4DBWA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 2'-desmethyl-indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of potent and selective indomethacin analogues for the inhibition of AKR1C3 (Type 5 17 beta-hydroxysteroid dehydrogenase/prostaglandin F synthase) in castrate-resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 115
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbwA00
2IQDA 1Z89A 3BCJA 3T42A 1FRBA 1MI3A 3M64A 2ACSA 2IPFA 2PDHA 3CAQA 4PR4A 4EXBA 4LAZA 2IKIA 2IPWA 3CMFA 2FZ8A 3LZ5A 1S2CA 3V35A 1JEZA 1M9HA 2PDYA 2PFHA 1X97A 1QRQA 1HW6A 3UZZA 2F38A 3N2TA 2R24A 1YE4A 4JIHA 4YVPA 2PDIA 3M4HA 2IKGA 3V0TA 3R58A 3QKZA 3GHRA 4WDWA 1US0A 3GHUA 3GHTA 4FZIA 4IJRA 2IKJA 1AZ2A 4LBRA 1Q5MA 4LB3A 1RY8A 4GQGA 4GABA 4FA3A 1ZUAX 2INEA 3R43A 1S1RA 2NVCA 4PUWA 4XZIA 2VDGA 4F40A 4FAMA 4PMJA 1VBJA 3O3RA 1RALA 2PD5A 2C91A 1MRQA 3F7JA 5DANA 5JH2A 3LEPA 1R38A 2ACUA 3C3UA 3V36A 4DBUA 2ACRA 1K8CA 2PDGA 3V0UA 4JTCA 5M2FX 2WZTA 4ASTA 3GUGA 4QBXA 2IKHA 1LQAA 5LIYX 4GQ0A 2WZMA 3LN3A 3VXGA 3N6QA 2NVDA 2QXWA 3S3GA 4GACA 1C9WA 4WDTA 3UGRA 3UP8A 2PZNA 3G1RA 1AFSA 1T40A 1J96A 2HVOA 2PDJA 1HQTA 2DV0A 4DBSA 1YE6A 3FJNA 4JTQA 1UR3M 1OG6A 4YVXA 3U2CA 3CV6A 3B3DA 4GCAA 1AH3A 4AUBA 5AZ0A 1T41A 3BV7A 3RX2A 2I16A 4PRRA 4LAUA 1PWMA 4WDXA 3COTA 2FGBA 4XZMX 4JQ2A 3BUVA 2ISFA 2BGSA 3LQGA 4XAPA 3LZ3A 4GA8A 2P5NA 4JIRA 1YNQA 3LQLA 4DZ5A 2PF8A 1Q13A 4WGHA 3R8HA 1XJBA 3EAUA 2FVLA 2FZ9A 3WBWA 2PDNA 2PDUA 1ZQ5A 4IJCA 4G5DA 4PRTA 4WDUA 4YVVA 4LB4A 4Q7BA 2PDBA 3LNMA 4JQ4A 1EXBA 2IPJA 5HA7A 3WCZA 2HV5A 3ERPA 2IQ0A 3EB3A 4QR6A 3MB9A 3UZYA 1PWLA 1IHIA 3D3FA 5KETA 4ICCX 2HDJA 2HE8A 4JIIX 1QWKA 4JQAA 3WG6A 1ZGDA 2PDCA 5HNTA 1PZ0A 4L1WA 5LIXX 2DUZA 2PDKA 1S1PA 4L1XA 3ONCA 1PYFA 2DUXA 2PDLA 4XZHA 3G5EA 2ACQA 4XVEA 3Q67A 4YU1A 4MHBA 1XF0A 3UZWA 3FX4A 4JQ1A 3R94A 3LENA 4XO7A 4XVDA 2PDMA 3LD5A 1AH0A 3GHSA 3H7RA 3KRBA 4R9OA 3LUTA 2ALRA 1S2AA 4ZFCA 3R6IA 3RX3A 2PDFA 1SM9A 5JH1A 4YS1A 2PDXA 2PDPA 1X98A 5C7HA 3RX4A 3CV7A 1AH4A 1ADSA 4WRHA 3UFYA 3M0IA 4HMNA 3H4GA 3Q65A 4JTAA 5AZ1A 4DBWA 3WBXA 4H8NA 5LIUX 2HEJA 4JQ3A 3UG8A 2A79A 2R9RA 1A80A 4H7CA 3P2VA 3EB4A 2BGQA 4XO6A 1Z9AA 3CASA 5LIWX 4XK2A 4GIEA 3CAVA 3WBYA 1Z3NA 3BURA 3ONBA 1LWIA 5LIKX 4XZLX 4RPQA 3R8GA 1XGDA 4OTKA 3LBOA 2HVNA 4PUUA 2PD9A 1EL3A 3DN5A 2PDQA 3MC5A 4JTDA 1EF3A 4I5XA 2PEVA 3DOPA 4HBKA 2IPGA 2I17A 2FZBA 1IEIA 4Q3MA 3V0SA 2FZDA 2CLPA 3O0KA 4NKCA 1VP5A 4WEVX 4EXAA 1AZ1A 3UYIA 1YNPA 2J8TA 3NTYA 1GVEA 3H7UA 3UWEA 4FALA 5HNUA 3R7MA 2IS7A 1X96A 2AGTA 1EKOA 4XZNX 1PZ1A 1RY0A 1Z8AA 2F2KA 2PDWA 3UZXA 4QXIA 1ZSXA 1MZRA 4JTRA 4QX4A 4IGSA 4LBSA 2BP1A 2INZA 2HE5A
chains in the Genus database with same CATH superfamily
3T42A 3MW7A 1E55A 3FYYA 5M3WA 4OZOA 3SCOA 3OIXA 1KGUA 1DJXA 3W1PA 3SQSA 3W7LA 5DO8A 1PV8A 4AY1A 3KBMA 4YYFA 1GJUA 1G4EA 2RGLA 1LL7A 2NQJA 1PS9A 1XUUA 3TKFA 3FCPA 2JQXA 3PJWA 4DRSA 2ZUUA 3UR8A 1QI4A 2PDIA 2BVTA 4UFJA 1VIWA 3G1XA 4HA1A 3PB0A 4P8WA 1U30A 2E7FA 3PNUA 1US0A 3NZPA 4IGMA 4XBKA 1G69A 4JIQA 4IJRA 2IKJA 4JHZA 1Q65A 5DMNA 3HB9A 2WMHA 4IX2A 2E77A 4I7VA 4MGGA 4UQAA 2D3LA 2XSAA 4ADUA 4HOWA 4DJFC 4F9DA 1Q6RA 4QP0A 3A9BA 4HTBA 2PD5A 1IXOA 4NZ4A 1XISA 3F7JA 2POZA 2EPHA 8XIMA 1TVNA 3ARRA 3GH7A 4J3XA 4LV4A 4KS0A 3PG8A 1DYSA 1UKTA 3IGUA 1SW3A 1BTMA 1GW9A 4UC5A 4RE0A 1B54A 4OVXA 3VUSA 3VNZA 2VOTA 4HU0A 4DO6A 2IQTA 1FKXA 4P7NA 1P48A 1RJRA 1MEIA 3W83A 4HHPA 1KCXA 3KXQA 5I09A 1FWJC 5DY3A 1C9WA 3OGRA 1KTNA 5BNKA 5CBBA 4B5WA 3B0XA 3WFLA 4QJ3B 3L2MA 1G7UA 3VIMA 3QF0A 2PRHA 1DXEA 2VX7A 3K1DA 3CV6A 3H2CA 1CNVA 4QS5A 1OGGA 3WUEA 3RJXA 4GJ1A 2RDUA 1Q4NX 4XKYB 5AHLA 1RBOB 4G1NA 3NSNA 1E6QM 3EYPA 3OO2A 1H2JA 3W7EA 4IFRA 4WDXA 3COTA 3UXDA 5K9CA 1CPUA 5EFDA 1G67A 3RAOA 3BSMA 4GRSA 1ISXA 3GDTA 3MJMA 1UKQA 3IV8A 2YDRA 5MKGB 4B15A 3QR0A 3HV8A 3QEZA 3DFQA 1Q13A 4WGHA 3NYZA 3R8HA 3L4WA 3WLTA 1WDDA 1VAHA 5CSRA 3T4CA 2ATSA 4MSSA 2YW4A 4H04A 4FNQA 1LRQA 3QMTA 1SO4A 4IIHA 4UB9A 5CZTA 2QDDA 4HPHA 4PRTA 2V6AA 2QJNA 4EF9A 4KCVA 4O1BA 4V1YA 5A3HA 3L12A 5BWAA 1ME7A 1FWEC 3REQA 3IJDA 4JQ4A 3M43A 4FS9A 2A3HA 1NWRA 1GUVA 5C5YA 2FFIA 4NILA 3PTDA 1IT7A 2PGWA 3CV1A 3VNMA 4J3ZA 1KGWA 3KL0A 1UH4A 5KETA 1J01A 3ZT5A 1VFHA 1KM4A 2OVLA 2CC0A 3PZMA 4ICNA 1IXNA 4GGHA 3CNYA 1NH6A 3WLLA 1HJUA 2TODA 1W5QA 3LLXA 5XIMA 3L5AA 5LIXX 1DQXA 1XBYA 3HQOA 1VPYA 4AFYA 2CEQA 3C8NA 1M6JA 4AY8A 3KAOA 3JVAA 3OLGA 4PE8A 3FVMA 2DPEA 2V67A 3EWDA 1LF1A 1OFAA 