4DBUA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 3-((4 -(trifluoromethyl)phenyl)amino)benzoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Crystal structures of AKR1C3 containing an N-(aryl)amino-benzoate inhibitor and a bifunctional AKR1C3 inhibitor and androgen receptor antagonist. Therapeutic leads for castrate resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbuA00
4GA8A 3LEPA 3LN3A 5C7HA 3Q65A 4DBWA 2INZA 1T40A 1S1PA 1EKOA 3ONCA 1XGDA 3RX3A 3O3RA 5M2FX 2HVNA 4LAZA 3V0SA 2WZMA 2IKJA 4QR6A 4YVVA 2IPJA 4FZIA 1YNQA 4Q7BA 4H8NA 4WRHA 1AZ2A 3MB9A 2PDIA 4JQ2A 4JQAA 2F38A 2ACQA 2IKHA 3M0IA 2PF8A 3BV7A 3VXGA 3U2CA 5JH1A 4XO6A 5AZ1A 1S1RA 1AH4A 4XAPA 2VDGA 4PRRA 2PDFA 3CAQA 4XZLX 2C91A 4I5XA 3GHSA 2CLPA 3LD5A 2PDJA 2NVCA 1AZ1A 4JQ4A 3COTA 2ACUA 4LAUA 2IS7A 2I16A 3GHUA 1MRQA 2R24A 1UR3M 1HQTA 4XZIA 2PDXA 4WDTA 3LENA 2A79A 3KRBA 2PDMA 1X96A 2FZDA 1K8CA 1RY8A 3UZYA 3QKZA 1T41A 4GQGA 1EXBA 1RALA 1LQAA 4LB3A 3UZXA 1Q5MA 2PEVA 1C9WA 4HMNA 4JTCA 1JEZA 4WDWA 5LIYX 4PUWA 3M4HA 4JTQA 4JIRA 3ONBA 4FALA 2IKIA 1HW6A 3NTYA 3UG8A 2HVOA 2FZBA 3R8HA 4IGSA 3N6QA 3FX4A 3S3GA 2PDWA 3CV7A 3CV6A 1LWIA 3H7UA 4LB4A 3V0TA 3UZWA 2IPFA 4HBKA 2FZ9A 1IEIA 1FRBA 2IPWA 4XK2A 4XVDA 5JH2A 5HA7A 4YS1A 1ADSA 1PWLA 2IQDA 2PDPA 2HV5A 2FGBA 1SM9A 4LBRA 2PDYA 3R94A 3WCZA 3EB4A 3WG6A 3H7RA 3WBYA 3WBXA 3B3DA 4GACA 3RX2A 2PDUA 3V36A 5HNUA 3LZ5A 3EAUA 2PDNA 3GUGA 2HE8A 2DUXA 3BUVA 2HDJA 1EL3A 4H7CA 1EF3A 4JQ1A 2R9RA 4DBSA 4EXBA 4YVPA 4NKCA 3BCJA 1AFSA 4XZMX 3R7MA 2J8TA 3BURA 1X98A 2WZTA 5HNTA 2IKGA 3UWEA 3V35A 1PZ1A 4LBSA 4FA3A 4G5DA 4PMJA 5LIWX 3T42A 4XZNX 4YU1A 4MHBA 2PDHA 4GCAA 3R58A 1US0A 2PDCA 2P5NA 4PRTA 1XF0A 1S2AA 3UYIA 1M9HA 4QX4A 3UGRA 4ZFCA 4Q3MA 3R43A 3O0KA 4R9OA 3F7JA 3D3FA 3LQLA 4QBXA 4L1WA 2PDBA 1OG6A 3MC5A 2ACSA 2QXWA 3GHRA 4GIEA 4YVXA 4IJRA 1J96A 4EXAA 2ACRA 1RY0A 4WDXA 2NVDA 4XO7A 1QWKA 4FAMA 4WDUA 4WEVX 3WBWA 1Z89A 2PDGA 1XJBA 2ISFA 3RX4A 3LBOA 3M64A 2DUZA 1A80A 4RPQA 2HEJA 2PD5A 2DV0A 3N2TA 3R6IA 1Z3NA 3R8GA 2FZ8A 1R38A 4XZHA 2FVLA 4JQ3A 1ZSXA 2AGTA 3CAVA 1YNPA 1X97A 3H4GA 1QRQA 4F40A 1PWMA 1VP5A 2BP1A 1AH3A 3LZ3A 2PDLA 3LNMA 3UP8A 4JTRA 3DOPA 2ALRA 2PD9A 2PDQA 1YE6A 4PR4A 1ZGDA 1MI3A 5AZ0A 3P2VA 3UFYA 2IQ0A 4JTDA 2PZNA 3CASA 2HE5A 5KETA 2INEA 4ICCX 2IPGA 3C3UA 3Q67A 4XVEA 4QXIA 4AUBA 5LIXX 1PZ0A 4JIHA 4JIIX 1GVEA 1VBJA 4JTAA 5LIKX 1Q13A 2BGQA 2F2KA 3DN5A 4ASTA 3V0UA 3FJNA 1YE4A 2BGSA 3G5EA 1Z8AA 3G1RA 4PUUA 1ZQ5A 1ZUAX 4OTKA 4L1XA 2PFHA 3ERPA 2PDKA 4DZ5A 1IHIA 4GQ0A 4GABA 3UZZA 3GHTA 3LQGA 3EB3A 4DBUA 3LUTA 1AH0A 2I17A 1S2CA 4WGHA 1MZRA 5LIUX 5DANA 1Z9AA 4IJCA 3CMFA 1PYFA
chains in the Genus database with same CATH superfamily
1PIGA 4JTEA 4R53A 3Q65A 4MWAD 5CPTA 5EY5A 1L8PA 1RA5A 1XLGA 5ABTA 2VVNA 3NR0A 4DB7A 2WNQA 3IJ9A 3TONA 3QV9A 4KEZA 1OG0A 5FEPA 2E9LA 1AJ2A 3A64A 1XCFA 2OQLA 1TUXA 1DHPA 4JX4A 4LF1A 3AHVA 4W86A 3NZQA 4WXZA 4WRHA 1Y5WA 3LHTA 3IJ7A 5I24A 4ONVA 4D6CA 3V4BA 3S8HA 3HN3A 1QPQA 2FVKA 5EMLA 2NZLA 1S2TA 1TVLA 1HUVA 4JQAA 4V15A 3J7HA 1ADDA 2G50A 1PHQA 3VKBA 3BDKA 3H23A 3OBKA 3STEA 3VOFA 3F4VA 4Q4MA 3ZVHA 3H21A 4BY3A 4CNTA 1AQHA 1K6WA 3VTRA 4B9ZA 1E73M 5GJNA 1GCYA 1FH7A 3KEHA 2OFJA 4GXPA 1BG4A 1TJ1A 4PMDA 2WCAA 1JZ3A 4GFSA 3NO1A 1C8VA 1K77A 4F0KA 3FAWA 3TU9A 2HS8A 3W2NA 1V02A 4GPNA 4E3TA 4Q4KA 1W1ZA 6ALDA 1C8YA 2IS7A 5HBFA 2E25A 1J18A 1PKLA 3SBFA 1CNVA 2RGMA 2V2DA 5EMJA 1Q4WA 4OUEA 5JVLA 3TP4A 5T26A 4KRUA 3C6CA 1F6YA 1E6PA 1AL7A 3KRBA 1K8CA 4DXVA 3W2UA 1Q66A 3MJYA 4NAEA 4HPNA 1VD6A 4YTRA 5F1UA 4O8AA 3RNDA 2GFTA 3ICJA 1A5OC 1JZ7A 3QOMA 1OYAA 1XIGA 2DPEA 3GKAA 4UFMA 5AECA 3ONBA 1MZHA 4FALA 2A6LA 2XSAA 1F7BA 3EMQA 3M07A 1TTJA 2G3MA 4U33A 2VGGA 1JZ6A 1A0DA 4O0KA 3U2OA 4DBEA 4E2VA 4QHRA 5J04A 2DU2A 4AG0A 3ITGA 3M0YA 5E70A 2IPWA 4MFEA 3KLLA 3ZOAA 1W1IE 4M6UA 1T7LA 1TZ9A 5AHLA 4DAFA 1F61A 4UTMA 3LM3A 3EX4A 3MP4A 2BASA 4UFHA 1DIEA 3WBXA 1QNSA 3WFAA 4BF7A 1CB7B 1L2UA 2Y62A 1ZLPA 1VFTA 4WVXA 2VR5A 2YDQA 4QFUA 3BUVA 2QCGA 4J3XA 3OOQA 2J13A 3D46A 5H6HA 4I6VA 1A5LC 4U10A 4RDVA 2XVKA 2XJ7A 4K1WA 4I9AA 2GJNA 4PMJA 3AIWA 4WCJA 4IPJA 3POCA 1OC6A 2DH2A 3UWQA 1US0A 1DQUA 2BS9A 3E0IA 1JYVA 2YJQA 2HMCA 3HG2A 4LTSA 1XV8A 5FAGA 3RU8X 1EZ2A 2ZC1A 3PP7A 4ZZ9A 1YQ2A 4ZFCA 4HTBA 1REQA 1FH9A 3T44A 1EBGA 2PAJA 4B16A 3ZIZA 2R1LA 3QTGA 1TJ2A 5A8OA 3RCYA 2Q8XA 2VEIA 3CWNA 5LNVA 1GOMA 3UERA 4R5EA 2W62A 1S39A 4UTUA 4UQBA 4HK5A 1CYGA 1VJIA 2WPGA 4MNKA 4HCLA 3VGGA 1XIMA 3M0MA 1UA3A 1PTGA 3EX2A 4DN1A 3PN8A 2HEJA 3QHOA 3CL8A 3DX5A 3QW4B 4RZ5A 3VNJA 4C6NA 3B9OA 4NYYA 4HNOA 1YNPA 3AHYA 2FDMA 1R3SA 4HNVA 4ADUA 2YCEA 4AW7A 4GNVA 1HO4A 3WD4A 2PDLA 3NQCA 1F3WA 1D3CA 3WD0A 1YE6A 3ABRA 2R1PA 1EWDA 3TNBA 4X2PA 4XAYA 4FI4A 3D3AA 3W7LA 1SZEA 3B8IA 3VIOA 5G1YA 3THQA 4QTGA 2WQDA 4DUXA 2HE5A 4F79A 1KB3A 4LW7A 4C60A 3EOEA 4J3WA 1E0UA 4IHCA 4QNEA 2ZX9A 1PX4A 4PL2A 2CW6A 3CL6A 2EPLX 4PB5A 2Y88A 3KCOA 1TR1A 4IM4A 4O4VA 2NX3A 2Q02A 1TO3A 4MAVA 5LIKX 2BVDA 1QI4A 1KD0A 3IGXA 1R9XA 3VFLA 4QS6A 3A21A 3W22A 2QPXA 1M5WA 3WLOA 5AC7A 4YHGA 2PDKA 1XSIA 1TCMA 1UKOA 