4DBWA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 2'-desmethyl-indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of potent and selective indomethacin analogues for the inhibition of AKR1C3 (Type 5 17 beta-hydroxysteroid dehydrogenase/prostaglandin F synthase) in castrate-resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 115
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbwA00
4GABA 3MB9A 1Z9AA 1EF3A 5LIXX 4YVVA 4Q3MA 1A80A 4PRRA 1LWIA 4XZMX 1PWLA 4GIEA 2PZNA 3RX4A 3RX3A 1MI3A 1GVEA 4R9OA 3DOPA 5LIYX 2ACUA 4XZHA 1YNQA 2PDWA 1X96A 4GCAA 4GA8A 4XZNX 3UYIA 2PDPA 2PDBA 2PDUA 1PYFA 3T42A 3LN3A 4JQ1A 3UZWA 2I16A 3LEPA 4PMJA 1AH3A 1S2AA 4GQGA 1Z3NA 3N2TA 3EB3A 4XO6A 4YVXA 3M4HA 3EAUA 1RY8A 3LD5A 3M64A 2HV5A 2CLPA 5AZ1A 2BGQA 4WRHA 3R6IA 3NTYA 3WBXA 3COTA 4IJCA 3V35A 4ICCX 1YE4A 3P2VA 1ZSXA 3G5EA 4G5DA 3CMFA 4JQ3A 3B3DA 2PDMA 1MZRA 2PDGA 1T41A 1AH4A 3UP8A 5DANA 5LIKX 1YE6A 2BP1A 2HVOA 4JTRA 2DUXA 2DUZA 3UZXA 2BGSA 4LBRA 3GUGA 1Z8AA 3R8HA 5C7HA 1IEIA 3CV6A 3WBYA 4I5XA 1HQTA 4L1XA 4EXAA 4IJRA 1XJBA 3F7JA 1VBJA 3LENA 4WDTA 1RALA 3Q67A 2VDGA 2FZDA 2IQ0A 1YNPA 3GHTA 2WZMA 2NVCA 4Q7BA 4ASTA 3FJNA 1US0A 3WBWA 3WCZA 1Z89A 3GHSA 3R58A 5HNTA 2NVDA 2IPJA 3O3RA 1EXBA 2IPWA 4MHBA 3C3UA 3DN5A 2PEVA 1ZQ5A 4XZIA 2PDIA 1ZGDA 4FA3A 4NKCA 3V0TA 3ERPA 2P5NA 4GACA 1RY0A 3M0IA 1K8CA 3BCJA 1AFSA 2ALRA 3S3GA 4QR6A 2FVLA 1S2CA 3V0UA 4YVPA 1VP5A 2IQDA 4WDUA 4JTDA 3LUTA 4QBXA 1M9HA 4PRTA 5AZ0A 2IS7A 2DV0A 2FZ9A 3R94A 2PD5A 3EB4A 3BUVA 4H7CA 3U2CA 2IKIA 4XO7A 3G1RA 4DBUA 1Q5MA 4PUUA 4XVDA 4DBWA 1UR3M 2PDFA 1HW6A 4WEVX 2A79A 2FGBA 1XGDA 4JTAA 3CV7A 1AZ1A 2PDYA 2F2KA 2PDXA 1T40A 1PZ1A 1S1PA 2HE8A 1JEZA 4HMNA 4YS1A 2R24A 1QWKA 4LBSA 4FALA 4HBKA 4LB3A 4LAZA 2F38A 1MRQA 2HE5A 2WZTA 4JIIX 1XF0A 1AH0A 1EKOA 4YU1A 2ACRA 2AGTA 2IKJA 3H7RA 3GHUA 4QX4A 4LB4A 3ONBA 5JH2A 2PD9A 5HA7A 4L1WA 2IKGA 3UZYA 3LNMA 4GQ0A 1X97A 1C9WA 1R38A 2I17A 1S1RA 1EL3A 4JQ2A 2C91A 3BV7A 2FZBA 5LIUX 2PF8A 4JIRA 4XZLX 3R8GA 3H7UA 3BURA 3RX2A 4LAUA 3MC5A 4IGSA 1LQAA 1PWMA 4JQAA 4JTQA 1OG6A 3WG6A 2ISFA 1Q13A 2PDCA 2HDJA 3GHRA 3UWEA 5JH1A 2IPGA 3R43A 3UGRA 4H8NA 1ADSA 3Q65A 4JIHA 5HNUA 3UFYA 2PDNA 2PDJA 5LIWX 4JQ4A 1FRBA 4FAMA 2IKHA 2PDLA 4XK2A 1X98A 2PDQA 4F40A 3LZ5A 2INZA 1ZUAX 2FZ8A 4JTCA 3R7MA 4ZFCA 2IPFA 3N6QA 4XVEA 3O0KA 4AUBA 1QRQA 3LQLA 4QXIA 4DZ5A 3QKZA 4DBSA 3CAVA 3V36A 1J96A 3D3FA 2INEA 5KETA 4WDXA 3CASA 3UG8A 3LZ3A 2QXWA 3VXGA 4XAPA 5M2FX 3UZZA 2HEJA 3FX4A 1IHIA 3ONCA 4PR4A 3KRBA 4WDWA 4RPQA 1AZ2A 2ACSA 4PUWA 1SM9A 4EXBA 3H4GA 1PZ0A 3LQGA 3V0SA 2PDKA 4WGHA 2ACQA 2R9RA 3CAQA 3LBOA 2PFHA 2HVNA 4FZIA 4OTKA 2PDHA 2J8TA
chains in the Genus database with same CATH superfamily
3BW2A 1XCWA 1TIWA 4U2YA 1A5CA 1J0KA 5G1TA 1GQNA 1OSEA 1TVLA 4WKFA 5EU9A 3T0BA 3A64A 3FGCB 5DMNA 5LNSA 4XZMX 1VENA 3IVTA 2YFNA 2D2OA 2ZYFA 1TCDA 4R7WA 3HMJG 3DG3A 2DQWA 4O0ZA 3C0SA 3FYOA 2CPUA 3ICJA 3CNYA 3TFXA 5IFPA 4ZQOA 4RZ4A 2FJUB 1T0OA 4GHRA 4I7VA 5CPOA 2NQ5A 3RG6A 3KL0A 1JGMA 3GKFA 3A22A 4CCCA 4DJFD 1D2KA 1VC4A 1PKMA 1LT8A 2D0FA 4ATLA 3UXDA 1DJWA 5HPOA 2Y24A 3BGAA 4AWSA 2V2CA 4DRSA 1V03A 4BEQA 3VX1A 5HQLA 1GGOA 2OLSA 2YCLA 3KBWA 3QHMA 5BRBA 1SZFA 4NAEA 3LD5A 3I4EA 3SUTA 3ZZ1A 2JIEA 3IK4A 3ANVA 1E1CB 4GJ1A 1ZENA 2FGLA 3WUEA 4E4FA 1P0KA 2YCJA 3AJ7A 3NZGA 4X2RA 3IV3A 4RCXA 2WHMA 4QM1A 2YA0A 1TTIA 1H50A 2ZUMA 2Y6ZA 3CMFA 4JQ3A 1K4HA 4A8RA 3ES7A 2CZDA 4JICA 2X1UA 4Q8UA 1HVXA 4PUDA 4AIEA 3CUJA 2JEQA 5ABHA 5RUBA 5FF7A 4WY0B 2BBFA 3PZ9A 1PX4A 2NT1A 4MWAC 2HVOA 1P7TB 4QE1A 2DUXA 1EOMA 3L0GA 1GOWA 2DT1A 2B7NA 2PGFA 3IACA 3NQEA 4PSPA 3SM0A 3P60A 5DY2A 2YA2A 1IEIA 1XPYA 4IXXA 4RW5A 3DHDA 1HQTA 1CEOA 4Z1DA 1U1HA 2KX9A 5I3GA 4S2CA 1E4LA 4RXFA 4YYFA 1XLLA 5IDIA 4PC8A 1GKQA 2FZDA 4P5UA 2VUNA 2UWFA 4ROQA 3OLGA 4ES4A 1X7IA 1JZ2A 1W9VA 3CPRA 3VPLA 3OO2A 5DCEA 1AQHA 2FPTA 3AS0A 1K6WA 1XPGA 3VNJA 4QDMA 4IP7A 3QY8A 1LLZA 1W37A 3RRXA 4BQ2A 4UNLA 3HGRA 3SCWA 3ENLA 3AHZA 1W8SA 2XDFA 3OYZA 5LHEA 2ZUVA 3W2LA 4FX7A 3KTXA 1KFEA 9RUBA 2GOUA 2JF6A 1JDEA 4E2BA 4MDOA 2RAGA 2FB3A 2ZBTA 1CLVA 4Z1YA 1OVDA 2P5NA 3VNZA 1FWAC 1W2PA 1M41A 2FZNA 1P6WA 3KHDA 3P74A 2YX0A 2O9PA 3BLDA 3CHCA 3CQJA 4U5IA 4XQ6A 2WZIA 3M46A 3VMOA 2Z24A 3PZTA 1TPEA 3UW6A 1TWDA 1TUXA 4JYDA 4D1JA 3CZLA 2A85A 4OHQA 1F61A 3TN4A 2WC4A 3GKAA 3A4AA 3M47A 1ZJAA 4ZTYA 1ME9A 4ZVJA 1HP4A 1TPFA 1TTPA 2A1YA 3N04A 3TAOA 3GM8A 1YLVA 1D3HA 1KV8A 5CBBA 2UY4A 3U5UA 3GTNA 2WLZA 2FGBA 1U5HA 1JPDX 4WSJA 3LDVA 3MV11 1EFZA 1G4PA 1IXQA 4AC1X 1XS2A 4LRSA 3CJPA 1IWAA 1NEYA 4HB7A 4JEQA 3IJDA 3VIMA 4HK5A 1J79A 1G67A 3O6CA 3G8RA 2ZZ2A 2P3EA 8XIAA 3RU8X 1PTAA 5HMSA 1AH0A 2V9DA 2JKAA 1HXJA 3QJAA 4TX6A 1E55A 4JL2A 2ZADA 2J9YA 1K9TA 1RAKA 3RRAA 3WDRA 1KLYA 1OC7A 3HFTA 4W85A 3ABZA 2XFWA 3I65A 1HG3A 1JYVA 3NPVA 4PTDA 1M01A 1E6PA 3TR9A 1EO5A 2QDEA 1QNOA 3WQEA 3VVGA 3PZIA 4PCPA 1OHLA 5C2CA 1NWTA 1R38A 2XVKA 3IIOA 3ME3A 4PEEA 4NP7A 4AZBA 2X8RA 1JCNA 4EXQA 4U3CA 2C0AA 4UFKA 1B1YA 2ZE3A 1PWMA 3RJXA 1IGWA 1TPWA 1FQ0A 4YCPA 3RM8A 3WG6A 2VFDA 2FTYA 1JZ8A 2HDJA 3GHRA 3W25A 2B31A 