3WENA 4BQ5A 3LGGA 2WMIB 3AWOA 2PTZA 3OHMB 1BKHA 2UY5A 3WH7A 2E5DA 5EBUA 1H41A 1TMLA 4MZ1A 3WELA 3PWAA 1YPIA 3H70A 5C0QA 3GHSA 3CPUA 4DJED 3S83A 3PFMA 1BVNP 4E2DA 2ISDA 1KTBA 3DBNA 3KBSA 1FWAC 4GH1A 2MUCA 3L0GA 4AU0A 1DJGA 3MI6A 1VFSA 3ANVA 1XL9A 4JFSA 5FOOA 4J3TA 4JTAA 1PJ9A 3GW3A 4ZOBA 3KRUA 4UTJA 5AHNA 3LCXA 3WZ0E 4OV4A 4Y9PA 3W7KA 3RO6A 2CKRA 2WQPA 3NQCA 1E1CA 3QC0A 3KHDA 2WJDA 4LUJA 4MIMA 1ECQA 1TR1A 4I7UA 3S5OA 1XCXA 4QAIA 3RR4A 3TW6A 3FLUA 3N13A 3HIJA 2O4QA 1TQJA 4XWUA 3PZQA 4Z1BA 2WXDM 3MSRA 2O92A 2C79A 3CUIA 1IYXA 1UZDA 4NXKA 4X2PA 4XTDA 3MANA 2BDQA 3VD5A 3CZJA 4RL3A 1HUVA 3DHUA 3KS5A 5J8LA 2XVNA 1CT5A 4ZE5A 1V8EA 4GUHA 4LQ1A 4M6QA 1V3KA 1IGSA 4FIRA 1XYCA 1EF2A 4IFKB 4B2DA 1DEDA 1RPXA 2A4AA 3W7PA 1REQA 4A8NA 2IPGA 1XIGA 4AYGA 3SCSA 4OKDA 1YDVA 3C0SA 3T0DA 3PUGA 2XTKA 3BAKA 1J6PA 2W3ZA 5KITA 3MMUA 1GKPA 2JEPA 3OP2A 4BF5A 1F6YA 2HPMA 1SJCA 2E1WA 3IEBA 1R7AA 5A5WA 1V6YA 5E70A 2PLJA 3GK0A 4K1WA 2B4GA 2GLKA 4OHQA 3CK5A 3QRHA 1NOUA 4CQ9A 2XVPA 3CZLA 1M04A 4YCOA 3N2OA 3R8RA 3I3EA 1L0PA 1ICPA 2ZRUA 1KCLA 1LBLA 1OCQA 3LU2A 1UROA 3HMJG 5HXMA 4J40A 3GAYA 3VILA 2ACSA 4A05A 4LAZA 4KESA 5A8MA 4QM1A 3EX6A 1UR0A 4O1DA 4E8GA 3WQOA 7TIMA 3WDRA 3O6DA 3KP1A 1EOMA 4JICA 3W7NA 1W0MA 3MUZ1 1MQRA 4KWWA 1UKSA 2DZVA 3SECA 4DUVA 1O7AA 2O9TA 3K46A 4A3HA 3E2VA 1GW1A 1R3TA 4DWSD 4ZO9A 2J7EA 2DSUA 3N3TA 1KQYA 2GWNA 3IIZA 4YHEA 4HTYA 1RSCA 1EJWC 3VE9A 3G2GA 5LHEA 3E49A 4DF2A 2OKOA 2XH7A 4NU7A 2WWCA 3O05A 1UWSA 3KRSA 1D7FA 1VBJA 1MW0A 4MNJA 1FWDC 3IIVA 4KIRA 1MRQA 1IIGA 2G3NA 3EDJA 3OVPA 4UQEA 4JAWA 1I1XA 1JGMA 1GPWA 3O8AA 4Z1CA 2O9RA 3LPGA 3UJRA 2P10A 2VEFA 4WZHA 3CAKA 3S0CA 3G1DA 3ME3A 4GIAA 4B3LA 5LIYX 4AVOA 2PC4A 4F0SA 4PMNA 3G0XA 2ATMA 4GLEA 1VCVA 3RJYA 3BMWA 2XN0A 2UY4A 2QNEA 2Y2WA 1SZEA 3VNDA 3LXBA 4UTIA 3RM4A 1OC6A 4S38A 4NJKA 4GY7A 3C4UA 1GG0A 3AS0A 2B7QA 3QGVA 3SFKA 3TTOA 4KWUA 4P2VA 2BFGA 2Y5EA 3AICA 1RVKA 2FDSA 2WHLA 3WF3A 3NZQA 1FCVA 1K3UA 1V3IA 1Y8BA 2QV4A 3CZEA 3VCCA 4GUJA 1ZP4A 4I90A 3NQAA 1VFOA 4GA8A 1A5NC 2CLOA 4L4OA 3RR1A 1VYPX 5CBJA 3VTRA 1RK5A 3WD3A 2Y89A 2QW5A 3H54A 1B3OA 2VYOA 5AVNA 2OZTA 1GVOA 3DFPA 3CUZA 1SZGA 5CLTA 1E0WA 3KE0A 5G4HC 4JEQA 4LVFA 4LB4A 3S5SA 4QJ1A 5E6ZA 2VWTA 4WY0F 5KZDA 4W7VA 1J6OA 3E0FA 1C3FA 2X1SA 1C8QA 3C52A 2HV5A 4E3VA 3VKCA 1Q63A 4GY0A 1JZ2A 1XKJA 1UPMB 4L1GA 4ZCWA 5C9ZA 3WKZA 3SCVA 5TF0A 5D9PA 1JI2A 3UJEA 2FFCA 4N7QA 3M0ZA 1MNSA 3TW7A 1UH3A 3UVAA 1PZ0A 2GJPA 1KWGA 1DL3A 1YADA 5AFDA 5LGXA 1LQ0A 3ONCA 1OX6A 3G5EA 4E4FA 2XIBA 2CZ5A 1N7KA 3TC6A 4UNIA 1BYCA 1B3YA 5I02A 1O5XA 3MTWA 3LSBA 3TAKA 2FKPA 3S2LA 3WJWA 3T9PA 1U2YA 3TX9A 1R30A 2QDGA 1B4KA 2JGQA 1JRBA 1LBFA 3WQWA 3EX4A 3VD7A 4E4PA 2XYLA 2EG8A 1FWGC 3H7RA 1R9ZA 3SSZA 1ZPTA 2X05A 1ZRQA 2P0OA 3JS3A 4ZFCA 3HMCA 4R3UA 1V6WA 3CUJA 5JH1A 4GFSA 1KM3A 3RILA 5HJLA 3UFYA 3ENLA 3BSGA 1GPFA 4DJDA 3OBAA 3DAQA 1SUXA 5B7YA 4V28A 2OSXA 1OD0A 4A6GA 2DQXA 4QE4A 3SQLA 4WIWA 1GZJA 1EPVA 3HO8A 5CEWA 1WZMA 4IQDA 3W1MA 2V8ZA 5M17A 1JPKA 1W9XA 4JBRA 4QS6A 3EX1A 4O0KA 1QHOA 3URQA 4OWGA 1NVMA 1O95A 2ZCGA 2XH0A 1IQ8A 3ZR4A 1QTWA 3VZXA 1PB0A 1ALDA 4JTDA 1W9UA 4FOJA 2YL6A 2YFOA 3SCUA 3GIQA 1R0MA 4M7TA 5CCZA 3NXLA 2F6XA 2X2YA 4C6KA 3CXOA 4Z2JA 4UQCA 4MB4A 3ZWSA 4B5VA 1OIMA 3A12A 3S6DA 2OG9A 4JYDA 2XN2A 4EOUA 5IFTA 1JDFA 3A5VA 1GVEA 5A8OA 3OW1A 1WP6A 3PZOA 1POJA 5I2UA 1ONEA 1EEXA 2FTWA 2WKLA 3EKLA 1YDYA 3KCLA 5A2AA 4D6DA 5BZAA 4LRTA 3ZVIA 3QN3A 2QKFA 3W7RA 1X1NA 2XFRA 3U0HA 4H9XA 3M64A 3NQ7A 4PTNA 2IPFA 4EXBA 1GKRA 2VO5A 3GKFA 3G24A 1TJ2A 1PO9A 6TIMA 4PMOA 1GOWA 1H11A 4LUTB 4PFHA 1YYAA 2WHJA 1X97A 3MT1A 5CPTA 4EACA 1QRQA 5CGQA 5E0CA 2CZDA 5L6UA 2WZIA 3UJFA 2ZVIA 3JRKA 3BO9A 3VABA 3AZTA 3UXIA 2W66A 1DIDA 3MCNA 4JL1A 1JPIA 1PKYA 1QK2A 1W56A 2HCVA 1TZ9A 1FDJA 3AHVA 3AU2A 3B0VC 1YXYA 2ODOA 3N4AA 3U8GA 1B1YA 3S5YA 1AVAA 2YFNA 1LRTA 1LYXA 1QI5A 1B57A 4Q4SA 5HUPA 2Z1WA 3AXHA 5FEPA 3PVFA 4JFUA 4LYRA 3HOJA 1Q6GA 2JGYA 1H51A 3BGJA 2CLHA 2EJ1A 1EC9A 2Z2AA 4DBUA 1OWQA 1UZHA 5FJTA 2X42A 1LCOA 5M2FX 2WZTA 2QJHA 2QCMA 4O1AA 1CW2A 1F73A 3N6JA 3LG3A 2GQ8A 1HT6A 1SW7A 2ZE3A 3R5EA 1P43A 4JZ5A 5F1VA 5HAOA 4CCCA 3PZ9A 3BLKA 2FB2A 3CIXA 3RCNA 3W4RA 1E15A 4NYUA 4PEEA 1W6TA 5CPNA 4C60A 1LT7A 1ITQA 5CPQA 4XG1A 3LI0A 4GACA 4O1FA 3G1RA 3OLEA 4DXVA 3TN6A 3W1LA 3ZO9A 3PJTA 1U5VA 1QUMA 1OFOA 2HNEA 3W1TA 1BSLA 3IGSA 2C1HA 2JIWA 5I07A 1ZL1A 3U4AA 4P7LA 1KW1A 1HG3A 3L5LA 4QISA 2VENA 3FN9A 3GO2A 3S2MA 2PU1A 2XM1A 1DIKA 