4DZ5A 1QNPA 2YA0A 5JUVA 3BURA 2E4TA 3B0XA 3C0QA 1YXYA 3SCSA 2VFIA 1HG3A 1NTHA 4AYSA 3TQVA 1H7XA 2VVNA 5I07A 1RP8A 3LHYA 2JEQA 4CN4A 2PCQA 3IV3A 2BZNA 3CZ8A 2YYTA 1KNWA 7ODCA 4IP4A 5D9OA 3W6YA 1NFBA 5DT5A 3AQUA 3K4WA 1JJKA 6TAAA 3AJXA 1Z48A 3FJ4A 4NAFB 3LPGA 3WJSA 3DERA 4GMEA 4DZAA 4HOXA