5DELA 4FPSA 1ZFJA 3FEMA 5CG7A 3UFYA 1EIXA 4ADSA 3S5OA 2E8ZA 1QK2A 3ZJ8A 2HJPA 5H8MA 1UMLA 1YKWA 3NURA 3UPMA 5E0KA 2CZFA 2NV2A 2J88A 1UROA 4UIOA 5BCAA 4OIFA 4AZCB 2D2GA 1QHPA 2CLOA 4LUSA 2GQ3A 4JTKA 1XM3A 2INEA 1V8EA 4WDXA 4HU4A 2CIPA 4XAFA 5D2WA 1DEDA 1AJZA 2ZUSA 3AU2A 3N11A 1R3WA 1A5NC 2WZHA 1TVPA 3U5YA 4HSOA 3U2EA 1KRAC 3JVAA 4TU1A 4E4UA 3SY1A 1G7VA 2WBKA 5EMLA 1E5JA 1DIKA 1QMLA 1KO0A 1LUCA 4UFLA 4A8LA 1WP6A 3VNYA 1MW2A 1EDTA 4WLCA 3HB9A 4Y8EA 1E0TA 1VJSA 2YOCA 1REQA 5FA5A 1AG1O 4Q4MA 1EF3A 5SWUA 2I5IA 5LIXX 1GYMA 1DXEA 1IV8A 3AMLA 1LWIA 2QLYA 2HNEA 1VPQA 5KZEA 3NZQA 4JBRA 5CAKA 3FDGA 4UNKA 3RX3A 1GVEA 3CIXA 2ACUA 3PJTA 3KBNA 2WPGA 5GJMA 3EWZA 2Z1SA 4WF7A 4L4LA 2Y63A 5M03A 1FWIC 8CGTA 2OLHA 2A3EA 2EXOA 5DX7A 2ZX6A 1MXGA 4L4MA 5KZ6A 1AW5A 5D8WA 1WDWA 2YZRA 3KRZA 3WQ4A 7XIMA 3E5PA 1ZP3A 4IFKB 3VOCA 4NIRA 1EEXA 5C54A 1XG3A 1FH7A 2VUYA 3CHFA 1UA7A 1GPFA 3N73A 2EPNA 2WSKA 2ZXQA 4S2BA 2NUWA 1Q3NA 3BDKA 3AOFA 2BZNA 5F7UA 3WNMA 5HWNA 5DY3A 1LL7A 3R89A 3PBUA 5A8QA 1VD6A 4XD3A 2CXEA 2PDMA 3BMWA 4O28A 3WLPA 3BAIA 3T8QA 4PA8A 4LNCA 1OF6A 3AMKA 3CHEA 3MUAA 2G3IA 3SEPA 3GR7A 1XYMA 2BGNE 4EANA 1O68A 3W76A 3VD3A 3M5VA 5E6ZA 1LP6A 2JKPA 2WANA 3B8IA 4JHMA 3BOXA 3F7JA 4IT1A 4BK9A 4LV9A 3K4AA 4IPPA 1JDFA 2A4AA 3A3HA 2OELA 4GYPA 3CAWA 1WDPA 1DJIA 1YNYA 3WBWA 3VU2A 4I7UA 4BF5A 4WX2A 1ZB5A 1ZRQA 2I9UA 4ERAA 3KBVA 1LBLA 1VQTA 2VHLA 2W3ZA 4HU8A 2QHAA 3M6YA 5FL1A 3KDNA 4MMWA 5DXYA 3QLDA 2J7BA 3B8SA 1DE6A 4J3SA 4FA3A 4J9JA 4LUJA 1P0EA 2VCBA 3ERPA 1Q6GA 3WQ8A 4DWSA 2YCEA 3CL6A 1X7FA 4KMQA 3A5VA 1H1YA 4N4QA 1FVPA 2ZZ1A 1GQLA 3VC5A 3NPWA 1M3UA 4E3VA 4HPXA 2IQDA 1GG0A 1VR6A 3LUTA 3SURA 4BKNA 5HMEA 1H63A 1M9HA 2J77A 2WK2A 1J01A 1QTWA 2EPKX 2ZIDA 3CAKA 3TXZA 4L56A 1QNSA 3W1UA 4J2MA 1AA1B 5I3KA 4PMZA 4XD4A 3O6DA 4KWSA 3H21A 3STFA 4CLMA 4NQ1A 2VWTA 1IIHA 2UV8G 5A2AA 4Z2KA 1FHDA 4HU3A 2BOFX 3CV7A 3TU9A 2I56A 4U31A 2FIQA 2BXVA 4ZO9A 4DYKA 1S1PA 3TNOA 4NF7A 3WLLA 4E8DA 1R2RA 3LPPA 1AQFA 4LAZA 5A6BD 2F38A 2CZ5A 1KM0A 2WZTA 2HE5A 4ZB2A 4DI9A 2HISA 3GDMA 2PP0A 2Y0FA 2CBUA 3A21A 5D37A 3PSWA 2EKCA 3C2YA 1ICPA 3W2MA 2IKJA 3H7RA 4M7TA 4QX4A 4LB4A 2E5CA 3M43A 4QIUA 3KS6A 3W85A 1FXQA 2WZEA 8TIMA 2C3ZA 3WBEA 1EP3A 1XWYA 2QULA 2GQ8A 4BQ3A 2OU4A 3ZT5A 3W53A 3PJWA 4GQ0A 3MT1A 4FEZA 5C2GA 1EL3A 1S39A 1XIHA 2PF8A 3QN3A 3BLEA 3PBMA 4C1NB 3EGJA 3BURA 1HJSA 4LAUA 1HKIA 1LOQA 2J9ZA 1GOQA 1FA2A 4AIBA 1RPKA 4R33A 4MADA 1THFD 1CXIA 4UOJA 3AIBA 2OLAA 1KCLA 5GPRA 1HJUA 4UC5A 1PX3A 1XC4A 1TPC1 4YTTA 2VZVA 1LCOA 2BSLA 1EJRC 4IOTA 5E70A 1IQ8A 3VNDA 3MUZ1 1Q66A 1EC8A 4US5A 4AEEA 3ABSA 1LUCB 5A8PA 2XU2A 5CBIA 2J79A 1G5AA 1M7XA 2J7GA 2HSAA 4JX5A 1HTIA 3VI2A 3QGVA 3WK2A 4B5NA 1C7TA 4W8LA 1UWTA 3W7GA 5D9MA 3UR8A 3EMQA 4K1WA 4HCLA 1ML1A 3IGSA 1XYAA 3ONCA 4JTFA 1DHKA 1QVBA 5E5CA 1A50A 1TCMA 2ACSA 3KL3A 3LMZA 3A9BA 3BVJA 4D8LA 4PUWA 3IIZA 3ZJKA 2QT3A 4FLOA 3QY6A 5GQBA 3WY1A 2V68A 4XAZA 4IQJA 5EMYA 2YB1A 4UOZA 4EIVA 2O56A 2OWXA 1R86A 4A8NA 3G1HA 3LA4A 3RPMA 4DUOA 2XIOA 2W91A 2XIQA 3GD6A 4D2JA 1Z9AA 1AL7A 4XBSA 4IZGA 2F9RA 5JXQA 3SCPA 4B2DA 1KWGA 1RJRA 3LGGA 4Q6XA 2AKZA 3EKGA 5CZ0A 2XJ7A 2D24A 4ACZA 2Z00A 5AHNA 5C7VA 2CZVA 5C71A 3ARVA 4HYVA 3W22A 3PS7A 1L8NA 3URAA 1VEOA 1WAUA 3AHXA 2D2JA 2QUNA 3MCMA 3RX4A 1MI3A 3VYLA 3WDIA 1W9BM 3TVAA 5FAGA 2PBGA 3UWVA 5T8GA 3PR2A 4QFUA 2H9AA 3OJGA 3MP5A 4C5YA 2DW6A 2XHYA 3FA5A 3GH4A 4H8HA 4RE0A 1TPUA 3GNNA 1HZYA 1KA9F 1AH3A 3QV9A 1XRSA 1DOSA 4M3PA 3NYZA 3EB3A 3PTQA 4BZYA 1KCZA 5B80A 2OGJA 1RY8A 3PBWA 1EGMA 2QQ6A 5AZ1A 3GVGA 3I4KA 2V81A 3RHGA 1WA3A 1TMQA 1UWUA 4IX2A 1CGWA 3GXFA 4N9BA 3Q2DA 4CCZA 1E0UA 2ZTKA 2E68A 3V5OA 1NQ6A 1ZSXA 1TJ0A 3BWWA 4GZJA 2CNCA 3WD2A 3R0UA 1M1BA 3QFWA 3RF9A 1AH4A 3HPFA 5A6JA 5KZDA 1XLCA 5AC7A 2VD8A 3S2LA 5U4NA 1ONEA 1XUUA 1B9BA 4B3LA 3E1F1 3UCDA 4AY1A 4JKKA 4AG0A 4FNPA 3R12A 2A3HA 2X2GA 4K3ZA 3E96A 3S6TA 3T2QA 2ZC8A 2WMKA 4OU1A 1UH4A 3AUJA 4MM1A 1BAGA 1JCYA 1V02A 1WNOA 2J8FA 1RALA 5AKQA 2AKMA 2OT0A 5I79A 1TSIA 2VMFA 1HNYA 4Q4KA 1XFBA 4TX8A 3ZYZA 3EWYA 3FKKA 1EOKA 3TTQA 3H2AA 4EK7A 4RX0A 2OSYA 3MMUA 1EHAA 3R58A 1UHVA 3BCDA 1IE7C 1YXDA 3KHJA 2HROA 4AVOA 3C3UA 3TOYA 4JL1A 3LHZA 1XC6A 4BWLA 3TYCA 2E9LA 3TE9A 2V5LA 4DM1A 2QJNA 3OIHA 3LPGA 3YPIA 1XBXA 1AMYA 4QEEA 1F07A 3B06A 1MO0A 4AAJA 1GJWA 3NQ8A 5M5DA 1U33A 3SUVA 4GCXA 4NAFA 1VP5A 1JFHA 4DEFA 6ENLA 2KZHA 4Y9AA 2G37A 5EMMA 4AF0B 4DVOA 1ZALA 1ZL1A 2QF8A 1KFCA 1MMFA 4C6QA 4V1XA 1A5AA 3WZ0E 3UF9A 3ARQA 1JRCA 4DWSD 1K02A 4DBWA 2BG5A 4IG2B 4LF1A 5EKYA 2CHOA 5E09A 3VO0A 1EYWA 1XGDA 3B8WA 1F3WA 1IXOA 4INFA 2F2KA 1L2UA 1BVWA 2DFAA 4ZO7A 3TC6A 3M5ZA 1LLWA 2YW4A 1BRLA 2QNEA 2ON3A 2YBVA 3W88A 1UASA 3FN9A 3F03K 4XAGA 1JRBA 2E6YA 3TSBA 3W38A 3G1XA 5IRPA 1MRAA 1U83A 1NSJA 3KVMA 3MHGA 3CMJA 2D2HA 4K8HA 5D8ZA 3G0XA 4HU0A 2ABAA 3W1NA 1Y5WA 3QVQA 3WF1A 4IIFA 1SFSA 4ZO6A 3JS3A 1KBJA 4D6CA 3W6LA 4L1WA 4J3XA 2VFGA 3EOUA 2X05A 4QG8A 3WX7A 3GTHA 4OJYA 4RE3A 3UZYA 1JDCA 4H6QA 1L6FA 1EDGA 3W0KA 2P50A 1G0CA 2G97A 3TDFA 4KQNA 4D6HA 1WBHA 4GK8A 4W7UA 4QQ3A 1EA9C 2PTDA 3ZM8A 3WLTA 4DJEC 4JNZA 1OG6A 1QI5A 