4PMXA 4QTGA 1ZNNA 1PWMA 5IBXC 3HQNA 3BG9A 1SFJA 4G6CA 4JQ2A 5DMYA 5BMWA 2E5BA 3NAVA 2J74A 5I3JA 3E12A 1XC4A 3N18A 1JCXA 2Y85A 3PTMA 1QO2A 4QG9A 1ISYA 4PODA 5F4SA 2NW0A 3GX9A 1QU4A 1NSJA 2OB3A 3AUOA 2CZEA 2J27A 2QMKA 4C7GA 4OBSA 5T26A 5C2XA 1K7XA 2FHBA 3POCA 2NQZA 2G50A 3HN3A 3O0FA 4Q7BA 3QH2A 2IPJA 1LG1A 4M6UA 3WCZA 4Z2KA 3FDKA 1JZ3A 2ZX6A 3UU0A 2AMGA 4IMEA 3NZRA 4PULA 3OGVA 4A2RA 1DV7A 3W6LA 3HGOA 3DZ1A 2DZAA 3MKVA 3VOGA 3GB6A 2PLCA 4LC8A 3TROA 1ZGDA 5HBFA 5HNTA 3U3HA 4S2CA 3WK1A 3ZVHA 5HMDA 3QW3A 5BRQA 2R1LA 4ZXOA 1R9XA 4ZQRA 3Q94A 4DIAA 3T81A 1BVWA 2BZNA 2FMNA 1CLKA 4Y6GA 3KZPA 5K4ZA 1WBHA 3NL3A 3SIMA 1XH1A 3GR4A 4K3ZA 1DIEA 3IANA 2BX7A 5CC5A 3SN4A 1QNOA 3QLDA 3IUIA 7A3HA 5BXRA 3FA5A 3GBDA 4TVDA 2QCGA 4B5XA 3IRDA 2W6RA 3UG5A 4ZQOA 4Y8EA 5EBAA 2OLSA 3N2MA 4YTSA 2RH9A 2JF6A 1K6AA 5IHSA 4D2JA 3SJ3A 4BJHA 2PDXA 3TSDA 1Q6CA 3PUEA 2E40A 2G0WA 3WNPA 4C90A 3GTXA 3MU7A 4H7VA 4P8XA 2ADAA 1JZ5A 3Q65A 4JN6A 4DM1A 3G6LA 2FJKA 1Q66A 1EIXA 1PBGA 9CGTA 3PG9A 1RK6A 3VD9A 3MYPA 3N19B 2P8CA 4UNKA 4XBJA 2R9RA 4PL1A 1B90A 5H1WA 3W81A 1GZ1A 3MMWA 4OUIA 3TJXA 4HPJA 2TAAA 2WHMA 4KEUA 4RV3A 3MP5A 3T40A 2X0YA 2EBNA 2W67A 4B9ZA 3CWNA 3TNOA 4H6KA 4LYKA 5E9AA 1RHCA 2VZSA 1B31A 3G1HA 3EXRA 5I3FA 4OTKA 3UWYA 1M68A 3C0JA 1YBQA 1KV8A 4IOTA 4QROA 3EX2A 1UR2A 4BA0A 4N4QA 3JR2A 4JTGA 3F4DA 3SCNA 1B3VA 4WD0A 3L68A 2CBVA 1O66A 2QPXA 3R13A 4Q3MA 2TMDA 2AL2B 1TPH1 2NXHA 1R3QA 3AHYA 5LNVA 3Q58A 1W5OA 4WEVX 3ARQA 4L4LA 4YN5A 1HZYA 1RPKA 3ABSA 4UQDA 1UIOA 2OU4A 1H1NA 4QDPA 2ON3A 1GQLA 2E67A 3BCFA 5HNUA 2XH2A 1ONWA 1O5KA 1NP2A 2H8XA 4BWLC 4GUIA 1EKOA 3T4WA 1UA3A 1GEQA 1S46A 1CB2A 3B03A 3STGA 4KETA 1ZSXA 3M5YA 4NYYA 3LCLA 3TQ0A 4GBDA 2X09A 1EDTA 3AALA 1Q7QA 2C16A 1T8QA 2EXOA 4DUXA 1BWKA 1Q8JA 1IT8A 3DFHA 1ZBCA 1LTDA 2POTA 4MAVA 1Z89A 1B3XA 2YXGA 3CAQA 4UMCA 3LX9A 3F4CA 2AQOA 2O55A 3ZLFA 1NOWA 4NUWA 1BRLA 5C55A 6PTDA 2AL1A 2VELA 4YTRA 2J9ZA 4XQ6A 1FWBC 3FGCB 4S23A 4XD4A 4QCEA 3N4EA 3VDHA 1RCXB 1M65A 2GVLA 4ACZA 3R11A 3W01A 3FSUA 1VZWA 1T7LA 4Q8WA 2KZHA 2H9AB 4U33A 1HO4A 3QKZA 4OBTA 4V15A 4DYKA 1BGGA 5B7ZA 2VC6A 3V5FA 4HZMA 4MKNA 4HSNA 1KXQA 3FFSA 4C6NA 1E0TA 3EXTA 3IJLA 3KUMA 3MUY1 4Z1DA 1NWTA 1TV5A 1DTUA 4PTMA 4J3UA 3AS1A 4QNEA 4LCQA 1L6GA 4CQAA 1TE6A 2YGYA 4BHYA 5DANA 3U7VA 1M01A 2DUAA 4N6FA 4EAMA 8TIMA 5FCZA 2V2DA 3HBLA 1UYQA 1TV8A 2ALDA 4LTSA 3GIYA 3NO5A 4ZQMA 4BI6A 1H49A 3UWWA 3L0NA 3NQDA 1V02E 1W2PA 4QQUA 4B4FA 2WSPA 2J24A 3B8UA 3G3MA 4WKAA 1R86A 1V79A 4GQ0A 3G8EA 2YW3A 3ALGA 4JY9A 4GNKB 3QY7A 4IIDA 1X8CA 4AF0A 1X6NA 3L67A 3I4KA 2AKMA 4DO4A 1P7TA 3O6CA 4XD3A 5LNRA 4DHGA 3CL6A 2RHGA 2VCCA 2W79A 4D72A 1CXFA 4D8ZA 2J7FA 5AYZA 2OGYA 2RFGA 3KDNA 4EE9A 1K8XA 1JULA 5FKYA 5GPRA 4JTQA 1J0ZA 4BS0A 2VZTA 4XTIA 2BY0A 1V3HA 2XSBA 3W37A 3AXIA 3EOSA 4AIOA 3B97A 4K8EA 3BMVA 3DC8A 1AH3A 4AUBA 1H09A 3KWXA 2QQ6A 1H63A 1WKYA 4RZ5A 4O50A 1RZMA 2ISFA 3MI3A 1E70M 1R2SA 3TUUA 3LS9A 4MOZA 4IJBA 3U7BA 3G0UA 1GOXA 2WSYA 4AQLA 5FF0A 1DXIA 2WJFA 3VDAA 3TR2A 4KPLA 4H19A 2BLEA 2F8QA 2D2GA 3T6CA 3OLDA 1AQ0A 1V02A 3MDWA 3B8WA 2FZ9A 4HD5A 4NJGA 3WQ6A 3YPIA 1NDWA 3KBNA 1HN1A 2EHHA 3DDMA 3IK2A 1G0CA 1PHQA 4IJCA 1NTHA 3W76A 4ATLA 5B80A 2BY2A 4FX8A 1SYTA 1XRSA 3TTQA 1U83A 3IPWA 2QCFA 2VFIA 3K30A 3WLKX 4DYJA 2OZ3A 1EJ7L 4N4PA 3ARXA 3BE7A 4AHOA 2HDJA 3BAXA 3T0AA 3W3OA 1LOLA 3SRKA 3A21A 1SPQA 4GUGA 5I23A 2E25A 1K02A 4DJFA 2VFDA 5GQBA 1DIOA 2E6DA 4KEVA 2Y7DA 4GVGA 3C2YA 4K7YA 5G1TA 3W7IA 3KTCA 1A5OC 1I1WA 4LF2A 3Q2DA 3AISA 4ORIA 4PSRA 4J27A 2OT1A 3TC3A 4QE5A 4AMAA 1QNRA 4W9TA 5AHIA 3NDZA 1JL8A 1H1ZA 4JX5A 3P5ZA 3NIYA 3QZEA 3UY8A 5HQMA 2GUYA 5HATA 5BXPA 2DORA 2XZ9A 1KR0A 3MV01 5IBXA 1AD1A 1TWSA 3AAMA 4X0NA 1HIZA 3LUTA 5FIPA 5LSMA 1L6SA 4Q4PA 5I78A 2PDPA 1JCJA 2PP3A 1OFPA 4H8VA 4FR1A 3VIHA 3MSGA 2FMOA 1RH9A 4OT7A 1MUCA 4BR1A 4EKJA 2FLIA 2VM8A 3QGKC 3LLDA 3RLGA 2VC5A 2J62A 3DG3A 4ZSUA 4Z2GA 3BAIA 3UG8A 5FSEC 4MADA 5SWUA 1E4IA 1EJUC 5AC8A 1AG1O 1QOQA 3K4DA 4JGDA 1LL6A 3MP3A 3KVMA 4Q4OA 1TA3A 4AH7A 1FA2A 2GVYA 4HYVA 1V7YA 4WK9A 2OQLA 4C5YA 8CGTA 1QFEA 4O8RA 8RUCA 4M6PA 3E6EA 3KEHA 3R8GA 2F7FA 4L4MA 3TTYA 2QDHA 3DN5A 2BXZA 3FXGA 4IWWA 3MC5A 5LXEA 3T0CA 1WO2A 4UTHA 1VBHA 1EO7A 3VMPA 5DCBA 2FZBA 3P74A 3N3MA 1HF6A 3P0XA 1F8IA 4C1NB 2BNJA 5AC4A 3CZGA 1Q7ZA 3RYSA 5TNVA 3SIZA 4EXAA 3HQ1A 3GTNA 3I6RA 2ZRWA 3UYIA 4IQJA 3OB8A 3WLMA 5AVHA 1FXQA 2G8ZA 2OSWA 3W88A 4F2TA 1QPOA 5FD0A 2E5CA 4D6HA 4FMVA 4FALA 3EPNA 2GYIA 2OX1A 