3ENLA 1YPXA 4X60A 1OB0A 2I17A 2XINA 1GJPA 4L4PA 3FJ4A 4JR5A 1MFVA 5LNWA 1KBBA 2CU0A 1JCLA 1A47A 2VEFA 4J9JA 4QRNA 5G4HC 3PBMA 2QGHA 4JN8A 2XVGA 1XW8A 1W1VA 4M8UA 3MQTA 4N6EA 1TVPA 3SY5A 2HXTA 2XH0A 2OMAA 4CNUA 3D6NA 4ZGYA 3C56A 3L5AA 2ZX5A 1XLJA 3NPVA 1BVWA 1XCWA 3V0SA 3W83A 4LRTA 4O54A 3ABOA 2PRLA 2O7QA 1XPYA 3IJ8A 1QR7A 3L2IA 3W28A 3BCDA 3UBPC 3KL5A 1FUYA 3GTNA 5CLWA 3OA5A 3U7BA 4C7GA 3VDCA 4G2DA 5IFPA 1SW0A 2Y63A 3BXWA 5I3IA 3BMXA 3U2EA 3W7DA 1JF5A 2YOCA 3C0LA 3WQ8A 1UR9A 1V6WA 5CKSA 5BRPA 1JQVA 4GQQA 1BWKA 3W25A 4ZENA 5FJOA 1G1YA 4Q7IA 1VRDA 1TRIA 3MO7A 1TV8A 3CAQA 4NJIA 1GVIA 3SCPA 1OIMA 3GM8A 1DXFA 3CU2A 1PDYA 3K30A 2OZ3A 1SW3A 1ZBCA 2J4GA 4WOQA 4GI8A 4US5D 5BOOA 5F2IA 3PZMA 2OT0A 4MDOA 2JF6A 1ZALA 2ICSA 4O11A 3THUA 1FCQA 1Q6EA 1EH9A 3N2OA 3IGUA 3L5MA 3AS1A 2AL2A 4H8VA 5CC3A 2CFFA 3KM8A 4LYPA 3MMDA 1HGWA 4JTFA 3M16A 1WX0A 5B7YA 1BGGA 3QSTA 1ONXA 4JOMA 1R3QA 2GGHA 1C90A 1LUCA 1AW2A 4JTQA 2Q6ZA 3WLNA 4CD7A 3OPSA 2O55A 4RUBA 3EMZA 3W85A 2C8NA 3DBPA 3PWAA 1U1UA 2V6AA 3QTPA 4E38A 4JDYA 2G0WA 4HPJA 4AZ6A 1H5VA 2VTFA 2TAAA 5HATA 4AMCA 5HUPA 3NQ6A 4LUJA 2BVWA 3RLUA 5IM51 3N6QA 4QM1A 3GE7A 1BXNA 2GQ3A 3IIOA 3WKZA 2EF9A 1KRMA 1QBBA 1FHDA 4LB4A 3R12A 2X40A 3O7UA 2XGBA 3S6TA 4A8IA 2Z4GA 4DPQA 3W29A 1HZYA 2HROA 1FWRA 2PWUA 3WIJA 3BJSA 2AKZA 2RFGA 5A8QA 3GXTA 1SM9A 3T4CA 1X6NA 4JFSA 4LBRA 3VGEA 2IXVA 3R94A 5BU9A 1CIUA 4E8CA 4JTTA 3JR2A 3AALA 4RNJA 3SI9A 3GU9A 2DT1A 2YBTA 1TV5A 1E6XM 3W71A 2Y7FA 2HDJA 1EL3A 5DMYA 3CUXA 4GNKB 4ORIA 4W9TA 1E4IA 3L4VA 3WLIA 1DVJA 1ZJBA 3O16A 4PCTA 3UA4A 2IKGA 4LYQA 3VVGA 1F6KA 3NQ7A 1REQB 4NZ5A 4LBUA 3UPBA 3W7NA 3VOIA 1IEQA 4Y8EA 5REQB 2PB1A 4QAIA 4FF5A 1R3TA 4F8XA 1CBGA 1TWIA 3N9KA 3N2XA 3TE9A 4D6JA 2P5NA 4L6HA 3CV2A 2RJGA 3FA4A 1MWOA 1FCUA 1XRFA 4KF1A 3LCWA 2NUXA 2XFFA 2RH9A 3ARTA 4AQLA 4P7NA 3MWAA 4A05A 2ZBTA 1OG6A 2O56A 4NF7A 4XKYA 3SCRA 3B8UA 2VX5A 1S5TA 2FMNA 4RW5A 3VGBA 2ZXQA 1HVQA 2BODX 3G8RA 3VIFA 4K8EA 3NSXA 1QW8A 3UY8A 5GNYA 3TZNA 1JYXA 4C90A 1UR0A 3WQ5A 1WQ5A 3LBOA 4L4OA 4JDBA 3M6YA 4MIMA 3SFKA 4AVFA 3DFOA 2FTWA 3S83A 1GORA 4JHMA 3GR8A 1NQKA 3SN1A 3WH6A 1H2JA 3D47A 1YX1A 3BW2A 4EXQA 3WF0A 1RQBA 4IP4A 1B9ZA 3VUPA 4DPPA 1XLCA 2CLMA 4F40A 2ISDA 1LCOA 4A6GA 1GJUA 1XLAA 3N4EA 1YXCA 4KESA 2WANA 3DHDA 5FEWA 1MO0A 2BDQA 3C2VA 3ITVA 4ZXLA 1BAGA 2V5CA 3RG6A 4PB3A 4M0XA 1TTPA 3UFYA 3UJRA 2W63A 2LLEA 3GVQA 5FOOA 3A22A 3W74A 2DZSA 3H2OA 2WVVA 3DECA 1ZJHA 4OV9A 1OFEA 3LCHA 1XRSA 3W0KA 3VKKA 4EAYA 4XWUA 3DXIA 1FX6A 1TA3A 2V3GA 3IS4A 2JKPA 3CUZA 3BSMA 2D22A 4Y90A 4C7FA 9XIMA 4OJYA 4X2RA 1XH1A 2G8ZA 3WLPA 4PUUA 4QNWA 4AB4A 1QU4A 1IR1A 1A3WA 3RMJA 1UW9A 2BLEA 2XVPA 1L6FA 3EX1A 5E93A 3PPFA 3HQPA 4WQ6A 1JD7A 1F05A 5DT7A 1H7WA 1NEYA 3A4AA 3WK2A 3DDMA 1YTDA 2JKEA 2QJHA 5HR7A 4O0QA 3CMFA 3SECA 3W00A 3CZLA 3LN3A 5C7HA 2E5BA 4B5NA 3L12A 2MANA 6ENLA 3CO8A 3ZVIA 3W2MA 4JFVA 1DXEA 2X8RA 3UXIA 3STCA 2C1GA 4TO8A 3EWYA 4IMFA 1RK5A 3VA8A 3H2NA 1DTUA 3S2JA 4ZQCA 1BHGA 3WELA 1W5OA 2HTMA 4BI7A 2ISSA 3TN3A 5CPMA 4B5UA 3WJWA 2FH8A 5BRQA 3LTYA 3F4CA 2WXDM 3W1PA 2X0YA 3GDTA 4GUJA 1GPWA 3OYZA 1B9BA 4CU8A 5E09A 4LUIA 4MPQA 5JH1A 4AH7A 2VWTA 2TMDA 3H24A 4UTHA 4XO6A 1ZP4A 3OYXA 3KHDA 1E71M 4RPPA 1V3JA 1I0BA 1SJCA 3T55A 3LV5A 3CZ8A 2QCDA 2YBVA 3JZEA 1XWYA 2OOGA 1BYCA 3UVAA 3PBYA 2DDXA 2CIPA 1GVSA 4KGLA 1F6PA 3I4KA 3UXAA 2FJKA 2PDJA 4R3UA 2X7VA 3M41A 4WUIA 3COTA 3N73A 2CLKA 3P3BA 2RDUA 2J75A 4F0HA 4JEJA 3U5YA 2Y70A 1SPQA 4UTWC 5D2VA 4TTUA 2NX9A 4JFUA 1XXXA 3RLHA 3PPHA 5C5YA 1U1HA 4JHZA 3TXZA 3KRZA 5B80A 1XIHA 1SZNA 4WDTA 4EPDC 1SVDA 4G7FA 2A79A 1LUCB 2VOTA 3WLTA 1GZJA 3RUBL 1JJKA 1EZWA 4RR4A 1V8EA 1U83A 3LLFA 4JY9A 4JXCA 2WO5A 1DJYA 1BYDA 1S38A 3BL3A 3RMEA 3BCFA 1JDAA 1CDGA 3LRMA 1KM2A 3DFNA 1CPUA 1XQLA 1A3HA 4CCCA 3SQSA 3O06A 3VKDA 1CW2A 3NTYA 1U2YA 4MLRA 3GYCA 2GYIA 2OB3A 5BWFA 1E5NA 5AHEA 5HWMA 3VD9A 4W5ZA 3FX4A 3VPLA 4LGXA 3DC0A 1OINA 4JX5A 2HISA 3BG9A 3N9RA 3VZXA 3MI6A 3W1UA 4H9ZA 3GAKA 1FDZA 1FDYA 2NT0A 1OEPA 3NVTA 3WNKA 3EXRA 5D33A 5CJ5A 1S2WA 4D6EA 2IQDA 4LC6A 1C8QA 5EB8A 1TV7A 2JALA 1ME7A 3DGBA 4XUYA 4HOXA 2I7GA 1UP3A 4EVZA 1BKSA 3DFTA 4DM1A 1UZDA 5XIMA 3QGAC 3UR5A 3LTPA 3OB8A 4JQ1A 5A8NA 4PFHA 5FAJA 4NKCA 3R7MA 2GJPA 4IQLA 3SIZA 3N04A 4DEFA 5LA0A 3TSBA 3AQUA 2JEQA 5FACA 5I78A 4OOUA 4E5TA 1FWNA 1NARA 4YXGA 5I0DA 2NQ9A 2CLIA 2AOSA 4BQ4A 2BZNA 2CWXA 1E55A 1YDNA 2GSEA 1EIXA 3N19B 2ZXDA 4UTFA 4I8YA 4JTJA 2ABAA 3ZJKA 2INFA 3UGRA 3AJ7A 4P7LA 3R43A 3F7JA 1ISWA 4MZ8A 4PE8A 1UWTA 1E4NA 2EPOA 1KXQA 3M6DA 1K70A 1GTHA 3GHRA 4GIEA 3O6DA 1DWAM 4IQJA 2CZEA 1SSGA 2ZX8A 3TVAA 2VX6A 3AMLA 1LZOA 3GVVA 4PMRA 4Y2WA 2Q71A 3JUGA 5C71A 3T7VA 2OU4A 4DZAA 1C3FA 3FJLA 4M56A 1GQLA 1IXNA 1FH8A 1CGWA 3GH5A 2VJXA 1FWAC 3MA8A 1X8FA 3B8DA 3TMQA 3C4UA 2DZBA 3VI2A 1Z3NA 1V6TA 3K4AA 3DESA 3PUEA 3TJ4A 4K3ZA 1KW1A 3E5PA 2CZFA 1F3EA 1OCJA 7XIMA 3ANYA 1YIXA 1X8CA 2VENA 2WVVB 1H7NA 3S47A 3W23A 3AIRA 4QQ3A 3L4WA 1NDWA 4ZTXA 3A5VA 4Z2LA 5EL1A 1KO0A 2FZNA 1NFPA 2YZ5A 4G6CA 3TR2A 2HZGA 3CHCA 1H7XA 4IXXA 2UY3A 1EEXA 3T2OA 4DF1A 4NAFA 3QY6A 5BWAA 4QG9A 3SADA 