2BODX 4GO8A 1SZEA 5G4WA 2OYLA 4H8NA 1EZWA 5HNUA 1AD1A 3HQNA 1V7YA 3U8GA 3IARA 3GZ3A 2VZOA 3H4WA 5BOEA 4ZFMA 5D30A 3KCOA 3KM8A 2XVPA 5DT7A 3D46A 3MUIA 3LQLA 2CU0A 2C79A 2OG9A 1UP3A 4O1FA 4O8AA 3NQCA 1VLIA 1RLCL 1K8XA 3W81A 3GXNA 2Y5EA 3W7RA 5EFDA 3DFNA 3EXTA 3RLUA 3NDOA 2NQ9A 4IFKA 4CQCA 2AQVA 1R7AA 3T2PA 1Q6OA 2AQWA 4P8UA 1FHVA 4LYKA 1GJUA 3F4WA 2EO7A 1T99A 1KXTA 2PLJA 1KFJA 4PTVA 3ZXWA 4XZBA 3VNIA 1QFEA 2ACQA 2G96A 1PJ9A 3L66A 3CAQA 4MPQA 4JDYA 5G5IA 4CQAA 1XFCA 1JCXA 2PLKA 4MAZA 1LRTA 1QI0A 3PTMA 4GD0A 3RNDA 3W1AA 2P3ZA 4MY8A 1UW9A 5E9AA 3UJ2A 1FWWA 3KRSA 3P8IA 4HN8A 1KFLA 3GDTA 3NL2A 3WNPA 3SRKA 2H90A 1LG1A 4C1NA 1OADA 3EEZA 3G0UA 1P6BA 4Q7NA 4R9OA 3N13A 1A47A 2QAPA 4UQDA 3BANA 1LDCA 5BXRA 3AUOA 4QE5A 3M0ZA 1EJXC 3TZNA 3MP4A 3WLNA 1GHSA 2YW3A 1LF1A 3AXMA 3N18A 2DJXA 3N2CA 1PEZA 5EMJA 4GVGA 3FXGA 5HULA 4C6MA 3FOKA 1ZY9A 5I6SA 1NWRA 2C71A 1WDQA 3EPOA 4O10A 3TCEA 1RA5A 1R2SA 3HTWA 2WYSA 1GOKA 3PJUA 5CZJA 3WLOA 2C1GA 5C9UA 3IGUA 4O1EA 4ATDA 5E6YA 3V35A 3AMCA 2HNHA 3KTSA 1WB0A 1NWSA 3F4CA 2X1RA 1F4HA 1EP2A 2NV9A 3A9IA 1NY1A 2RHGA 3STPA 4FI4A 4DO7A 4HZ6A 5HBFA 4NJGA 4OGZA 3IS4A 4JTIA 3RN6A 2YL5A 1L6SA 3H12A 2TMDA 3RPDA 4M51A 5C7HA 2NUXA 5K2ZA 2QJIA 1JNEA 1U2YA 3GDKA 4EXAA 1N8WA 4PUMA 1L6GA 2ADAA 3LHTA 4JR5A 3LGEA 3JRKA 2VDGA 1UP0A 4QDWA 1B2YA 5AYIA 1W1ZA 2DT2A 4QJ1A 2W5FA 3OG2A 3WD4A 1SR0A 5XIAA 5AN7A 5EMUA 5FEZA 4PBEA 1JPHA 3ANYA 4IQDA 2E9BA 5HJLA 3NDZA 3WFZA 2UY5A 1X6LA 3LLFA 1S3TC 2QGYA 4G8TA 2JFEX 2EPOA 4H7ZA 2DZXA 3T05A 4REQB 1I2NA 1TG7A 1VFHA 4KCUA 2PEVA 3LPFA 3IAQA 2VGGA 3DKLA 3TWAA 1F4AA 4MVAA 3FA3A 1JI2A 1TIMA 1ZBVA 4C6NA 4ML9A 2WJFA 1YADA 5BW6A 1RH9A 3BLLA 3IGHX 4TVDA 4QS6A 5EL1A 4LT9A 4FOUA 3OU8A 2GVJA 1FWHC 3PPHA 1S2CA 4K37A 2DSKA 3H22A 1EJWC 2EBNA 4NZ5A 4M1BA 2OMAA 1AW1A 3NR0A 2EG6A 3HFYA 4L1GA 3GB6A 4PRTA 1DWJM 1UJPA 3PK7A 4DLFA 3EB4A 2VVSA 5D4YA 3VCCA 1F8MA 1BKSA 1IYXA 4XAYA 3ARYA 2WJEA 1OZMA 1SMDA 4NY2A 1LWJA 4UQAA 3NL3A 5GNZA 3M7SA 2VC5A 3SUWA 1K7XA 1KM1A 4KEVA 2PDFA 1UD4A 2XTKA 4IHCA 4RDZA 4RDWA 3QTPA 2NZLA 1IR1A 4M6PA 4NILA 1UZ1A 5E9XA 1D8CA 1CXFA 3V7PA 2FMOA 1ZNNA 1T40A 4YHEA 4LC8A 3O0FA 3W01A 1ZJBA 5K4ZA 4HMNA 4AD3A 4I8YA 1OFQA 1FFQA 1QWKA 2R24A 3PUEA 1GORA 3GFZA 3MSRA 1UR9A 4NASA 4ECLA 4GH1A 3VDHA 1GQKA 3CU2A 5LZLA 3OG3A 1UIOA 4PUJA 3VUPA 1T8QA 2C0HA 1FCUA 4CN1A 1QHOA 2I14A 5KZMA 5FJRA 1KLZA 3L4YA 3D3AA 2HS8A 1SFLA 3AS2A 3GC4A 3DHPA 2GFTA 4RE2A 1UWAA 1OFPA 2V30A 4DELA 5A6TC 3T40A 4A35A 1HJVA 3NZRA 5BMWA 4ENLA 1T6MA 1F73A 4LWWA 3W9ZA 5AVHA 3RCYA 3ATYA 2IW0A 4EX4A 2ASHA 2WVVA 3L23A 2Y5JA 4AD0A 4CD7A 4IGSA 4GQBA 3GIYA 4O4WA 2R91A 1TQXA 4JD4A 3Q65A 4H8UA 1J2BA 4W93A 3D47A 1J8VA 2Y4SA 5A95A 1W3NA 3DCPA 3WELA 4PMUA 2H8XA 1EUNA 4I90A 4WY0A 3E0VA 1IWBA 3B04A 4O50A 1JR1A 4K68A 3EA1A 2PC4A 2NQJA 4FR1A 3OGVA 4DZ5A 3QKZA 3EOOA 3F4VA 1EJSC 3D3FA 1TV8A 3N19B 5BXTA 3AYSA 4AX7A 3BK0A 3MCNA 3LZ3A 4E8CA 5A2BA 3G1YA 2V63A 4D6EA 3C5QA 3FX4A 4DO6A 4DYJA 4P8WA 5CPTA 2G0WA 4NJHA 4QNEA 1F9CA 1A5BA 4IMFA 3BLKA 2G4FA 1V6XA 1KCXA 3EOLA 1JL8A 3OQ8A 3V0SA 3PB0A 5JIPA 3NSXA 5HR7A 3BG9A 4XKYA 1WXZA 2PDHA 4L80A 2HK1A 1JVNA 5ABFA 4P2VA 2X0HA 4N42A 1V3LA 2J7HA 3WF4A 3ZLGA 3THDA 4O11A 3BJFA 3LU2A 2JF7A 1HL9A 2ZUNA 4PZVA 4GINA 1PKLA 1C8VA 1V6TA 4E0CA 3EWBX 2DZSA 3NEVA 3OGRA 4DI8A 1GKPA 3LV5A 4M1RA 3ARXA 2W79A 1FHUA 1Z42A 2GDUA 4QJ3B 1GPWA 4YMZA 3S42A 3BE7A 3HGSA 2BV9A 1TTQA 4XV0A 5D02A 3PAOA 3KWSA 4HZ8A 3GZAA 3F5KA 3DFYA 4CVUA 3UCCA 5CPMA 1JFXA 4P7OA 4DZHA 4GYFA 1KRCC 5T9CE 4Z2HA 4AU0A 1POKA 3HZ3A 3GYCA 3HPSA 1C7SA 4H6RA 4O17A 3OLIA 3I10A 1QOPA 1HT6A 4UQBA 4US5D 4A05A 2VEIA 3LTPA 1TTJA 4QDPA 1H7PA 3B9DA 4H6EA 5A69A 2V5DA 3ABOA 1OD8A 3ARSA 2GGJA 3ZJ7A 3CIWA 2QR6A 2GGEA 3VTRA 2B7QA 1FTXA 3FJ4A 1YBQA 4C6PA 3DECA 1JDAA 3BSGA 4E8GA 5HR6A 5H2ZA 5J04A 4DJDC 2QPUA 1EH9A 1Q4WA 4CN4A 2EG8A 1MZRA 4A2SA 4K7YA 3UY7A 4LEQA 5CSSA 3WQ5A 4ZSTA 4FLQA 1F6KA 1RBAA 4DNHA 4R9XA 2JGYA 3EEGA 4FIQA 2O7SA 1OCBA 3ABRA 3LG3A 4N6FA 2ZRYA 1TELA 1KRBC 4JTRA 3WUBA 1TR1A 2DUZA 4UTFA 2PU1A 1S5MA 1R9YA 3UVAA 1O12A 4Q8PA 4BI5A 2RDUA 4ML4A 2JALA 4HNCA 1TQJA 1W1IE 3LENA 1AJ2A 3ZSTA 3GQYA 3QMRA 1NDZA 2WZMA 1P0NA 4IG2A 5I00A 5DCBA 4D6FA 3M0VA 1QNVA 1PSCA 4W86A 4D6IA 5TD4A 3EWXA 1A5MC 1N7KA 3K5XA 3LCIA 3WCZA 3U9IA 3STEA 3MSGA 2FQIA 3GHSA 3IUIA 2XN1A 2NXHA 4GIRA 2IPJA 3TAKA 4ZQRA 5REQB 3DU0A 1X1OA 1ZQ5A 2XZ7A 2PDIA 4TO8A 3QSRA 3POHA 1O5RA 3PBGA 4NKCA 2EAWA 1CCWB 2I9EA 3V0TA 4AEFA 3P62A 1DQUA 3BQ5A 1K1DA 2W9MA 4WJEA 1V0NA 4DM2A 4QR6A 2WXDM 6REQA 2EQDA 1DJZA 3GAYA 3WD3A 4RJEA 3WD1A 4B5VA 3NZPA 4J5NA 1KNWA 2A6NA 3G6LA 1Q6RA 4RNHA 2REQA 1E51A 3DHFA 2OTDA 1AUSL 2QAFA 2GK1A 1MVYA 3KCLA 2PI6A 5HWJA 3KVJA 1B30A 3IJ8A 4PUUA 1E0XA 2DVUA 3TROA 3LV6A 1HKMA 1REQB 5CZSA 3H7VA 3G0SA 3IJQA 1J6OA 5A3HA 4QG6A 3T44A 1AZ1A 1GEQA 4GMEA 4LEFA 2Z4GA 2Q8XA 3IJ7A 2ONEA 3W70A 5H91A 5LA0A 2DGAA 3DUGA 1LRNA 2AAMA 5IHSA 3RCNA 1ZS2A 3UWQA 3H6OA 3ZVIA 4PCNA 4WHBA 3V75A 3B9EA 2Y70A 3QEZA 3HPXA 3T0AA 4RKAA 3ONBA 3VILA 3KDOA 2PD9A 4IMCA 4NX5A 1KBLA 3CWNA 3HGOA 2PGEA 1E71M 1S5NA 4J27A 3UXLA 1CT5A 3VOFA 