3M6DA 4GIYA 4CQDA 1RQBA 1E6SM 1H5YA 3R7MA 5H2ZA 1AL7A 2TSYA 3MZ2A 2XHYA 2OR2A 1MW3A 1PTDA 1UC4A 1HTIA 2G37A 4GI6A 4JFTA 1M53A 3UZXA 2C8NA 4OV9A 2ZOXA 5A6LA 4JKLA 3RRXA 2J8FA 1JGIA 2Q02A 1QVBA 1HP5A 6A3HA 1CGVA 2PB1A 2QJMA 3GAKA 5JUVA 4W88A 1WDRA 1IEQA 1ITUA 2IXUA 1GHSA 4PR4A 1MRAA 4YLWA 4PTDA 1O4UA 4H9MA 2PODA 1PUDA 4IPLA 1QI3A 3OODA 4ZMGA 3H23A 1QNVA 4H6EA 3LV5A 3ZJ7A 1US3A 3W2UA 1XH2A 5D09A 4F79A 2J47A 2QULA 4MUZA 4FXJA 5C54A 3GLCA 1ZBVA 1EJTC 2G3MA 1MYRA 1HKKA 3CMJA 5FA5A 2O56A 1XIHA 2CWNA 4IT1A 7CGTA 1Q5MA 3TQPA 3E9AA 4J9JA 1ZUAX 2WWDA 4X2RA 2PTYA 4KCWA 3WF0A 4ML9A 2VGIA 4WSJA 1ZLPA 2PLMA 4KGLA 5I3IA 4OUEA 1KLZA 2ZE0A 3XISA 4RNJA 3S6OA 1K8CA 5A94A 3I68A 5CZSA 5T8GA 2XIJA 1M3UA 4JYFA 4CNTA 5FAJA 4IUOA 4CEUC 2Q8XA 2VGFA 3EOLA 3AYSA 1XXXA 4HPGA 1YX1A 3WLIA 4MM1A 2C14A 1UUQA 3VGGA 4LGXA 1I60A 3HGJA 1J0KA 1SMAA 4XZ9A 2VL4A 1WDWA 1P1MA 3QV8A 2WAGA 4NL1A 4TQTA 1CXLA 3NL6A 2Z7KA 1WDPA 4E6MA 1TWIA 3GNPA 1U1HA 4IPPA 5D38A 1DE6A 4F0MA 4G9PA 5F2GA 3BV7A 5HANA 4PRRA 1QW8A 3NQEA 3LGEA 4D8AA 3CT7A 3G6MA 4IIFA 1SZNA 1I2RA 4AWSA 2V81A 1NDYA 4LAKA 1K9FA 4PH6A 2Z00A 2ZDSA 3VMOA 4K6AA 3S46A 4WJEA 3C0LA 1NP0A 1CCWB 4XAGA 1WZLA 4V33A 3L4YA 4UUIA 4LT9A 4ZEPA 2NXGA 2ZUTA 1XSJA 3BICA 5CC7A 3L21A 3QPZA 3GFXA 4YVVA 2ZRVA 1KBIA 3EZ4A 3L0KA 1BYAA 1A4LA 1CXEA 4DX3A 2PSNA 4RDVA 1QI0A 3IVUA 4JY8A 1XQLA 3QSRA 1K8YA 4MWAD 1Q6QA 3A24A 3T55A 4YHGA 2C1GA 2Y70A 3LRLA 1XW8A 4UNLA 5E5CA 1H7PA 1QPNA 2PTXA 1Z42A 4GYPC 3WNOA 3H4XA 1THFD 3GNDA 4JL2A 3NFUA 2OLHA 2JALA 1JFXA 3N29A 3W84A 3S1UA 4QITA 2DW7A 1B2YA 4JD4A 2GVJA 1S2UA 2VJXA 3M6YA 3HGSA 3PY2A 3DFSA 3GR7A 4GHRA 4IH3A 1UKOA 3OZPA 4AD2A 3E0VA 3SQMA 1DJQA 1H7WA 4C6EA 1X38A 1POKA 3GTIA 4YU1A 4NX5A 1LDCA 1W8SA 3FX4A 3R94A 2DIEA 3PBGA 1K1DA 2O7SA 3W74A 1G5AA 2V9DA 1ZTVA 4KFPA 1C8YA 4HNOA 4RE4A 2QGYA 1LRNA 4W5ZA 5HR7A 3JZEA 1QW9A 1T0OA 3V5OA 4KQNA 4REQB 3B9DA 4ATDA 1L6FA 1RJQA 2GSEA 4CEXC 4CQ8A 5EMKA 1E1EA 2X30A 1CZ1A 3M0IA 3KCOA 1LJYA 1OGBA 3DC0A 4ZSTA 2BY3A 5AZ1A 3L4TA 4ES4A 2W63A 4YXGA 2PWVA 3IACA 4KEZA 4ZBCA 3SUUA 1A0EA 1KO0A 2HEJA 3R12A 3AQUA 4A4AA 4LAMA 2Q6ZA 1WUFA 1QR7A 1SJDA 3AWNA 2QEZA 4C6CA 2J75A 3K1GA 4FXSA 3VFLA 3M5VA 5D37A 3O6YX 1NFPA 4R7WA 3KCJA 3V18A 4GIEA 2GQ3A 3CAVA 2ZFAA 1WAUA 2ABAA 3TYUA 4GJIA 3ONBA 3GY1A 3LHZA 5DY2A 3H55A 3W85A 3D47A 1XGDA 3S1XA 4DF1A 3VNJA 2RDWA 1PZ2A 3FKRA 2PD9A 1PPIA 2PDQA 3DG7A 3W2KA 3AIRA 4TV5A 2I9EA 2PA6A 4PUJA 3S4TA 1LM1A 1E73M 1P0KA 4LXFA 5FEWA 1UD2A 3BVJA 1VLIA 3RU6A 4UQBA 2D1ZA 1IEIA 3QQ1A 1WXJA 1OFRA 2YX0A 4JPGA 3P62A 4JNYA 4J5NA 7XIMA 2XPKA 1D8CA 4UTTA 1AZ1A 3LB0A 1XLCA 1K9DA 3F1QA 1H7RA 4QSFA 4EANA 3VDGA 2Q01A 2AAAA 4DO5A 4BI7A 4HK6A 5T9BG 3URBA 3GG1A 4D6IA 3GXIA 3MPGA 1CX9A 2V30A 4AC1X 4UZSA 4W86A 1MZRA 4CQCA 2Z6JA 2HK1A 4QX4A 1ZHAA 2V5BA 3B05A 1W2VA 2IQDA 3FEQA 5CG7A 1MI3A 4PL2A 3ZSSA 1XCWA 4YYCA 1FTXA 2IKIA 1EJSC 1W9BM 1RP9A 3S8HA 1XLIA 2WQDA 4K2SA 4AWTA 1OFEA 1JEZA 1XG4A 3IJ6A 2Z29A 3W7QA 4AEEA 4AZ5A 1PDZA 4J3VA 3PBWA 1PZ3A 4M5PA 4RR4A 7PTDA 3SZ8A 4I6KA 3TWAA 3TJ4A 5LXXA 4AZCA 1BEUA 3M41A 3AOFA 1IZJA 3V0TA 1EBHA 2A3CA 2ZRZA 1XIJA 3P81A 2R1PA 4UCFA 5AOUA 3GG8A 2XJ7A 2ZWZA 1AZ2A 4WJ8A 3G0SA 4PMZA 4AB4A 1TSIA 3MUCA 3F03K 1RY8A 1EQPA 4GJJA 4GH3A 9XIAA 2HSAA 3WN6A 2CXEA 2QIWA 3DHDA 4JTLA 4U5KA 4J1OA 1TPDA 3AIVA 5I0DA 4HQVA 1V51A 1VEPA 3DX5A 4PUWA 4S3EA 1XLDA 1ENUA 2ZZ2A 4LH8A 1OJXA 4FXFA 2Y5JA 1XIFA 2CNCA 1W37A 2ACRA 1SSDA 1CYGA 3OG2A 4MWAC 4HU8A 2JEQA 5J5DA 2DDXA 1C91A 3DXIA 4NJHA 2DJLA 4DXKA 4GK8A 4IL0A 3WQPA 4QIUA 4LCRA 2DZUA 1OYBA 4W4QA 3EOOA 3NEVA 5EB8A 4DQWA 1QHZA 1SFSA 2DZSA 1HQTA 1P0EA 2DV0A 1ADOA 2WC3A 3IS4A 2VI0A 2WC4A 5ABFB 7ODCA 1LP6A 3S5NA 3W07A 1L8PA 4GCXA 3WH5A 3B04A 4P5UA 4LUSB 3R4IA 5A6AA 1O5QA 1T41A 1MEHA 4XZWA 3V75A 4PBFA 2QCCA 1QNQA 3I7RA 3PZVA 2B7PA 3FA3A 4UBPC 3PAOA 3GNRA 3LQGA 4AY7A 1KM2A 3GH4A 4ROQA 3NPVA 1ZAIA 2WNZA 1OY0A 5CLWA 2OYLA 4JKKA 2OO6A 3CPRA 3LQLA 5I3GA 1P6WA 4DZ5A 5FJIA 3WUFA 3CUGA 1TCDA 1QT1A 2Y88A 3NL2A 2YL8A 3GIPA 2ESCA 3J7HA 5DMMA 1TRDA 4RJEA 4CQBA 3MBDA 3AMLA 4FK9A 2EO7A 1LOQA 5G2WA 4ZOAA 3VI2A 4OU1A 1PVNA 3CUFA 3EKGA 5HA7A 3WBEA 1XLBA 1MNZA 3N9KA 3ZMRA 4JCMA 3U2EA 2QJGA 2VP8A 3KLLA 4NZ3A 4ADSA 3AI0A 2Q8LA 1PDYA 2VDIA 1E1FA 3GR8A 2DT0A 3NVDA 2CERA 1MW2A 5H91A 4RNIA 1KM1A 3W7OA 4AZ6A 4BF9A 4XZHA 4BEUA 3OZOA 1KXHA 4MJMA 2GUBA 3WDPP 5CJMA 3KTSA 1VENA 4AD4A 4AHPA 3BZGA 1OIFA 3G18A 4JFVA 4ZQCA 1SVDA 1VHNA 5HWMA 2NUXA 3LD5A 3M0VA 