4DBUA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 3-((4 -(trifluoromethyl)phenyl)amino)benzoic acid
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of AKR1C3 containing an N-(aryl)amino-benzoate inhibitor and a bifunctional AKR1C3 inhibitor and androgen receptor antagonist. Therapeutic leads for castrate resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 114
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbuA00
3DN5A 4G5DA 1S1RA 3LUTA 3Q65A 4XZNX 3S3GA 1MZRA 2WZMA 3GHUA 3LZ3A 4QR6A 1GVEA 4PUUA 5JH1A 4DBWA 2FGBA 3R8HA 3ERPA 3T42A 1EL3A 1S2AA 2IPWA 1Q5MA 3F7JA 4PRTA 4JIHA 2J8TA 1Z8AA 5HNUA 4XVDA 3LBOA 4F40A 2I17A 3V0UA 3O3RA 3UZXA 2C91A 3O0KA 4WGHA 3FX4A 2PFHA 3LNMA 4WDTA 5C7HA 4EXBA 2PDYA 4L1XA 3N6QA 3QKZA 4LB4A 1YNQA 1J96A 3MB9A 3P2VA 4ICCX 3WBXA 3H7UA 1S2CA 2PDWA 1PZ0A 1IEIA 2PF8A 2ACUA 3WBYA 2IQDA 4PRRA 1Z9AA 4GA8A 2PZNA 4YU1A 5AZ0A 4LAUA 2WZTA 3M0IA 1RY8A 2F2KA 3UP8A 2PDGA 1X97A 2IS7A 2PDMA 2PDIA 1X96A 4JIIX 2F38A 3H4GA 4JQ3A 2ACQA 3RX4A 1R38A 1K8CA 3GHRA 1US0A 2PDXA 4OTKA 4JQ2A 3ONCA 4HMNA 4GIEA 3G5EA 2AGTA 3CAQA 4H8NA 1RY0A 2FZ8A 2P5NA 4JQAA 2ISFA 2BGQA 4GQGA 2HE8A 1XGDA 4YVVA 4YVXA 2PDHA 1LWIA 4WDUA 1AZ2A 2HV5A 3ONBA 3Q67A 2FZDA 3UGRA 4JTDA 4FA3A 2R24A 3LENA 2HVOA 3V35A 3D3FA 3CMFA 1YE4A 2IKHA 1YNPA 2FZ9A 2HE5A 4LBSA 1IHIA 1T40A 2PDCA 1XF0A 4R9OA 4PUWA 2NVDA 1OG6A 2DV0A 4ZFCA 3LQGA 4DZ5A 3UYIA 2HEJA 2PDFA 5LIWX 4AUBA 3U2CA 4XO6A 2PD5A 4Q3MA 4GQ0A 3MC5A 1UR3M 1Z89A 5JH2A 1QWKA 1EKOA 3EB4A 4PR4A 3UWEA 1C9WA 4HBKA 4WDWA 1AZ1A 3VXGA 4JTRA 3WCZA 4GACA 3GHTA 4IJRA 4WDXA 4ASTA 3UZWA 2PDNA 3UZYA 4QXIA 4QBXA 3R94A 1MRQA 1QRQA 4JTAA 4JTQA 4LBRA 3UG8A 4XK2A 1HQTA 1T41A 4NKCA 1AH4A 3R43A 2PDLA 3H7RA 4GABA 2HVNA 2BP1A 5AZ1A 3LN3A 4JIRA 4EXAA 5LIXX 2IPJA 3CV6A 3M4HA 5HNTA 3UZZA 1M9HA 2PDKA 2PDQA 1JEZA 2INZA 4GCAA 4QX4A 3NTYA 1ZSXA 4L1WA 3R6IA 2ALRA 2PD9A 3RX2A 4LAZA 2PEVA 3LZ5A 3R58A 5LIYX 1AFSA 2QXWA 1AH0A 4FAMA 1ZQ5A 2DUZA 4FZIA 2IPFA 2HDJA 2PDBA 1ZUAX 3RX3A 4JQ1A 3LEPA 4DBSA 3GHSA 2I16A 5M2FX 1A80A 3R8GA 1MI3A 3B3DA 3V36A 1RALA 4YS1A 3EB3A 3KRBA 3DOPA 2FZBA 4YVPA 2R9RA 4H7CA 3BCJA 4DBUA 2A79A 2IQ0A 4JQ4A 3UFYA 4JTCA 5HA7A 5DANA 2PDPA 1VBJA 1XJBA 3BURA 3WBWA 3V0SA 3LD5A 2NVCA 1LQAA 2ACSA 1EXBA 1FRBA 2CLPA 4MHBA 2PDUA 1Z3NA 2IKIA 4WRHA 4XZHA 1YE6A 5LIUX 3EAUA 1PYFA 4LB3A 3R7MA 4XZIA 2DUXA 4XZLX 2ACRA 2VDGA 3C3UA 3LQLA 4IGSA 3CV7A 1Q13A 1ADSA 1SM9A 1X98A 4XO7A 2PDJA 4FALA 3WG6A 5KETA 1VP5A 2IKJA 2INEA 3CAVA 3COTA 1PWMA 1ZGDA 1EF3A 4PMJA 2IPGA 3BUVA 4XVEA 3V0TA 4Q7BA 5LIKX 4RPQA 2FVLA 3M64A 4XZMX 1HW6A 2BGSA 1S1PA 4WEVX 3G1RA 3FJNA 4XAPA 1AH3A 2IKGA 1PZ1A 3GUGA 3N2TA 3BV7A 3CASA 1PWLA 4IJCA 4I5XA
chains in the Genus database with same CATH superfamily
3C6CA 2GVGA 2VGIA 4D1JA 3I7RA 3KAOA 5KINA 2Z0IA 1NFBA 2MUCA 5AFDA 2ZUNA 4O12A 3N13A 4UR7A 4U33A 4EPDC 1UW9A 3DKJA 4GVIA 2XWEA 2J62A 4P5UA 4W87A 4CD4A 3DFOA 1SPQA 1B0IA 2J8TA 4A05A 1O94A 2YGYA 3OO2A 4N9DA 5F4XA 4IGHA 3SUSA 5K4XA 2X41A 3AZTA 1L8PA 3LTSA 3GNPA 1JDAA 2P0IA 3BOXA 1JZ6A 3B05A 1QHOA 2QUUA 3FX4A 2PBGA 3LNMA 5XINA 1VYRA 2NXGA 4JYEA 1B3YA 1RHCA 2ZZ5A 3KTSA 1KRCC 4GYKA 4JTFA 2Y5EA 3N6QA 5EBUA 1T8QA 5HQEA 1U33A 5A6TC 3CHCA 4PCTA 3OBAA 4XBJA 3OGSA 4M6PA 2XM1A 1Z9AA 1TO3A 4LGXA 1VFMA 3DI1A 3NYZA 3CV2A 3UG5A 3QGKC 1I60A 3E5PA 3GK0A 1GEQA 1RY8A 3APYA 4HOXA 4ZSTA 3W9ZA 1NELA 3ZIZA 2CHNA 4PB5A 2PURA 4XISA 2X16A 2HMCA 1WX0A 3O6AA 4E2DA 3M5YA 2RDWA 3HQ1A 4UQEA 2QAFA 2E5CA 4GMEA 3DERA 5G2WA 2XTKA 4GX9A 4BI5A 3ARZA 3VM7A 5U7SA 1IT0A 1QPOA 1ZAJA 2HBVA 3ZR5A 1UUMA 4IIEA 4A3HA 1IWAA 1RY0A 3A6OA 2P5NA 3WD1A 1TV5A 2WJZA 1NQ6A 1QPKA 2A7NA 2E28A 4YWIA 3C2FA 3U3HA 2D3NA 3BC9A 3UETA 8RUCA 3N2OA 4M56A 4ATLA 4H9MA 2C19A 1RQHA 5D33A 3VFLA 4Q8NA 3ZVHA 3M5VA 1XBZA 1REQB 2GFTA 4CGTA 3BAXA 3W1MA 5HBFA 3D3FA 4D6HA 5A8OA 3PZ9A 3HJEA 3IIOA 5HWNA 3SQSA 4EPBC 3WLTA 3GRIA 3HJZA 3KCLA 2VOMA 3BMXA 1UR2A 4ORIA 5I2UA 4BF7A 4DIAA 3CZKA 1OG6A 3BOFA 1LF1A 1RQEA 4PUKA 4GQ0A 3QTGA 2J8FA 5KZEA 4P7QA 4GXMA 4WHBA 5HMEA 1KQZA 4IFOA 4KEMA 4C5YA 2FMOA 1VCVA 3EB4A 3WEZA 3CHFA 4IMFA 1MQQA 2QCCA 3S5NA 4KCTA 1ITCA 4OV9A 4E2VA 3WMSA 2NXIA 5E70A 2V81A 3UZWA 5CG0A 3M0MA 2YBVA 3OA3A 2TMDA 2G41A 1UC4A 3MMDA 1FDZA 3M1ZA 4KWSA 4G9PA 4JTAA 3W7GA 3ZR4A 4DZIA 4GQQA 1E0VA 2D20A 3MYOA 1R9XA 4W88A 1FWTA 4FNTA 1NOFA 4JTEA 4US5D 4ZXOA 3ZWSA 1KR0A 3IJQA 4JIEA 4JTGA 4B4HA 3L66A 5XIMA 3C2EA 4BK9A 1CECA 3SADA 2J25A 2PGFA 2Z27A 3H22A 4NI8A 4A3YA 1NVMA 1GKRA 5AC4A 4RW3A 1W54A 4NVTA 1TUFA 3W2LA 1HJUA 4JX4A 3WBAA 3QOKA 3BPWA 4LC6A 1AQFA 1XC4A 1TX0A 1N82A 1NJJA 3E49A 3BLLA 4NAEB 3QYQA 3OGRA 1YKWA 1KFKA 5H8UA 4EWND 2YL5A 2A7PA 3PUEA 2W27A 1E1EA 3GU2A 5EFDA 2YKKA 3O7UA 3VOGA 1XLBA 6XIAA 1V6WA 1A0CA 6ENLA 2POTA 2XFRA 1MYRA 3EWWA 3BCDA 5T9CE 3SAZA 5HULA 1W3IA 2WLYA 1VYSX 2ZUWA 2WYSA 3BGAA 4IPPA 3TA6A 3NL6A 4NG3A 3H2AA 2DT3A 3UCCA 1ZALA 4UQDA 2D0HA 3P80A 5FJIA 4HU0A 4IG2B 2NV9A 1YMYA 5CZTA 6A3HA 4DBSA 1GTEA 3NO1A 4EWJA 1X1OA 2QF7A 1JRCA 3T09A 3SUUA 3F2BA 4Q4RA 3AIWA 2AL1A 3GFZA 1TV2A 2ZX5A 1F6YA 4WY0B 2BB0A 4UOZA 4HK5A 1YPFA 