4PMVA 1DJYA 2QJHA 2I17A 4C6BA 3QMTA 2Y8VA 4TXEA 2WCGA 1PCWA 5BNKA 3TC7A 1TZ9A 5MKGA 2FKPA 4D9PA 4RDVA 1H4PA 4IGHA 3AAMA 4OBRA 4NYYA 4Q6JA 4LRTA 4B92A 3O9NA 3UWEA 5JH1A 1KXVA 3R43A 2XVLA 2G3JA 2O55A 2A3LA 3DG6A 1VFTA 3R0KA 3HA1A 2EGZA 4ZGYA 4U2ZA 1X98A 3NUKA 4MY9A 3VOGA 3R0DA 1KRMA 4YTQA 1BWKA 2QW5A 1V4YA 1IZCA 1GOXA 3GNXA 3B9AA 1P5BA 3AHTA 4HVXA 1W3TA 5H8PA 1EJ7L 1V77A 6PTDA 3UJEA 1JD9A 1UQYA 3CH0A 1ZLPA 3UZZA 3SI9A 4Z0SA 1IEWA 2VZSA 2QS8A 3CTLA 2R1MA 4L61A 4WZHA 3UD6A 1IEXA 3KE0A 1HKJA 2WM1A 1ZCCA 4K6AA 3WLRA 1EUAA 4JN7A 1JULA 3VGGA 5FCZA 4J3ZA 3DYMA 4TMCA 1JXJA 4LVAA 4AISA 5C2XA 2J27A 5HAOA 2J8TA 1HL8A 1A3WA 4CEUC 3H54A 2F84A 3R5EA 3URBA 3AS3A 3SCVA 3O7UA 3DAQA 1G1YA 1XGEA 2ALDA 5F2MA 2E5BA 1WYIA 1Q63A 4BWLC 4UZUA 1LZOA 4IPNB 2A6LA 3WEOA 3WQVA 4O0QA 4DNMA 2QUUA 3ZJ6A 3UQNA 4QJ5B 4NNAA 3O2LA 1JXKA 1YNQA 2CWNA 2PDWA 1K8YA 1W5MA 5FJTA 4DB7A 4LJ3A 3VFCA 2ZX7A 1Z69A 1IT0A 4FSAA 3CZJA 3LN3A 3VX0A 4IPIA 4UUIA 4PMJA 1WZLA 1RJQA 4QLKA 4AHQA 4HJFA 4KEUA 3H2CA 2A5HA 1E1EA 2Z1BA 4NXSA 1HUVA 3M4HA 2Z2AA 1NWUA 1Q7ZA 3L5MA 1DWAM 4LF2A 4LW7A 1FWSA 4AWEA 1XIFA 4F0HA 5C9XA 1B0IA 2RDTA 4IIEA 1AL8A 4M29A 4IH3A 1H61A 2FTPA 4KCTA 3AJXA 2ZRUA 3JZEA 4WUIA 3EX1A 3NQBA 4DZAA 4CNOA 3KLLA 4ZBCA 1DVJA 3UJSA 2VFFA 4QITA 1X38A 3REQA 2JE8A 3SQLA 4DPQA 2Z6IA 4J35A 4Q8OA 3N3TA 1E56A 4WVXA 1RPXA 1DQWA 1AQMA 4J1OA 3TQKA 4EVZA 1KCKA 3MW7A 4GY1A 2YCKX 4HA3A 4IIDA 4RZBA 3N34A 1S2VA 3W7LA 3TYUA 1I0DA 1AD4A 2NV1A 2GVYA 1XLEA 2C6QA 1W3KA 3OOQA 4QG9A 1DYSA 4M7SA 2WJZA 2Y7GA 2EHHA 4OV9A 3RCMA 1M5WA 3Q94A 3SADA 3W1LA 3FJNA 2QF7A 2A3AA 4HK6A 3S1GA 4BA0A 5HMDA 1GVSA 4H4IA 1F2JA 3PZQA 4MKNA 4O57A 4IPLA 5HINA 1IGSA 4S1FA 5CEWA 6XIMA 1J11A 4JYEA 5AFDA 4A3RA 1DORA 2VR4A 5IHRA 2V82A 1ZGDA 4B3ZA 3UG3A 3W2JA 1NDYA 1OM0A 2WVTA 4GACA 4O16A 4QROA 5I03A 3N3MA 3AZSA 1XLJA 4CUCA 5AC6A 4I9AA 1OWQA 4AY8A 3P61A 2VX7A 4NG3A 1PHQA 4LYQA 4A3UA 1VJIA 4NZCA 5HK4A 4DJFA 2DIKA 4QBXA 4EAYA 3W6MA 5HUPA 3VIHA 5I7GA 1Y5XA 4ORIA 1QR7A 1OEPA 4MNMA 3BUVA 2WSPA 3UPWA 3B8TA 1SMAA 4XO7A 3KZSA 2NT0A 2PMQA 2PGWA 1ISZA 3BPWA 4GQRA 1VFFA 4G2DA 3MQTA 3QRHA 3KAOA 1QO5A 3GVWA 4AD4A 2F8QA 2P8BA 1B4KA 1N2VA 3VK5A 5A8NA 1FH9A 3AYRA 4ADTA 1L9WA 2YYUA 1EWEA 1E4MM 1EJTC 4Y9NA 3RK8A 4UTWA 3SUSA 3I3EA 4G7EA 1C3FA 2W92A 3F5JA 2NX1A 1OT1A 4JNMA 3GR8A 2BDQA 4RUBA 4JPGA 4A3QA 4GXPA 1XQLA 1NU5A 1Z7AA 1LT7A 2VWSA 7ENLA 4A6GA 3SSJA 3SB0A 3R11A 3N9SA 3ZO9A 5AYBA 1EP1A 2DH2A 4JFVA 1R85A 1VH7A 5I02A 3QM3A 4JY9A 2P0IA 6TIMA 4QQUA 1M65A 1TZ7A 3LRLA 1EZ2A 4MWAE 4MF4A 1BD0A 5A94A 3P81A 1BYAA 2OSWA 3RR4A 1E1FA 1FCQA 5LIUX 4H9UA 4JIRA 2XSAA 4JEJA 5DLCA 3HURA 3GC5A 1TA3B 1ZAHA 2YLAA 3K4DA 3PPGA 1CZ1A 1I2QA 3M44A 5TIMA 3L4UA 2ISFA 4R34A 3C4UA 2NX3A 1ADSA 3DFSA 4JIHA 2G4JA 4M8UA 4HNNA 1FRBA 1QPKA 3IEBA 3QOMA 2ATMA 2PRMA 2P8CA 3VD7A 2F61A 4AIOA 3KBJA 2ZC1A 4Y7EA 2DZPA 5D03A 1PB0A 2VDHA 3DHUA 3OB8A 1LWHA 3WN6A 4LAMA 4DZIA 2PTWA 3LBMA 2TPSA 2E9MA 1EGVA 1YHTA 4KCVA 4EWND 4L6HA 5IOBA 4YTUA 3QGKC 3I6TA 3M1ZA 1E9LA 1EXPA 3WDJA 2ESCA 3HQ1A 2E1WA 5HJYA 3L2LA 3C2VA 4CCEA 4C6DA 1ONXA 1EQPA 4X2PA 9XIMA 3UA3A 4PR4A 4LV4A 4KRTA 4O18A 3UG5A 2Y61A 4RPQA 4ZOBA 1TPH1 3WJWA 3G3MA 2E40A 1K6AA 3LCXA 2C1IA 3QC3A 2ZXAA 3UY8A 5T9BG 4L7ZA 4GPNA 2PFHA 3H23A 2HVNA 4J3UA 1MNSA 1KXHA 3K1GA 4X22A 3WEMA 1UD5A 1H7WA 1DJHA 1IIGA 4FR6A 3M9YA 4Q4OA 4Q3MA 3T8LA 4DYEA 3N6HA 2BWGA 1TYGA 3G18A 2NWRA 1H1ZA 2X0YA 3VIPA 5CLTA 1PWLA 4RLIA 2AL2B 2TODA 1VJZA 4GZIA 2ZZ4A 1I6NA 4MUPA 3TYZA 3DOPA 1J4EA 3DENA 3GW3A 4PUEA 5G4HC 1C9DA 3BAXA 1X96A 4IGNA 3FCPA 3OA3A 3D6NA 3EWWA 3NPUA 5E1QA 4AD1A 1K77A 4BF7A 2F6UA 3EXRA 4KRZA 1YEYA 2PDPA 5DO8A 2DIEA 2OX4A 3UZWA 5AC4A 1QPNA 3LTSA 4KGJA 4LVDA 1CENA 1OB0A 1S2AA 4F9DA 1BGGA 1CPUA 2BLEA 2C14A 3KUMA 1FDYA 4IICA 1W6TA 1Q8JA 1I45A 1C8XA 2XIIA 2BY2A 3H2NA 4PMDA 1HGYA 3C52A 1W1VA 4Z17A 2CLPA 4AQLA 3KOZA 4F79A 3R6IA 4POCA 4UFJA 5DBUA 3M5XA 1JUKA 3MS8A 1XUZA 1TB3A 4UMCA 4F2BA 4B2DD 1XBYA 2ZDSA 3EWDA 4C7DA 4Q8MA 3NA8A 2GDQA 2QMKA 1ONWA 4N9EA 4Z42C 4FX8A 6A3HA 2J8GA 1EEPA 1WE5A 3NM3A 1JYXA 4X60A 2B81A 2XGZA 1GHRA 3BLFA 3PNZA 4CN6A 1TUFA 1M68A 2G8ZA 3E38A 3WH5A 3S5SA 2Z1XA 1B31A 1OCNA 4NRRA 1OYBA 3BAWA 1WZMA 3LXAA 1KTCA 2R1PA 2CYGA 1CXLA 3EX6A 4MSSA 5E0FA 1FWFC 4ICNA 3OP2A 2WV8A 3RPTA 3TIMA 2Z7GA 3UZ5A 3U48A 3PFRA 3TFCA 3VA8A 2NVCA 3OZMA 3LLDA 2BX7A 2XM1A 4BS0A 4YTRA 5DT5A 1WO2A 5CC6A 2OPJA 4NAEB 3MI2A 1JI1A 2VR2A 3C0QA 3MU7A 1J6PA 5CJ5A 5C5YA 4B3KA 1UPPA 4J4KA 1NARA 1BKHA 5AC8A 4XZIA 2CEQA 1ZJIA 3NIYA 1H2JA 1WUFA 5BU9A 4QAIA 4F4RA 4QHRA 1I2PA 4DBEA 4MNLA 3FNDA 1KW1A 1NDWA 3B9NA 3KTCA 3B0XA 1U22A 3EDEA 2A21A 5DBTA 2CBVA 3WDHA 3V0UA 1DIEA 3SO7A 1FXPA 4IXHA 4UCFA 2V38A 3DC8A 1W1B1 5F2IA 3IUDA 4ACYA 1XLKA 4JKLA 2DV0A 4GI6A 2JEPA 4B9YA 1XLFA 4UQEA 1XYZA 1E0WA 4RNFA 3EOEA 2UZ9A 4HNLA 3F1QA 3L4ZA 3M6DA 4XIAA 1KQYA 5MKGB 1QI4A 1QW9A 4XVDA 4HA1A 3FAWA 3U3HA 2CHNA 4L6DA 4NXKA 2YA1A 3C0LA 2FMNA 4I7WA 3TLLA 3W7DA 4OVXA 2DZVA 1M03A 1BF6A 2A79A 4XX6A 3RM9A 4DQWA 3GY1A 2YGYA 2Q02A 3RUBL 3URQA 1BSIA 1OD0A 3WNLA 3WQCA 5CC7A 3OODA 1VRXA 2J7FA 5DN1A 