2ZC1A 1PIGA 3UT0A 3CQHA 1PXGA 4LV9A 5E93A 4GYFA 3O6AA 4AC7C 2ZWYA 1S2AA 5TIMA 3RF9A 3GDBA 4AZGA 3TVAA 3A4JA 3WQEA 3FKKA 5C7HA 4R7OA 1VBRA 1XH0A 3CPGA 4FHAA 2WJZA 4POCA 4Y90A 3AIWA 5CPSA 4N0RA 5GJNA 3BLPX 3VOHA 4AW7A 4PA8A 3POHA 1AMYA 3H6OA 1UR4A 3EOUA 3SSJA 1Q2SA 1DJNA 1L8NA 3HFTA 4RZBA 1AL8A 1XBZA 4CGTA 3TW9A 3W71A 5CBIA 3FYOA 1PKNA 1OF6A 4LOCA 3DGRA 1TWDA 2BS9A 1KD0A 3WBYA 1Z3NA 4DVOA 3MYOA 2GL5A 4A3UA 3PM6A 2E6YA 2VC9A 4GVFA 3F5LA 2ZICA 4A29A 3A9IA 1IXPA 3A23A 3APYA 3P60A 1JI1A 3MKCA 5CSSA 1DOSA 5EMMA 2PAJA 1QI2A 1N82A 4D71A 3ID7A 4IMDA 2IXVA 2Q3RA 2Z25A 3WJXA 2NX9A 2D23A 1WYIA 3CO8A 5D2WA 4KRTA 1KCZA 1CLVA 1FFQA 3GE7A 2ZUMA 4J2PA 2NT1A 2J8TA 2OX4A 3NTYA 3N25A 4JX4A 4TTGA 3NCOA 4NG3A 2FHFA 4GQBA 2WCGA 3U2OA 2V5JA 5H8UA 1BFNA 2J7CA 3AJXA 2H9AA 1KBJA 4DZAA 1W54A 4QEHA 3HFYA 4C6LA 2WMGA 4MNLA 2JKEA 3QPEA 1MQPA 1UP0A 3R1ZA 4HMCA 1XWYA 2HE5A 4KWOA 4UFMA 3BCJA 2DGAA 3UG4A 1WOAA 2PPGA 3WEMA 2IPWA 2VC7A 4XV0A 4ZR8A 5HQEA 3THCA 1XLHA 2Z0IA 3CEUA 1S2CA 1V77A 3V35A 1GNXA 4CU8A 3SUTA 4REQA 1PSCA 5D2VA 1X8FA 3UBPC 3RNDA 3VIJA 2QT3A 4AWUA 2YXOA 3QQWA 3EPOA 3R0UA 1SJBA 3L4ZA 1T8XA 4I6VA 2G96A 2FB3A 3BARA 2FTYA 3FHAA 1DP0A 3RUBL 1XSKA 4Z17A 1BGAA 1LLZA 4WSKA 4CD5A 4W89A 1EJXC 2XIQA 5D8WA 4N9EA 3W27A 3A22A 1M7XA 1VQTA 5A6JA 3EDDA 3TE9A 3QVQA 1O5RA 1B30A 2BHUA 1MZHA 2HS6A 4FLOA 3C6CA 3WDQA 4DZIA 5DF0A 4GNVA 3G1YA 4YCPA 2C91A 2I1OA 1JF6A 4BK9A 1F8MA 3V36A 1F05A 2WSRA 3UPWA 4FB7A 1W91A 4PTWA 1F4AA 4AXNA 1P5BA 4ASTA 2YPIA 2FVMA 1CECA 4HNVA 2IKHA 2CLKA 1NF0A 6TAAA 1GVYA 1H0GA 3LN3A 1F3XA 3WD2A 1UIPA 3ITYA 3CUXA 1EGVA 3W7CA 3EA1A 1VD6A 4JIPA 4KCTA 1FP8A 2VWSA 4PTVA 1U5HA 4CNOA 1EEPA 3QV9A 3NXFA 3KL5A 4LU0A 2WLZA 1A5BA 4JXCA 1TA3B 4FO4A 2QHAA 5HDRA 3UY7A 1RCOB 3WDJA 2VD8A 3DBPA 1XBXA 5IRPA 4M81A 3SGUA 2HS8A 3TV8A 2FZNA 2V3DA 3IUDA 5CPOA 3RCMA 1VFFA 2X1RA 4AD1A 3E0IA 4DAIA 2OT0A 3F2CA 4IG2A 5GJPA 1VEMA 2F6UA 3L65A 5LZLA 4ZOEA 3KOYA 3CL8A 3M0MA 4GO8A 2CBJA 4W5UA 2E68A 4DLMA 2NV1A 3UXKA 3FXYA 3W86A 3BLIA 4DNHA 1FH8A 4XX6A 1M03A 1I2QA 4ORMA 2XINA 3K2GA 1W17A 2X8RA 2WVSA 3P7YA 1HJWA 4GBUA 4U2ZA 4DXXA 4EPDC 4HOZA 1IT0A 2NQ5A 5L9FA 1H7XA 1XLFA 1SZFA 2IQ0A 3EB3A 3R10A 4JKMA 1A5UA 4TX8A 1NFGA 1EA0A 2PF0A 1TVPA 3NQFA 1WKDA 1UR8A 1OK6A 2CYGA 3DECA 2QS8A 5T9CE 4PBGA 2GZXA 4B3ZA 2VGBA 1EOKA 2OTDA 3NWRA 1IZKA 4ACZB 1EZ2A 3OHIA 1H4PA 1VFMA 1R3VA 2D73A 1YRRA 3AC0A 5JBDA 1ODUA 4UTKA 4QG8A 1FHDA 5C9RA 3S9IA 1UOKA 1UWTA 2DVTA 4I9MA 3OLIA 4AZCB 1J4EA 2NV9A 2OEKA 4TTUA 4Q8QA 4S3KA 3WQ8A 4CN6A 3ARYA 1OINA 2G4JA 3KS6A 4GVHA 1BXNA 2ALRA 3QXBA 3H4WA 3B9AA 1JDEA 4RLIA 4O0QA 1E9YB 3WMSA 4WX2A 3W7JA 3NOYA 5TBOA 1GOQA 1TWWA 1ADSA 2GDUA 3QZ6A 3UWUA 3ZZ1A 3N2XA 6REQB 3L9CA 5HWNA 2YLAA 1C8VA 3EDKA 3VNYA 1UZ1A 1LOSA 1TIWA 3THUA 3ZSTA 1WQ5A 3OYXA 2DSKA 1EWEA 2E8YA 3EB4A 3USBA 1E0VA 4CD4A 3E74A 2OWWA 4S3AA 4AF0B 1J5TA 4INFA 4ZTYA 4JCLA 5DT7A 1R6WA 2YB1A 4HSHA 4N9DA 5LIWX 3L2IA 1O12A 3A4XA 4XK2A 2D24A 1LWHA 4KWVA 4MNKA 3W29A 3ZJ8A 4C1LA 1DWAM 3KWSA 4RUBA 3O15A 2Z1VA 3VKJA 3RITA 4M24A 4BI5A 1EL3A 3T8QA 2VZVA 1EF3A 3E2QA 1VYSX 2QCNA 3C2FA 3VM5A 1FCBA 1KC7A 2VHLA 2Z1XA 3LSCA 3LTYA 3VU2A 5HULA 1WDQA 5HPOA 1OB0A 5H8PA 3O0KA 2DVUA 5A6BD 3M0HA 1ELSA 4S39A 3K5XA 4Q4MA 3LM3A 1R3RA 1DHPA 4UZUA 3RLVA 1UG6A 3FSTA 1VLWA 3W6MA 5D03A 3THQA 2PU0A 1GQIA 2J7BA 3CJPA 4MDOA 5TQLA 4L7ZA 2OEMA 3BGGA 1YDNA 2F2KA 4FNTA 3DIPA 3HA1A 4IMGA 1LUCA 4TVUA 3IWPA 1HL2A 4LFYA 4HJWA 4Q32A 2Z1SA 4IGSA 3UJ2A 4B92A 3WQCA 2QF7A 4IMFA 4RX0A 5J04A 4XAZA 4LYQA 3B8DA 3FJLA 4R27A 2V3EA 3A3XA 4IF2A 3GYEA 3BG5A 4H41A 3TYEA 5EMJA 4WQ6A 4UTMA 1LLWA 3W24A 1C93A 3WLPA 3B0YA 3DFTA 5DXXA 3IIXA 3B06A 5A8QA 4KT2A 1SU5A 3QMRA 1UCWA 1MDLA 4DJFD 4KGJA 1BRLB 3TYBA 3CQ0A 4AIBA 5GVJA 2ZZ1A 3IJ9A 1TREA 2P53A 3E0WA 3CUHA 1G4PA 1GYMA 1F6PA 4E0CA 2WMJA 4DI9A 3W2NA 1YIXA 4HK7A 2GVGA 3WO8A 4GVIA 2NQLA 3WH9A 1TJRA 4XISA 4R85A 2A1YA 1L6WA 3BXWA 4DAFA 4FA3A 4EAYA 2XISA 1M41A 4U5IA 3TONA 3V5CA 1A47A 1J5SA 3CH0A 2TRSA 1KV5A 1LBMA 1N2VA 5TAOA 2VR4A 1OQFA 2WOQA 4AWEA 2ACUA 4FXRA 3C3UA 3CYJA 1XQKA 2FPTA 2Y7GA 2R82A 3RPMA 3VGDA 4FNUA 3BAWA 1BXBA 3WLNA 4O10A 4BWLA 4WXZA 1ITXA 3W1QA 4WGXA 3KVKA 4RDWA 2PWFA 2R1NA 2HVMA 4YIWA 3DFYA 3MI2A 3ZVHB 1Z69A 3NQ8A 3PZTA 1FBAA 1SQ7A 1J0JA 1I8JA 3LDVA 1RVGA 1T40A 3TWBA 2VEMA 5FL1A 1O1HA 2X0HA 3ARVA 3SFWA 1ZY9A 3O7UA 4IPJA 1ZCOA 3EWZA 1GOKA 3BJTA 2J79A 2WNQA 3B3DA 2REQA 2ZVRA 4K39A 3LOTA 3W02A 2Y24A 5BRBA 3WQVA 1CB7B 3DFNA 