1QPNA 3LD5A 2QCDB 1E6QM 3RJXA 1EGMA 2YCKX 1WKYA 1PKNA 1FWCC 2Z1VA 2CLPA 1Q6EA 4AY7A 4OV4A 1XLDA 1IT8A 4O18A 3W1QA 2QR6A 1UH2A 2QQ6A 4HTBA 4L7ZA 1FH9A 2WC4A 3V1PA 1WKDA 1TYGA 3TA9A 3WJZA 5AYZA 4GLEA 2W63A 4HZ7A 5HR6A 4IUOA 1JCTA 2X7VA 3NA8A 3SM0A 1X1ZA 2PCEA 4GQRA 1XD0A 5EMJA 4MWAA 2V0TA 2Y7DA 4Z2LA 4PMJA 5FJUA 2IPGA 3M0ZA 3S5SA 2YYTA 2XDFA 4M24A 4XVEA 2GDQA 3IUHA 2ATSA 2VR4A 3CV1A 3UVIA 2J47A 2PTYA 3E3HA 3GW3A 4FF7A 1GOMA 1E6ZA 2VFEA 3LTYA 4AXNA 2Z00A 5AY7A 2WCGA 1ISWA 4PCNA 5A6MA 3LHWA 1OADA 3SIMA 4B5UA 4Q8OA 1KV8A 2OLAA 3D5HA 3TTQA 3SFWA 3LRKA 4E8DA 3JR2A 3GH4A 3E6EA 4RL3A 3PJTA 2J6XA 2W5FA 4K7VA 1G7VA 3M46A 4LOCA 2P3ZA 1PTGA 3LZ3A 4QIUA 4YMZA 1UH3A 3BK0A 3PULA 4JS3A 1E1CA 3IIXA 4HTYA 3RO6A 3BSGA 4FOJA 2J7EA 3GW0A 3CHEA 3VIMA 2WKLA 2DQXA 4PEEA 3F4NA 4OIFA 1DQXA 3LBOA 1VQTA 3PTQA 3UNTA 4NL1A 2EO7A 2QKFA 4AY8A 5CGQA 1HKJA 4F0RA 2DFAA 3S5YA 2JF6A 2C1GA 3R89A 3FJLA 4JY8A 3AIQA 2CW6A 4HD5A 1XINA 4MAVA 4EXBA 3P60A 1QDSA 1PE1A 4LVDA 1W5PA 2GQAA 1E40A 3B8VA 3P2VA 3R25A 2VQUA 2R94A 3TQKA 3IGXA 1IEIA 3PTMA 3NWRA 4IG2A 3CBWA 3GYCA 1RD6A 3BARA 3P67A 2PZNA 2OJPA 3M0IA 4CU6A 4DWSA 4MPQA 4H9ZA 3L68A 3N15A 4E4UA 1BFNA 1RPXA 2IS7A 2PTDA 1TPFA 1GOXA 2QUNA 4UR8A 1TZ9A 3GNRA 3I6EA 4KWWA 3WEOA 2VVSA 4ICNA 5D4YA 1HTIA 1US0A 4S1FA 3A12A 4WJXA 4M1BA 4ILSA 2AAMA 2V3GA 4DJDC 4DJED 2D73A 3A3XA 3AIVA 3NQ2A 3EWXA 3G1HA 5IDIA 4DJEA 2BGQA 3WNPA 2X7WA 2WC3A 1F07A 2J24A 3MHGA 5L9FA 5T9BG 3FYPA 1Q63A 3ONBA 4BWLC 2FZDA 3PTDA 2EG6A 5GNZA 1A3HA 4K6AA 4AWEA 3V35A 3A47A 4ZODA 3ABXA 5CGTA 4M51A 4TX8A 3M0LA 3ZLFA 3TXZA 3GUWA 3U0HA 5CPMA 3OLIA 3N2MA 1QHZA 4R9OA 1VJIA 4GBDA 3G6MA 1JZ3A 1W2PA 1B54A 1HL2A 3M0VA 3T08A 4G1NA 4S3AA 3ANYA 4J35A 3RNDA 3PBWA 3TXVA 1P4CA 1CTNA 1LCOA 3LG3A 5IRPA 4LPCA 2VZTA 3ORWA 3UWEA 5K9XA 1VKFA 1DJIA 4HBKA 1I6NA 2G3MA 2Y88A 2ZZ1A 2WJDA 1W1B1 2QDEA 3WNNA 2OEKA 2YCIX 3P61A 4GYFA 1AL8A 1ZTVA 3WQDA 2X1TA 3MI3A 3DBPA 4QBXA 4Z0JA 3AYTA 3ALFA 3S9YA 4LRSA 4UIOA 1T41A 4NKCA 4C91A 4JIQA 2FDSA 1PO9A 4KWOA 1G69A 3HF3A 3DFYA 1KGXA 1FWJC 1TRDA 4Q33A 3ICJA 3GS6A 1PCWA 3LCLA 1TPWA 1WUFA 2JEPA 4KQNA 2ASHA 4XBSA 1QK2A 5AZ1A 2QJHA 3FSTA 1XBYA 4IMDA 2IPJA 1BLIA 1TVLA 3WMLA 3V75A 4N9EA 2WJFA 2XG9A 3LA4A 3B03A 2PP0A 4GCAA 1HUVA 1WZMA 3LXBA 2QJGA 3HPAA 3SBFA 1L6SA 1J6OA 2C79A 1XCWA 2B7OA 4JPGA 1TB3A 2CXGA 3CM4A 4E2OA 1ZENA 2W66A 4IISA 1MWOA 4DJFA 4QG9A 3N1AA 4PA8A 3EA1A 1SZGA 3CZJA 4AD4A 3ARRA 3V5CA 1J10A 1VYPX 3CB8A 1ME7A 2G3JA 1E43A 1HXJA 3BV4A 1BF6A 4MIMA 3KRBA 3NPWA 3E96A 5FSDC 4IMAA 1V03A 3DHFA 4KMQA 4D6CA 1HP5A 3TH6A 4NZFA 1ISXA 4HU8A 1WKFA 4YYCA 5F2IA 4P8WA 1ZBCA 3JVAA 3RM9A 5IHSA 1HJXA 1Q65A 3UCDA 4MHBA 1MEHA 1NDZA 5D2WA 3N2BA 5DO8A 1VPXA 1P7TA 2C0AA 4JAWA 4K8HA 1NOWA 2NUYA 1JVNA 2VR5A 2Z25A 5I3IA 1JCXA 1EIXA 2AMXA 2PSNA 1E3ZA 2NQHA 1C3FA 1K9FA 4W89A 1VP5A 1PJ9A 4X2RA 3T55A 4AZCB 3BSHA 3IV8A 3W7EA 4DWSB 4IFKA 4RZ6A 4Z17A 3W26A 1GOWA 4IWWA 5E6ZA 3BAYA 1Q4WA 1PCKA 2OZ0A 3HG4A 4LS0A 2FPYA 1D8CA 3GBEA 4LV9A 3QSRA 1O4UA 1P0DA 2ZUUA 3CASA 3CLMA 5A2AA 5IXEA 4PMRA 1U5JA 4I5XA 3O6CA 4XUGA 5BXTA 2DY3A 1UWQA 2O56A 1J0IA 3PG9A 1TJ0A 5DXYA 3THQA 1XCXA 3HA1A 1ZBVA 3GHUA 2I14A 3PZGA 2A6LA 3V18A 1W9DM 5JH1A 4MWAC 1UYQA 4Y9PA 4F66A 2RHGA 3QW3A 2P10A 1JPKA 3OOQA 5EU9A 1LROA 1S2AA 2G8ZA 5EL1A 3S2LA 4QS6A 1E4NA 4DQWA 1M68A 3SJNA 4CLMA 1VFHA 2WCSA 2BHUA 1TTQA 4U3AA 1SW3A 3PG8A 3W1PA 3PK7A 2DSKA 3LCIA 4H83A 3MWCA 1XRVA 3MUY1 4MAZA 2CBUA 1SFTA 4DYEA 1J96A 3M0KA 3FOKA 5HMFA 3RPDA 2GJNA 2E6FA 3H2CA 4Q4MA 4AZBA 1E6XM 3SN1A 1K03A 4H3DA 3CUGA 4N02A 4K36A 4F9JA 2OX4A 4Z1CA 3TC7A 5FL0A 1B30A 4OGZA 4MLRA 3CPGA 1UWSA 5CSYA 3HTWA 1FWEC 2F2KA 2WHJA 1ZRQA 1EJRC 1W1TA 4DUVA 5D9PA 2WB5A 4DHGA 4R7JA 1YLVA 2WSQA 3H55A 3NGJA 5CH9A 3INPA 5AN7A 3VVGA 3AS0A 1V79A 3P6LA 1TE6A 3S4TA 1FWHC 3K30A 2Z6IA 3RX4A 1PAMA 3NXLA 4B16A 4NJJA 2ZUSA 1WZLA 3U5YA 2BOEX 2XISA 2PLKA 3MU7A 1S38A 3PZNA 3T2PA 1IGSA 3FS2A 3N12A 4H8NA 4B90A 2CZVA 4IXXA 3DFNA 4M1RA 4DBEA 3LY0A 3THUA 2FTPA 4YVXA 3SECA 3GQYA 1FH7A 4JN7A 4A2SA 2Z1SA 3UY7A 4UCGA 1WUEA 1NU5A 1DOSA 3Q67A 4JTDA 1XI3A 4C7FA 2J6VA 2BXZA 4RUBA 1C8XA 5AC6A 4PCPA 4O15A 3NDYA 2NWRA 4N7QA 1B3OA 1JFHA 3BLEA 3M5ZA 1QO5A 1F5ZA 3DU0A 4IIHA 3SRKA 1KXTA 2I5QA 3VDGA 3T40A 2ZRXA 3KL5A 4O0QA 3F2CA 3REQA 3S47A 1LL6A 1BTMA 2QDHA 1POKA 4U31A 3GR7A 3HGJA 2ZUTA 3ARTA 3ARSA 1GVOA 3GIQA 3BAWA 4MB5A 3STGA 2JALA 4EXQA 4ROPA 4PR4A 3U8GA 1ZNNA 1C9WA 3IPWA 4BWLA 1V6XA 2E9BA 4JEJA 4FPSA 4H4IA 9XIAA 4QE4A 2PU0A 5ABFA 2Y6ZA 2G3NA 4J4KA 1IEXA 5DQPA 2D22A 4N9CA 4HCHA 4OZOA 3NQMA 3UJSA 4XD4A 2OXNA 5FJJA 4QXIA 2CU0A 4JHOA 3TONA 5CLWA 2FH6A 1QRQA 2DIKA 2XVNA 4JTQA 2QPSA 3CGTA 1LOLA 4IPNB 1XIIA 4I7VA 5IDZA 3RO8A 2FJKA 1W9UA 3FKKA 4KKXA 3VGGA 5CPTA 1GVFA 2PAJA 2W92A 1PDZA 2WAGA 3SRDA 4JIRA 5CXPA 3ITOA 1OFOA 4XG1A 2FJUB 1B9ZA 3G3MA 3DIPA 3I3BA 3W7IA 2FTYA 4KWUA 4QM1A 2VWSA 3VKAA 1PZ3A 4K37A 1K9TA 1UR8A 3CH9A 3GXMA 3UWVA 3WY1A 1C91A 2CHRA 4LYRA 2WHKA 1V5XA 1OM0A 5SWUA 4AMCA 1FXQA 4L64A 5GJNA 3CPRA 1E72M 3A9IA 1H60A 4OU1A 3RLUA 4O1FA 3RHGA 2GWNA 3CTTA 3EZ4A 1IGWA 4OJYA 3M41A 1UJPA 4HA4A 