4U3CA 5LIXX 1PZ0A 5CZSA 1B1YA 2BXZA 4A8LA 1WXJA 4OT7A 3GH7A 1JAEA 1ELSA 4ZB0A 4A3HA 3GIPA 1PCWA 3WMSA 4Y9PA 1DYSA 6TAAA 4N6FA 4UTJA 3G5EA 1BTMA 3R0UA 1V6UA 3VIGA 1EO7A 4IQEA 2PA6A 2YCIX 3E96A 1G5AA 2ZRYA 1MVYA 5CPOA 3NA8A 1AJZA 2ZUTA 4IIBA 1OFOA 2A85A 3TYBA 3P74A 2E0PA 5BRBA 3GAYA 2B81A 1JYNA 4C6BA 2PWGA 2J7EA 3GNRA 1P7TB 2X1TA 1E0XA 1E6RA 3M5XA 1RCOB 1F8MA 4LAZA 4AEOA 2WJFA 3ITOA 4EE9A 4Q7BA 4R33A 1V3IA 3K8KA 2VUNA 1OX4A 1KFKA 3UG4A 5IXEA 3SUWA 1C8XA 3LPGA 3BLPX 3HURA 4AWUA 5AOUA 1N8WA 5H2ZA 4WLCA 4C6QA 1HL9A 5HJXA 2ACQA 4BQ5A 3OGSA 3C8NA 5K4XA 1QPRA 1WKFA 3DHFA 3VXGA 3MP5A 2DZVA 2ZYFA 3SUVA 1H4PA 4Y8FA 2A21A 4YN5A 3WQCA 5D8ZA 4REQA 1XRTA 2EJ1A 5KSWA 4FPSA 3RRAA 1DWIM 1ALDA 2FH6A 1K4GA 4F0MA 5A94A 5FL1A 2BNJA 3HU7A 4YTSA 3ZO9A 2P53A 4XSLA 3W02A 2QUMA 3W01A 2A7RA 2PC8A 4UTLA 2FJUB 1OC5A 3AROA 1ZBVA 2CXGA 3VCCA 1CCWB 4PYSA 3UWYA 4WSKA 3PUGA 3APYA 3K5XA 4ML4A 1JPMA 3DYMA 5IDZA 3WEZA 3IRSA 4BHYA 4I90A 1QNOA 3FA3A 4QDPA 2GK1B 3G1FA 4ML9A 1RALA 4G1KA 3VD7A 3FVDA 1DQXA 1CXEA 4JY8A 1QCWA 2G5WA 2P8BA 3B9AA 1LOLA 2B7QA 2HNEA 1H5YA 3V5CA 1VYPX 1V7AA 2BVYA 4QSHA 2BGNE 2ZX6A 4J4KA 5IOBA 3GD6A 4O8RA 3MT1A 2NQZA 4TVUA 3BMWA 2YFNA 2WC4A 1QMLA 3USBA 1K7FA 3JU2A 3NL5A 4AF0A 1XLKA 4POCA 2RDTA 2FZBA 3LHWA 3OQ8A 2P0IA 2R1NA 1YDVA 1IE7C 3CEUA 2V3FA 1D3HA 3P61A 4GH3A 1DV7A 5GJMA 1LWIA 3UYCA 1OGGA 2OELA 3TLLA 2XUCA 1FHLA 1UOKA 3KL0A 4DJFC 4GYPA 2DZUA 3CK5A 4R9XA 1VHCA 1EP1A 1HJWA 1J12A 1P4CA 1KQZA 3PWGA 2BHUA 3PZTA 3LERA 3VUSA 4RXGA 1B3YA 1H1ZA 3WK3A 5GQBA 1B4EA 3ZFHA 4HA4A 4IMDA 3CB8A 3V36A 4HSOA 2OYKA 4H6EA 2RUSA 3UJSA 4W7UA 3V1PA 3T0CA 1IZKA 3RF9A 1V6VA 2Z1KA 5BZAA 4MJ2A 4DBSA 3S5OA 2I5GA 2ZWZA 3NQBA 3O05A 2VL4A 3G8EA 1XIDA 3BLKA 3VC5A 2J7BA 2NX1A 1W31A 1UD8A 3UWEA 3W1LA 2GJXA 1CLXA 1D3GA 2WSKA 3G22A 2NWSA 1QHZA 1JZ2A 3LGGA 3R58A 2C1HA 2C71A 5K9XA 5IBXC 1H63A 4UQDA 3W2JA 4Y9AA 3L65A 2PBOA 1OYBA 3MUAA 3MHGA 5K9CA 1GQJA 2V9DA 1UR4A 3APTA 4IPPA 2H90A 2Z7GA 1CGTA 1JR1A 4ERIA 1F07A 4NZFA 1B3ZA 2BG5A 2E6YA 2G95A 1Y7VA 1ZB5A 1Q6LA 2JF7A 1M7OA 1W1PA 1W5QA 7TAAA 1XHGA 4MUPA 3LGEA 3BQ6A 3T05A 4GCXA 5TIMA 4BS0A 5LNRA 2B31A 5M5DA 4HKPA 2A3HA 3RJXA 2P3ZA 4R85A 2D3NA 4F2BA 1KC7A 3Q58A 3C0JA 1RK6A 3BJFA 2WOQA 1OCQA 2O9OA 3R6IA 2FZ8A 5A8PA 2FVLA 3VOJA 4BF9A 1TMQA 1WKDA 1EEPA 2D2GA 4NAFB 4LYKA 1RPXA 1WV2A 5I3FA 2BP1A 2NV1A 4UR7A 3LZ3A 2F8QA 3WUBA 2R82A 4JTRA 4UZUA 3WD2A 3O6YX 2PD9A 1M41A 4Z2GA 3OP2A 4PR4A 4J3TA 3IACA 2YL8A 1QATA 3M0VA 3A5FA 3AU2A 3E2SA 2DP3A 4FX8A 5DF0A 1W3NA 2VZSA 4FO4A 4MDPA 4JIHA 1T5AA 1UIPA 1J2WA 3KTCA 1MW3A 1PDZA 1NH6A 4LV4A 3IEBA 3PTMA 4DJDD 4EPEC 1PBGA 2F2KA 3VOCA 4CD8A 1R30A 1YE4A 1V6YA 3CC1A 1AQMA 5HUOA 4JTGA 3W3OA 4D2JA 4JZ5A 3P5YA 1UH4A 1ISZA 2NQHA 2YA2A 4C6CA 4AYSA 4FHAA 2GUUA 4UQAA 1R3VA 2Z25A 2V2HA 3IIPA 1Q85A 3UXDA 3HQ1A 1EP2A 2GQ9A 1W3HA 2VQTA 2YL6A 3TW6A 3ARQA 4V2XA 4DBDA 1O5RA 4IIDA 1OADA 2VX4A 4D8AA 2V69A 1KGWA 3IK4A 3MSDA 4D8LA 1UYQA 4KRTA 4QR6A 3FSTA 4N7QA 1RV8A 4NNCA 4J1OA 3AS2A 2BOFX 1UBPC 1YADA 4EWJA 4FLSA 1RPKA 2A3CA 5F2LA 4GVIA 4REQB 2DZTA 2SFPA 2QULA 3VE9A 1FBAA 3T78A 2CC0A 2WHKA 1SW7A 4CCDA 3SRDA 3CZEA 4RK8A 4C1NA 2WKLA 1KXVA 5FJJA 4AZGA 3TAOA 1VJZA 2IKHA 2XH4A 4GZ7A 4O1CA 4A4AA 4LQ1A 1QBAA 3GW3A 3GG7A 4HN4A 4IFOA 2X2YA 4M1BA 5AC6A 1NJJA 1V3KA 3NZRA 4IH3A 3RFAA 3EA3A 3GHSA 4Q7NA 3EB2A 2QKFA 4JQ4A 1AW1A 1PB0A 1VKFA 4D8ZA 1SFJA 3EOSA 4S1FA 3ARWA 3W82A 3EGJA 4EANA 1Q6CA 1AMKA 3WZ0E 1I2QA 4GJJA 3WF1A 3KAOA 4HYVA 4FP1A 2X7WA 2BY2A 3VZYA 2OLAA 3O9NA 4MWAE 4WXYA 4PCSA 3NQFA 4DXKA 3QV6A 1HN1A 1KLZA 1T0OA 5I6SA 3UNDA 3TX9A 4I7WA 2WMHA 3W87A 1NF7A 1LQAA 2YL5A 3L0NA 4BJHA 2GPTA 3KOFA 3UZXA 4HU4A 4CVWA 6CGTA 4HMNA 3VIIA 3W6YA 1RH9A 2PBGA 3OIHA 3WNOA 3WF4A 2VC9A 4KFNA 4G8TA 3NQ8A 3CTTA 1XFBA 3M0XA 2ATSA 6A3HA 3G1AA 3IPWA 1HW6A 2VP8A 3FV9A 3UG8A 3GFXA 4K7YA 3GZ3A 2OODA 3HMCA 3DKJA 3NPUA 2F7FA 3SCOA 1ZCOA 1MXSA 1UD3A 3S3GA 2PS2A 1H62A 3CV6A 4IT1A 3W1NA 1NWUA 1UKSA 1GQIA 4U2YA 1YBQB 2D69A 1J4EA 4CD6A 3HGOA 3NYZA 3KOYA 4LY4A 3HB9A 1LWJA 3HGRA 1FRBA 1UUQA 1I2OA 4YPJA 1O1ZA 3K4WA 5C2GA 3NCOA 3PZIA 2CWNA 2DZPA 1EXPA 1XYLA 1XYZA 3WCZA 3QPEA 3I7QA 3BICA 3T0AA 1RVKA 4MADA 1CGYA 5DQPA 4HNTA 4FOUA 1WAWA 2GJXB 4K1GA 3WJXA 2QAPA 1Q6DA 2QJNA 4M5PA 5HK4A 3TIMA 1ZP3A 4OGZA 1NDYA 3B40A 8XIAA 3R79A 1LLZA 1BFNA 2I57A 1OK6A 5FSEC 1E56A 1TREA 5G2WA 1FWDC 3NXFA 1DWHM 3VNYA 5MKGB 3NYDA 1ZENA 4O12A 4TU1A 1JPHA 4LBSA 2CBUA 6XIAA 1G6CA 4ZODA 3RCMA 5LSMA 4C6OA 2OO0A 5IFTA 1TVNA 2HPMA 3ZMRA 3AYSA 1XF0A 3W7EA 3IVUA 4Z1BA 3T6CA 4AY8A 1V0LA 4NX5A 4AWTA 1ZY9A 3LDVA 3D3FA 4L1WA 4F48A 3LI1A 2GDQA 2VQUA 2Z2UA 3B0UX 1QT1A 2Z00A 3GXIA 2EKCA 4FNQA 4IL2A 2VO5A 2ZXAA 1GJWA 1UJQA 3N17A 4AXKA 1E51A 3CLMA 3WBWA 1OT1A 3EMCA 3VIMA 2VC7A 3B06A 3BAXA 4OKDA 4K8GA 1YPFA 2ZRXA 1MW1A 3TYDA 4LT9A 1KTNA 2OXNA 4LAMA 4WKFA 4B3LA 1SO6A 1Q6RA 1UASA 4HOZA 2WZEA 1QASA 4DZHA 2E77A 5DY2A 4XBKA 4XZHA 2AGTA 3LHUA 1UC4A 3TV8A 4X3ZA 1XIJA 3H4GA 1QRQA 4I9TA 4U4MA 3TJXA 2NXHA 4H83A 3SCUA 5IHSA 3AXXA 3PWIA 3CXOA 4CQ8A 4ADTA 1SYTA 5T8GA 5I5RA 1CXKA 3KX6A 1JDCA 2GVYA 1KKRA 3W7MA 