2CLLA 4C7FA 2BGSA 1TWZA 2P3ZA 3GU1A 1DTNA 2QIIA 2V2CA 4JIRA 3I3DA 3KOWA 3W2LA 5A69A 4C1NA 1XIDA 1P6CA 2DIJA 4M7SA 1RUSA 3BOLA 1OFQA 3QYSA 3QR3A 4L80A 4ZO7A 2P3EA 3TZNA 1GK8A 4FPSA 4NHVA 1W3KA 4GY1A 1QWGA 3ZS4A 1D3HA 1FCQA 3CTLA 3VE7A 3L23A 3AUJA 4EX4A 1R3WA 3WK0A 3UR2A 3VNKA 4Q4KA 4NSBA 2VEPA 1S5MA 5HPCA 4LNYA 1KBLA 4NAFA 3D3FA 1CGYA 1CWYA 3W1XA 4O17A 3CBWA 2EJAA 5XINA 4MNMA 2X1UA 4L9YA 4LYPA 3GC2A 1AW2A 3A5FA 5K9DA 3W2JA 5A2BA 2DVXA 1BF2A 1I2NA 3MO7A 2PDKA 3VOFA 1FWRA 2E3ZA 3I65A 2QUMA 2HISA 3GXNA 2FZMA 3SO7A 3VFCA 3N2CA 2VMFA 5EU9A 1G4SA 3N1AA 4PBEA 2ZTKA 1HJSA 4R88A 5DX7A 3QGAC 1HP4A 1UJQA 1F5ZA 1RLCL 4NT0A 1PKMA 1P0BA 4AISA 4LANA 3EGJA 5D4YA 4JR5A 1MMFA 4XVDA 4LEFA 2PDMA 1QBBA 3GUWA 3JZUA 3LHYA 2R94A 1XFCA 3EMZA 4HB7A 4JEJA 5FF2A 4QAWA 3R6IA 3FAXA 1W8GA 4CNSA 2QDEA 5KSWA 1JZ7A 4HP5A 1KFJA 4L9XA 3H4GA 3P5YA 2OGJA 1V0NA 2A5HA 1ODZA 4WOZA 4DBWA 4G7EA 5BXTA 4I8DA 1BWVA 3AYVA 4F48A 2YDSA 4H8NA 1E71M 1VEOA 2VFHA 4L56A 2W0UA 1Q6LA 3I6EA 4GI8A 4A8LA 1KFLA 3K4AA 1IV8A 5JU6A 2DZXA 1ZAHA 1KM0A 3P2VA 3VIIA 2FPYA 1E72M 3APTA 1X7FA 2ANUA 1M1BA 2AL2A 1Z9AA 3OQEA 3WFZA 1BVZA 1A5SA 3RIKA 4GKLA 1CXKA 2BG5A 3D0CA 5LIKX 4XZLX 7REQA 1EC8A 5CGMA 1XI3A 1M7JA 1YPXA 2ZX5A 3O06A 3ISIX 3M1ZA 3SCQA 2OELA 1AJ0A 1XS2A 3DI0A 3AS2A 5DRCA 3MSYA 2C71A 4K7VA 3GNOA 5HK4A 3ANUA 3OOQA 1W9PA 3TLLA 1MXSA 1R3SA 4W84A 4KKXA 3T0BA 1ICSA 1K6WA 5D2XA 1Q6DA 1YNPA 2BOGX 5C2CA 2YBTA 3CHDA 3WLJA 4UQ9A 2DJXA 3GZAA 4C6JA 1PX3A 5DBTA 3TYAA 2WM0A 4TMCA 2GK1B 1Z8AA 4CNUA 1UPPA 1HX0A 1Y7VA 2A21A 3WIJA 1ISWA 1UWAA 4DWSA 1YTEA 4H7ZA 3LK6A 1PTAA 3ITGA 4K1GA 3NM1A 1W1VA 1W5PA 1OX4B 4J35A 3SW6A 2PDHA 3UCCA 3WEZA 2O4MA 1J18A 1YLVA 4K8GA 1ISZA 2QUVA 2CITA 4Q8VA 2PFHA 5IXEA 5M1TA 1UD3A 1WCGA 3LNPA 4FX7A 2DZBA 2HROA 5BU9A 1UWIA 3EEGA 2ZC8A 1RBAA 5CPMA 4GE8A 5FJOA 1JCNA 1Q45A 2VX6A 4B90A 1UQZA 3UWQA 2WKGA 4KH2A 3BQ5A 4TOQA 1XGZA 4ZO6A 1E0XA 1R46A 5F2LA 1BG9A 4H8HA 4HCHA 3NM3A 3NO3A 3TMLA 1ZZMA 3FJ6A 4LB3A 3EMCA 4GABA 5U7SA 2PRMA 1R2RA 4O15A 1X7IA 3ELFA 5F4WA 3E3HA 2OO0A 3R43A 2YDAA 1J2BA 1MDRA 4D6GA 5DBUA 4F40A 3OVRA 3GXMA 2VZOA 5AN7A 3AU6A 2DT2A 3W23A 3KOZA 3G77A 2B31A 5JH2A 3MDUA 2WNNA 4WY0B 4NZ1A 1IR1A 5ABEA 4FI4A 4U3CA 4ACYA 1E6NA 4D9PA 1VFUA 2BV9A 4XUGA 3GUGA 5CPLA 4HMEA 2J6XA 3SGZA 1DJIA 4K8HA 1RQEA 1FUYA 2WPBA 1H7NA 2GSHA 2JIEA 3BL3A 4Q7NA 5FJRA 4JTJA 4IGHA 3KBVA 1AMKA 4WY0A 1OADA 2HNHA 3GVWA 4HOXA 4KFOA 2HVOA 5U4NA 3IJQA 2ZZ5A 3NZGA 1F74A 4B16A 4RE2A 1WZAA 1KFBA 4DBDA 1OG6A 4AD3A 2Y63A 3NEHA 4RDYA 3HTWA 4O28A 4A3QA 1BQCA 2WPGA 5AZ0A 3JUGA 2I16A 3STFA 1HO1A 2XN1A 2Z24A 3IJIA 3HPZA 4MPKA 2XVGA 3W6YA 4WSHA 3TYZA 5ENLA 1M7OA 3N04A 1NDZA 1X39A 3BQ6A 3E1F1 3U2ZA 4GD0A 3TTEA 2E9MA 3BW3A 4MKSA 1J0YA 3OBKA 4MDPA 4R53A 1TELA 3UXAA 3WJSA 1ZS2A 3I6TA 5DMLA 5F2IA 1JZ4A 3FIGA 3M44A 4PYSA 1GOIA 1KBBA 4GUFA 3A6OA 1D9EA 2YR1A 4HHMA 4IMAA 4M80A 3QFWA 1EB3A 3GDRA 2VRQA 3NDYA 1GEHA 5DFAA 4AZBA 2X1IA 4R34A 4HYRA 4DWDA 1QAPA 4LEQA 2G5WA 3P82A 4P7RA 1V5XA 1NQKA 2DQWA 2X1TA 4JTKA 1S5NA 2OYKA 3NSMA 4B5NA 1IHIA 2V3GA 4JIIX 3O07A 1R8LA 3VGBA 4F4RA 4Q8MA 2FIQA 1G6CA 2I5IA 2D0HA 2H3DA 2E9BA 2UV8G 2HXUA 4WLCA 4Y7EA 2XGZA 3ICJA 4NAEB 1S3TC 4H00A 1JG9A 5FF4A 3GNNA 1A5AA 2A6NA 3O16A 3QYQA 3CGTA 5JVLA 4J7RA 3ITOA 2E6AA 4WF7A 3G8RA 3BLEA 1HGWA 3AMGA 4H83A 5DEZA 1SO6A 1G1YA 2W62A 1UC5A 1XF0A 3UZWA 4JQ1A 2IUZA 5A95A 4A2SA 2FHCA 2VD9A 2EAWA 1C90A 2PWDA 3VZZA 1JUEA 4LVDA 3Q37A 3RLHA 2V5KA 3MUAA 1XGEA 1XIIA 1XKYA 2V5LA 4IP5A 1VRDA 2A6LA 4YS1A 4HNTA 1X98A 1CTNA 3GC4A 4S1FA 1BPLB 3ABRA 3SB0A 4QE1A 1EX1A 3AXKA 5I3DA 1IF2A 3M9YA 4PN2A 4CCDA 1A50A 1CGUA 3W9ZA 3STPA 1JF5A 1GGOA 2W5FA 3BDKA 2P76A 4FF7A 4S3CA 3CQKA 1BTCA 5CJ5A 1XD0A 4Q8PA 1WAWA 1E43A 1C29A 4MY1A 3RFAA 4BQ3A 1YDOA 3PBMA 1VCGA 3ITTA 1EJVC 3BURA 3IJ7A 4Y8FA 4D6FA 4BCEA 1KXVA 4XB3A 3AMCA 1DJHA 1FWHC 1H60A 3LBOA 1MQQA 4GXWA 1QJWA 4GX8A 2B7OA 2XWDA 1JQVA 5EMUA 3ARUA 1BYDA 2WB5A 2ZTJA 4AD0A 1OT2A 4HGXA 3VCNA 2I17A 5ABHA 2NWSA 1OF8A 1TG7A 4F0HA 2H8ZA 2A2IA 3I4EA 4ZTXA 3EX3A 1QPQA 3N12A 1JYXA 1YBQB 3S2CA 3EWYA 1JPMA 2IS7A 3C8FA 3OG3A 2W9MA 1NQ6A 1KFKA 4PUDA 1AJ2A 1VRXA 2YKKA 2NQ9A 2Y8UA 5CSUA 2ZZ6A 1NARA 3KW3A 4HPXA 1EUAA 2ISVA 1OC7A 2KX9A 3VYLA 1OYCA 4N6EA 5EMLA 2UBPC 4FOUA 1IGWA 1ZCCA 4AYSA 2YBVA 1R3YA 3TOYA 4HYWA 3REQB 5H6HA 4L9ZA 3CMFA 2CW6A 3QKEA 3PZNA 1V6TA 3NNTA 5HNRA 1WNOA 3H53A 4MFEA 2O9PA 4X60A 1JDAA 3UZZA 2NLYA 4ZB2A 2R24A 3UA3A 1A5LC 3CQJA 4DYEA 2DU2A 4IX0A 