4IICA 4QE5A 2DUZA 3PNZA 3W1LA 2HDJA 3ARPA 3BAKA 1YADA 4ERAA 3POHA 3EKGA 4JQ1A 3IJIA 5J8LA 2PRHA 1D9EA 1W3KA 4J3VA 1H1YA 1U30A 4Q8UA 2WMIA 3L5LA 3DOPA 4Y9AA 2R9RA 1JDFA 1D3GA 2PRLA 1XRFA 3DC8A 3OP2A 4RDVA 1B90A 4HT3A 2OT0A 2CLFA 3PUOA 3VFCA 2IUZA 3HQPA 5DMNA 4U5IA 4QNEA 1E6SM 2R6OA 4B3LA 3SRFA 2C71A 3ZJ7A 2GWGA 3L4TA 4FHAA 1LT8A 2ZA2A 5D37A 5AVNA 2OMAA 1GNXA 1HVXA 3CMJA 8XIMA 4IIGA 1FKXA 4U5KA 2GDUA 3OZPA 2V82A 4XZLX 1LORA 1ME9A 3KRSA 3C3UA 4PFHA 3H26A 2FLIA 2DZVA 1KM4A 3W7JA 4CNOA 4AEFA 1FP8A 3HV9A 4XIAA 5FF2A 2GK1A 3T07A 1YRRA 3KRZA 2E6DA 1DJZA 5GPRA 2J9XA 1SSGA 4D72A 3QYSA 1TWSA 1AW1A 4A3RA 1ZCOA 4HHHA 4NILA 2Y1HA 1TRIA 3SEPA 1OHLA 1KTCA 5TNVA 4CU7A 4DAFA 2EGZA 1N55A 4D6EA 1OF6A 1SGJA 1OZMA 2WSYA 2YL9A 4ZGYA 3VGDA 4NZ3A 4JTSA 3TE9A 3JZUA 4BKNA 3VIOA 2A3CA 1FWWA 4G7EB 2DVTA 1K6AA 1IZJA 3I3EA 1H3GA 1QNSA 2DW7A 4CCEA 5A2BA 3W87A 1S1RA 4WR3A 4FLQA 3RDKA 3QRHA 2JK2A 1Q6OA 4K3ZA 3I10A 2NQZA 1GVEA 2WBGA 1H1NA 4LX4A 3ERPA 1KCKA 3U7VA 3SJ3A 4RDYA 4XAYA 1SFSA 3KOZA 3F5KA 3NSXA 1IWPA 1ZB5A 4X2PA 3LS9A 3E9AA 2GGHA 1XKYA 1DTNA 2VJXA 1TZZA 3MMTA 1XLCA 2C91A 4QEEA 1H7OA 2G37A 1XPYA 4LS2A 4UTMA 3N6HA 4UFIA 2NQ9A 3C2YA 4O14A 3G0SA 5I78A 4NZ1A 3NVDA 4OVXA 3RFAA 3G1YA 2NQ5A 4AVOA 2OX1A 4C6JA 1J5SA 2PDWA 4UMCA 3TJXA 3W7LA 2D0FA 3WQFA 4KESA 1MW2A 2ZRUA 1V6VA 4C6NA 5AZ0A 2P0OA 2DZSA 3FN9A 5ECVA 4FNPA 2Z29A 1EC9A 2E3ZA 4UTWA 1HJQA 4AC7C 4GVHA 4NT0A 4HCLA 1FWIC 2XZ7A 5IFTA 4MJ2A 2F2HA 1RVGA 4B5TA 1C93A 3QFWA 2PODA 4X0VA 3ECQA 3B40A 4GXWA 3MBFA 4WSJA 2VEFA 3UYCA 4WLCA 3UXDA 5M5DA 2PLMA 1SZFA 3FAWA 1UWRA 1JCNA 4MJ4A 3PBYA 1FCUA 4CD7A 2D24A 2Z7GA 4C1NB 5D9OA 1E4MM 3ONCA 3W23A 3N6JA 3HIJA 5K7JA 5K4ZA 5C9WA 1S5NA 3VIPA 5D30A 4JYFA 3R1ZA 3GFXA 3EGJA 1UBPC 3WN6A 1W1IE 3GTNA 4JFSA 1L6FA 1GPWA 3BW2A 1GQIA 1KM6A 4EE9A 3UXIA 1JYWA 2R24A 5DX7A 4AF0A 1LRTA 3T81A 4IOTA 2KZHA 4HSHA 3UXAA 4DJDA 3PC0A 1LBMA 3N4FA 1KCXA 4DF1A 3WLLA 2CZDA 1EQPA 2FZ9A 4KRZA 1SVDA 2IXUA 1JNDA 1XL9A 4LAMA 2G96A 3VGFA 1VR6A 2RKXA 1YHTA 1TQXA 1XSJA 4R7WA 1E3XA 1K3UA 3N4AA 2ZX6A 1PKLA 3BH4A 4C6PA 4F8XA 1FBAA 4WQ6A 1OFDA 4O8RA 8CGTA 3N73A 4WKFA 1CBGA 4QGCA 2CPUA 2FZNA 3MC5A 1R46A 4MY8A 4LSBA 1WQ5A 2E1WA 4O17A 3PJWA 1A5BA 2EKGA 3F4WA 3WK0A 4JN6A 3OU8A 1YTKA 4M5PA 2XFYA 5HR7A 1GG0A 1BF2A 3WQ5A 1F3TA 4ZO8A 3KBWA 1R3RA 1VC4A 2F8QA 3DC0A 2ZQ0A 1GVSA 4X9SA 4KFPA 4AW7A 1TCMA 1I8JA 3PS7A 2XGIA 3H12A 4QE1A 4PBFA 3U4AA 3UZYA 3CC1A 1QNRA 5HQMA 3LRMA 1ZY9A 3NURA 4GUGA 1SSDA 4GJ1A 5BOFA 4INFA 1OFPA 2EPLX 1S46A 2GJRA 1TA3A 3IIZA 1O60A 1GGOA 1P7TB 1QW7A 4P7LA 2VMFA 4ML4A 3H7RA 2NX1A 4KRUA 3NM3A 4RPPA 1OFRA 3H6OA 2E8ZA 2WNNA 4CVUA 3GC2A 3GIYA 3QMTA 3M6YA 2A6NA 1DJXA 1QOXA 3VIIA 4NQ1A 4MY1A 3UY8A 2PU1A 3ZYZA 3D6NA 3VDAA 2GSJA 3T2QA 1SZRA 4QX4A 1C7SA 3R0DA 1E5JA 1CGUA 3NSNA 3NEVA 3GZAA 3KBVA 5C2GA 1DHPA 2PD9A 2RDXA 2GQ8A 4BF5A 2R1NA 4PMXA 2PE4A 1NF7A 2WKJA 1D8WA 4FAMA 1JZ7A 1F3XA 4ZQNA 3LGEA 1XYFA 2PGWA 5I77A 3ARYA 3WSUA 2W0UA 1VD6A 2EKCA 3L2IA 3LEPA 2DSVA 3IIPA 5DCEA 1S3TC 3BGGA 2OLSA 3WLHA 1RK6A 2X42A 3APGA 2PWUA 3B9OA 3G77A 2VUNA 3KVKA 3AZSA 1XPGA 2A79A 4DBUA 3W28A 3NCOA 1EDGA 3E5BA 3MCMA 1VBJA 4J1OA 3WBWA 3USZA 5FF0A 4BQ5A 4NXKA 3NZRA 4JDBA 4MG4A 3EB2A 1XIHA 4JTKA 4L4LA 3XISA 3PPHA 2D0GA 1VPYA 3CAKA 1T5AA 4JFWA 1GW9A 3N2CA 1TV7A 1ONRA 4Y6GA 2FB3A 1GONA 3EWBX 4IGSA 4H04A 3OIHA 3AMKA 1X98A 2DSZA 1PHWA 3LHVA 5BXSA 3WFZA 3GKFA 3WG6A 2VFDA 1V0LA 1MMFA 1NDVA 3VC6A 4LU0A 3AQUA 3CAVA 1BQGA 3SN0A 2DIJA 4XZWA 4GK8A 1XDJA 4H9YA 3OBEA 4Q7BA 2J7FA 3VU2A 1XSKA 3CL8A 5HOSA 1WDRA 5D9NA 1BXNA 3AHXA 3CH0A 1HZYA 2CLKA 1OGGA 3B0YA 1AH3A 1JFXA 3IANA 1UUOA 5LYRA 2CLLA 3CB3A 4O0KA 1PWLA 5FJRA 5TBOA 2BP1A 1P0BA 4F48A 4JEQA 2QHAA 2B81A 2RJHA 2Q3RA 3WO8A 1TWIA 1MZRA 4R27A 4D8ZA 4Z2KA 1D2KA 3KBMA 3VZXA 1H09A 3T8QA 3CQJA 4JKMA 1Q5MA 1PIIA 5I5RA 3CZLA 1HO1A 4JIHA 1IR2A 4HN4A 2Z4GA 4NUWA 2R14A 3FSUA 2BSLA 3K4DA 1EJXC 2ESCA 2C13A 3C0QA 4KGLA 8TIMA 3NQGA 4JD4A 4XKYB 3RAOA 4LEFA 4E8CA 4GGHA 2NX9A 1JCJA 5F1VA 1AMYA 5C7HA 1W0MA 5DN1A 1R0MA 3SRHA 4UFLA 3WK3A 1KBBA 3QKZA 3QVQA 5C71A 3QMRA 1RLDA 4C6MA 1TWZA 2HK0A 4E2BA 3S2MA 1LYXA 3W85A 1UR1A 1R3YA 2GUUA 3ISIX 2CESA 2WHMA 3EDDA 4YU1A 3CHVA 3P7YA 4PFMA 3VTRA 4IGMA 2GVLA 4ZB2A 1GYNA 2C3ZA 1X7FA 3IJ7A 1ALDA 2PDGA 4LVGA 1KKOA 2VWTA 4M0XA 3ATZA 1NM9A 1W1PA 4O19A 2PDIA 3A4XA 3C61A 1XICA 3F4VA 3T7VA 2ZOXA 5CBIA 5ABFB 4NSBA 3WQ8A 2A3LA 4K1WA 1R38A 3M9YA 3LDVA 4XZBA 2XVGA 3LPPA 3B0PA 1BXBA 1E6PA 3TSMA 3FA4A 3KBSA 4WJ8A 2WM1A 5JBEA 1HT6A 1XX1A 3NOYA 1KFJA 1Z7AA 3RM8A 4Z1YA 3BLPX 2PTWA 4M81A 1A4LA 5T91A 1LWIA 5LZLA 1EJ7L 4GIAA 1N8FA 1SYTA 3MUAA 3U2OA 4AQLA 4MKVA 3O63A 4P7RA 1JZ4A 3W7KA 1EUNA 3EMZA 3LENA 3G0XA 4X61A 4D8LA 2DSUA 4BY3A 3HQNA 3AYVA 4CU8A 2RDTA 5FI8A 3LYEA 3WLOA 3CQHA 3PBUA 3PB0A 3HFTA 2V3EA 2ODOA 1KXHA 2JKAA 4JR5A 1F76A 3N25A 2HEJA 1BTCA 3FCPA 3T44A 3MTWA 4D2JA 1HIZA 3TTSA 2OVLA 2QJMA 1BG4A 2FFCA 3EXTA 3FXYA 2XU2A 1JF6A 4AZ6A 5XIAA 3WUBA 5AKQA 1OK6A 3TVAA 1UKOA 2NLYA 2O55A 4EK7A 3CAWA 4TMCA 1YPXA 4C90A 3EWUA 4DF2A 3WL1A 4Z2GA 3WCZA 1AA1B 1VGAA 4QDMA 1IT7A 1DKWA 7PTDA 4DO5A 