3PBGA 1W9PA 1PIFA 2XDFA 3ZT7A 5BXPA 4JTDA 2WCSA 1PCKA 3BVJA 2IPGA 2CKSA 4KWUA 4QEEA 1FWGC 4LU0A 3WF3A 3C0SA 3BLIA 2ZRWA 2CLOA 3UZ5A 1EIBA 2PGEA 2OEMA 1EF2A 3FXGA 1XIFA 1VBJA 5MHBA 1TR9A 1VHNA 2P88A 3KBSA 5AVNA 5C9XA 3DZ1A 4X61A 2PODA 3NM3A 3TR9A 2KX9A 1FTXA 1NWRA 4O1EA 3RGTA 4NRRA 1HFBA 4B5VA 3VDBA 1BQGA 4ZQRA 1XDLA 3W4RA 1EJSC 2B7PA 1E9IA 1M6JA 1IHIA 1I9CB 3UZZA 3F2CA 3MYOA 5CZ0A 2PF0A 4DO6A 3BAIA 1OHLA 1H11A 3OVQA 1K02A 1DORA 3TUUA 1MEIA 4B4HA 2GGGA 2XM2A 1UQYA 3MMWA 2ZUWA 4A22A 2NLYA 4IMCA 3O8AA 3B0PA 3KOWA 1DJWA 1F73A 1TMLA 3B9DA 2WAGA 2FLIA 4KRZA 1GTEA 3VCRA 4FZIA 1UMLA 3REQB 3T1GA 4W93A 4OECA 2DGAA 2YXOA 2YZRA 5C70A 2WB5A 4LSBA 4PMZA 2OZTA 3SGUA 3PZGA 4A3UA 4HK7A 4MJMA 3DU0A 2G4FA 3SW6A 2YA0A 1LP6A 1YYAA 1WDWA 1ZRQA 2H3BA 2OZ8A 2QNEA 4QE1A 5A69A 3EKGA 4D6DA 4MZYA 3G1HA 2RHGA 2XM1A 4NG3A 3OVGA 3CUIA 1IWBA 3ZYZA 4B5TA 4ZQMA 2YIHA 1OABA 5ENLA 4NZ4A 1XLLA 5HPOA 5FEXA 2F2HA 2DSWA 1GT8A 3PAOA 2CESA 3NZPA 3E12A 2I1OA 2D0HA 3OG3A 1GGOA 2BFGA 1J9YA 3THCA 4WX2A 4AYGA 4ATLA 2WBKA 2JE8A 1MDLA 3HGJA 4L56A 2E5CA 4UQEA 3VKAA 1J2BA 4XZIA 3N2CA 1I1WA 4LVDA 4HSHA 2D2HA 2C79A 4PN2A 1F9CA 1OFRA 3UZYA 5A2BA 1A4LA 2TODA 2Z6JA 1AUSL 2ZQ0A 1Q63A 3C2FA 4O13A 2EPHA 1E3XA 5C54A 1ZU8A 5DCDA 1V5XA 5DN1A 4PTMA 4OV4A 4H9TA 4KQNA 3H12A 1HKWA 2QPSA 3GVGA 5LIYX 3K8MA 5J5RA 4DNHA 4FIQA 4JIRA 4KGJA 1TX2A 2YBUA 5L6UA 3UD6A 1E3ZA 4EF8A 4F0SA 4DLFA 5HWJA 2VEKA 3R8HA 2POZA 4OBRA 2Y61A 1XRVA 1RBLA 2VT0A 3HIJA 1KWGA 9CGTA 4NUWA 1ME9A 4Y7EA 1FWWA 2YXGA 3GG0A 3UWWA 2NUWA 3URAA 5BNKA 3UWUA 1IXPA 4Q8NA 1SO4A 8TIMA 4LS1A 4MWAA 4WGXA 2E68A 2PDPA 4M81A 3AIQA 2YCLA 2WC3A 3EB4A 2WHMA 5AYZA 3MUCA 3QMTA 3O15A 1XBXA 3FSUA 4HMCA 3VU2A 4Q32A 2HE8A 4UTTC 3PY2A 1WB0A 1XS2A 2ONEA 3GK0A 3FEMA 1KRAC 4FOJA 2QDHA 3DFPA 3SY8A 4H7CA 3LMYA 4AZ5A 4B91A 3ITLA 3IANA 2R1MA 3AS3A 1FFQA 3BURA 1UD6A 3N15A 4IFKA 4ZMGA 1W5NA 3KVMA 1QNQA 4L61A 3RM8A 4O53A 3EA2A 2GLKA 3WDIA 3W7KA 4RXFA 4AHOA 1L6WA 1KFLA 1KWKA 5BROA 4L9XA 3ARSA 4GCAA 2O0TA 4DYKA 1ZJAA 2PTWA 4TVDA 1F5ZA 3BK0A 3SB0A 3CL7A 5DMLA 3LQLA 2W67A 2VDIA 4KEMA 1J11A 3CM4A 1POKA 4EOUA 3HGSA 1RP9A 4H1ZA 2Z1SA 4IJRA 4LEFA 3EYPA 1F4AA 5E9AA 2XFYA 1WCGA 4UFLA 2YW3A 4I5UA 3PZQA 4MAZA 1RAKA 3OGRA 1ISXA 4DXXA 2ZICA 4WD0A 3GU2A 3WUGA 4DQWA 4HOWA 4N02A 3TYZA 1MEHA 4UQ9A 3UCCA 4QG6A 3WH5A 3S6DA 1LOQA 3GKFA 1XL9A 2GWGA 2WNNA 3Q2DA 2C15A 4LVGA 1Z7AA 2PD5A 3BSHA 3NGJA 4QJ3B 3N2TA 1KM1A 3Q37A 4JNYA 1QW7A 2Z29A 3KCLA 1V51A 3KCJA 1X97A 4RCXA 4YNGA 4QGCA 1PWMA 2FB3A 3UETA 5AYYA 2Y5EA 2FGLA 3S46A 2V81A 2EHHA 2F6KA 5I3DA 1J8VA 3DOPA 3MHFA 1H1YA 3K2GA 4E4UA 3C8FA 4L64A 4DI9A 4QCEA 3F1QA 3FYPA 3QGVA 3E49A 1VYSX 1A53A 5CPNA 3L9CA 2E1DA 4IQDA 4NNAA 2WC7A 3P93A 3Q4DA 2CBJA 1JCXA 3S5NA 2A5HA 2J6VA 2G96A 2WNZA 4JYDA 4JIIX 3WENA 2I14A 2WVSA 4P7OA 1HG3A 2QQ6A 3PF3A 3A13A 3ABZA 4PUJA 2VR2A 1HJSA 5EFDA 2X1RA 3NL2A 2GVEA 4ZB2A 4MUZA 3G1DA 1Q8JA 1YEYA 3GXMA 2V3DA 3TQVA 4R27A 5FCZA 3N6JA 3QOKA 1HX0A 1M7XA 4Z2IA 2FYMA 3P67A 1J93A 4PBGA 4UTKA 2W27A 2QT3A 5A6AA 4JBRA 1KM6A 1JCYA 4LOCA 3ARVA 4C1LA 1XINA 2FPTA 1Q6OA 3TKFA 4Z1AA 2KAUC 1DBTA 2PWFA 3N9SA 5HNRA 3KZSA 1QFEA 4LNYA 5JUVA 1BSIA 4H3DA 8A3HA 2PURA 6XIMA 2ZDRA 1IF2A 4IL0A 2VXNA 4NJHA 2WM0A 3N12A 4GE8A 1E40A 4RLIA 2G37A 3O3RA 1GW1A 1CECA 3K4DA 5A1AA 3LXCA 4LYRA 4YVVA 3A4JA 1K8YA 1WDRA 3S5ZA 3RPMA 2WWCA 4HNNA 3TYEA 3ARYA 2B4GA 4WY0F 3W7HA 1EHNA 3W76A 4WF7A 3W1TA 1WDQA 1G4SA 1X7IA 1WDPA 2XGZA 2XZ9A 4YYFA 5BW6A 5JIPA 2BHYA 1M7JA 4M6QA 3RDKA 2HBXA 3G77A 1A0EA 5CSSA 3S0CA 3LCXA 3G6MA 4W7WA 5ABFA 3R89A 4FNPA 1JQXA 4E4FA 4HIBA 2QUUA 3H54A 1DOSA 3ZJ7A 3PBUA 1M3UA 4Q4OA 3M0LA 1EGVA 1U5HA 3LD5A 2X30A 3TCEA 3MKVA 1WXYA 4C6IA 2GOKA 1Q45A 2HS6A 1NP2A 2ACUA 5G4EA 3BZGA 3GG1A 3BGGA 1XM3A 4LAUA 4ZCWA 3I6TA 2CITA 4GUIA 4J27A 3U3HA 1W1TA 5AN7A 3C2EA 3DG6A 3VNLA 3WQEA 4YCOA 1PX8A 2VNCA 3PSVA 2PDXA 5BOEA 3URQA 3L68A 1VCFA 1W5PA 4R7JA 4XBSA 1B54A 2WSYA 3WQFA 4MKSA 1X96A 3KDNA 1RY8A 1J0YA 1DPMA 3QKZA 1EO5A 4YYCA 5DCBA 3UESA 4JKMA 2P1FA 3DG7A 4H01A 1L0PA 1SSDA 1W3KA 2E9BA 1KFCA 3RAOA 1ZAIA 3IJDA 1RR2A 3AI0A 4PMQA 3NGFA 4PUWA 2NLIA 1EUNA 3SAZA 3TTQA 5CZJA 3T2PA 1HKJA 2DFAA 1XLHA 4CU6A 3MCOA 5DX7A 2EKGA 4MB5A 4LY8A 3AWOA 4XD6A 5AFDA 2D20A 1VJSA 4MWAB 4IMGA 5DRIA 1XG4A 5K7JA 5D03A 3CV7A 1OYCA 1FKWA 5JIWA 4WKHA 2E5DA 3PZ9A 5DFAA 3XIMA 1LF1A 3N29A 2A6NA 4ZBCA 3EOLA 4FX6M 4DWSA 3HG5A 4LANA 1BRLA 3AXKA 2CEQA 1JVNA 1OGSA 3DERA 4S3EA 3UJEA 3TJIA 2JEPA 2WMIB 4AZ7A 1XICA 3UF9A 3H7RA 3H8AA 3N11A 3VIKA 2PLJA 4QSFA 3R13A 1VFOA 1X6UA 5HQMA 2FFIA 1R3WA 2PDNA 1OFPA 4O1AA 5LHFA 2DT2A 4YVPA 1UD2A 1M7PA 1DJXA 1J0HA 4GLEA 3CJPA 4E4PA 3L2LA 2NW0A 3WEOA 1TMHA 3ANUA 3UG5A 4JYEA 2XIJA 3AMCA 2O9PA 4H04A 5EFFA 1TG7A 5ABGA 2FB2A 3GO2A 4A8NA 4WZHA 1E5JA 2ZZ3A 4XZNX 1Y8BA 3GBEA 1A5NC 1ML1A 1XQKA 1XG3A 1X1OA 3TFXA 3TQKA 1LORA 2H3DA 1TRDA 3LMZA 4PBFA 3ALFA 2J47A 2UV8G 2QIWA 3PANA 2D2OA 2QVHA 4Z2JA 3S5YA 1RXOB 2EG6A 3WD1A 1NTHA 4F2UA 4C6LA 4JKKA 2ISVA 1HKKA 3MC5A 1VS1A 3IV8A 3U8GA 1QAPA 3A6OA 2CHNA 4OBSA 4HNUA 4ERGA 2BOEX 2VFDA 3LXBA 3EDJA 1XLEA 4PUKA 3QYSA 