4J2PA 3VNLA 1OCQA 2WCAA 1NM9A 3C61A 3A24A 2GGIA 1WUEA 1KQZA 1YYAA 3W75A 3MY9A 3DFPA 3BMXA 2V3GA 4EAMA 3PNUA 3KVKA 4GBUA 2PLCA 2WC7A 3DG7A 3W72A 5AHEA 2MNRA 3GBDA 2CBJA 1EIBA 1Q4NX 2VEGA 3E49A 4UTJA 3THUA 2E6DA 5CPQA 3SDOA 2VXNA 2ANUA 1V6YA 3BLIA 4MGGA 4NUWA 3PWAA 3T81A 2C19A 3AMDA 4O53A 4MB4A 1UG6A 3S1VA 3W7IA 3PG9A 4O12A 3AFBA 4E6MA 1LQAA 3VFLA 3ITCA 4TV5A 3AWOA 4GYPC 4MNJA 4FF7A 2XIBA 5BU6A 4ZXLA 1EX5A 1GYLA 4GOAA 3KXQA 5C6MA 3ZR6A 2Z0IA 3PM6A 4S3EA 4AD2A 1M6JA 5J5RA 2Y1HA 1X39A 3APYA 1J18A 3FHAA 3VCRA 4DIAA 4KKXA 2TAAA 5XIMA 1V3HA 4LS1A 3GNOA 4HNOA 4XTIA 1ZUAX 4QCEA 3O0KA 2RDWA 3AXKA 4MYXA 4TV6A 4AUBA 4H8VA 3O16A 1W91A 4QNWA 3BJSA 5KETA 3VOJA 1Z48A 3WQGA 3NNTA 4NYUA 3UG8A 3QW4B 4KFOA 1PDZA 5AYXA 1Q2RA 1K70A 1ZU8A 1W5PA 1CXHA 3A4JA 4MJ4A 3VKKA 3L4WA 4CKQA 2FZMA 5DEZA 3HPZA 3SUUA 3GS6A 3GUWA 3W1MA 1FWDC 1DTNA 3FA4A 1QBBA 4B5WA 3K46A 4UZSA 4JIEA 4PCSA 1E0VA 4K2SA 4DN1A 4CD6A 1SZRA 1F74A 2PDKA 2J13A 4DF0A 4HA4A 4DWDA 2HRWA 3HG4A 3MHFA 1XH0A 1O60A 3GO2A 4PMYA 5EB8A 2GDVA 1E6RA 2AAAA 3GYEA 5I3FA 3U0HA 3R79A 2G5WA 2Q6ZA 4YVVA 4JX4A 1A53A 1JCJA 1YMYA 5DCDA 1SFJA 3TNBA 3MUXA 3EDKA 2ISDA 4GIEA 2CERA 2Q8ZA 3L12A 3UR2A 5F2GA 4D8ZA 4C6EA 2ZX5A 1RZMA 3NM1A 4H7VA 1JCLA 3P7YA 2ZCGA 1NF7A 4EF9A 5EMKA 5D04C 4K38A 4O1AA 2J7DA 4EP8C 1MUMA 4TX9A 1CIUA 2QCDB 1O1ZA 1EC7A 1CGVA 2D3NA 1XD1A 2PDUA 4H9TA 1UBSA 3UJFA 1P1XA 2ZZ6A 3FAXA 1YBQB 2VENA 4LANA 4OBTA 4M6VA 4A22A 3MJYA 1W5NA 1VBHA 3CHDA 4PMRA 1YIXA 1O95A 4MKSA 3S9YA 1SW7A 3W7MA 4DUVA 4CCDA 4EPBC 4UFHA 2XH2A 3TR2A 1TV4A 1O5XA 3B9OA 4ZA0A 7TAAA 3TQPA 3PULA 1LQ2A 5M3WA 1CGYA 2J24A 2RGMA 3H2FA 3XINA 3BOLA 1VFOA 1OYAA 1V0MA 1FDJA 3TTSA 4AEOA 3P2VA 1QPOA 3G5EA 3N2XA 2CHRA 3VIFA 4B4FA 2QZRA 5LNWA 3T0DA 1S5VA 2XVNA 3WL0A 3M16A 5B7ZA 2WMHA 3UZXA 2VOTA 2J47A 1QK0A 4E3TA 2X0SA 5AHLA 3N25A 1A49A 3ZQ9A 3VGBA 2V5KA 4HYWA 4N0RA 3WMLA 4AX6A 2VM8A 2PPGA 1EYEA 5HNRA 5ABGA 1B3OA 2CLMA 3WNOA 1XSIA 1VHNA 4PBGA 3L2IA 4ZXOA 2W27A 4ZQPA 1OCJA 3I6RA 1K9FA 4O54A 4J7RA 1V0KA 3QH2A 2ISVA 1TJPA 5A6AA 5A8MA 3WDQA 4M5PA 1QATA 4ORMA 5ABEA 1ADDA 3THQA 2NQLA 3A13A 5I78A 3HG2A 5JU6A 7TIMA 3CPUA 1UMYA 2ZA1A 2IPWA 4M56A 2POZA 2W0UA 2FPVA 2WHLA 3DXIA 4GYKA 3PZMA 1C90A 1CB2A 3IJ9A 3CZGA 3S83A 1FWNA 3WLHA 5BOFA 1GTEA 5C70A 5K9CA 3M0IA 4OWGA 3BV4A 4QGCA 3M5YA 5CAHA 2VVNA 1VAHA 3F2BA 2HMCA 1G94A 3O15A 3MMDA 1VRDA 2WB5A 1HFBA 3CV1A 4Z1AA 2Y8KA 3BQ6A 4I8DA 3BJTA 5DQPA 4GVFA 4PTMA 3BH4A 2RGLA 2HXTA 1QOXA 4GC4A 1EBHA 3P80A 4W9TA 3VKCA 1C29A 3G1RA 1ZJHA 1PZ2A 3UBPC 4XBJA 5M17A 5CGMA 3FIGA 3VZYA 4WSKA 4AFYA 1K7EA 4U10A 4UWMA 2J6XA 3P67A 3R4IA 2P10A 3VD4A 4W8AA 4PMXA 3PSVA 1FOBA 1KGXA 1W9DM 1NQKA 3DGBA 3UJRA 1SZGA 5FF0A 3WQ6A 3MMWA 4HJWA 3PVFA 1MUWA 1S2UA 1NOUA 5A8OA 5CPLA 4LCRA 3CV2A 4LS0A 3KBSA 4HBKA 4X63A 4LUYA 1O5KA 3UR5A 3W7OA 1Y5VA 4KIEA 3ANUA 1XF0A 1JQXA 1QBAA 1TPDA 2VEFA 1RLDA 4YU1A 1U1UA 4L9YA 2OEMA 3AIEA 3MYOA 3O06A 3P6LA 5E93A 4GX8A 3SR7A 2Y7DA 2BVDA 4OOZA 2ZRWA 2VC6A 3NEHA 1LROA 3M0JA 1Q7MA 3CEPA 2IKGA 4N4PA 1R47A 3EPMA 2VR5A 4EE9A 4MZ8A 4N7QA 3WJSA 3EBVA 4W88A 1L2QA 3T78A 4K8EA 2JGQA 2DEPA 3SY8A 2D0HA 4HYRA 1F6YA 2NXGA 1B57A 3RX2A 1PZ3A 2ISWA 1PIGA 4Q8TA 4DLMA 3TN6A 1IR2A 1Q13A 3CIVA 4DXVA 4FNRA 4AZIA 2VRJA 3UXIA 3S2JA 3NQMA 3UGRA 3T4CA 6CGTA 3HGJA 2XWDA 2PDJA 2VC7A 5C8BB 3E12A 2VQUA 1RP9A 3TV8A 1O66A 1D8WA 1P0BA 3R7MA 2DDXA 8A3HA 1J10A 4DBSA 4ZO8A 1DBTA 4P7QA 3LXBA 4AIUA 3TYAA 5F1UA 2E7FA 5TNVA 1K4GA 4BQ5A 2E5DA 2VURA 1EPVA 2HEJA 5F4XA 4NSBA 1TWZA 1H5YA 1E1CA 1J0ZA 3W7EA 3U6WA 4GNKB 3UVIA 3QTGA 3G1SA 2FYMA 2OCZA 3QOKA 4HZ7A 3W82A 3L65A 5FJIA 4HNUA 5LXEA 3MI3A 1MYRA 2D0GA 3SN1A 1VZWA 1HGWA 4H9YA 3DFQA 5T91A 3V1PA 1EO7A 1DIOA 4FNSA 2I7GA 4WJ8A 3S1WA 1W5OA 3ALFA 4YHGA 1I2RA 1G69A 4ALDA 3K8KA 3K8MA 2BFGA 1JJKA 2YCLB 3GG8A 4W89A 2ZVIA 5REQA 3DI1A 5AOUA 1NJJA 2ZZ7A 3L4VA 3W6YA 5K7JA 2X09A 2XSXA 4AZHA 3BZJA 2J7CA 3M0KA 3SFKA 1G4TA 3N2MA 4YCOA 3W7HA 1V6UA 2XH7A 3AMGA 3B8DA 3NQVA 5KTLA 3LTYA 3P5YA 3G2GA 3WQWA 4HIBA 3UXKA 5JBDA 4BI6A 4HZMA 4CNTA 1P43A 1R7OA 4JTHA 4C5ZA 3UYCA 4Y8FA 5LNUA 1SVDA 1WKYA 1XLBA 4X0VA 1H7RA 3FYYA 1D7FA 1AW2A 2YKKA 4XO6A 2FB2A 2EF9A 3VIJA 2ZTJA 7CGTA 3NSMA 2V6AA 3CQ0A 3BAJA 3QKEA 1UKQA 2B7OA 4YL2A 5A5WA 1T5AA 5D38A 3CZEA 3ZSSA 1WQ5A 1Q6FA 3W37A 2YLLA 4GKTA 1PIIA 1X1ZA 5BXSA 1Q2SA 1UWSA 1FUYA 1K3UA 3NO5A 4ZOCA 5LIKX 1PTDA 2GVGA 3TQVA 2ZZ5A 1G4EA 1YPXA 3UNDA 4UTWC 3W2UA 3GDBA 3W1RA 4ZZ9A 2E3ZA 4FNQA 3FVMA 4ZB0A 4LSBA 4LY4A 1C8YA 4L9XA 2QJMA 2WQPA 4L1XA 2YIHA 1XLDA 1J9YA 4IJRA 2JIWA 1UR0A 4M81A 4HOXA 5HNNA 3SAZA 1TRIA 1TA3A 1QNRA 3VGFA 3GFXA 3EPNA 2IQ0A 3LX9A 3UERA 1Z6KA 1W3LA 4I6VA 5D9PA 1V5XA 1W2VA 3W27A 4PSRA 2GL5A 1M7PA 4ZEPA 2E6AA 2QCGA 5G2IA 4WGXA 1A4LA 2H9AB 1RCXB 3K13A 3DX5A 1VBRA 4UFIA 1NAL1 3NQ7A 3GH7A 3NQ2A 3AS1A 5CXPA 5MF5A 2PE4A 4Q7IA 3RM4A 2P0OA 3AIQA 5FOOA 2QCFA 1QHZA 1FWRA 1AFSA 2D23A 1VCFA 3S4TA 4Y96A 2XGIA 3GX9A 3N2BA 4GUFA 3LXCA 1GKRA 1TJ1A 4CQ8A 3UWUA 3LCHA 1J5SA 4JTDA 1Q6LA 3NVDA 2XISA 1FWJC 3WKZA 2J25A 4QTGA 3MWCA 1S46A 1MEWA 4H7CA 3STCA 4DJDD 1RCOB 1FP8A 2XH0A 3IV8A 4GJJA 2V2HA 