4TV5A 2FB2A 2PA6A 3BWWA 3M44A 1DQUA 2CLMA 3QV6A 5CC5A 1PS9A 2BFGA 3OZOA 1R6WA 3TAKA 2J7CA 4ZE5A 5RUBA 3EA2A 5D03A 3W84A 1LQ0A 3F4DA 1XQKA 1K4HA 3KWSA 3PP7A 3VX1A 1EPXA 2XGBA 3OBKA 1E9ZB 3BMVA 1R3SA 3S46A 1H2JA 2O7SA 4NY2A 1N2VA 4ATWA 4I7WA 1OJXA 3NAVA 4GJIA 5CJMA 5KITA 5BCAA 2A2IA 1P43A 4GY0A 2V5JA 3XINA 3OTRA 2Y7EA 3PSWA 3H2MA 3FYYA 3VNIA 1KRMA 3KL0A 1XG4A 4HZ8A 4ZEPA 5AHLA 3VKBA 1R86A 4C1LA 4ZTYA 3M0HA 3VM5A 3WKZA 4LVBA 4JL2A 1UKSA 1DWJM 1A0DA 4L1WA 3VINA 1LUCB 4GQBA 1ONWA 1HVQA 1X7IA 2E6AA 2QUTA 2WVTA 2WCAA 3LZ5A 1EEPA 4IX2A 4W86A 2LLEA 2O4QA 3LHZA 4FX6M 5CPLA 3TSDA 5HUOA 2QV4A 3PZQA 1N7KA 4PUNA 4QG8A 3IACA 4K38A 3RX3A 3L0KA 1F9CA 3DG6A 5GQBA 1RH9A 3UNDA 1M7PA 4ICMA 2HK1A 2E5DA 1TJ1A 4HK7A 1MI3A 1H4PA 2V3DA 1RALA 3HGRA 3TW6A 2GLKA 4HU4A 2WMIB 1KD0A 2FZBA 4IL2A 4MMWA 1PB0A 2E9MA 1KFCA 1UD3A 3E0IA 4D6GA 3G24A 4LW7A 3SB0A 2BVYA 5A6BD 2Y4SA 5G1TA 3UR2A 1XJBA 1XIDA 1JGIA 1O1ZA 3HG2A 2B7QA 4QJ1A 2WMJA 4BI7A 3TDFA 3MBDA 4PMOA 4TR9A 1AQ0A 2VCBA 3M0JA 2GGIA 4JNMA 5FD0A 4G7FA 3OQ8A 2FPTA 4X22A 1YNYA 2I9EA 3PPGA 5REQB 5CSSA 3A24A 3S1WA 3DFSA 4DI8A 1XLHA 1JCYA 1Q13A 5HPOA 1Y65A 3W88A 2BHZA 3CWOX 4L9XA 1ML1A 2PDJA 3IGHX 4J3ZA 5HINA 4H7VA 5G4WA 1LDCA 2DH2A 5TAOA 4NNAA 4F0MA 4DJEC 4UNKA 5AECA 5AOUA 5BYWA 1Q6GA 1JDCA 1WDSA 1J6PA 3GH5A 1C8VA 1ZAHA 4GPNA 3DXIA 1Q7ZA 3IV3A 4XZMX 3WQ4A 1HW6A 4H8HA 8A3HA 1P0EA 1TJRA 4J5NA 4LWWA 3CUHA 2Y7FA 4M19A 1G1YA 2WHLA 5DBUA 2BZNA 1KRBC 3D0CA 3LPFA 4I9MA 3GB6A 2GGEA 1SR9A 1FHVA 1T7LA 5J5DA 3O9NA 4HIBA 1H7WA 4W7UA 2DPEA 1U83A 1Z48A 1VFFA 1HKMA 3NG3A 2W61A 1SW0A 3LCXA 2A5HA 4MUPA 1PPIA 4D6DA 2ISSA 1WZKA 1U1UA 3W70A 3A4AA 4FXRA 1JPMA 4KCVA 3UT0A 2HISA 4PODA 4QITA 1DJGA 1LWJA 3LTPA 1YX1A 4DBWA 1TZ7A 2EPKX 3R8HA 4B5NA 1LTDA 1V02E 1FWDC 1I2RA 4Q8PA 2L5HA 4TIMA 4Z42C 2O7QA 1Z8AA 1AW5A 3W7OA 4NP7A 1DWHM 3QEZA 1R9ZA 4YPJA 2Y8VA 2VEIA 1FCBA 4C6LA 2R1PA 5E0KA 2QVNA 3U7BA 4WGHA 3S1VA 2VX6A 1OC5A 1Q2SA 2HZGA 3CYVA 2YIHA 1W1VA 3I6TA 4U2ZA 1E0UA 4GWEA 4LALA 3DESA 5J04A 1R9YA 3NL3A 2DDXA 3MVTA 2V5KA 4LUTB 2JGQA 2QEZA 3R13A 1QI3A 2Y24A 1FWAC 1ADOA 3LLXA 2O9PA 4Q8WA 3BLFA 3IAQA 2QT3A 1GHSA 4CEXC 1UB3A 3PNUA 2JBMA 6XIMA 4QSFA 3I6RA 3NDZA 3HMCA 2OG9A 3VD7A 2VT0A 1PSCA 1BKHA 1GVQA 3UWYA 3KLKA 4E3VA 1T6MA 3P8JA 3GU9A 1KW1A 3V16A 2P76A 2GOKA 3DH7A 1W9XA 3S42A 2ZX9A 4X0NA 4N4QA 4IHCA 1A5CA 1JPDX 4LFYA 3UJRA 1PEZA 3NQVA 3C0JA 3GX9A 5C5YA 3GG8A 2I7GA 5CPOA 1WPCA 3SGGA 1XUUA 4L65A 3MQTA 4JL1A 4N2YA 4PB4A 1MO0A 3VMNA 4P8XA 4GX8A 1QXLA 5BW6A 2CC0A 1C8YA 4KEVA 4RXGA 2DORA 1UZ4A 2WMFA 1DXFA 2QCNA 3UGRA 4OUEA 4EAMA 3CZGA 2BV9A 3PUGA 3W4RA 2FDMA 3QQ1A 3GU1A 5CC7A 2GK1B 5HPCA 4NI3A 2A21A 1YE4A 1KA9F 2Q3OA 5A3HA 2V38A 2BVTA 3VE7A 2ZA3A 4XB3A 4LVAA 2AQOA 3MMWA 3UZ5A 3MP3A 4ZR8A 1XM3A 1IR1A 4KEZA 4XQ6A 5FJTA 3SW6A 4EP8C 2CZ5A 4PBEA 2A7RA 1KXVA 4V1XA 3RITA 4ZO9A 1IZCA 1L0PA 2WWCA 3E0FA 1DBTA 2QJJA 3K2GA 3WZ0E 1YDNA 1AZ1A 3TYDA 4JTRA 5LA2A 2ZZ3A 2PLJA 2CIPA 2AL2A 1Q3NA 3ALGA 5EKYA 2D2JA 3W7NA 1EJVC 3IJLA 4DYJA 2CFFA 1GPFA 1I45A 1OFQA 2PWEA 3MHFA 1QJWA 5H2ZA 4C60A 5FACA 1AH4A 1E9YB 3NQFA 2YCEA 4UZUA 2NZLA 1HFBA 1ZAIA 4HNCA 4R88A 1H7NA 3OW1A 1RJRA 4KF1A 4JKKA 3RU6A 4UC5A 3B4UA 1A3WA 1QOQA 1B3WA 3M5XA 4YIWA 1QI0A 4YLWA 3BVJA 1IF2A 5AVHA 3B06A 3KOFA 4XAFA 2A85A 2WSRA 4PUMA 1V02A 3QLLA 4XX6A 4J28A 3W2MA 1UIPA 2VL4A 3LHUA 2P1FA 3C2OA 1BVWA 3MO7A 3IS4A 3QV8A 3SCOA 3TKFA 5LXEA 1QI2A 3NL5A 3RX2A 3KRUA 3O6DA 4RDZA 3RR1A 2GJLA 4O1EA 3K8MA 3AJ7A 3A4JA 2O9TA 1ME8A 3KVLA 2FGLA 3GM8A 3PANA 1NFGA 3WQEA 4GUJA 1NQKA 1OABA 4WX2A 1Z44A 3AXXA 3KOXA 4XTIA 4B4FA 5BWAA 2P53A 4A8NA 4RX0A 1E56A 1HP4A 4YYFA 4GZJA 3VOIA 5HNNA 2FVKA 2NVCA 2AKZA 5BXRA 3AMDA 3FLUA 4I8YA 1EA9C 3A5VA 1OINA 3BLDA 2OODA 5A6SA 3PWIA 4WRHA 1UJQA 1R2SA 1TWWA 5LKYA 3LK6A 2SFPA 4C6BA 3QN3A 4EACA 1TCDA 1H50A 4S3CA 3VIKA 2H8ZA 3FKRA 1F4HA 3O16A 2ZRYA 1DJHA 1PHQA 2NQLA 2EPHA 5AHMA 1S5MA 1E51A 3CEPA 2XVLA 1XLEA 3N19B 5E6YA 1V93A 1LZOA 5IHRA 3N14A 4GI6A 2V5BA 5LIKX 4HSOA 2NSOA 1BYCA 2UBPC 4Z08A 4AIBA 3AUOA 1UZDA 1LLOA 2YJQA 3EKLA 1E9LA 5HJYA 1EF2A 5DMLA 3C8NA 4RZBA 3M43A 3C4UA 4LRTA 2F9RA 4GXPA 1W2VA 2OZTA 4HJWA 4B2DA 1QAPA 4ZO7A 1V3KA 3GWQA 1V7YA 3CLWA 1A5KC 3R8RA 1HKKA 5I3GA 4H00A 1E70M 4XKMA 3GVWA 3WF0A 2OOFA 1JXKA 3E0VA 3GDRA 3IJ6A 1GOIA 4TX6A 4PGLA 1OIMA 1UIOA 3WNOA 1THFD 3JU2A 1JXJA 1UD6A 1J0KA 3F7JA 5GJMA 3WQWA 3CT2A 9XIMA 4UTFA 2IMRA 3HOJA 4U10A 1UD4A 2YOCA 3HZ3A 5AC7A 1GJPA 1BRLB 4I6KA 1NWUA 3AU2A 3STEA 4XWUA 3TROA 1DL3A 3MT1A 3W2JA 3WNKA 1E5NA 2Y7GA 4PE8A 4MNJA 1EB3A 4S39A 5EA9A 2Y5JA 1YIXA 1XW8A 3ME3A 4DPQA 4LF2A 2GYIA 3NQAA 3OVQA 3KFTA 4R85A 3WD3A 4UTTA 2DT0A 4AZHA 1CCWB 1NEYA 1KWGA 5BRBA 1A4MA 2O92A 5REQA 3NVTA 2BNJA 4LCRA 4RNHA 2GSHA 1UZHA 5BOOA 1R3TA 3FIGA 1AD4A 5D38A 3APTA 1BXCA 3VOCA 2VI0A 1X8FA 2O4MA 4UTUA 3H4GA 4HZ6A 3SZ8A 2ATMA 4JQ3A 2ACQA 3HO8A 3GHRA 3EX3A 4BCEA 3OLEA 1WKEA 1CLKA 4GC3A 1KV5A 3PZIA 2AGTA 3UR7A 5E1QA 1XC6A 2P8BA 3RM4A 2QDDA 2FZ8A 2Z1BA 2VCCA 4CQ9A 4FXSA 4J40A 2PI6A 3P62A 1TJ2A 4H41A 3GTIA 5IFPA 3C2RA 3W2UA 1AK5A 2VEGA 3GLCA 1K9EA 4I7UA 2CKRA 1RBOB 2ZX8A 4AD3A 