4E8DA 1RY0A 3AHZA 3H6OA 3GXFA 4UR9A 1EUAA 4Q4SA 4RV3A 4AWSA 1DJZA 3W1XA 4O28A 4C6JA 1CTNA 4YL2A 1AMYA 1WDDA 3RX4A 1JL8A 1CX9A 3LPFA 3VOHA 1W37A 4M3PA 2PP1A 1R87A 2W9MA 2FHFA 3GR7A 6REQB 3ZLFA 3NEHA 5CGMA 2DQWA 3QV7A 3QFEA 1MQPA 2YDAA 3TN4A 3R8RA 3VCNA 5C9UA 2YLLA 2ZC8A 2POTA 3ZR4A 4DY1A 2A7PA 4GYFA 1IR2A 2X1IA 1W1YA 2VFGA 5FJIA 1AVAA 2PGWA 1VP5A 4O4WA 4CNPA 1JRBA 3KXQA 1O66A 1E0TA 4CCZA 2JK2A 2QF8A 2ESCA 3HQOA 3WQ6A 3WY1A 2B7NA 3NOYA 4HPGA 4CQ9A 2DSZA 3CUFA 3WLJA 4UNKA 1A5MC 2QUVA 3WSUA 3P8JA 4LX4A 3C2RA 1NFBA 3PJWA 2ZA3A 3TA9A 1O60A 1I2RA 5F2MA 5K2ZA 3QHNA 1DP0A 4JICA 2AMXA 4GWEA 5GJPA 2E8ZA 3KS6A 3PBVA 3VNKA 4AZBA 2Z1VA 1EJVC 2IUZA 1ZBKA 1EJUC 1TELA 3PG8A 3LHVA 4E8GA 4JTAA 3OG2A 1OFBA 4LUSA 2HCVA 4AAJA 2VFHA 1X6LA 2GQAA 2Y6ZA 2JIEA 4J5NA 4EACA 2V0TA 3ERPA 3OU8A 2YA1A 3KL3A 3GHTA 3LQGA 5D9OA 4O19A 1PZ2A 2UBPC 4WGHA 3ES7A 1FWJC 4PGLA 3HF3A 4DHGA 4PB4A 1GOIA 4GIAA 1CXIA 1LRQA 4HA1A 5K4ZA 3ALGA 3R4IA 2PZ0A 3EDDA 4PTDA 3N6HA 3N34A 2J9ZA 1OK4A 2QDDA 4DBWA 1GEQA 1SU5A 3BE7A 1XLFA 1TJPA 1VLWA 4US6A 1P5BA 1W6TA 4N2YA 2PWEA 4S38A 3MYPA 1GHRA 1LRNA 4GIYA 3EA1A 3ZR6A 2WZMA 2WPBA 1R47A 5IHRA 3UEQA 3GW0A 1BQCA 5LHEA 2UY2A 2BOGX 1NVMA 3PC0A 4S3CA 2JQXA 4QISA 3ZJ6A 3WLMA 4J3VA 3JZUA 1CT5A 1J01A 4TR9A 1W17A 3LS9A 1V08A 2PDIA 3CIWA 2PRHA 5HINA 4H41A 2H9AB 3VAVA 3GC4A 1RD5A 3EWZA 3ITCA 4L4MA 4LNCA 1DJNA 1XISA 1HKMA 1FWIC 3VK5A 3DYPA 3EEZA 3WQOA 5EMKA 4FB7A 5AB3A 3DKLA 2DIEA 2BB0A 4L80A 3UCQA 4AWEA 3QHMA 3N14A 4F9JA 4K2SA 1UC5A 3W7PA 1IZJA 3AIBA 3OLIA 4GINA 4HHHA 4S23A 1NOUA 4IGHA 1VENA 1ICQA 3UA3A 1HGYA 2YDSA 4NNBA 1E1FA 3CYJA 3P60A 4G9PA 1L9WA 4I7UA 3CGTA 1C7SA 5F1VA 4DZIA 1RD6A 5D8WA 1GQNA 2CXEA 3PB2A 3UT0A 3AMKA 3AO0A 1QHPA 1UCWA 3MZ2A 1HQTA 1ICPA 3PVFA 4PMVA 2FHCA 3LENA 2VX7A 4C5ZA 3ARUA 1TPDA 1ZL1A 1B31A 2UY5A 6PTDA 2E09A 1SZGA 2ZOXA 3PFMA 5JBEA 3TOYA 2WLYA 1Q5MA 3MMUA 1WZMA 5AC5A 5FJUA 5CC6A 2FVMA 4MTVA 4UXDA 4H9YA 3N4FA 3BLEA 2C16A 1DJQA 3LK6A 2IKIA 5G5IA 5FJTA 4ZOBA 3UU0A 5A3HA 3ITTA 3AXMA 4CQBA 3HPSA 1BRLB 2W5FA 2VRJA 4GVHA 1FWSA 5DY3A 5CC5A 3BWWA 1JZ8A 3WQVA 4AC7C 3UZWA 2IPFA 2QVNA 4FS9A 3W88A 3KBMA 3B4UA 1IEXA 3MV11 3EEGA 3G1SA 1PWLA 3VMNA 1RVGA 1E1CA 3E2RA 3A9BA 3CHDA 2XSXA 4E0CA 3WG6A 5BOFA 3UXKA 1R7OA 1KGUA 1GW9A 1R9YA 4N9CA 5PTDA 3L4YA 1EDQA 4RJEA 1FQ0A 1YKWA 3E0VA 1H49A 1YNYA 3H26A 1OQFA 3RR4A 3AU6A 1H3GA 1OF6A 2OT1A 3WJYA 2PLCA 4JIQA 1UMYA 3TFCA 5D37A 4KEVA 1LT8A 3FIGA 3B9EA 1IZCA 4F66A 3G0SA 3FOKA 1BGAA 2VZVA 4AIUA 1NSJA 2ZUNA 4UOZA 3BQ5A 5C7VA 5FF0A 2F9RA 2CZVA 4FA3A 7A3HA 2DSUA 3AHTA 1ECEA 4YU1A 4O57A 1K9FA 4MMWA 1YDOA 1WOAA 3GTIA 4W88A 3VD3A 3SY1A 3GS6A 1R8LA 3I3EA 3HZ3A 3CPRA 2OO6A 1I0DA 4MM1A 4S3FA 3RJYA 1P0KA 3IIXA 1B2YA 3B8SA 2X05A 4Z2HA 1SO3A 3H70A 3BAYA 1G4TA 5K3VA 4A35A 3SCSA 1MUWA 2NVDA 1QWKA 4M24A 4GMEA 1V79A 3P8IA 4O50A 1O7AA 3VE7A 1O94A 4DWSD 1NOFA 1XJBA 3W07A 1KBKA 3M64A 4R88A 3GB6A 1IEWA 4W7VA 5A6TC 2BY0A 3T2QA 4D6GA 3U4AA 1WKEA 4CD5A 3PZUA 5BXRA 1M01A 3EKZA 4ES4A 1QNPA 4JIEA 3ZVHB 4CQDA 1QI3A 3SJNA 3ZSSA 3L0GA 1EB3A 3M0KA 4FNTA 3D0CA 1C93A 2J25A 3GNPA 2WJEA 4PFMA 4J40A 1FWEC 2VD9A 3OEXA 4HZ8A 2J66A 3C0QA 4ZQPA 1GKRA 5A6SA 4DI8A 1JGIA 1B3WA 3F5LA 5JMUA 1KV8A 5FA5A 2C1IA 3UG3A 3TROA 4PC8A 1AODA 5CPLA 4EPKA 2PU0A 4PTWA 3RILA 2NXIA 4LUSB 5FF3A 4PSRA 5FL0A 3SO7A 3ARXA 2HK0A 1BF6A 4UMBA 2X0SA 2YXXA 1XH2A 1GVEA 2EXOA 4MB1A 1EYEA 2NSOA 2QCHA 3UVIA 4D9PA 5KMYA 1MW2A 4NAEB 4HCDA 4UOQA 4NJJA 4IIFA 3VGHA 4H9MA 2D0GA 3W7GA 1Q3NA 3MI2A 4YTQA 3WQGA 4O52A 3T0BA 2Q01A 3IARA 4B2DD 1VFFA 1Z8AA 2PI6A 2RDWA 1ZUAX 2XYLA 3UWZA 1QWGA 3E38A 2XHYA 3WLHA 4DELA 4ORMA 3WH7A 1MMFA 3E6EA 3JVAA 1Q4NX 1KCLA 1H61A 3WDRA 1B30A 3SURA 4KBXA 2PCEA 3SRKA 2NSXA 4QEHA 4IP7A 4MF4A 3PNUA 1PYFA 1EJ7L 4I6KA 5KTLA 1ONRA 4P8VA 3EKLA 4H00A 1TPWA 2B0MA 4ZOAA 2ZA2A 3CNYA 3TQPA 4IIGA 1J0KA 2G41A 3TW7A 1XGDA 1GYNA 3OLDA 1WZAA 3FN9A 1P6WA 1XLBA 3W27A 3E9AA 3EOUA 4ECLA 5AYXA 1EGMA 1N7KA 1JCNA 2V38A 1U1JA 3UPMA 3QR1A 4YLWA 4WJEA 3U5UA 4MKVA 3G0UA 4ZE5A 2HBVA 2VCCA 3H7VA 2ZZ4A 1UP0A 1I60A 2FIQA 4MNMA 1K9TA 4R7WA 3QM3A 1LT7A 3SSJA 5GVJA 4BCEA 4PTNA 4OHQA 1Z42A 3USZA 2XFRA 4JIPA 3LOTA 3TDFA 3MVTA 3QH2A 5T9BG 2AAMA 3IIVA 3VZZA 4UIOA 2JFEX 4F9DA 2PDFA 4P5UA 4E2OA 4XZLX 4I5XA 2D3LA 1RQEA 1LQ0A 1TQJA 3DI1A 3ZWSA 3W53A 2ZE3A 1AZ1A 1EDGA 4BR1A 3IJ6A 1IQ8A 3FYOA 2R6OA 3M5YA 2VGFA 4C6EA 4NHVA 3A3HA 3TCSA 1GHSA 1ONEA 1CLKA 3MSGA 1X1NA 2CZDA 1W91A 2ABBA 4LEQA 4PMNA 3DH7A 4KMQA 4Q8PA 4C6PA 3V1HA 5A6MA 1PVNA 3LU2A 4Z17A 1J6PA 3E0FA 3NEVA 1JPIA 1PL9A 1C9WA 4LVAA 4TQTA 4S2BA 1UPMB 4N9BA 4DAIA 3MP3A 5FF2A 4FF7A 5A6BD 4WHBA 3N4AA 3BOXA 3AXIA 4MB3A 3M4HA 4GUGA 1VBHA 3N3MA 3KVKA 1E9LA 3VFCA 3BGAA 3OJGA 2BX7A 2OEKA 3VD5A 3VNMA 3WLRA 3ELFA 3TTSA 1M68A 3FJ6A 4Y96A 3R10A 2CZ5A 2HVOA 1E1CB 5FSDC 3BC9A 3PZOA 4HT3A 1DWJM 3I6EA 2PWHA 5I3GA 2PPGA 4O16A 1GNXA 3R25A 1MDRA 1O95A 4M7TA 3OIXA 2ON3A 3M7WA 2C6QA 3WDPP 1PEZA 4YS1A 5LXEA 1H1NA 2EO7A 4X0NA 3BW3A 2VGIA 4H7ZA 3T08A 2FGBA 4TV5A 1A4MA 4D6IA 4S3BA 4B3ZA 4HA0A 2J7HA 4GXWA 1AJ0A 3KWXA 3W1QA 3KBVA 4XIMA 2QMJA 3LTSA 3GUGA 5J5DA 