4M24A 3KVLA 1ITXA 4S3FA 2DSZA 1FY6A 2D69A 3OVQA 2DH3A 2MUCA 4OQVA 3PWGA 1FCVA 4P61A 5JVLA 2X16A 4LY8A 2BOGX 4TUFA 2PTYA 1GQJA 1OX6A 2IQTA 2OZ3A 4TR9A 2BVYA 2ZUWA 2C16A 1UWRA 4LAKA 1XIBA 4UTTC 1I75A 4NZ3A 1PTGA 1V08A 2HE8A 3NO3A 4I5RA 1DE5A 2YR1A 1MDRA 2VYOA 2FVKA 2ZWZA 5BXPA 3VUSA 2YL8A 3N6JA 4F2UA 1QU4A 5EBUA 4X0NA 3FJLA 4AW7A 2J74A 3T55A 4XD5A 3OW1A 1EKOA 1VCVA 1ZP4A 5HDRA 4Y9OA 1RQBA 1XRFA 3FSUA 3KOFA 5FKYA 1DIDA 1Q6EA 1UOKA 3GW0A 4UTIA 2YFOA 3B0UX 1EBGA 3OYXA 1LM1A 4GXWA 1YDVA 1ZPTA 3T6CA 1XRVA 2DJLA 1UC4A 4NJIA 1BSLA 5EGRA 4FXJA 1ITCA 1LJYA 5EYWA 4HP5A 2NLYA 1UPMB 3CB3A 1LBMA 1QT1A 2FZBA 2O9RA 1IZKA 4TIMA 5BRQA 3OBEA 1SW0A 3F4NA 3AIRA 1MUCA 4RV3A 3GXDA 9XIAA 1R3SA 3TN5A 1ZCOA 1OK4A 4D6JA 2XVGA 3V1HA 4MPKA 1H1NA 5D05A 1T7LA 4FP1A 3POCA 4HA0A 1BLIA 3E2RA 2GJXA 3W1XA 4MFEA 3E02A 4C65A 3MBDA 1W9PA 4Q33A 1TKKA 3P0WA 1BG4A 2UY3A 1ADOA 2GJPA 3SFWA 2PDQA 1B90A 4WY0F 5DMYA 2X7WA 3RJYA 1ZBKA 4UTTA 4ZFCA 3C86A 1V6VA 2YYTA 3IUHA 4L64A 3CAVA 5FSDC 1OGGA 3QV7A 4JTTA 3EWUA 1VFMA 3T07A 3KOWA 1A5UA 3AISA 3WH6A 3AHYA 1BQGA 2ZQ0A 3CXOA 3W86A 3ORWA 3FXYA 4EPDC 4DF1A 2WSRA 1IHIA 3UETA 2QYGA 3H24A 4DWSB 4HHMA 4YWSA 3OLDA 5CSYA 4O52A 3JUGA 3MSYA 1AZ2A 4TTGA 3PB2A 5MHBA 6ALDA 2Z6JA 3S0CA 2WMJA 1UD6A 1PZ0A 3CK5A 4XUGA 4CQ9A 2FHCA 4Z2IA 3EYPA 3WSUA 4PB5A 1MW3A 4KIRA 5CSUA 4GY7A 3CGTA 1GVYA 3N14A 3S9IA 3U7BA 4WIWA 3DI0A 1G7UA 4GUHA 4B9ZA 3TTEA 2DIJA 4LGXA 3HJEA 1A80A 4PRRA 2PS2A 3OA5A 5CBJA 1Y8BA 4P7NA 3FEQA 5FIPA 3AXIA 3SQMA 2F2HA 1BTMA 3W7JA 1XSJA 1P48A 1GW1A 2CLFA 4GX9A 1G01A 1VF8A 2QUTA 2DW7A 2XYLA 4L65A 2WW5A 4DJEA 3PN8A 2ZXDA 1K9EA 2X2YA 4YPJA 4TTUA 4Y9MA 2X1TA 3UWWA 4IIBA 2XZ9A 1WZKA 3QHNA 1E3XA 4JHOA 3VGEA 1HX0A 5I77A 2ZICA 3LB0A 1RVKA 2OQLA 5HOSA 3LEPA 3M0XA 4IIHA 2FTWA 4PMQA 5LGZA 1W8GA 1HN1A 3HO8A 2VD9A 4N02A 1W9XA 3QLLA 1DWIM 3WQOA 2CKSA 2Z1VA 3WK0A 4UTKA 5CGTA 2GSEA 4ZB5A 3ZR4A 3NTYA 3T08A 2OYKA 4F0RA 4PUKA 1XLMA 3A6OA 3MANA 1HO1A 3EB2A 3C2OA 1XLAA 2ZA3A 2QV5A 1DP0A 2ZVRA 2D22A 2D73A 1SU5A 3BL3A 1DJGA 1MXDA 2WVSA 3HU7A 3S2CA 4RPPA 4PYSA 1SGJA 1YW1A 1SYTA 3E0LA 3SY5A 2BXZA 3BICA 4ZCWA 2C7FA 1PE1A 3CV6A 2HZGA 2OKTA 1V3KA 3TYBA 3WMCA 3V5CA 3WDPP 4LCQA 4IFRA 4AZ6A 4FIRA 2AGKA 3SIZA 3N9RA 4P8VA 3GHTA 4ILSA 5FESA 2R1LA 3BOFA 1XDMA 4NZ1A 4ASTA 2Y5SA 4G7FA 2DORA 4LPCA 1KM4A 4RW3A 1YPFA 4S3KA 4IIGA 4LALA 1I8JA 4LNYA 1XKYA 3LYEA 1R30A 3G1VA 4IF2A 3TSMA 4GIYA 1FDZA 1EXBA 5F4WA 4S3DA 2Z27A 3VZXA 4GNVA 2RUSA 5FACA 3C2RA 5AHIA 2BY1A 2WNQA 3HG5A 3UXAA 3EOSA 3PF3A 4F9JA 3S9ZA 3AI0A 1RY0A 2ZX8A 2D20A 1K8CA 4HNVA 2P1FA 4PODA 1SW3A 1DTUA 3HJZA 4GJIA 4ONVA 4Z2GA 2P76A 1K9DA 3CUHA 1GVQA 1EGZA 5FF3A 2FVLA 2XWEA 1CTNA 1MXSA 3NQFA 4Y90A 3VZZA 1A3HA 3LHWA 3OBAA 4WXYA 2HWGA 3I6EA 1TJRA 4LFYA 1WXYA 5JUVA 2VRKA 3G77A 1DL3A 4ROPA 1AK5A 3O07A 1AQ0A 4Q8NA 1CDGA 2FFIA 3UA4A 3GG7A 2CBIA 1Q5MA 4XWUA 5ABTA 4F3HA 3TCSA 4DHGA 4FK9A 1UR3M 5HATA 5K9XA 2CCRA 3VGDA 1XCFA 3DEQA 3TOPA 3HF3A 3E2VA 2DVXA 3VIIA 2VGBA 3FHQA 2YDSA 3MYPA 3A47A 4FX6M 1RV8A 4Q32A 3TN3A 4MLRA 2GVEA 4Y6GA 5AYZA 1U1JA 1M04A 2VI0A 4FHAA 5BRPA 5CJNA 5HMFA 5FJOA 1OINA 3CLMA 4GWEA 2WWDA 3TYEA 3W07A 4CNSA 2J62A 2PC8A 1G4SA 2FJKA 2R94A 3A3XA 2Z25A 4D72A 4G6CA 3G1FA 3R25A 4NZ4A 4MWAD 3CUIA 3AYTA 4P7LA 4G9PA 2GGHA 5G2WA 3OVRA 2PSNA 1YTDA 3MUCA 5D9NA 2V5CA 1R9ZA 3CQIA 1ECEA 1UUMA 2DQXA 4UMAA 2ABBA 4FNUA 1W17A 4YTSA 2IXUA 5AVNA 1NFBA 3UESA 1FHLA 4CU8A 3LCWA 3Q58A 2PDNA 2PWUA 4MKVA 4XK2A 2F7FA 1YPIA 1OX4A 5C55A 3QZ6A 2DT3A 2QUVA 1EC9A 3CTTA 3EWCA 5CLWA 1QW7A 2CLHA 4JTCA 3SRFA 2IPFA 2G3MA 3EMZA 1FWEC 1QASA 1WAWA 3V36A 1J96A 4B15A 2ZKMX 5K9DA 1IWPA 3V16A 3PP7A 1X6NA 1R8LA 1W0MA 3T09A 1JZ5A 1XSKA 5M2FX 2L5HA 1ITQA 4HHPA 1OFDA 4YLWA 4HT3A 3UU0A 2XINA 3NGJA 3AQUA 3BO9A 1S2TA 2FHBA 4FXRA 1EQCA 1O5QA 2HBVA 1L8PA 3ZMRA 4FNTA 1KR0A 2DY3A 4FLSA 1VPYA 4HTYA 3WNKA 1HJXA 3ZT7A 3WQFA 4RZ5A 4S23A 4ERIA 4JZ5A 3I3BA 1KKOA 3L4XA 1KXQA 2H3DA 1SQ7A 1VPXA 2O4QA 3CT2A 4B5XA 2FFCA 3MB9A 3ARWA 1R9XA 1KFKA 3QMSA 2OZ0A 2WAGA 5HQEA 4RV8A 1FBAA 2CLEA 3ITVA 4AXKA 1ALDA 3QSTA 2PZNA 1R5YA 1UH2A 3CUZA 1YX1A 1VCGA 2PRHA 5TAOA 1XYFA 2INFA 4KWUA 1TWIA 5LIYX 3I7SA 4W7WA 1TV7A 2R82A 1E72M 1W1YA 4DJED 1P0DA 3W1PA 1AVAA 4OKDA 5FJJA 3UYIA 3VE9A 3AU6A 1C91A 4H01A 1FWTA 4J40A 1JDDA 1SJCA 4NL1A 3P8JA 3CL7A 3L68A 2I16A 3GLCA 2OT1A 3CEUA 1MEHA 4UQCA 5BWAA 4PTWA 4JTEA 1JZ6A 4QCFA 2EPLX 4IX0A 4O0KA 3TP4A 5LYRA 3EAUA 4C60A 4LUTA 3L67A 1YXCA 3B0VC 3HOJA 1RJPA 2QGHA 4RDYA 4D6DA 2WQDA 2YSWA 1QAPA 1TFVA 3WLJA 4H19A 3BGJA 1H51A 3W1TA 2VP8A 1H7OA 3OEXA 4G5DA 3MHUA 2ZOXA 3AIVA 2PWDA 1M7JA 1GZJA 3S47A 1KC7A 1V3JA 3E0IA 4GFSA 1TV5A 2XGBA 4NI8A 2YBUA 3IVUA 4J3TA 1YE6A 1GK8A 2AOSA 1PS9A 3GSMA 1XIJA 4DXKA 4Q4QA 5I07A 4CNPA 1NIUA 2BGSA 4LX4A 3ZS4A 2VEMA 4GVHA 4NJKA 1FKXA 5A8GA 1S3HA 4B5UA 3WBAA 4LUTB 4U33A 2DZUA 4BFAA 3BW4A 1CGTA 4MFDA 2GYIA 1XJBA 3H4XA 3NPXA 2DSVA 4MJZA 2YL6A 2EPHA 4MZYA 3UZJA 1KBBA 3AALA 5ECUA 3IK2A 2G50A 1XBZA 1YNPA 1IF2A 4J28A 5CC5A 1OABA 2O0TA 2YXGA 3WF2A 4E4PA 2QCMA 2WSYA 3WEZA 3SCUA 2RJHA 1K03A 2A0NA 3GTXA 3JW7A 3CZKA 2J6VA 3MA8A 2PU0A 