3Q4DA 3TYBA 4DF0A 4UOQA 3KTCA 3O6YX 4Q4SA 3EOEA 1Q2RA 3NM1A 5IOBA 1E73M 3TLLA 1SO4A 1UP0A 2HE5A 4AZIA 3OHIA 2PTZA 4JFVA 3W53A 2OCZA 4XAZA 1MW0A 3CMGA 1XS2A 3MI6A 2ADAA 3WX7A 2PDFA 2OSYA 4H6EA 5CC3A 1QOPA 2PD5A 3WLKX 1XG3A 3L4VA 1V6UA 2GVEA 3I4KA 3H7VA 4AHPA 3ES8A 4PN2A 3SUTA 1J0ZA 4QQ3A 1HL9A 1R3QA 3RLHA 3QTPA 4ATDA 3A64A 1BQCA 1WBHA 1C9DA 1L2QA 3T0AA 3TR2A 4DLFA 2XHYA 4B92A 3WUGA 3N04A 3M16A 4A2RA 3MV01 4DUOA 2CLIA 1VHNA 1I0DA 1E55A 3IGUA 3N34A 5I07A 3QY6A 1BYDA 1XLKA 4UFHA 4FR6A 2EJ1A 1DP0A 3FA5A 5MF5A 3R94A 4H9XA 4W5UA 3A9BA 2OPJA 1L6YA 4XD3A 2VEMA 3G1SA 2DZWA 1HQTA 1E1FA 4LYPA 1BD0A 5FEPA 4IP7A 1KTNA 3KWXA 3AIBA 4AZ5A 4GGBA 5A8GA 3DFHA 1L9WA 3P5ZA 4LAOA 4E8GA 1XKJA 5MKGB 3MMUA 3NR0A 2HVNA 4AEEA 1EH9A 4DX3A 5BZAA 3MW7A 4N9BA 1YDOA 3LN3A 2B4GA 5U4NA 3M4HA 3TMQA 1R3WA 4YHGA 1W37A 3TTOA 3UZZA 3A3WA 3W1AA 3GDLA 1YTEA 4K7YA 1ZP3A 4MM1A 1B1YA 5TIMA 1G67A 3GC4A 4GUHA 5DT5A 3IWPA 3KL3A 1V3MA 3EPNA 4RNFA 3DGRA 4OFCA 3KZPA 4IT1A 3HMJG 3QQWA 1UD5A 4K8EA 2QXWA 1KGWA 1RP8A 5K2ZA 4GE8A 2IPFA 5EY5A 5FEWA 2C8NA 3PM6A 1PX4A 4LUJA 1Q8JA 2XUCA 3RILA 1C7TA 1NTHA 5C9XA 4TTGA 3BE7A 1JZ5A 3TQ0A 1CXIA 4B91A 4WSHA 2DU2A 1ADDA 1CX9A 3QC3A 3HN3A 2C18A 3NJ3A 1JD7A 5BU9A 4Q8MA 4U28A 3VNZA 4GUIA 4MB1A 3H53A 4JTCA 5EMYA 1M03A 2ZUMA 3I7QA 1UOZA 2Z26A 1UASA 3AS1A 4ROQA 4ADSA 4V2XA 1MUCA 1MRAA 2VP8A 4IJBA 1EXBA 3SN4A 2CITA 3ABSA 2PDUA 3BQ5A 1Z32X 4PTVA 4FEZA 2D2OA 3TNBA 5DY2A 3WH8A 3R7MA 1ZJHA 1ELSA 2NV1A 3BJSA 3R12A 2ZVIA 4KBXA 1TKKA 1LL4A 3NUKA 8XIAA 3NQEA 2YBUA 4UTKA 3P81A 1MNZA 3TN4A 1A0EA 4KPLA 3U9IA 4Q7IA 2XN0A 3COTA 3BQ6A 4HHLA 1ZGDA 5FJOA 4P8VA 3OYXA 1JAEA 2QLYA 4TU1A 1RQBA 4WEVX 4NYYA 5TD4A 2CZFA 2I5GA 4M6UA 5B7ZA 3G1RA 2PWGA 1SFJA 1PV8A 3L2LA 3NPXA 5AHIA 2OTDA 2WSPA 1JD9A 2EPMX 1NDYA 3AXKA 1JQXA 2BVDA 2XIMA 1RV8A 1B3VA 2VNCA 4RV3A 5A2CA 3E0LA 3TOYA 4M3PA 5CGMA 5EYWA 4ERIA 1P0KA 1NAL1 3FHAA 3WMCA 4QLLA 3CZEA 1UKQA 4QR6A 1WCGA 4FNSA 1QW8A 2PTXA 2YDSA 3TYAA 1XLJA 1PTAA 1WXZA 1DPMA 1EC7A 2CETA 1BAGA 2P3EA 1HO4A 3PJUA 4M6VA 1NY1A 2I17A 4H6KA 4EF8A 4GOAA 1B5TA 3ABQA 1GKPA 3K1DA 3MSYA 2RH9A 2VQTA 4RZ5A 1LWHA 2X0HA 1J0HA 4YTRA 1M53A 2I9UA 5D8WA 3L4ZA 4W8LA 1GQKA 1QATA 3ARXA 3AHVA 3GKAA 4AVFA 2ZC8A 1BWKA 3GXPA 5E5CA 3FGCA 4H6QA 1R85A 5BWFA 3SCQA 4PEKA 3WQGA 3VIFA 3NYDA 1WXJA 2J79A 1HJWA 4PRRA 4PZVA 4YTUA 2C1IA 1QW9A 1YDVA 3NZPA 3W72A 3LGDA 2O9RA 4DB7A 3UJEA 5I3KA 4WIWA 5A8QA 4HHPA 3RYSA 3IEBA 3I4EA 2XVPA 2P8CA 2WQPA 1BSLA 4H9VA 2ZE3A 3TV8A 1OFEA 4JBRA 4UQBA 5E93A 2DH3A 1TV8A 1PTDA 4US6A 1AJZA 3W82A 5CBJA 5EGRA 4CQ8A 3KW3A 3N29A 2CEQA 1Y0EA 3LLDA 1A49A 2XN2A 4Q8QA 1WDPA 2ZC1A 3QGVA 4JCMA 3MP5A 4JTJA 1A5OC 4RV8A 1SJAA 4HMNA 4BR1A 4DM2A 2ZTKA 4V28A 3H4XA 1O95A 3EX4A 5CQ1A 4FXJA 1WAWA 3GDKA 3VI2A 2BG5A 1AZ2A 3K4AA 2WZHA 3WDRA 1RD5A 4GNKB 2G0WA 1VH7A 4XSMA 1WDDA 3DGBA 5E09A 1F6KA 3N18A 3KHDA 3WD2A 3IRDA 3PZMA 4KCUA 3GNDA 1FWNA 2W9MA 1XYZA 5PTDA 2XSBA 3OVPA 3AYSA 3NSMA 4E4FA 2WMKA 2AQVA 1KKRA 1VRDA 4NIRA 1VF8A 3ENLA 3LQGA 4PMVA 3BW4A 1XLAA 3B8DA 1A5UA 4ZMGA 5DMYA 3VKDA 3EKZA 3VIHA 1I2QA 4I9TA 1XH1A 3GY1A 1EKOA 4I8DA 4DVOA 1ZBKA 4UZSA 4DUXA 1P5BA 2C0HA 4A3QA 3MO4A 3GXDA 1TTPA 1LRQA 2OGJA 5G2IA 1XV8A 3VGBA 2ISWA 5DRCA 3M6DA 3SCRA 1JF5A 1OCBA 4TQTA 3AICA 3L12A 3GHTA 4PCSA 1L6WA 4CVWA 3UA4A 1GTHA 1D7FA 3SCVA 2P50A 2ZA1A 5G1MA 3C2VA 2E8YA 5D2VA 3WLPA 1VEOA 1R2RA 4J2MA 4XK2A 2HCVA 1NP0A 4HSNA 2DEPA 3OA5A 1RZMA 4MPKA 1KLZA 1JI1A 3E2SA 3PB2A 2Z2BA 1FWRA 3ITCA 1FWGC 4GY1A 2JIEA 1JDDA 1SR0A 3A13A 2YL6A 4B5SA 3SIZA 3G1DA 3Q45A 3AWOA 4UUIA 1H41A 1LOQA 4E0CA 4L6HA 3W75A 1CENA 2VRJA 1OX4A 2VKZG 1TX2A 3UJ2A 3VOHA 2ZFAA 2PB1A 2EBNA 1K77A 1QNVA 1Q4NX 4P2VA 2Z1WA 5M17A 2DT2A 4PL1A 4YWSA 3CIWA 1L6GA 2UY4A 4IP5A 1ZUAX 1EJSC 1KB3A 5C9UA 4Y9OA 3FK4A 4QLJA 2AGKA 2YXXA 5D09A 1A80A 2Z28A 4QHRA 3EB3A 1HGWA 3KEHA 1MEIA 3PZOA 3L67A 3L4WA 3DHUA 1RBLA 4HNNA 4CQBA 1BWVA 3UFYA 3LERA 1GYLA 1ZP4A 4WK9A 1CT5A 3NZ1A 3ZT7A 4WD0A 4HK6A 1G01A 4R34A 5E9XA 3G0UA 2DUAA 5ENLA 3EX6A 1DE5A 2D3LA 4FLRA 4PCFA 4F3HA 1MQPA 3L0GA 2VZOA 3M47A 4W8BA 3QF0A 3TEVA 3EAUA 1PYFA 4QAIA 2Q6ZA 1GVIA 3W00A 1XCFA 4BQ3A 4A8IA 4KFOA 2WMGA 2OFJA 3FA3A 1SM9A 2ISVA 2Y0FA 4NAFA 3TW9A 1H51A 1OG0A 2WXDM 1XYAA 1M7JA 3W1TA 3KOYA 5KETA 1N8IA 2IKJA 1X38A 3QY8A 3SCNA 3HGOA 1ZJIA 5CZJA 4GFSA 1TSIA 4CNTA 2QV5A 2DZAA 3R0UA 4HA1A 4KIRA 3L2MA 4N6FA 3G1AA 1SJCA 3SCUA 4PSRA 4Q22A 1HKIA 1DE6A 3V0TA 4NRRA 2FVLA 3M64A 3WF4A 4YXGA 2PBOA 5D04C 2VEKA 4Q4PA 4YCOA 2HRWA 3QC0A 3KXQA 3VNYA 4HNLA 3TR9A 2OQLA 1JG9A 3CXOA 1DWGM 5CPSA 3F03K 4ZZ9A 2GJPA 1BYBA 2G3IA 1XLIA 2GDVA 3AHYA 5I09A 3AJXA 3BCFA 4IIFA 3SGZA 3PUDA 1K02A 4UTLA 5EBAA 1Q6DA 2NWSA 2X09A 1IXPA 3RK8A 4HMDA 2DZBA 4MJZA 3W76A 4Y9MA 3T42A 3MANA 3KVJA 1CLXA 1GJWA 1LLWA 4G7EA 4MYAA 3RCMA 2R91A 5I24A 5D8ZA 2NUXA 4ZSUA 5HNUA 3VMOA 2PWFA 3CUJA 4HB7A 4RJEA 3TX9A 5FEXA 1CXHA 5G1YA 1MUWA 1V6TA 3RLGA 3WJSA 2DT1A 4D6FA 4MZ1A 1TREA 1UHVA 5F2GA 2ZXQA 5I0DA 3KLLA 3A22A 4UBPC 1W1YA 3GAKA 3VKKA 3IJ9A 4O57A 2FIQA 3MB9A 1OD8A 2BXYA 3EOLA 3W29A 4IX0A 4E5TA 3OZYA 3DFPA 1KM0A 2W3ZA 3TZFA 1WNOA 2E40A 