4DBEA 4PUNA 5G4EA 3OQ8A 2PI6A 3QM3A 1XG3A 4MG4A 4WXYA 2G3IA 1O68A 1CXIA 3LRMA 1U5JA 4HNLA 2XWEA 3TN4A 2ZUWA 1V93A 3GW0A 4BY3A 4BEQA 2BBFA 5LNUA 2VRKA 4QCFA 1FHVA 2WMIA 4YNGA 4L6DA 1KM5A 2OKTA 2HMCA 3VOCA 3VGFA 3H2NA 2WM1A 3NGFA 4G7FA 1PHWA 4Z0JA 1E40A 2XFFA 4XKYA 3EWCA 4JTCA 1JXKA 3TYCA 4UR9A 1LZOA 4B91A 1XINA 1E6RA 2I5GA 4BF7A 3R2GA 4UXDA 1PCKA 3IVTA 3ARTA 4IXHA 3H2OA 3SM0A 3RN6A 1IWBA 4L61A 1TMHA 4ONVA 3UERA 2BOEX 2YCIX 1T6MA 3TZFA 2ZA2A 5MKGA 3THDA 2QXWA 5EFFA 4O18A 1VBGA 4HZ8A 1V3MA 5EKYA 5EPDA 4H3DA 3AIEA 4XIAA 1DWFM 2OQHA 1E1CB 4TVCA 2MNRA 2Y6ZA 3HG4A 4XAYA 3VZYA 3AMKA 2YYUA 1YE6A 4O57A 3FJNA 3AIQA 1D2KA 4WR3A 4EP8C 3PULA 1YW1A 2VVNA 3G1SA 3DYMA 3GDLA 2V3FA 1ADDA 1VKFA 3D46A 2P8BA 2V68A 1KTCA 4F0LA 1P7TB 5RUBA 2CWXA 2X2GA 1D8WA 1UBSA 3DU0A 4Y2WA 1I0DA 1IR2A 2OPJA 3ES8A 1DJYA 3GNXA 3KFTA 1V6XA 4KW2A 5CZJA 2WVTA 3AHXA 2OOFA 2P5NA 3NA8A 4C6PA 3O1NA 3UPMA 4TX6A 1GT8A 3KOFA 1GHRA 4LWWA 1UHVA 1UD6A 1ZENA 3WQFA 1W1YA 4KERA 5IHRA 1Y5XA 3WBWA 4M19A 4RPPA 3GU9A 5HJXA 1ZQ5A 1FHLA 3FGCA 4W7UA 4GIRA 2VX4A 3QTGA 4MLRA 2VUNA 3WF2A 3NPUA 2GJNA 4F0RA 3P8JA 4H4IA 4US5D 2INFA 5JBFA 2PDBA 2Z26A 1HKWA 1QPRA 5KZMA 1KGXA 1PX4A 3UWVA 2Z1KA 2D0FA 1AQHA 3N9SA 5AC7A 4YTUA 3H8AA 4ZGYA 3AZRA 4G56A 1FHUA 1H7OA 3UZYA 3N9RA 1CLXA 3EWUA 1I2OA 4ICCX 4QRNA 1YMYA 3W82A 3S9ZA 4H9VA 2JKAA 3CLWA 1CIUA 1S1PA 3WUBA 4L1XA 1IXQA 5JMUA 1ECEA 2NLIA 3AIBA 5FI8A 5LA2A 1JCTA 4XSLA 2RAGA 5I77A 4OGZA 3IARA 2HRWA 1UKPA 1RA0A 2WYSA 1K7FA 1YXCA 2YJQA 1F3EA 2QJIA 3M0KA 3E5PA 4FNPA 5A6MA 4OE7A 1W1B1 3RM9A 4C6DA 3URNA 1ZU8A 1BYBA 1GQJA 1MVYA 2PP0A 4PEKA 2XFYA 2DW6A 3SN1A 4NNCA 1JQXA 1AK5A 2OWXA 4HN4A 3GS6A 1YEYA 4LUIA 4C6QA 3MY9A 4IZGA 2RJGA 4UWMA 3LGDA 1N8WA 2PLKA 2Q71A 3I7SA 4ZB0A 3VK5A 1TPEA 5PTDA 1ML1A 4Y96A 4J2MA 3MUXA 1OCNA 3CWOX 1EP1A 2GDVA 4LALA 3OTRA 3LRKA 1B4EA 3SRHA 1VGAA 2WC7A 2ZX7A 1V03A 1UD5A 3EOEA 4JNZA 2AQWA 3WK2A 3RM8A 1TJ1A 3PHAA 4JN8A 2Z27A 3S2JA 4ZE4A 1AA1B 3W73A 1SFTA 1OZMA 4LNCA 1LWIA 1CBGA 3W7MA 3QMSA 2D69A 3R25A 2G3JA 2HVNA 1Q2RA 2AMXA 1CXHA 3SRDA 3WH8A 1EWDA 3LBMA 1EO5A 3N34A 5F2MA 1GZGA 3FJ4A 3CU2A 3V0SA 2FZDA 3WBAA 3F5JA 3KVLA 1XLEA 4HPNA 2QCDB 1VP5A 3ITXA 2QR6A 1OC5A 2EPOA 4C65A 2WW5A 4H8UA 4O4WA 3GWQA 2D2JA 2X7VA 4R5EA 1F6KA 3C2VA 4BQ4A 3UWEA 1UWRA 1O1ZA 4LS2A 3UR5A 1EH9A 1VCFA 3UGVA 5AHEA 3B9NA 3JU2A 3CH9A 4Q4QA 3UJSA 3SRFA 3HZ3A 1C7TA 3IK4A 3MKKA 3TTSA 4Z42C 3AXMA 4J4KA 3FW6A 3CIWA 3C2RA 2YIHA 4E2OA 1NELA 1BLIA 3ZWTA 1W3HA 3RGTA 5JIWA 3G1FA 4W8LA 5MF5A 2BOFX 4GWEA 1JZ8A 4JTHA 2WVVA 3TAOA 3TC7A 1ZAJA 2ZZ3A 4DWSB 3GFYA 1JR1A 1SO3A 4YPJA 1ISVA 3KDOA 1O94A 2PWEA 2XU2A 1M9HA 5IOBA 4I9AA 4CKQA 3WNNA 4LY8A 3T7VA 2F38A 3DKJA 3TR9A 4K37A 4NAFB 4Q6XA 4IUGA 1GQNA 1EHNA 5HMEA 4H2HA 2YDQA 4M6VA 5C9WA 1DWGM 2I7GA 4LUYA 3V16A 3PK7A 1XIBA 1YTDA 2XVKA 1W1PA 1AW1A 5FF7A 3DYPA 3Q45A 4WDWA 1HKMA 4B5UA 5LKYA 3ITCA 1K7EA 1C8XA 4GQGA 1SZRA 3KVJA 2HJPA 2JK2A 4X0VA 3FA4A 4DJEC 1EPXA 1QATA 1UW9A 4XZIA 2CZFA 3UD6A 1J93A 1RALA 3TH6A 3VOIA 1OG0A 5E6YA 3PF3A 3LEPA 3OJGA 1ME9A 4L4PA 4AIUA 1UZ4A 5DELA 3WNLA 1UD4A 1E4LA 1TPFA 2WBGA 4GXMA 1XFBA 2IW0A 5E9XA 1XR2A 1BAGA 4QLKA 1DJWA 5JIPA 2WZMA 2YCEA 3VXGA 4H9ZA 2NVDA 3GD6A 1V3JA 3BPWA 3DERA 3S3GA 1Q6FA 4KF1A 2UZ9A 4EIVA 4PCSA 5DCEA 3EA2A 3GYCA 1SGJA 3PSWA 3NJ3A 5C9UA 3UP8A 1V6UA 4NXSA 1AFSA 1J96A 5I00A 1CEOA 2VT0A 3L2LA 4M1RA 2ZYFA 3KOXA 4JN7A 3GRIA 4PUEA 2VCBA 3ALFA 2NVAA 3L4VA 3U2CA 3O2LA 1TTPA 1HNYA 3TFCA 3TDFA 3DI1A 1CDGA 3D6NA 4J28A 1XIMA 2B0MA 5C6MA 2QMJA 1NJJA 3WQ5A 3T2PA 1ONXA 3S42A 4WCJA 2VGGA 4NI8A 3SGGA 5A6BA 3UEQA 4ILSA 4OECA 1K4HA 2CCRA 3KLKA 3TXZA 1JCLA 4AZIA 4FOKA 3QZAA 3ZQ9A 4DPQA 4RE3A 4QG6A 1KRCC 4F2BA 4OBRA 5A8PA 5AHFA 2QVHA 1MWOA 4H9TA 3QPYA 4P7OA 2E09A 1UMLA 2X40A 4S3BA 1HJVA 3QR1A 4CCZA 2ABBA 5D9MA 3HU7A 3BANA 4LSBA 2C6QA 1PL9A 2YOCA 4PMYA 1UD8A 3H21A 2VKZG 3URAA 1QK0A 3P93A 1TX0A 3B0PA 4BKNA 4IL2A 1FOBA 4QLJA 4NVTA 3EBVA 2D22A 3DCPA 1OZQA 3ARSA 4IICA 3MB9A 4OFCA 2BHZA 1QCWA 2WLYA 1QO5A 1OX4A 1PKLA 4CD7A 2QUUA 4NQ1A 3MCOA 3ZYZA 5GNXA 3AROA 3WG6A 1F07A 1OD8A 4W7WA 4YMZA 1XRFA 5IDIA 3II1A 1Y5VA 4PZVA 3MP4A 3FOKA 2Q8ZA 3R0KA 4Y9MA 3VKDA 2ZQ0A 2PBGA 2QCHA 4W8AA 2PDLA 4JHMA 4NRSA 4I9JA 4WUIA 2QCEA 3L7RA 1G94A 1LORA 2JBMA 3OZMA 4X22A 4H9UA 2AOSA 4GI9A 2V0TA 3TCSA 3RG6A 1VYRA 4U28A 4AIEA 4C7DA 3T2QA 2XSXA 1UP3A 5FEZA 5CC6A 2J13A 3DHPA 2I56A 4CVUA 1KM6A 2SFPA 1G9HA 5CZ0A 2YSWA 4PRWA 5C9XA 1U1JA 4Y9NA 3W1NA 3W1RA 