1GKPA 1XIBA 1QOXA 1G0CA 3LCIA 1EF3A 1M1BA 3UQNA 4H6RA 2OSWA 1HJUA 3BCJA 4X63A 1VPQA 1X98A 5CQ1A 4HVXA 2J74A 1SJAA 2CHRA 4PCFA 4OUIA 1RSCA 4F2TA 1OM0A 3VX1A 4PUEA 4G5DA 3URNA 4NI8A 1W2VA 3BAJA 2X41A 1JF6A 4XZWA 4MHBA 1S3TC 2PDHA 5AY7A 2PDCA 3RITA 3GTHA 2J9XA 4JAWA 2GVJA 4AISA 4Q8VA 1VGAA 2HPIA 5AHMA 4RDWA 3B9NA 1UKQA 3IUHA 3CBWA 3CT2A 1AW5A 4DJEA 1PTAA 3MV01 3WO8A 4RNIA 2ZCGA 4O14A 5ABEA 4GJIA 2PUZA 3G1VA 5I23A 3MCMA 3OHIA 5DCEA 5DBUA 7REQA 2PMQA 3WQPA 4D6FA 2O4QA 3MSRA 1YW1A 2PWDA 1XDJA 5F2GA 4HN8A 2ODOA 3MZNA 3RLVA 4ZSUA 1A80A 2XN1A 4E2BA 1CXFA 4WJXA 3L67A 3BOLA 1QVBA 4H9UA 4JTLA 3R8GA 2EQDA 5C6MA 3RU6A 1W3JA 1ZSXA 2FDSA 4AZCA 1FHUA 3DFSA 1UKTA 4UB9A 4KETA 4L7ZA 1CZ1A 5CZKA 4QIUA 5G1TA 5CBIA 3ITYA 3RRXA 4FK9A 3Q45A 2J7CA 2J6XA 3TEVA 2PDQA 2PSNA 2QGYA 3H2AA 1T8XA 4RNHA 1MI3A 4FR1A 4Z1CA 2FMOA 3LI0A 4HB7A 3POHA 1XKJA 2QCFA 4LH8A 3BOFA 3GDMA 4O10A 2XU2A 2G97A 3C3UA 1IEVA 4INFA 1D7FA 4GX9A 4DYJA 4QQUA 1DE5A 3T81A 5D04C 4GNJA 4K8HA 1KXHA 3U7VA 2BSLA 4L6OA 1C29A 1FWFC 3WH9A 4AU0A 2AL2B 1BSLA 1Q13A 3AZRA 5CGQA 5EPDA 2WV8A 3TZFA 3QJAA 2QCNA 3BANA 1M04A 3PPGA 4ERAA 4MLJA 4L1XA 1K1DA 4H8UA 5I2UA 2BXYA 4RW3A 2QYGA 1OFAA 4A2SA 2GDUA 4R7OA 3ABQA 3IJLA 2I56A 3SR7A 5HQLA 1HL2A 3UGVA 1MZRA 3S9YA 3SEPA 1KBJA 4ACYA 1R2RA 2EPKX 4HNCA 4LS2A 4GGHA 3WBAA 3IRDA 4GVFA 3H2MA 3W26A 1SMAA 4N9DA 2J79A 1IT0A 2XZ7A 3CAWA 3NQGA 1DE6A 3UNTA 5M2FX 4WSHA 3P84A 4GO9A 4C7DA 4DF0A 2IPJA 4PULA 5BXSA 2FHBA 3U48A 1TPFA 3GY1A 1O1HA 2Z1BA 3KVJA 1VBRA 4C6DA 4K36A 3EX6A 2OR2A 4A29A 2QJIA 3S42A 2GWNA 2VGBA 1FWCC 1W9XA 4DYEA 4CN6A 4OIFA 1PYMA 1SO5A 4F0LA 4UUIA 4AD4A 1JUKA 3I4EA 4GY7A 3AAMA 3EPOA 1R7AA 3EWBX 4KPLA 3PG9A 1B3XA 3GTXA 1J5SA 1TZZA 1VIZA 3MU7A 1K8ZA 2VM8A 4NZCA 2WKGA 3NQEA 2DIJA 4J3ZA 4NI3A 1KR0A 4ZXOA 1W56A 1JI1A 3LHYA 3CB3A 2Z24A 3W24A 2PE4A 1FXQA 1Y5VA 3MUXA 3GYEA 3S1VA 4OFCA 2DJLA 3S2MA 1J6OA 1CWYA 4QE4A 1YHTA 2I16A 1YLVA 3K46A 2OX1A 4XKYB 2C14A 4UR8A 1BTCA 4W4QA 5M3WA 2UWFA 3KDOA 3U57A 3ZWTA 1HO1A 4LC8A 2VOMA 2OKTA 4MY8A 1AQ0A 1VYRA 3VKJA 3M0ZA 3V5OA 3QGKC 4WJ8A 3RPTA 3S2NA 4EPBC 1ISVA 4GZEA 1DIKA 2JIWA 3TTEA 4QE5A 3HPFA 2YCKX 4IP5A 5E0CA 3TH6A 3THAA 4GI6A 1QDSA 1V03A 5AYBA 2ZZ1A 4KCWA 4X22A 1S3HA 8CGTA 5MF5A 4WDWA 2DY3A 1K9EA 4FXSA 4DJDA 1ITCA 2VR4A 3I3DA 2CBIA 1T8QA 3N2BA 2XFWA 4AXNA 4RZBA 4NX0A 3W2LA 4P7QA 4KWWA 3VC6A 4GQRA 4P8WA 3WDJA 2J88A 3NXLA 4YWSA 1MQRA 2J62A 1S2VA 4BK9A 2A2IA 3H7UA 2H6RA 3ZM8A 4HBKA 1LL6A 3HJEA 2ZXBA 1TFVA 4QLKA 2GSJA 1FP9A 3T09A 5HA7A 3BGJA 2ZRUA 1ADSA 1ZJIA 2QR6A 1B4KA 1P6BA 5A5WA 3QN3A 2BHZA 3UY7A 3GNOA 4N42A 4PUDA 3CO4A 4D6HA 2ZTJA 2VRQA 5HNUA 5BMWA 4PMOA 3LZ5A 3E3HA 1RQHA 1TA3B 4QJ1A 3SUSA 2DVTA 2EG8A 1UQZA 3QW3A 1OCNA 3FHQA 2XIMA 5LGZA 3W38A 3NO3A 5L9FA 5HMSA 4ATWA 2J27A 3NQVA 3B4YA 3N2MA 3W7OA 3JW7A 4LPCA 5DXYA 3L5LA 2EBNA 1NDZA 3QZ6A 4K7VA 5LA2A 3CV1A 3PM6A 4GYPC 2F84A 4Q8OA 3SUTA 3U6WA 2QPUA 3LA4A 2ZRZA 7REQB 3E0LA 4FNRA 2L5HA 2XH7A 3O63A 4W5UA 2NWRA 3T0TA 5D9NA 2OGYA 4AEEA 4FSAA 4XD5A 4R9OA 4Q6XA 5TNVA 4DWDA 1WAUA 3K13A 4FIRA 5A95A 2V3EA 3OZOA 4Q4RA 2A3AA 2C13A 3C5QA 3UR8A 4FLRA 2Z2BA 3GLCA 1SFSA 1B90A 3OZMA 1J96A 4K6AA 1Z44A 2XSBA 4IX2A 3HM7A 3SCVA 5D2TA 2J7FA 1PO9A 3O0FA 4KFOA 3LG3A 3TC7A 3P6LA 4AZCB 4GYKA 4WIWA 2V2CA 4PTXA 3CWHA 1FY6A 3EWUA 1WP6A 1F76A 1MXDA 1X7FA 1YPIA 3CWOX 4FOKA 3SN0A 4CLMA 3GDLA 5I06A 1GOXA 2Y8UA 2FQIA 4PCPA 3WJSA 3F2BA 2OGJA 1DTNA 1PSCA 4L65A 4UTIA 5CPSA 4M80A 2REQA 3GVWA 4YWIA 2O4MA 2OWWA 3CAVA 4KEUA 3WLLA 1IV8A 2QCDB 4U28A 1F2JA 2V63A 1X39A 1OGBA 3W86A 1AH3A 3AIUA 1RLDA 3FFSA 4DNMA 3MHUA 3PTDA 4GGBA 3VYLA 1JNEA 1NAL1 1K9DA 3C3NA 1QK0A 1TPH1 3GC2A 3TMLA 4HQVA 1FHVA 3C2YA 1DJIA 1R2SA 4XVEA 4D1IA 5JBFA 4HPXA 1BXBA 3MBDA 2WMFA 4DJED 1SJBA 3NM1A 2FGZA 3ARRA 2NV2A 1F3TA 2VZTA 3XINA 3TYAA 1Z6KA 3N1AA 4S3JA 4AD2A 4ASTA 4XISA 5D2YA 3FJNA 1VZWA 2ZKMX 1TWDA 4XQ6A 5EBUA 4LAOA 4UFJA 4CUCA 4EAMA 1GG0A 2FPYA 1EP3A 5REQA 1X38A 2DSKA 1ECQA 1HKIA 4PEKA 1TPB1 4CGTA 2XIIA 1JRCA 4CEUC 5DANA 1PXGA 1J0IA 1KGXA 5LNUA 1JXJA 1V4YA 4IIEA 1V7YA 3SDOA 2FPVA 2P3EA 1RJQA 3QZEA 4ZOEA 1NF0A 3IWPA 2WW5A 1E0WA 4KIRA 2JGQA 5AHFA 2E40A 1BYAA 1S1PA 2V5LA 4B4FA 5DELA 2QV5A 1OD0A 2J9YA 4PBEA 5CGTA 2WJZA 1Q6QA 2I9EA 3OO2A 5DRCA 1WOBA 3BO9A 2XG9A 3NZ1A 3G0XA 1KFBA 4EK7A 4Q8WA 2OSXA 1QO2A 3EPNA 1V0NA 1NFGA 4GOAA 2Z28A 4OVXA 2PP3A 3MB9A 4CU7A 5I00A 3BG5A 3F03K 3LXAA 1J10A 1W32A 2F38A 2XH2A 2WMKA 2BXVA 4KCVA 3T07A 1MEWA 3VGFA 1EQPA 4LVFA 3FGCA 1NOWA 3NWRA 3F5KA 4XAPA 2E4TA 2HQAA 3VIJA 1BF2A 3O6CA 3LY0A 2WK2A 2P10A 2CLPA 1W3LA 4AIBA 3VKCA 1QTWA 2PC4A 3MO4A 2CHOA 3FHAA 3TWAA 4QROA 4ATDA 1W8SA 4NZ1A 3QVQA 3KOZA 4NILA 4PZVA 1TPUA 4AIEA 4XG1A 4TX6A 2HVMA 1TPC1 4OWGA 3P82A 1AK5A 4B5WA 2XTKA 4BEUA 2FKPA 3MANA 1SFTA 3LGDA 2GGIA 4PODA 2OX4A 5B7ZA 4IJBA 3ANVA 4I9JA 1EHAA 3BARA 2G3NA 3AZSA 2YLAA 4BA0A 1KTCA 2YCJA 4Z1YA 3MJMA 4JHOA 1BLIA 1DWFM 1YXDA 2BVTA 1OVDA 4HYRA 2DSVA 3LSCA 1HJQA 2E7FA 1E6ZA 4ZR8A 4RX0A 1G7VA 4IUOA 2VC6A 2WBGA 1R9ZA 4J2MA 3UJ2A 2NV9A 2WJDA 7CGTA 4LCSA 7PTDA 3H2FA 2VELA 4ZA0A 1AQFA 2Z0IA 1QXLA 2G3IA 3HPZA 