3NQ6A 5HJLA 1TUXA 3CK5A 2V2CA 4DWDA 1HJSA 2QYGA 3C52A 3GG1A 4OECA 4S3FA 4U3CA 4C5ZA 2OELA 1GOKA 2E1DA 2PDMA 1WBJA 3VCNA 3VD3A 4AH7A 4F2TA 1OBAA 5CZKA 4L6OA 2VC9A 2QAPA 4URIA 5BRQA 2POZA 2PGRA 1K8ZA 4UTJA 1B4KA 1WA3A 1OF8A 2VOTA 3ZLHA 4GO9A 3EEGA 2WW5A 4FB7A 3PF3A 3AO0A 4AIUA 1UWUA 3KCOA 2CLOA 4PTWA 1NP2A 2YFNA 1ONXA 4JHMA 4FNQA 1G9HA 4NU7A 1KFBA 2ZRZA 4PMDA 3HFYA 3HPFA 3VDHA 1WV2A 3IAPA 5G4HC 3MJMA 3O1NA 4FR1A 1WOBA 3ZLGA 4PMUA 1A5LC 2YDRA 3SO7A 3FW6A 3PFMA 3PSVA 2QNEA 3FHQA 2DJLA 4LBSA 3TC3A 3N3MA 1QFEA 3PPCA 5JUVA 3OJGA 2OU4A 3ZZ1A 5LIWX 3KM8A 3U2CA 4XO6A 4XZ9A 4Q3MA 4AD5A 1GZJA 3RF9A 1OC7A 5D32A 4QS5A 6TAAA 3H23A 4CNUA 1JULA 1W3HA 1NH6A 4X60A 4FX7A 3QM3A 4FNUA 4N0RA 4WDWA 4QQUA 2OO0A 2WNZA 4WKHA 3T8LA 2UY5A 2XSAA 3EYPA 2FHCA 4J3XA 5FEZA 3WEMA 4BZYA 1OX4B 4BJHA 4H1ZA 2PDNA 1DV7A 3VPLA 1Z42A 3U6WA 3UA3A 1MRQA 3UWUA 1PX3A 1AJ2A 2QJIA 2FGZA 4CCDA 4L9ZA 3BO9A 3ANUA 1XYLA 2WC7A 5I00A 3B8SA 4S3KA 1O6IA 5DMMA 2V68A 3BLOA 5FF7A 3MJYA 4GABA 1BPLB 1CB7B 3KE0A 4EPEC 3VZZA 3DHPA 3VD9A 3NEHA 3AYRA 5CLTA 4I90A 2Y8KA 5HQLA 1XUZA 5DFAA 4QG6A 3CIXA 3DG7A 3ZJKA 4AX6A 4BA0A 2Z24A 3QZAA 3N11A 5LA1A 1K1DA 1PYMA 4MLJA 1U1HA 4DXXA 2GJXB 4RE2A 3VD4A 1CWYA 4C6QA 1W8GA 2PGEA 1ZSXA 3W22A 1B4EA 4YJ5A 1T8XA 1QNOA 2GL5A 2QMKA 5H1WA 2YA0A 4Q7NA 1AFSA 3QOMA 3E2QA 1UWAA 1EWEA 3AMLA 5TQLA 1PX8A 2ANUA 1FP9A 1XLFA 2AQWA 4G8TA 4ZQPA 4S3BA 1ZLPA 3ARUA 2YDQA 1KM5A 1P0NA 2YB1A 2C6QA 5G4EA 2DZPA 2IQ0A 3S83A 3VGEA 5FAGA 1KCZA 2PDPA 2WZIA 1MZHA 4O1CA 3BURA 3V5FA 2V2DA 1J0YA 3AFBA 3WQCA 5I06A 3NQ8A 1HG3A 3AAMA 2E5BA 1J93A 5JMUA 3H2FA 1YE6A 3EDKA 2VD9A 3P74A 4K1GA 3CV7A 4JGDA 1EO7A 1R8LA 3VUSA 3WLMA 3I68A 3GNNA 3UZJA 1EEXA 4AD1A 4DN1A 2D2HA 3W71A 3LMYA 1MDLA 3UPMA 3L9CA 1A50A 2RGMA 3NQCA 2QCEA 3TP4A 5C0QA 3PAOA 3SCSA 3G18A 4HJFA 3WJYA 3AHTA 3H2NA 4UFMA 4TX9A 5CAHA 2C16A 4EAYA 3VMPA 3TNOA 4C65A 4Z1AA 4Z2IA 1KBKA 2F6UA 3T05A 2IKGA 4Z0SA 3N2TA 1XWYA 3ZMRA 3ZQ9A 4U2YA 2AMGA 2VZSA 4LXFA 1TR1A 2O9OA 2CBVA 3DN5A 5M03A 5EMLA 4UWMA 4Y8EA 4MJMA 4ADTA 3TQPA 4OBRA 1MXSA 5K9CA 4A8LA 5M1TA 1WAUA 3S3GA 1LT7A 1CPUA 3ZO9A 4PUUA 3ITLA 3TW7A 4UCFA 5D9MA 3AMCA 2ZWZA 3OIXA 3A23A 4RNJA 3WFLA 1O5RA 1JJKA 4P7NA 1UROA 2V3FA 4G1KA 2E77A 2WVUA 1H11A 4XVDA 4NZCA 2XSXA 2EG8A 3B9DA 5EMKA 2V8ZA 3GSMA 1O66A 2IW0A 5JBDA 1TMQA 4DWSC 4CN6A 4LUTA 4UQ9A 3D47A 1K8XA 2Z6JA 4L4MA 4H2CA 2ZIDA 4KCWA 4QSHA 1LQ2A 4D6JA 3MPGA 3ZM8A 7CGTA 5CZ0A 4RR4A 3R79A 1TMLA 1FHLA 4TXEA 3O06A 1EJTC 2UWFA 4GA8A 4O28A 5D2YA 2WZTA 3C8FA 4CKQA 3MDWA 3VNJA 4GY7A 1ECEA 7TIMA 1EWDA 1RA0A 2ZKMX 3BICA 1FY6A 1EDTA 5D02A 1TJPA 3BSMA 1FHDA 3SCTA 1X96A 2E25A 4R9XA 1IIHA 3M7SA 1KRAC 4LTSA 1GKQA 4S38A 3S2JA 2ZX7A 3P0XA 5LSMA 2JKEA 3KP0A 3PZTA 2GUBA 2R82A 1XIMA 4I3GA 1FXPA 3PN8A 4AXKA 2PDXA 5AYXA 4V15A 4WVXA 3W7HA 4IGNA 4J3SA 4Z2JA 4MF4A 3BTNA 3RG6A 3VIGA 3M0YA 1CIUA 1K70A 4C6OA 4PTMA 1ZZMA 4E38A 1P6BA 4CNNA 3G8RA 2QGHA 3OQEA 3TN3A 1GT8A 4AHQA 4OWGA 5HDRA 3W86A 2J7BA 1R7AA 1XLGA 3F1QA 2GGJA 1AD1A 1KQYA 4JHZA 3BLIA 3RMEA 3S2NA 5AYBA 5KZMA 1P6WA 1ZS2A 1OYAA 4NZ5A 3H2OA 1BYAA 1VBGA 2OWXA 2VURA 4GD0A 1CZ1A 4TVDA 3O07A 3O15A 1ODZA 4QP0A 3ABOA 5IBXA 1XYBA 1UQYA 4KH2A 3U2ZA 4CQAA 3AXMA 2XIJA 4LCSA 3UEQA 2GQ3A 3G8EA 1UPMB 3E02A 4IMEA 4LANA 1D3CA 5C70A 3W1UA 1DORA 2PS2A 5CSUA 1BVNP 2BY2A 2H8XA 1ZBWA 1ZU8A 1YXCA 4K2SA 4LUYA 2REQB 3TU9A 3WK1A 3SQLA 3LX9A 3E12A 4NAEA 1HN1A 4LBRA 1MXGA 1IZKA 3B0VC 4PTDA 1PVNA 1ECQA 5BMWA 2X1SA 5CZSA 5LGZA 1TPDA 3LM3A 1Q7MA 1VFLA 3DBNA 3Q2DA 3IVUA 1UP2A 2VXNA 3GXNA 1CXFA 1X6LA 1FKWA 1GOOA 5T8GA 5HK4A 3GR4A 3LXAA 1GQNA 3DENA 6REQA 4DEFA 3M7WA 1R87A 1GZGA 3D46A 1O1HA 3MSDA 3NL2A 1MVYA 2J77A 3URQA 1NF0A 1CW2A 4ZXLA 1LG2A 3S5ZA 1EOMA 5A5WA 4NJIA 1E6NA 1W32A 3WL0A 1SO6A 3FEMA 4BEUA 3R6IA 3FVMA 3SSJA 4TVCA 4A22A 3FYOA 3DFQA 1XFCA 4F4RA 1ZQ5A 4ACYA 1R5YA 2PDBA 4R3UA 1UBSA 2Y63A 2BOFX 1W1A1 5FOOA 1KO0A 5M2FX 1PIFA 5A95A 4NJKA 1ENUA 2YB4A 3B8UA 4AF0B 1W56A 9CGTA 4JOMA 4WJEA 4JN8A 3UERA 1AMKA 3W7DA 1W5MA 4PUEA 2W4XA 4MNKA 3QBUA 5C9ZA 4BI6A 1IQ8A 4HGXA 4I5RA 1UD2A 4M7SA 1I2PA 3POCA 1JCMP 3TN5A 4Q4KA 4M82A 2XH2A 1VAHA 5JU6A 3TSBA 3QV7A 3ZSSA 1OYCA 1DIKA 4ACZB 1S2UA 4LVFA 4XZIA 4DXKA 3WLIA 1T99A 4IPLA 2VDGA 4GYPC 3S5OA 1SO5A 2FVMA 1XRTA 3UGVA 3A3HA 2WOQA 4MZ8A 4ECLA 2ZICA 1VPQA 5KZ6A 5H91A 1VIZA 5E0CA 3OODA 3QQ0A 3GXIA 2HBXA 5HWMA 5I03A 2E7FA 4GKLA 4KIEA 1QI5A 1A5MC 1XDLA 1A3XA 5I3FA 1IXQA 1UR4A 4R33A 4FI4A 3L4XA 5HNRA 4PUJA 3GDMA 5EB8A 2BGSA 1RK5A 3W24A 3JRKA 4D9PA 3MUXA 3W73A 1I9CB 2HS6A 4Q8VA 3GVRA 4UNIA 4ZE4A 4O54A 2VR2A 1QUMA 3DDMA 4B5WA 4IJCA 1Q6LA 3MZ2A 3TCEA 4O52A 3WJWA 4JTHA 1M7XA 1XR2A 3Q65A 4GH1A 3W6MA 2G3FA 2WZMA 1TQJA 3LBMA 3FNDA 3N9SA 1UQZA 4W93A 4W84A 1SJDA 3TOPA 3TYEA 4Y90A 1IXOA 1XP3A 4ZVJA 2BY3A 3WK2A 4A21A 4F0KA 3PBGA 2RAGA 3BJTA 2H90A 1ICSA 1W91A 1TELA 4WUIA 5A8PA 3KP1A 2A3BA 1GCYA 4AIEA 2PFHA 1U22A 1A5NC 1DVJA 3GAYA 2W91A 1HF6A 1QT1A 2VGGA 4L1XA 2X1IA 1RCOB 1CXEA 1UR9A 1RPKA 4B5XA 2R1MA 1EFZA 4YN5A 3T0DA 3B04A 2XIQA 4ZL1A 4GHRA 5LNRA 1JUEA 3VNLA 3A5FA 1BSIA 1SMDA 3S6DA 3E38A 4MYXA 4OBSA 3VCCA 2MANA 