1Z89A 1IT8A 4BF9A 1MFUA 4K39A 1JIBA 1A0DA 3TJIA 1BHGA 4PGLA 2VX5A 4ZTXA 2CXGA 3ABXA 1E43A 3IVSA 3UCQA 2E0PA 2VFHA 2JQXA 3NL6A 2BVWA 4L6OA 4PFMA 4RL3A 2J4GA 3AIWA 2AQOA 4KFPA 1GVIA 3M0HA 4PH6A 2QUMA 5IDZA 1HKVA 4C6FA 4PMNA 2P53A 1X8FA 3DFOA 3S3GA 1XHGA 4LCSA 3ARPA 2F6XA 4WDUA 2CLIA 1U5VA 1XDLA 2WPBA 4HK7A 4ERGA 3VKDA 3CT7A 3HMCA 2IS7A 6TAAA 3R94A 3JZUA 2PD5A 1CGXA 4QLJA 3H70A 2BS9A 4HCDA 2RKXA 3B4UA 5DF0A 1Y65A 2EEXA 1RD5A 3CLWA 4Z2LA 5L6UA 2G95A 4DO4A 1EHNA 4JIPA 3S5NA 2XFFA 1KM5A 2OOFA 2OKOA 2R1NA 4RR4A 2YXXA 3RU6A 2Z28A 4D71A 3HPAA 1W1PA 4MAVA 1R2TA 2PRLA 4ADUA 1A5LC 1HVQA 2Y7FA 3VAVA 1NOWA 4YS1A 2VGFA 4LBSA 1MQPA 1JD7A 2J75A 1TMLA 3N12A 1BFNA 3W02A 4JIIX 3ECQA 1ECQA 3BARA 4JFUA 3H8AA 4PB3A 4EWJA 3FVDA 2E4TA 3ARRA 2FVMA 1V3MA 5DXXA 1H3GA 3NSNA 3GNRA 1QCWA 3SZ8A 3CO4A 3B03A 4JX6A 5I09A 1ITUA 4DY1A 5HJXA 4CD8A 4PCTA 2LLEA 1L6YA 1KGWA 1Q85A 3MMTA 5HA7A 4QSHA 1XD0A 5GNYA 2PWVA 4KW2A 1ZHAA 3ID7A 4QJ4B 1IXNA 4QEHA 3LNMA 4O14A 4CGTA 5I23A 1AMKA 2WMFA 5KITA 4BI7A 4V2XA 3RMJA 2UBPC 3VINA 1LTDA 5JBEA 4DAIA 3V5FA 4KPLA 3WQDA 3ABQA 1P4CA 2QJJA 2PWHA 2YDQA 4L4PA 1VBGA 4A2RA 2OWCA 3W29A 3GDRA 3EA3A 2RDXA 1YDNA 3K1DA 2R6OA 4C7FA 4HKPA 1QWGA 2IPGA 1SJBA 3R1ZA 4KFNA 2ZDRA 4JGDA 4JQ4A 2I5QA 1BVZA 5FEXA 4A29A 5LGXA 3F5LA 2INZA 4QAWA 5AY7A 3MSDA 3NQGA 1N82A 4KH2A 3VDAA 4KEZA 1ISYA 2W67A 1KBKA 4F2TA 1ONRA 4JN8A 4PCFA 3QV6A 1SZNA 2ZRZA 3MBFA 1MQQA 1K8ZA 4XIMA 3PBVA 3L7RA 4XBKA 4NT0A 3E9AA 2J78A 3AROA 4EPEC 4D8AA 1SPQA 5C9RA 3QY7A 4V33A 1OBAA 3T0CA 2WSQA 4Z08A 1DWHM 1F6PA 3EMCA 1OFBA 3F4DA 5GJNA 3INPA 3BSMA 3VKAA 1JAKA 1OFOA 3GIPA 3G1AA 1XLIA 4QE4A 3A23A 3AZRA 2QCNA 3NVTA 4FMVA 4J3WA 2DUAA 4O8RA 1BGAA 3LS9A 2E28A 3IJIA 2XFRA 1M7OA 3TWBA 2R9RA 2V3EA 4AMCA 3W3OA 3DDMA 5D2VA 1TVNA 4Q8VA 3QYSA 4OTKA 3C8NA 1YTKA 3LMYA 5BOOA 2BOEX 3WL1A 3S2MA 4X9YA 3GTIA 2AMXA 1WOBA 4U28A 1Q45A 2VGIA 2XM2A 5DRCA 1TX2A 3FFSA 5J5DA 2VJXA 4WQ6A 1HP5A 3N29A 2EKGA 4UTUA 1WPCA 1JG9A 1OGSA 5I0DA 3TLQA 1TX0A 3A3WA 1OF8A 2YXOA 4LYRA 4B90A 1S2WA 1WCGA 2VO5A 4WCJA 4JTGA 3USBA 1H0IA 1UIPA 2VZUA 4EOUA 4GCAA 3QFEA 2ZRXA 4GA8A 3LSBA 4C6OA 1RA0A 2HK0A 3N4AA 1H60A 1R3QA 4N2YA 4TVCA 2IXVA 4KRUA 5IM51 2Y85A 2ODOA 3WFAA 3J7HA 4H2CA 3SCTA 3LM7A 2PP3A 3TXVA 4C6JA 4CNUA 3TC3A 4GQGA 5I2UA 2C18A 1EA0A 3N2TA 3CC1A 4F0MA 5D32A 2H3BA 4IFOA 3IAPA 3L4TA 2HV5A 3CHVA 3KX6A 4HHHA 1ISWA 4KBXA 3ZVHB 2BGQA 2VTFA 3QZAA 3LCGA 2Q8LA 3SCOA 1JQVA 3WBXA 3KS5A 3COTA 4HOZA 1NF0A 4H04A 1YE4A 3CUGA 2PBOA 1XYLA 3MKKA 4BJHA 4PEKA 5E0CA 2OEJA 3PHAA 3OZYA 2X40A 4PL1A 2G3NA 3T9PA 3TJ4A 2DSWA 1BVNP 4CD4A 1AODA 3MZNA 2BP1A 3P93A 2W62A 3C2FA 2PF0A 4IUGA 1V0LA 4GGHA 4DF2A 2VX4A 3CPGA 5HWMA 1S5TA 3RIKA 2VL4A 1Z8AA 1E15A 3C2EA 3NOEA 4IMDA 2VCCA 3LERA 3USZA 2A7NA 2VKZG 1XGZA 2OGYA 4I9JA 2WNNA 4UFMA 3Q67A 1ZAIA 5BWFA 5D2XA 3HG3A 1W32A 2WHKA 3PG8A 3T2OA 4WKAA 4AWTA 1NH6A 2WMGA 3P82A 4GQQA 4Q7BA 4ZL1A 2GJXB 3MV01 3KBMA 4GXMA 2CLKA 2ZE0A 3FKRA 2Q01A 1SO4A 3W4RA 4QS5A 3VNMA 1GJPA 3GRIA 3GU9A 3DESA 2PUZA 1OIMA 1IXPA 3ITOA 1ICQA 3TEVA 2DVTA 4UTMA 4C1KA 1GTHA 1KM6A 2E1DA 2W61A 3SCRA 1HKWA 1UZ4A 3AZTA 1H11A 3MCOA 3BCFA 1U30A 2NSXA 3VGHA 2PB1A 2WOQA 1V7AA 2FLIA 3BC9A 4GUGA 3W71A 3OVGA 4N9CA 3DFTA 1WDSA 4GI4A 4DPPA 5D9OA 3FK4A 3B0YA 4IQEA 3TX9A 4FF5A 1VBUA 3RXZA 1QNPA 5D2YA 3U2CA 5KSWA 4JTSA 3AYVA 4KWVA 1CX9A 2QDHA 1C92A 2QCEA 4E2VA 4JIQA 1KR1A 3MVTA 1XCXA 4W5UA 5XINA 1YRRA 1DXFA 3GU2A 2I5GA 5CCZA 1XXXA 3IIVA 2QDDA 1UA3A 2PZ0A 4AC7C 1Q7QA 1LL6A 1CECA 4ZOAA 2KAUC 2SFPA 5HXMA 3WF0A 1XLHA 2YDAA 1C93A 2Y89A 5BYWA 1SFTA 4FOJA 3CYJA 4LB3A 1H62A 4GNJA 4LS2A 2V5BA 1BTCA 2A7RA 1MDLA 4OUEA 5F2LA 1BYBA 3QQ1A 4GO9A 4U3AA 3UEQA 3U4FA 3GXPA 2V3FA 2WNWA 1F05A 4GBDA 3A4WA 3ARZA 1GVRA 5CPNA 4A8IA 4O1BA 3W7CA 3KOXA 2XIMA 3GG1A 1LLOA 3N1AA 4HSNA 2QMJA 3ES8A 3M0MA 3NAVA 1KTBA 4NVTA 3BTNA 1WDRA 7REQA 1GG1A 3LCFA 7A3HA 4AY7A 4JTJA 3CBWA 1RCQA 4AWUA 1XI3A 3BZGA 4AD5A 3RLGA 2B0MA 4MYAA 1A5SA 3QHOA 2ZX9A 2OODA 1UJQA 4WOZA 3GNDA 3ZLHA 3R8GA 3H7UA 4I9MA 3NWRA 4P7RA 1C8QA 1TE6A 5ENLA 4TQTA 4JQAA 4HOWA 1KD0A 3CQKA 2GLKA 1UQZA 1XL9A 2PDCA 4IL0A 4MJ2A 1A5OC 4LH8A 4V27A 3KP0A 4W8BA 4L9ZA 1PKNA 3O8AA 1LYXA 1XRTA 5LIWX 2J66A 3DGRA 4HCHA 4FAMA 3P5ZA 3MI6A 5CKSA 3LZ5A 1B3ZA 3SQSA 3MWAA 3AICA 1ESWA 2WNZA 1OC6A 2Z1WA 1KB3A 4H9XA 4BY3A 3LY0A 3M07A 1BWVA 2W66A 1QRQA 4QXIA 1SO5A 2BVTA 3M41A 3GXIA 3GR4A 3IIPA 1RR2A 4JYFA 4LU0A 1I2OA 1RBOB 2VFIA 1QUMA 1F3TA 1W31A 2QXWA 1SO3A 1B3WA 4AVNA 4ZQMA 2OWWA 5I3DA 1O1HA 4C6KA 2BY3A 3VIOA 5HANA 1U5JA 4URIA 2BB0A 4OV4A 4M19A 2YZ5A 2PURA 4WDWA 2R8WA 2AL2A 1OFAA 3W7PA 1FCBA 2FGZA 4R7OA 2EJAA 4IUOA 4EXBA 1VYSX 2OSXA 2TRSA 1O6IA 3FYPA 4PMOA 1GVOA 4F48A 4FZIA 4MB3A 1UR2A 2ZXBA 3LHUA 4WK9A 5GVJA 1VFLA 4LUSB 3WO8A 4S3GA 4X3ZA 1BG9A 4GABA 4DBDA 1UP2A 2A3BA 1RUSA 3MP3A 3E2QA 2NX9A 4O4VA 4PL2A 3MDUA 1MSSA 2VT0A 1W56A 3S6OA 5CJMA 1XBVA 2GWNA 2NWSA 4K7VA 1CXKA 2RJGA 2R14A 4GH3A 5FF4A 3B0PA 1A0CA 1CLXA 2DZAA 3LM3A 3S5ZA 3DYOA 2ZUTA 3N17A 5D33A 4P8XA 4MTVA 2G3FA 3EA2A 2H8ZA 3MJMA 1V79A 4XZNX 4GUJA 1A0EA 3PWIA 4L4OA 5IBXA 3TZFA 3T42A 