3NL3A 3OHMB 7ENLA 4LXFA 3V0TA 4L5ZA 3BLOA 2QUNA 3T4WA 4O1DA 1PAMA 4UBPC 3F5JA 1DJGA 1MRAA 2Y8KA 4AD5A 3M47A 1VFMA 4QDWA 1DWGM 4U2ZA 2I5QA 5BXTA 3H53A 1R3YA 1QHOA 2NVAA 4GACA 1HKVA 2PDUA 2XWDA 1RBOB 1H51A 2E9MA 1DKWA 1VCGA 3WL0A 3KP0A 3IIZA 4AEFA 1XCXA 4KW2A 3DEQA 2DUXA 4UCGA 1K7EA 3E5BA 1I75A 2P50A 4EXBA 1V3HA 1Y5XA 3OA3A 2VFFA 1KTBA 3U2ZA 4JPGA 1JPDX 1AFSA 5BMXA 1FDJA 2WZTA 3T0DA 3CHVA 1IWPA 1MSSA 3SUUA 1WBJA 3SQMA 3CH9A 4IGNA 4TX9A 3MCNA 1F8IA 3M7SA 4B5XA 3GDKA 1F4HA 4XX6A 3LLXA 5LIWX 3QFWA 4AZHA 1WZKA 4XB3A 4GVGA 3KUMA 4PRTA 1XD1A 1RBAA 3TW9A 2Q8ZA 4JTHA 3ZLHA 4LV9A 1CLVA 3S9ZA 4L9ZA 5C2XA 5JQ9A 4QBXA 4YTTA 3HOJA 5CEWA 5AVHA 2C18A 3W75A 4TVCA 1EC9A 2A3LA 3LBCA 4Y9MA 1H7RA 3A24A 1KXTA 4NRSA 4IUGA 1OX4B 4JGDA 2REQB 3CQ0A 4W87A 3G6LA 1TV3A 2W4XA 1AL8A 4O15A 1WO2A 3G1YA 2PDGA 4AHQA 1GONA 1B0IA 1S5MA 1EJXC 5D09A 2Y2WA 1H41A 2PU1A 1DIOA 1W54A 1EA9C 2VRKA 1WDSA 4PL1A 4AX7A 5FIPA 1PPIA 1TYGA 3WDHA 3VNDA 3HTWA 4CN4A 4JQ3A 1OCBA 4CKQA 1QOQA 1VFHA 3ATYA 1VEOA 1RJPA 4H19A 2V30A 2V82A 2WVUA 3IV3A 4JEQA 5CBJA 2ALRA 4UOJA 5C55A 1VFLA 4AHPA 5G4WA 1P6CA 4DLMA 4FXRA 4JN6A 4D71A 2OJPA 3TQ0A 3SJ3A 1HXJA 3R2GA 3CTLA 3A23A 4FMVA 1DQWA 1W3IA 1HF6A 3PULA 1JCTA 1MFUA 3WK0A 4OBTA 4Z0SA 1I2PA 3DFQA 2CLEA 3M0JA 4NP7A 7TIMA 1ITXA 1IXOA 1K6AA 3GXNA 1R6WA 3FLUA 3LCLA 3CT7A 1XYCA 4MY9A 3T9PA 2VCBA 1PTDA 1ZAHA 4JTSA 4OTKA 1E0VA 2ZRVA 5HXMA 3LM7A 3EZ4A 1JZ5A 1EPVA 2HSAA 5DLCA 1P0BA 4Q8QA 1MNSA 3LUTA 2QMKA 3WMLA 5G2IA 3WEMA 1GUVA 3THDA 4XUGA 4CQAA 4IJCA 4OOZA 3E2VA 3LX9A 2QDEA 1NQ6A 3MKKA 2PLKA 4AF0B 1JPKA 3CMGA 2X2GA 1KM0A 4TIMA 2WMGA 2J24A 1QI2A 2PTZA 2WZHA 1GYLA 1Z48A 3DENA 1TZ7A 1ZHAA 4P8UA 2IKJA 2J7GA 5G2HA 3CHFA 5FI8A 2QCMA 1JAKA 5TBOA 4HU0A 3ZZ1A 4I8DA 1UUOA 3FGCB 2C0HA 4IXHA 2PRMA 2W66A 4DX3A 5I79A 3W9ZA 4WSJA 1AZ2A 3TWBA 3EXSA 3AJXA 4GY0A 3K8LA 4J2PA 4JTIA 1UWUA 4MGGA 3BW4A 3IAPA 2H8XA 3VINA 4TMCA 5CLTA 3VM5A 1E15A 3T40A 5HDRA 4HA3A 1LQ2A 1KV5A 5C9WA 1S1RA 1AH4A 3PHAA 3W73A 5SWUA 1WE5A 2HWGA 4I3GA 5FD0A 1EX1A 3W37A 1LBMA 1P43A 1O5QA 2FTYA 3L66A 4B15A 3CUHA 5CSYA 3S2CA 2GQ8A 3GWQA 4ZO8A 5XINA 3IK2A 4Y9OA 6TIMA 3G2GA 1CGXA 3RO6A 1HTIA 3VABA 2ZDSA 2JBMA 4J7RA 3I3BA 1UWRA 4NVTA 1TE1A 4CNSA 1TX0A 3AUOA 5ECUA 3L4TA 2R24A 3GNDA 1FFRA 1EJTC 5M1TA 4I5RA 4LWWA 3W84A 1LG1A 4U5IA 3PZNA 5RUBA 1KCKA 2WWDA 2PDMA 3RIKA 4NSBA 1UBSA 5LGXA 3P0XA 4KFPA 3PNZA 4GQGA 3Q94A 4JFTA 3WL1A 2I9UA 1XUUA 1BPLB 1W8GA 4MJ4A 3NQDA 4BEQA 4BQ3A 5A6JA 5KITA 3GXPA 1V3MA 2GUYA 4OZOA 4JTKA 4PEEA 3DHUA 4OQVA 1EDTA 3B8TA 3B04A 1QOPA 3UCDA 1O5XA 2XPKA 4YIWA 3CPUA 3M44A 3V5FA 3GIYA 1P0DA 2CCRA 1XC6A 4MFDA 1UR1A 1Z41A 2CBVA 2XISA 3MS8A 5TQLA 1N8FA 1LDCA 1TUFA 1FWBC 3DFYA 3KRSA 3CIXA 3MMTA 3S1XA 2DJXA 1U30A 2PDWA 1KM4A 4HD5A 1P7TA 3QMRA 4B90A 3PBWA 3TOPA 1RZMA 3B0VC 1TV4A 2IW0A 1XP3A 3MPGA 1XPGA 1GVFA 5HR6A 4XK2A 3NQMA 3QRHA 1LTDA 1ZZMA 5E0KA 4Q6JA 2BTMA 3TA6A 3CMJA 2WKJA 3NSNA 3GC5A 2PDYA 1BVNP 1JGMA 2A3BA 3FYYA 4MY1A 1Y0EA 5I09A 3TLQA 1YDYA 1DXIA 5A6KA 4PUMA 4EIVA 4KCTA 1AA1B 2Q3OA 5GNXA 3P0WA 3H55A 1BEUA 3PPCA 5EMYA 2ZX7A 2R9RA 3APGA 4B5SA 5D32A 5I3KA 4O1FA 1US2A 1E6SM 3RM4A 4FXJA 5AHIA 1MXGA 1VB9A 5KINA 2PGRA 3TYUA 4GO8A 3FCPA 4HHLA 1A5SA 2Z1XA 3R0DA 3ME3A 5FJPA 1PZ1A 4W85A 4JCLA 3QR3A 2F61A 3NQAA 8XIMA 3BLDA 5D9PA 1G4PA 3RR1A 3E0WA 4MWAC 1R3RA 1EGZA 3ZR5A 1U33A 3KVLA 5JU6A 2VYOA 1S2AA 2W61A 2WSPA 3UYIA 4O17A 4UMCA 4Q22A 4QX4A 5CCZA 3MSYA 3VOGA 3QBUA 1XD0A 2VEPA 4EX4A 3WUFA 1XBZA 3L0KA 3OBAA 3TN5A 5F4XA 2ACSA 4GHRA 1VR6A 1GKQA 4EXAA 3HMJG 3H22A 1OX6A 4FR6A 4TXEA 2WVTA 2AL1A 3E1F1 2GK1A 4BWLC 2BY1A 2AQVA 4WDUA 4H4IA 4GFIA 4H2HA 3VO0A 4HJFA 1KCXA 3QC0A 1L6SA 1FVPA 1K7XA 4C1NB 3VX0A 1NWSA 1VPYA 3VNZA 4AFYA 1LBLA 4AC1X 4RPQA 4F0RA 1Q7MA 3VILA 5HULA 3S6OA 4PSPA 2PLMA 3F4NA 3WX7A 3W7QA 2OCZA 2EPNA 1QW9A 1JFHA 1GOWA 4J35A 1UIOA 4HYWA 4Q8UA 2YPIA 5CH9A 1JDFA 2CLFA 3HG3A 1QK2A 1R46A 4GUFA 1R2TA 2OEJA 2ZTKA 3UP8A 1EYWA 3SM0A 3ZJ8A 1YRRA 4PMXA 3BSGA 1LL7A 2QCEA 2ZIDA 1JD9A 1YMYA 4Z08A 5HAOA 1UA7A 1TPVA 1GVYA 3E74A 1RCQA 2O9RA 4IFRA 3KHJA 4Q33A 2VKZG 1XBVA 1XSKA 4ICCX 4W84A 3Q67A 5FF4A 2P8CA 4QXIA 4AUBA 3DYOA 2Y0FA 3WN6A 1XLMA 1W9DM 9RUBA 4FNUA 1A5CA 3L4UA 1SZRA 3QC3A 2Z26A 3O2LA 1D8CA 3DN5A 3VDGA 2BGSA 1TWWA 1LJYA 3A4WA 1NY1A 3ZQ9A 3G18A 3QPYA 3NURA 3OVRA 1PUDA 1XIIA 2YX0A 3EB3A 4IPIA 3VM7A 1XYMA 5LIUX 1Z9AA 3CZKA 2UY4A 4L9YA 4IOTA 1KKOA 2E6AA 4RE3A 2PTYA 4GX8A 2OVLA 4IISA 4RE0A 3VIPA 2TYSA 3N13A 2YW4A 1OJXA 1QO5A 4PTVA 2AQOA 4ROQA 3ONCA 4EF9A 5EU9A 1E1EA 4FX7A 2ZVIA 2VEMA 5AKQA 3S2LA 3LRKA 4MVAA 4NY2A 1XYAA 4HMEA 4LCRA 3B97A 5FJRA 2VCAA 3FDGA 1GK8A 2YKKA 4GG9A 2FFCA 5AC8A 2Y7EA 4UNIA 4UTWA 1FWHC 2V5DA 3QEZA 3TJLA 2YB4A 1G4EA 1XC4A 3LNPA 3DGRA 1RJRA 1GYMA 3HFYA 5KZMA 5EKYA 3RHGA 5DMNA 3M0IA 4FXFA 2TPSA 3MKCA 4XD3A 3QQ1A 4HK6A 1BD0A 5AZ1A 2EG7A 5M17A 3B03A 5E0FA 3NOEA 2QCCA 4M19A 1PV8A 5U4NA 3LPPA 4H9VA 5F7UA 4S3GA 2C91A 1W9BM 2C7FA 4C1KA 4XD4A 4LAKA 4PRWA 1H09A 4ROPA 3SSZA 3TNOA 3I10A 2R1KA 4XBJA 2E28A 4BWLA 1EWEA 4RL3A 1G01A 1XH0A 5DBTA 3V3WA 1Y65A 3RO8A 2NQJA 1E4LA 3HJZA 4U3AA 