3W07A 4UXDA 2V5LA 3MV11 3K5XA 3VNDA 2UV8G 3II1A 5FSEC 3W0KA 1DQWA 5DCBA 3RU8X 3ITXA 4JIIX 4HZMA 2F38A 4MWAE 1I75A 1VCFA 1ITUA 1VZWA 4D1IA 1F8IA 4JFTA 4H6RA 1PKYA 2OQYA 2I1OA 1JCLA 3K13A 1S39A 4KFNA 4QDWA 5FKYA 1XLMA 2X05A 2Z2UA 1K7FA 2CBJA 5AB3A 3OG2A 1SFLA 4G6CA 2ISFA 3D3AA 4O4VA 3WQPA 2BOGX 2J74A 2J78A 2TAAA 1XGDA 2FKPA 4YVVA 4AYSA 3KZSA 5A69A 3SDOA 5CBBA 4LEQA 1I4NA 3G1XA 1E0TA 4ZA0A 3MKCA 3AUJA 3HURA 4UTWC 1TWDA 3W25A 4AY1A 1I1XA 1BG9A 3FV9A 3R10A 3JW7A 3TTYA 2HQAA 3OG3A 1Y8BA 2H9AB 2YXGA 1MFVA 1J11A 2REQA 1J79A 4FX8A 4EANA 3UPWA 2XIIA 2OOGA 1NOUA 4KGJA 5A1AA 4PMZA 2QCGA 1P1MA 5JIPA 2WPBA 3A4WA 1IHIA 4ZOBA 5JXQA 6TIMA 3C86A 3BZGA 4CQCA 2JE8A 1OFBA 4DNHA 2Q8XA 1LOSA 5ABEA 2W62A 1SMAA 4DLMA 4UR9A 4JNZA 4QLKA 5F1UA 4WF7A 2VX4A 4W5ZA 3TN6A 1R7OA 3TLQA 5LNUA 1ZFJA 1EZ2A 2OB3A 4Q6XA 1WOAA 2GJXA 2WVVB 1XXXA 1OIFA 2E68A 5C9RA 1H5VA 2GZXA 5DLCA 3CT7A 2DP3A 3WQOA 4KT2A 3USBA 3HB9A 1YDYA 1Z41A 1ZJBA 3CL6A 5F4WA 5I02A 4TUFA 4KWVA 1W3LA 5H6HA 4WDXA 2PF0A 4QAWA 2IQTA 1KFWA 1AQHA 3EPOA 3SUVA 2HPIA 2D69A 5KZDA 5BOEA 1ONEA 3XIMA 1XD1A 2FQIA 1G5AA 1WE5A 1VLIA 1VFTA 4B2DD 2BGNE 4DJFC 4PSPA 3OZMA 1FOBA 1NIUA 1TFVA 3NDOA 3EXSA 2Q09A 2G50A 1JYVA 3GH7A 3MWAA 3S0CA 2QCDA 2TRSA 2J4GA 3FDKA 2ZCGA 3OVGA 4ZFMA 2J13A 4MZYA 3P84A 4O11A 1GWJA 4IFKB 4RZ4A 2GGGA 3IJDA 1SQ7A 1EBGA 2OYKA 3KCJA 3WH6A 3BJFA 3LSBA 2PDKA 5CKSA 5DBTA 1OB0A 4ORMA 2QVHA 3WUEA 4ZOEA 3MKVA 3DKLA 1H63A 1TVPA 4Y96A 1YW1A 4IPIA 9RUBA 1UA3A 5LIYX 4YTTA 1QNQA 3QGAC 4DZAA 4LUSA 4FZIA 3STPA 4C6FA 1UWTA 4DUWA 1PL9A 2NT1A 1TG7A 3EOOA 5D2XA 3NO5A 3V36A 1BKSA 4GI4A 4Z2HA 2Y85A 3LU2A 4TOQA 5HJXA 1M41A 4DELA 1ZJAA 3PTKA 3T1GA 2VCAA 4L6DA 1U1JA 4XV0A 2HS8A 4DBDA 1KTBA 1JNEA 1QO2A 4C7GA 5D2TA 1N8WA 3K46A 3STFA 3LCGA 2GVJA 4JICA 5LGXA 2X2GA 3LPOA 4MFEA 3THCA 3FY1A 5LIUX 3CZ8A 4L5ZA 4LB3A 2FH8A 2XGZA 4QNWA 4NNCA 3VX0A 2X2YA 1GEHA 1O5KA 3K8KA 2BASA 3QR3A 4LCQA 1W9VA 4IPJA 1UMYA 1US3A 1YEYA 3SURA 4PC8A 1VIWA 3BG3A 3NQDA 4A8RA 1GORA 3QZ6A 4HMEA 3P3BA 5EMMA 3GNOA 4L1GA 1DJQA 4O53A 1JL8A 3V4BA 1PDYA 1V3JA 4MUZA 3B0UX 4RW5A 1CNVA 1FFQA 1XBVA 1S1PA 1KXQA 1VBRA 3FJNA 1VRXA 2BY0A 3T0BA 1EQCA 4MKNA 3QY7A 2Q8ZA 3K1GA 4UMBA 4M8UA 3AIRA 3S6TA 5FA5A 3CPUA 4Y7EA 4MKSA 4EIVA 3VIJA 2G5WA 4NZJA 1FUYA 3NZGA 1HL8A 4LH8A 4JYDA 4ZOCA 1DIOA 1K6WA 2NUWA 3AI0A 3W02A 4UB9A 4J7RA 3IIVA 1H0IA 1W9BM 1CXKA 2A3HA 4MGGA 4L80A 2J75A 1EL3A 2CBIA 3WD4A 3ZR6A 1KFEA 1VFSA 4REQA 3DYMA 4PRTA 2PPGA 3RN6A 4LC8A 3WDPP 2GQ9A 2BWGA 2E67A 3CIVA 3UWQA 4B5VA 3O3RA 3UZXA 2BY1A 2OZ3A 4CQDA 1H62A 3UESA 3BANA 3WQ6A 2Q71A 4EX4A 2HPMA 3EPMA 4IH3A 1M5WA 4LYQA 1RCXB 2VFIA 1W5QA 3GZ3A 5HMSA 3WYZA 1M04A 2QPXA 1IWBA 1EP3A 1VHCA 3QPZA 3ABZA 4LYKA 5F7UA 1J8VA 3WBYA 3QHMA 4O13A 5B7YA 2I56A 4IUGA 1FDJA 2BBFA 3GD6A 1NSJA 5H8MA 3LCWA 3CO4A 3VD5A 3P0WA 2WNWA 2VEPA 2AL2B 2V5CA 3CO8A 4IQJA 1MEWA 3TZNA 3J7HA 1CYGA 4AZGA 1YYAA 3EWYA 2QUMA 1G4PA 1OVDA 4O1DA 4NXSA 3W7RA 4JQ2A 1OCJA 4GIEA 3TWAA 4RE4A 4CCCA 2V6AA 3CAQA 3SFKA 4XD6A 4AD0A 2V63A 1V3IA 1YPIA 4GQGA 1CGXA 4BF9A 1V4YA 4WDUA 1FCQA 1EUAA 4M7TA 3A21A 3DEQA 4C1NA 3KDNA 2ZZ6A 3FJ6A 2OSXA 5DXXA 3QFEA 4HP5A 2HVOA 1FCVA 1OGBA 3WDQA 2TSYA 3DZ1A 3ZT6A 4F9DA 4H9TA 3WJXA 3B8TA 4MADA 3CUXA 1C92A 4GNVA 3F2DA 2FPVA 4I9JA 1Z6KA 4B9ZA 4DO7A 2EAWA 5CPNA 4ZFCA 4AFYA 3UYIA 1LRNA 1ISZA 3I3DA 4AUBA 4IM4A 1VEPA 2ONEA 3TWBA 2WZEA 5CJNA 3GO2A 1J12A 1JDEA 5LNSA 1V0NA 2Y89A 4O10A 5F4SA 1KM3A 2ZDRA 3Q94A 3U57A 4AB4A 2P88A 3QPEA 3E2VA 1JIBA 1IV8A 4GG9A 4FP1A 4Q4QA 2B7PA 5LXXA 2D23A 4TVUA 2E09A 3GG0A 3T4WA 4TO8A 5C7VA 1G7UA 3AIEA 2RDUA 3TQVA 3HBLA 1DJWA 3LI1A 4XIMA 1TPEA 2YYUA 1QCWA 5BU6A 3ITYA 4EPKA 4AMAA 2PDLA 1VBUA 2JQXA 3WLNA 1FHUA 3WLQA 1W5NA 1XIEA 3WH7A 3L23A 1RJQA 1YBQA 4MB3A 1JI2A 4TMBA 4BQ4A 2PWHA 2XIBA 4AZCA 4YCPA 3B9AA 1EX1A 4EXAA 3TJIA 1R30A 3OLDA 3UXKA 4JZ5A 3W74A 2OZ8A 2BTMA 2DZXA 2GSEA 3RR4A 2WWDA 4H2HA 3WMBA 4FOUA 1M9HA 4XBKA 4FO4A 6PTDA 1O68A 4CNSA 2HNHA 1Q6RA 3NTYA 1OD0A 1K4GA 5M3WA 1LL7A 3S1UA 4ERGA 1QNPA 3N4EA 3Q58A 1GVYA 4OUIA 1EX5A 1B9BA 2V5DA 3IUDA 5HANA 3T78A 3WBEA 3GTFA 3WH9A 1OWQA 2EF9A 1J0JA 3RRXA 2ZXDA 3AALA 3W1NA 3EXRA 1M1BA 4WOQA 1CXLA 1EZWA 2W6RA 2VFGA 5EMUA 4KERA 1W17A 3AISA 3ZVIA 4YS1A 1Y5WA 3FJ4A 3PAJA 3PZVA 4DAIA 4HPNA 6REQB 4KETA 1OFAA 4AC1X 2YX0A 1DEDA 1DYSA 4HOZA 4Z1DA 3MS8A 4GRSA 1LG1A 3AS3A 2BMBA 4QISA 4F2BA 4QJ5B 3MI2A 3VDCA 1BGGA 5C8BB 3UG4A 3RCYA 2OYLA 1Z3NA 3F4CA 3GVGA 1SO3A 2HJPA 2QCHA 3V3WA 4A29A 1P1XA 4DZHA 4GI8A 2FMNA 4ZO6A 1KGUA 2X30A 5FF4A 1DWIM 2KAUC 3W38A 3MCOA 1XFBA 4BEQA 1V77A 2ZZ7A 3CEUA 5C2CA 1G6CA 3SY8A 4A35A 3HG5A 3ARVA 4S2BA 2GPTA 3URNA 3GBDA 2VFHA 1EF3A 4Z1BA 5HUPA 3UR5A 3BUVA 3CUZA 4HPXA 5JBFA 3ARQA 3QHNA 4FLOA 4QEHA 4RPQA 4QFUA 3TMLA 4GYPA 1V6YA 3KOWA 1DXEA 4XAPA 1VEMA 4CCZA 4CUCA 1UD8A 1PZ1A 2OSWA 4UTHA 3GUGA 4IMCA 4E6MA 2XH7A 3QXBA 1J18A 1GK8A 3CUFA 1LP6A 4LF1A 3UWZA 5I79A 4M80A 4NF7A 1FWFC 4CD6A 1IEQA 1HNYA 3ES7A 2QF8A 2C1HA 5TF0A 1XRSA 1R2TA 4WZHA 4XZNX 3IVTA 1V8EA 2OEJA 3T9PA 2X8RA 1AUSL 1V3LA 2Y62A 2OWWA 3ABRA 5DF0A 1S5VA 4GVGA 1K7XA 2FGBA 5D05A 7TAAA 3LHTA 3ZSTA 