5C0QA 3PY2A 1PIFA 2XIJA 2NXIA 2DSUA 3SCQA 4W5ZA 3WMSA 5I3JA 3A5FA 1ODZA 2HBXA 5PTDA 3LSCA 3JU2A 2PAJA 4YVXA 4I9TA 3FW6A 1DV7A 2GPTA 1JUEA 5CH9A 1ELSA 3AO0A 3VM5A 3GU1A 4JS3A 2HXUA 5IXEA 1KGUA 1BXNA 3DC0A 2A2IA 4R27A 3NCOA 3V3WA 1JYNA 4K1GA 3GH5A 1E6XM 1QNQA 4RZ6A 4AMAA 3ARTA 4NZFA 4IJCA 1RD6A 2DZTA 3VDCA 1E4IA 2V67A 4WSHA 4IMAA 3Q37A 3S1UA 3WLIA 4KWWA 4AZGA 2PDGA 1PBGA 1GZGA 5FAJA 5LHFA 2X41A 3GDLA 3IGXA 4O15A 4PFHA 1J2WA 3MDWA 2I57A 1ZZMA 1XIIA 4M0XA 4AF0A 2CLLA 4E2DA 4RK8A 1KFWA 3O05A 4UNIA 2OQHA 1IEVA 1QDSA 2WO5A 1IT7A 2G41A 3DERA 1VBJA 1HF6A 4LOCA 4WD0A 3PTDA 1T96A 1TWSA 1VEPA 3QPYA 3WUGA 2WKJA 4O1DA 4X61A 4XUYA 3W73A 3R8RA 1WKDA 1JF6A 4WOQA 4G7EB 4C6CA 4FB7A 4JHZA 1HKKA 1J5TA 3OTRA 1W5QA 4HN4A 3UPBA 1OK6A 3FS2A 5KEZA 3UNTA 2FDSA 4W87A 2OEKA 2W4XA 2ZZ3A 1FFRA 1K7FA 4K8GA 2QVNA 3W84A 3S5YA 3LLXA 5AC5A 4Z0JA 3W1QA 3W83A 3O3RA 1UR1A 4LVBA 2GK1B 1HIZA 4WKHA 1KV5A 4JTLA 5JBFA 3PC0A 1JZ3A 4KESA 1MWOA 3KWXA 4AH7A 3FGCA 4XTDA 1JPIA 3NYDA 2OR2A 2VDIA 3W24A 4CU7A 4OECA 1DQXA 3G6MA 2ALRA 1CGUA 2O9OA 1T8XA 1GCYA 1WZAA 1D3CA 2PWGA 3C8FA 1OX5A 1VKFA 1JCTA 1PYMA 3BLPX 3SJ3A 2QIWA 2GZXA 1VIWA 2FZ9A 4MG4A 4Y2WA 3VDGA 3L5LA 2BHYA 2FDMA 3QYQA 4B5SA 4A4AA 1MFVA 1E9IA 1POJA 1UD2A 1DWGM 1V51A 4LAOA 4OUIA 2BTMA 2ZUUA 1GT8A 1NFGA 1UWQA 4NHVA 1B4EA 2BXYA 2GVLA 4NNBA 4JTAA 5K4XA 3ATZA 1NDVA 4KWOA 3S6DA 1XX1A 2WVUA 1B3XA 1EPXA 2VELA 2CITA 5K3VA 3CWHA 1ODUA 3LBCA 5A1AA 3DIPA 1SSGA 4GKLA 4S3AA 4AYGA 2V5JA 1XH2A 5J8LA 2ACRA 4IJBA 3SGGA 1NELA 4LTSA 1KTNA 3E0WA 5M1TA 1SO6A 3UWZA 4LXFA 1XG4A 4N9DA 4ZR8A 1PCKA 4YWIA 4R5EA 1PL9A 2C13A 3WK3A 1YQ2A 4GFIA 4HMEA 2VX6A 3TW9A 5EY5A 1DJNA 1X97A 1EX1A 1UB3A 1H41A 3QBUA 2XN2A 2C91A 3BV7A 3U2OA 2OB3A 3LRMA 3T4WA 5I06A 1OJXA 3K30A 4XISA 1LL4A 4HGXA 2AL1A 4CNNA 5FJPA 2Q71A 1Y7VA 4DJFC 4QSFA 2XPKA 3GVVA 2PODA 1QXLA 4LBUA 2YJQA 2PDLA 3PUGA 3WD0A 5AB3A 2X42A 5EPDA 3DYPA 4D1IA 4F8XA 2PCQA 4HMDA 2V8ZA 3EX3A 3QR0A 3APTA 2DP3A 3E74A 5I5RA 1A4MA 2HCVA 3ZVHA 3RILA 1TO3A 2J9XA 3UG4A 1XYCA 2DU2A 3TJXA 3JR2A 3TJLA 2RFGA 1BXBA 1J93A 1YDYA 2ZFAA 4GRSA 2YCIX 5DFAA 2QCCA 3WENA 1VFSA 2XSBA 4AB4A 3LCLA 1SJAA 3GG0A 5HPCA 4U5KA 2EJ1A 1UWIA 1TV3A 3E5BA 3KRBA 3W87A 3SW6A 4ZENA 2YBTA 1XIEA 2WKLA 2HQAA 1E6SM 3V18A 1N8IA 4WGHA 3GIQA 1EB3A 3OVPA 2W6RA 1KFBA 1US3A 1E4NA 4K36A 2BHUA 3L5AA 1RBLA 4JKMA 5AYYA 1JAEA 4EF8A 5A6MA 2QCDA 4Q8WA 4US6A 4UOQA 3W74A 3CB8A 1PKYA 3S2NA 3HN3A 1N55A 4JFTA 4NI3A 5FF2A 5H1WA 1UD8A 4ZE4A 1R87A 1QW8A 3E6EA 1I4NA 2REQB 2HPMA 3CUXA 3CZ8A 3WLMA 3H26A 4PN2A 3PBYA 4DO5A 2NUYA 4Y9PA 4C6LA 4Q22A 1OQFA 4DUXA 3REQB 3NJ3A 1DJQA 5CSRA 8XIMA 3RLHA 3VNKA 2PDBA 4O13A 1KBIA 3ZR5A 4V15A 4C90A 4JXCA 2E6FA 4XB3A 1PHWA 3MPGA 3LOTA 4ZE5A 3RGTA 1Z3NA 5IFTA 3VD9A 3IJ6A 4O19A 4KEMA 3KRUA 4J3VA 5F1VA 4X9SA 4KF1A 5A6KA 4CQBA 2OFJA 4H83A 4ACZB 3WQPA 3FV9A 3G1DA 1GOMA 3NQ6A 5L9FA 5FEPA 3ZOAA 4S39A 5CPSA 3R10A 4BQ4A 4HSHA 4LUIA 4GI8A 4HD5A 1BPLB 1XQKA 1CWYA 1ME7A 3B3DA 1E9ZB 1EDQA 1EJVC 1PUDA 1T41A 3MTWA 5DANA 1WX0A 2XH4A 4AYSA 1R3YA 4XKYB 2Z2BA 2YL9A 3NZ1A 4FXSA 3DBNA 3GK0A 4KETA 3MZ2A 4LBRA 3GXMA 4HTBA 2FH8A 2E8YA 3WIJA 3OLEA 5FJUA 3TA9A 3ZWSA 3WBYA 3QW3A 1SR9A 1RVGA 4GY0A 1Z44A 4F0LA 5JQ9A 2POTA 2PLMA 4FXFA 4WDTA 2PTZA 3WH7A 1ZAJA 1B9ZA 3H55A 3PUOA 4AHPA 4S38A 3NXFA 3B4YA 3GNPA 1QPRA 4KCWA 2OZTA 1JZ4A 5LKYA 1IEQA 2Z26A 1W3HA 3VOHA 3FY1A 4MB5A 1IZJA 1PO9A 1US2A 5FEWA 3IRSA 2HTMA 3TTYA 3IIXA 5T26A 1ISVA 2WHJA 3TSDA 4TVUA 1G9HA 1VS1A 1X8CA 3DBPA 3RFAA 4LC6A 7REQB 5DMLA 3EX2A 4R7JA 1MEIA 4MHBA 4MUZA 3DN5A 2XFYA 2RH9A 4PB4A 1UR8A 3ZFHA 5A6LA 2GWGA 2OYMA 3CYVA 3HBLA 3OBKA 2Z1KA 3LGDA 3OHIA 1QI2A 4LYPA 4EPKA 3EKZA 4GZ7A 3NQDA 5HQMA 2NVAA 4H9MA 3QPEA 1M53A 2GJNA 3BCJA 2OQYA 2QJGA 4NJJA 3W2KA 1WV2A 4UR9A 1BEUA 1WKEA 2E25A 1VHCA 2HS6A 4OZOA 2XUCA 1ISXA 4Z1BA 4B5TA 3II1A 1B3VA 1GONA 4H41A 4XKMA 1MW1A 2IKIA 2NLIA 3O1NA 1H5VA 1R0MA 3V4BA 4IP4A 3OZPA 3M7WA 3MVIA 3GAKA 2VFEA 2A7PA 1PAMA 1G6CA 4H2HA 5JIWA 3HQOA 4HPHA 4TMBA 4R88A 1E6QM 1RP8A 3DKJA 2GJRA 4HQVA 4GISA 1H7NA 1Q65A 2GOKA 4YXGA 3W7NA 2X30A 1JEZA 3ITYA 3SSZA 4AZCA 3NQAA 4DWSC 2OXNA 3BMVA 2YB4A 1CB7B 3QXBA 5ECVA 2GQAA 3URNA 3U57A 2VEPA 3CQHA 3GWQA 3LRKA 3WFLA 2O92A 3LI1A 3THAA 4Z2JA 1F3XA 4MNKA 4UQ9A 1BYDA 1RQEA 1UC5A 2DZWA 1R3RA 3QQ0A 1D3GA 5U7SA 3AIUA 4Q8QA 3W26A 3CO8A 2GUBA 3W2NA 2E09A 3GTFA 4KT2A 1NVMA 4C6IA 1C9WA 4GC3A 4O1CA 5HUOA 4JQ2A 3TONA 1TR9A 4XZLX 3XIMA 1UH3A 4GIAA 4OBSA 1J12A 4JFSA 3HV8A 1JPMA 4JTQA 3A4XA 3A12A 3B40A 4WJXA 3ITLA 3N4FA 3SGZA 1OGBA 3N9KA 4YYCA 3S8HA 3KCJA 5A2CA 1DXIA 3PZUA 4R3UA 1S38A 1UCWA 3ITTA 1XISA 3NL5A 2IKHA 1D9EA 4UR8A 5FD0A 1X1NA 3BG3A 1XR2A 4F0KA 2FZ8A 1BRLB 1O4UA 3BSHA 3O6AA 3QZEA 4QRNA 3PFMA 3VOIA 2X7VA 4YN5A 3PAJA 6XIAA 2BMBA 1BYCA 3WMBA 2Y8UA 3CASA 4GGBA 1E3ZA 1XKJA 4F0SA 1OG0A 1VIZA 3AXHA 3TMLA 2WKGA 3VXGA 1FWCC 1UKOA 4CEXC 1JZ7A 3SECA 4B16A 3VMPA 3VIKA 1WDDA 1XLGA 3VMNA 3GC2A 4DJDA 3UGVA 3KZPA 3WYZA 1X6UA 2OZ8A 2YDRA 2PWFA 1XINA 1FWGC 1KM2A 3P0XA 3S1XA 1DWFM 1I60A 4PULA 1XH1A 3H4GA 3I68A 3NG3A 3M0YA 4ZSUA 1UUQA 3AHVA 4I6KA 2GJLA 2X1IA 2QEZA