4Q8MA 3OZYA 3EWCA 4AY1A 2FZDA 1UB3A 1NM9A 1SGJA 1UH2A 1NP0A 2AQWA 1T96A 5AYIA 4WY0A 2X09A 4JYFA 3ORWA 3AUJA 3TSMA 4BI5A 3H4WA 2ZUMA 3P80A 4ENLA 5EGRA 4HP5A 2DZXA 4Q4PA 3A3WA 4TOQA 3STGA 3P62A 1EA0A 3QYQA 1ENUA 3BJTA 3FDKA 4GIRA 2VZUA 3ABSA 5LKYA 2DEPA 3ZSTA 4AIOA 4TV6A 1RP8A 4HCHA 3BPWA 4A21A 5H8UA 3MVIA 4ALDA 2D24A 1XX1A 4V33A 3NZGA 3ID7A 3UXLA 3VDAA 3WDQA 4XVDA 3L4XA 3QR0A 2AKMA 4HHMA 1EJRC 4IPNB 4LVBA 2GGEA 4AY7A 2RDXA 1G7UA 1H60A 1UUMA 2NQ5A 3W6MA 3P81A 1JCJA 4L6DA 2OLSA 1KFEA 2GJRA 1KRCC 4P2VA 2DIKA 2AAAA 1C7TA 5GNZA 3T8QA 4F4RA 3F2DA 5XIAA 2Z27A 4N9EA 3AOFA 1GOOA 4KT2A 1G9HA 2X42A 3GNXA 4ZSTA 1WZLA 4ZO9A 3W72A 4KIEA 3CHEA 4ZEPA 3U0HA 5F4SA 1V93A 4L4LA 3M1ZA 3GFZA 2C3ZA 2A0NA 3A9IA 4RZ6A 2BY3A 5ECVA 4HU3A 1W5MA 1FP8A 4DWSC 2JKAA 3OBEA 2OYLA 2ZUUA 1HJVA 3NSMA 3PFRA 5BCAA 1DEDA 3M0HA 2J7DA 3CAKA 1M9HA 4DO5A 3SIMA 2QV4A 3GH4A 1DHKA 3O0KA 3GVRA 2D23A 3AISA 1E70M 4YTUA 1NWTA 2WHJA 1GVQA 3WBEA 2DORA 4GBUA 5D2WA 2ISWA 4YVXA 2FZMA 2Z2AA 4K37A 3TAKA 1HL8A 3OW1A 4LF2A 2FTPA 2QHAA 1WA3A 4H9XA 1P1MA 2A7NA 1Z89A 3ECQA 4AMAA 3IJQA 3SGGA 4UMAA 5A6LA 1D9EA 3BMVA 4GISA 3CEPA 4JNZA 3QSRA 4PCNA 2QW5A 1JI2A 1PIIA 1MYRA 3DFHA 4AD0A 2DUZA 4Z2KA 3AYRA 5C2CA 2OWXA 4CCEA 2WNWA 3D5HA 4A3QA 5JXQA 4MNLA 4M7SA 3AIVA 3WH8A 1O4UA 3VNIA 1JFXA 2ZADA 1AG1O 5FESA 1JG9A 5LYRA 1P1XA 3N25A 3AS0A 2BV9A 4JFWA 2ZA1A 5TF0A 1ME8A 3LNMA 2W6RA 3PJUA 1TWZA 2VZOA 1H50A 4V28A 1YBQA 1W1A1 4MSSA 3EXTA 2Y24A 3WK1A 1ZGDA 3M43A 4URIA 3AXHA 1CEOA 4MYAA 4QLLA 3NJ3A 3KE0A 3ZT6A 3FK4A 3GUWA 2PGFA 1EOMA 1XIEA 2INEA 1T99A 1IT7A 4GXMA 4GD0A 4KH2A 1OZMA 1S5WA 4HGXA 1HP4A 5FF7A 3STFA 4H2CA 3INPA 2D73A 3WQ4A 3IVSA 3DI0A 2P0OA 4KWOA 3B8VA 3AHXA 2DW7A 4RV8A 1XLIA 3GSMA 2OYMA 3UJFA 2XIQA 2PTDA 3FEQA 1JULA 4I9MA 3P5ZA 3QQ0A 5C0QA 3A47A 3W1MA 1A5KC 3O1NA 1P0NA 3OODA 4J3UA 4V1XA 1VFSA 1FWTA 2XN0A 4G1NA 5MKGA 4Y6GA 4Z0JA 3DC8A 5A2CA 3L21A 4DF2A 4XIAA 1C9DA 1UPPA 1UR8A 4GC4A 2G3JA 3FKRA 5HANA 3FY1A 5HJYA 4GY1A 2QJGA 2OG9A 3HG4A 2V5BA 5TD4A 1Q7QA 3V18A 3I6RA 2INZA 1GQKA 1TE6A 1UROA 2GSHA 3KBJA 4X0VA 4AD1A 1ADOA 1CGUA 3MUZ1 1M03A 1XDMA 2EAWA 4MNJA 3KRUA 1YXYA 3H2EA 3I68A 3G24A 1A5AA 1H0GA 2YCLB 2VDHA 3RLGA 3TSDA 5LNSA 4PH6A 4UFIA 1VEMA 1PS9A 1UZHA 4W8LA 2X1SA 4O1BA 2ZFAA 4JTUA 3SCWA 1SJDA 1ONWA 3YPIA 2YGYA 1I45A 2WM1A 4PMYA 1L8NA 3FW6A 1ZCCA 1QPOA 2VDGA 2YSWA 4IFKB 1VEPA 3QQWA 1NELA 4DRSA 1HP5A 2C19A 2G3FA 4YMZA 3TC6A 2GL5A 1B3VA 2D0FA 2WSQA 4OU1A 2WMJA 4DUWA 4E6MA 2V68A 1PX3A 4MJZA 4NZ3A 3PUOA 4WY0B 1ZBWA 1EC7A 5DEZA 1C91A 1QPNA 2CYGA 2GOUA 1KCZA 4YCPA 2RGLA 1SR0A 2QUTA 4JNMA 3R0KA 4UWMA 5CG7A 5EBAA 1LWHA 1JUEA 1KFWA 3EPMA 1J79A 2Y1HA 4A3RA 3WQWA 3LCFA 2VMFA 4MKNA 1EXBA 1O5KA 2VWSA 5LXXA 1KQYA 2MNRA 2AMGA 1MQQA 3PAJA 4QG8A 4P61A 1Q65A 1ITUA 5H8PA 4CN1A 3GRIA 4EKJA 4ILSA 3BLLA 4DJFA 1XLDA 4MOZA 4J3SA 1JEZA 3HFTA 1O6IA 3SCNA 3HPAA 3WLQA 1A5BA 3RYSA 4AD3A 3XISA 1EX5A 4B2DA 5KZEA 2Y7DA 3WMCA 4KERA 4QP0A 3AMGA 2DW6A 4BI6A 3UW6A 5I7GA 3M5ZA 5AHNA 1OSEA 3HO8A 4QLJA 3W70A 3NPWA 4GH1A 4QITA 4NIRA 1UP2A 3QY7A 1EJWC 5CAHA 3NVDA 1ZNNA 1B5TA 2YL9A 1SMDA 2IMRA 4HJWA 5IDIA 3REQA 3KWSA 3I65A 2CERA 2W0UA 1BG9A 4NXSA 4DUVA 2OQYA 5IBXA 1GWJA 3QPZA 3MDUA 3U9IA 1M65A 2NT1A 1TJ0A 4KWVA 1WXZA 4PUNA 3QLDA 5A2AA 1PHWA 1QUMA 3NDOA 3R11A 2WYSA 3EAUA 4M1RA 2Y5JA 3WNMA 2CPUA 3L2MA 1EOKA 3W6LA 3PSWA 4YHEA 2KZHA 4XZMX 1TPEA 4R34A 4Z42C 5EMUA 3G1XA 4AZIA 4KCUA 2VVSA 1Z69A 3EOOA 1Q2SA 1UWSA 5H1WA 4MPKA 1DJHA 4XZ9A 1IGSA 3G3MA 2ZVRA 2Q09A 1LROA 3SN4A 5I07A 3URBA 2OLHA 1F3XA 2CNCA 3WQDA 3MDWA 1KBLA 1LL4A 3BV4A 1WNOA 4MZ1A 3GNNA 4XZBA 4A8RA 4H6KA 4CVUA 4RDYA 3BZJA 3ZS4A 2ADAA 1R86A 5KZDA 3CPGA 4N4PA 2PDBA 4LCQA 1E9YB 2R8WA 3ARZA 2QXWA 1V6XA 3RM9A 1CXHA 3NNTA 4ZQOA 1OBAA 1CENA 1PE1A 2BWGA 2VI0A 5CPQA 2WSRA 3EBVA 4WDXA 4ICMA 4TUFA 1E4MM 3UWVA 3HA1A 2EPMX 1E9ZB 1OX5A 1UKPA 3MI3A 3DUGA 3KFTA 2X0HA 4XKMA 1POJA 1OF8A 1JNDA 4S39A 5IRPA 5D02A 5FEZA 1JXKA 3EDEA 3LHZA 2E1WA 5HOSA 5HMDA 1XFCA 5D30A 4NYUA 1OD8A 3WMBA 4MYXA 4GKLA 4N0RA 4XTDA 4LS0A 3GIQA 1W1B1 3NL6A 1IT8A 3AIEA 3PJXA 5ABFB 5GPRA 1GZ1A 1JUBA 5A6BA 2Y4SA 3PR2A 1TWSA 3V75A 3VMPA 1XKYA 1EPXA 2E67A 2Q3RA 4JX6A 5CSUA 5CXPA 4IPLA 4P7RA 3EX3A 1S2UA 1GVOA 1Q7ZA 1HIZA 2VURA 4PMUA 1SFLA 5AZ0A 2Y8VA 2ALDA 1SUXA 4D72A 3K1DA 2NQLA 3CQKA 4S3AA 5D05A 4JL2A 2GVGA 3S1WA 3CASA 1S46A 3WUEA 3PJTA 4DO4A 4NU7A 4DVOA 3UR7A 2ZZ2A 2XVNA 3SFWA 5DT5A 2E8YA 2DZWA 1UR2A 1OWQA 1CB2A 2F6UA 5I3HA 3CZGA 3BAWA 2W92A 4JCMA 2CLLA 5KZ6A 3DG3A 5CBBA 1FCVA 3OVPA 1NU5A 2BGQA 3IUDA 4LFYA 2E3ZA 4GUHA 1H0IA 4FNSA 1VF8A 3MBFA 3V0UA 5AC4A 3A12A 4U5KA 1BVZA 4IG2A 1RUSA 1D2KA 3WF2A 2PFHA 2IQTA 2GZXA 3KP1A 3HPXA 1ITQA 4BQ2A 1T6MA 1KBIA 1UJPA 5JBDA 4GABA 3FS2A 3W1RA 4DBUA 5DO8A 3ZLGA 4E3VA 4EWND 4K68A 3RN6A 2DVUA 3PTKA 3QKEA 3FA5A 3UPWA 5I3JA 4HTYA 3W1AA 3GQYA 2Y89A 3B05A 1T40A 5HMEA 3RXZA 2O9TA 1EKOA 2V5KA 3E02A 3RX3A 2QLYA 4XV0A 1VFUA 1VIWA 3W7IA 1JYWA 4ACZA 4C6MA 4HSNA 3P7YA 3ZT5A 4DWSB 1OC7A 1XR2A 2Y5SA 4F3HA 4XSMA 4JKLA 1EFZA 3E2QA 2NUYA 2E6DA 3DIPA 2QZRA 1HVXA 4ZFMA 2QJMA 1LLWA 2GGJA 1FA2A 1BYBA 3L7RA