2OQHA 5F2LA 2NW0A 3WNMA 1FWBC 2YLLA 1PIGA 1OEPA 1EC8A 1K8YA 3O0KA 1ZL1A 3LCFA 3H4WA 3MZNA 1LLZA 1GZ1A 1O5QA 2GOUA 3MSGA 1O12A 5AC5A 4R5EA 2PDYA 4NNBA 2C14A 1QTWA 5CPQA 1IIGA 5HXMA 3KTXA 4TV6A 3CL7A 1D3HA 3R4IA 2PF8A 5CAKA 5BXPA 5IM51 2YL8A 2H9AA 3HU7A 1IEVA 3CHDA 1LM1A 5I23A 4LAUA 1EA0A 3TIMA 3ITTA 3DG3A 3HPSA 1U5VA 3N9RA 4F0LA 1W6TA 3ITGA 1X97A 5I7GA 1V3HA 3AWNA 2BHYA 3T4CA 1C90A 3U2EA 5DCDA 4GIYA 2F7FA 3MVIA 3FGCB 2JF7A 1K8CA 3W1XA 2E9LA 3MSRA 2H3BA 4HYWA 4C6KA 4OTKA 2Y5SA 3P93A 3NGFA 1E0WA 2V69A 2TODA 3G5EA 4GO8A 4ZBCA 3WFAA 1YBQB 5CEWA 3ARWA 2NQJA 5I3JA 3EEZA 1JRBA 2HE8A 2ABBA 2WO5A 2VDHA 1SW7A 1MUMA 1JZ8A 2XM2A 1KCLA 3CS2A 1FFRA 2HV5A 1M01A 4GCXA 1KWKA 4GKTA 3SCWA 3DAQA 2YZRA 1M6JA 3N17A 3K8LA 3O2LA 4JCLA 2IKHA 1W3JA 1S2VA 4FSAA 3UXLA 3V7PA 4ZENA 3H54A 2DVXA 1XF0A 4AAJA 3VCRA 3NIYA 5CG7A 3PZUA 2H3DA 1A53A 3LNPA 2VC6A 4RLIA 3BZJA 1AVAA 3THAA 1Z89A 2QMJA 5KTLA 2IXVA 3O05A 4I5UA 4LUIA 2D1ZA 4WY0F 3QMSA 1KLYA 1TV3A 2RUSA 2X1UA 3KDOA 7XIMA 3U48A 1QPQA 2VRKA 3AXIA 2B31A 4H7ZA 2EPOA 5FAJA 4K68A 2E0PA 3VOFA 5AYIA 4FIRA 4WXZA 1UMLA 3R5EA 1ICQA 3AU6A 1BWLA 3NQ7A 2I57A 2XH0A 1VJSA 2EHHA 5E9AA 1V0KA 1J2WA 2PRMA 4LY4A 3GNXA 1RCQA 2YZ5A 3TTEA 3AZRA 3WLSA 3IJ8A 1GUVA 3BOLA 3UJFA 2QCFA 2TPSA 2ALDA 1JPHA 5F2MA 1H49A 4G2DA 2PP1A 2INFA 1Z69A 1RJPA 5HATA 5ABHA 5FF3A 4IIBA 2FYMA 2A4AA 1S3HA 4HVXA 1XBXA 3NQBA 4LBUA 1RP9A 5FESA 5EFFA 4GISA 3H8AA 3VILA 1MDRA 4IFRA 1FH8A 2PWDA 4GIRA 4JXCA 3LM7A 2OGYA 3CV6A 3MYPA 5AHNA 1EXPA 4P7OA 3WF1A 2CXEA 2BLEA 1Q6CA 3QLDA 5HNTA 4FF5A 2PC4A 3TYCA 1GW1A 1G4SA 2FZMA 4FS9A 2G95A 3B97A 4ZB0A 2XPKA 1M65A 4FOKA 1E6RA 4D8AA 4L56A 4RE0A 1IXNA 4J27A 4ZQMA 3SUWA 7ENLA 5LHFA 2V67A 1OQFA 4O8AA 1Y7VA 2TYSA 3R58A 1BEUA 1UWIA 1UKTA 2G4JA 1EO5A 5CSRA 3T6CA 3VDBA 3MUCA 3GTXA 1TPVA 3B4YA 3GHSA 4NAFB 3R8GA 3FDGA 4C6DA 3ZS4A 3WDHA 4CD8A 1F2JA 4E4PA 3PWAA 1E4IA 2XFFA 2DIEA 4IZGA 4MDPA 1QASA 1W1ZA 1D7KA 1YQ2A 1TE1A 4JQ4A 1CGVA 4ZTXA 3C0LA 2QUVA 1UA7A 5I3DA 3V0SA 1PZ2A 4MSSA 1Q66A 1LQAA 5C6MA 1EHNA 1F8MA 2FHBA 1KFLA 2PC8A 1R47A 3RXZA 1OYBA 3KHJA 4MOZA 4XZHA 4IF2A 2ZWYA 1EP2A 2DUXA 3G6LA 3KS6A 4Q8TA 4AWTA 3TUUA 1B57A 2OKTA 3S2CA 6ALDA 1WB0A 2WLZA 4OBTA 1EYWA 4FALA 5BMXA 2Y61A 4XSLA 4AG0A 4ADUA 2Q8LA 4JDYA 4WXYA 1P6CA 3W6YA 1L8NA 5A8NA 1H7RA 2ZXBA 3HPZA 4HNOA 3TFXA 1OC6A 1E71M 1KNWA 1UOKA 2ZYFA 3LMZA 2WPGA 1XGEA 5LA0A 4I6VA 2ZADA 3UR8A 3B8WA 4DM1A 4HNUA 1F3WA 4AZ7A 4L61A 3OGVA 1Q6FA 2JEQA 3BV7A 1UCWA 1DWFM 4GFIA 5A8MA 4QTGA 3BLKA 4JNYA 1RXOB 1XH2A 2F6KA 4HKPA 3MCNA 4MWAD 4AWUA 3OYZA 4GNJA 1WP6A 4NYUA 1J4EA 2VENA 3FAXA 4JIPA 3FFSA 1XGZA 3CQIA 1NWRA 1NWTA 1M7OA 1JUKA 1S5WA 4J9JA 3UCQA 2G4FA 1TPC1 4JTUA 2IPWA 4HA3A 3EWZA 3QR0A 4A6GA 4JFUA 4QCEA 4N6EA 4NX0A 1OY0A 2A1YA 2XIOA 3V0UA 2OLHA 1ODUA 3BW3A 3WNLA 2HWGA 5DEZA 3QJAA 3TFCA 4WDTA 4A4AA 2QIWA 3W2KA 4GYJA 1X6NA 2FFIA 3OVRA 2DQWA 3LPGA 4LB4A 4FNRA 3EMQA 1IE7C 1CB2A 3EDFA 2OYMA 4KRTA 3ZVHB 1PZ0A 3W7QA 2ZVRA 3LV5A 1SJBA 2CWNA 3WELA 1RSCA 3I65A 4LUSB 1B3ZA 1OK4A 2ZZ2A 4MDOA 5JVLA 3LI0A 3BDKA 3WF3A 4B3KA 2FHFA 1JUBA 3AS2A 3UP8A 3VO0A 1E1CB 3ITVA 4DXVA 4DWSD 1QBAA 4H8UA 3C56A 1WDWA 6CGTA 1F7BA 2QCLA 2XN1A 4OHQA 3T0TA 1JGMA 2EEXA 1DIDA 4LNYA 2CERA 4O0ZA 2VZUA 3NNTA 1YTDA 2EQDA 4DNMA 1X39A 3DI0A 2YDAA 3C5QA 2VX7A 4UOJA 3IUIA 2BS9A 3OHMB 2CYGA 4PRWA 2R1LA 3UG3A 1OCNA 4KS0A 2Z7KA 4AU0A 4LV4A 4PTNA 5ABGA 3RPTA 4YTSA 5A6BA 3W6LA 4PH6A 2ABAA 4FA3A 3S8HA 5AHFA 1B2YA 2VO5A 1XYMA 4OT7A 3VE9A 2A3EA 2Y2WA 2YSWA 3CMFA 3GVQA 4GJJA 1Q7QA 3W7PA 1W31A 3FXGA 5FL1A 3DHDA 1H61A 4HPGA 1HKVA 4M29A 4W8AA 4C1KA 2NXHA 4NJHA 3H70A 3AHZA 4DZ5A 3URAA 5JQ9A 1XQLA 2R1KA 5K9DA 3K4WA 5A94A 2A3AA 2NLIA 3PPFA 1C8QA 1F73A 1Y5XA 3W37A 4PB3A 3SSZA 1UKPA 1DTUA 5GNYA 5JH2A 4DPPA 3G3DA 3EWCA 1DJYA 3WLJA 4UQCA 3VXGA 4NX5A 1O5XA 3CJPA 1RAKA 3VZYA 2QGYA 1WO2A 4OE7A 4ASTA 3M07A 4PMNA 1A47A 2J9ZA 4HNVA 4GC4A 3LHYA 1RUSA 1X1NA 2BVWA 3BL3A 3YPIA 1KM1A 3CYJA 4AX7A 2VX5A 5E0FA 4CNPA 4DO4A 4WOZA 3AROA 1GG1A 3IARA 3R43A 4IP4A 1ITXA 3H24A 5FJPA 1V7AA 2J7GA 2J27A 3GXFA 3EOUA 3T0CA 5HWJA 3IRSA 1H7XA 1US2A 3E2RA 4Y8FA 1H1ZA 3GTHA 4YL2A 3I7SA 3AMGA 1K9DA 3LLFA 3WF2A 2PP3A 1KM2A 4O1AA 4P8UA 4CN1A 3L5AA 4K39A 1ISYA 5LIXX 3S1XA 4YTQA 3VK5A 2O0TA 3CWNA 1KBLA 4RKAA 1F4AA 4N42A 1QR7A 4IQDA 3LB0A 3G1VA 4J3WA 4MVAA 4GUFA 4J3UA 3QV9A 3GVVA 2AAAA 2R8WA 5MKGA 1V0MA 1PUDA 1J9YA 1GYMA 2ALRA 2GVYA 4EOUA 4YHEA 4LAZA 3NFUA 5I3HA 3R11A 4B3ZA 3CQKA 1EHAA 2PMQA 1B31A 3P8IA 3MP4A 1VFOA 1PBGA 1TMHA 3EBVA 2YCLB 3BAIA 4OOUA 4OKDA 1PKMA 4RK8A 2I16A 1CGWA 4NZ4A 5FCZA 3B3DA 2NSXA 1C29A 4WGXA 4MWAB 1DHKA 4HOWA 2NX3A 2UY2A 3VKCA 3VKJA 2QZRA 1TTJA 2ZRWA 4JX5A 4Q4OA 3URBA 2HROA 1E4LA 1EOKA 3HPXA 3LBCA 1W8SA 2QJNA 4F2UA 2VC7A 2ACSA 3W01A 1FRBA 3DECA 4CEUC 3RIKA 3WDIA 1I0BA 3UU0A 1K7EA 1F3EA 1UC5A 2JFEX 3VNMA 2YXOA 5GNXA 1B3XA 2PCQA 1ADSA 4S3GA 4HPJA 1FDYA 1OT1A 4XO7A 3JS3A 1F61A 1OSEA 4AD2A 4WY0A 3S6OA 3LGGA 1NWSA 3F5JA 3ZFHA 5G5IA 3MY9A 1CLVA 1GQJA 2XZ9A 1FWSA 1PWMA 1QVBA 3CQ0A 4DI9A 4ML9A 4Q6JA 4BS0A 1G4EA 2V2HA 1I1WA 5C55A 3VYLA 3EOSA 3W2NA 1ITQA 3GE7A 2B0MA