4AVNA 3CZ8A 3M0JA 3ZR6A 5CC3A 5MHBA 5BU6A 4HHHA 3UCDA 4B5SA 1NM9A 4AEFA 1V4YA 3EDEA 3QQ0A 2XGIA 1V7AA 1GTHA 4NJJA 4HSOA 2ZZ7A 1XHGA 3CEPA 1H1YA 3T44A 1Z48A 3U57A 4D1IA 1S5VA 1R5YA 2A79A 4HU3A 5K7JA 1EIBA 4L6OA 2OZ0A 2Y7FA 1BF6A 1JPDX 3C2OA 5CQ1A 3SBFA 4MPQA 3ZR5A 5GNZA 2UWFA 2OXNA 3M5XA 3DYOA 2OSYA 4C6FA 4J3SA 1FH7A 2BXYA 1V0KA 2NWRA 1B3WA 4IIBA 4MJ2A 4RPQA 3KZSA 3PR2A 4NP7A 3GVRA 4DUWA 2BGNE 4MZ8A 2V5DA 1TIMA 4HT3A 2D20A 1W3IA 3WH6A 1EA9C 2ZUVA 5CH9A 1OGSA 2ZUNA 3ZT7A 4HCLA 5C7VA 1HJXA 2WJEA 2BY1A 3H22A 2R1MA 2QCLA 4NF7A 1REQB 2WMFA 2ZBTA 2REQB 4O19A 5LA1A 3LCHA 2EPKX 3VIOA 2GWGA 2HWGA 1VS1A 4LW7A 2W4XA 4XBSA 3LBCA 3B40A 4NZCA 1Q3NA 3B4YA 2A3AA 3CYVA 2GOUA 2YCJA 2OYMA 2WVUA 2DZWA 3IUHA 1W31A 7ENLA 3NQMA 1LWJA 4JTRA 3C0QA 3IGXA 3KBJA 2EF9A 2F2HA 2QAPA 1TV2A 1Q85A 3BLOA 5AYIA 2GPTA 1JNEA 4XSMA 5AC6A 2QPUA 2R91A 3M0YA 4PSPA 4HHLA 1ZALA 1JUKA 1QXLA 1MO0A 3VDBA 1KKOA 2DSVA 4IHCA 3PPGA 4IQLA 5FL0A 4HJFA 3FV9A 4ZA0A 1RD6A 3NL5A 5C2GA 1XSIA 4YVPA 1JPHA 3NQ6A 1LLOA 5T91A 3B8TA 4XUYA 2UY2A 4E5TA 1XLAA 3F4NA 2QLYA 2PS2A 4CNPA 2A3BA 5BMXA 1RBLA 5DLCA 2I14A 1QOXA 3EB2A 3FHQA 4FZIA 4IIGA 1I45A 2ISSA 4NAEA 1A3WA 4NNBA 4FX6M 4DELA 1FX6A 4HK5A 3LHWA 1KLYA 3BWWA 3ORWA 1VH7A 4B4HA 1S1RA 3VX0A 2VURA 5JQ9A 5CZKA 3WMBA 3LPFA 4MKVA 5A6KA 5C71A 2GJLA 4I7WA 2A7NA 3QHNA 1OHLA 4UMAA 1PEZA 4CNNA 3AMDA 4D6EA 3CMGA 1XYZA 5G5IA 3WQGA 4FSAA 4DO7A 1Y65A 4QGCA 4MB1A 3C3NA 4FNRA 4ZO8A 1T96A 3FVDA 4P61A 4W8BA 3ARPA 2CIPA 1LQAA 2F9RA 2I9UA 1S5TA 3RO8A 3KRZA 4HNCA 5BXSA 4US5A 4PUMA 2DY3A 4JHOA 4PMDA 5FJPA 3TA9A 4WKHA 4O53A 3ZXWA 2GJXB 5I24A 1WUEA 2ZZ4A 4CVWA 5KZEA 2E4TA 1KR1A 1XLGA 3W7HA 1EZWA 2NXIA 2NX3A 3NDOA 1UR3M 2EG7A 2J4GA 4KBXA 2EPNA 4GINA 3GXDA 1JJKA 4NY2A 4ECLA 3L4XA 1NWSA 1PTGA 2Z1BA 4GX9A 4IXXA 1ICQA 3ECQA 2GJXA 3B9EA 1RJPA 4GQRA 3RPTA 3U9IA 4TV6A 4CD6A 4AZHA 4LRSA 4XAPA 4PMQA 5EA9A 4GPNA 1K03A 4K36A 1YNQA 4JTSA 1I2PA 4XKMA 4M56A 1XP3A 3V1HA 3TN3A 3HPFA 3D5HA 1H3GA 2X7WA 2DH2A 5IFPA 1P0DA 2R6OA 3WLSA 3MVTA 2CBIA 4Z08A 4HZ6A 3RXZA 4WDUA 4KEMA 1VR6A 3UNDA 4UCGA 4ATWA 4F3HA 1ZBKA 4V27A 4X9SA 1XM3A 7TAAA 2KAUC 3LNMA 3ITLA 3VVGA 1KWKA 1JD7A 1UR1A 1F3WA 5HR6A 3T8LA 2Z4GA 4QR6A 2W92A 4PUKA 2YCLA 3UQNA 4XD6A 4ZOCA 4N2YA 5A1AA 3OGSA 2BTMA 3DFOA 5I7GA 1GYNA 1UP2A 1UH2A 1ZFJA 1FWWA 1X6LA 1GVQA 3ABZA 3LXCA 5A6TC 3OU8A 3UR7A 2VR5A 6XIAA 2R8WA 4ZL1A 1XV8A 5E1QA 2Z2UA 1E3XA 4MTVA 1EQCA 5LNSA 1TB3A 3R0DA 1RP8A 3PN8A 3QFEA 5REQB 4EK7A 3SCPA 3P3BA 1UWQA 1Z7AA 3Q67A 1US2A 3ARZA 3HJEA 2PP1A 1DQUA 1N8IA 3QJAA 4IGNA 1JCMP 2Z2BA 4IIEA 4MWAA 2FTPA 3VMNA 2CXGA 1J9YA 3KL3A 1UASA 3QY8A 1JYNA 4LAOA 2HBVA 3WL1A 4US6A 5IDZA 1SO5A 2B7NA 3PJXA 1UOZA 1WKFA 2FQIA 4DN1A 1GJPA 1WX0A 2NQHA 4G7EB 4BQ2A 2GUUA 2VX5A 1MFVA 3LCWA 1IEXA 2PDFA 3F4WA 1QBAA 3GZ3A 1DE5A 3QHOA 3RX3A 5CG0A 1J12A 3W72A 2V5CA 1KRAC 3CV7A 5C8BB 3DG6A 3N14A 5GJMA 2DT1A 1NOFA 3WBXA 4PB3A 4PCTA 3UYCA 3GXPA 4JQ3A 3MHGA 3HG3A 1Y0EA 1A80A 2QPSA 3LCFA 2ZXAA 4Y9AA 1P1XA 1WOBA 2NUWA 4U3AA 2QYGA 1A5KC 2CFFA 3RCYA 2H6RA 3CASA 1BXCA 4JTTA 1FDZA 3BLFA 3EKZA 4IM4A 1FFRA 1F3TA 3S9YA 3GG7A 1LG2A 4C91A 4CU6A 3KX6A 4ZXLA 3PZIA 3VA8A 1VIZA 2VCAA 3WDIA 3H7VA 1IE7C 1P6BA 4IFKA 2C15A 5CGTA 4UOJA 3BMXA 3BAYA 2O9OA 3W7GA 4MLJA 1TV3A 4O8AA 5EGRA 2VOMA 1MEWA 1W1A1 1SMDA 3W25A 2CLPA 1FWIC 4RKAA 4Y9OA 1JIBA 4Z2IA 3T78A 3MVIA 2DT3A 1UR9A 2OEJA 5D04C 1EP2A 2XM2A 4ERAA 2CKSA 1J11A 4UFLA 2BVYA 4G8TA 2VR2A 4C6MA 1PZ1A 1P0NA 3T07A 1W1ZA 3OBEA 1D3CA 1XD1A 2CHNA 1T99A 3UWZA 2HZGA 1HL9A 5F4XA 4ERIA 3SEPA 5BROA 1GJWA 3H2AA 3GDKA 3VDCA 1XLLA 2ZRYA 1PIIA 1GKQA 3SURA 2ZUSA 3WLHA 3NQVA 3BJFA 4AEOA 2YA2A 5D02A 3W53A 4KIEA 4Q4RA 3ABXA 2NV2A 3IJ8A 6REQA 3LXAA 1HW6A 3IV3A 1S2WA 4QDWA 4KRUA 1OCJA 2YB4A 4M1BA 4PTXA 4D6CA 3CAWA 3SDOA 4K68A 1XRVA 1TJPA 2TPSA 4PMRA 3F2DA 4DPPA 3TU9A 3H26A 4UTLA 2PWHA 3GHUA 3NVTA 3MCMA 4HA4A 6ALDA 5BCAA 5AHMA 3LHUA 1FXPA 3C56A 3H2FA 1BWLA 1VF8A 2W61A 3VGHA 1V6VA 5I3KA 3W70A 1UJPA 3MS8A 2ICSA 1EDQA 2NVCA 1IEVA 1EYWA 1B3ZA 2VDGA 2BVDA 4YWSA 2ZA3A 5HINA 4LBUA 1NFBA 3M0LA 1R38A 1K4GA 4L64A 3TA6A 3GQYA 2WV8A 2PDGA 4HA0A 5D32A 1OM0A 3PBYA 5I6SA 5M03A 2Y8KA 4RK8A 3FYPA 3PWIA 1UMYA 3TCEA 1Q4WA 2G97A 1ITCA 1YQ2A 3VC5A 4NZJA 1DJZA 2Y61A 1HKVA 4X61A 3CTTA 4RXGA 5FJUA 3DENA 3NSXA 3R89A 5LYRA 4NX0A 4WHBA 4PCPA 3WYZA 1U22A 2F6KA 1QW7A 2CLMA 3HPAA 6XIMA 1BQGA 1XUZA 2J25A 2BODX 2J88A 3AYRA 2ZX9A 2WBKA 4S2BA 2BMBA 3GU2A 4Q8OA 3CB3A 3B9OA 3ZLGA 2J66A 3PJUA 2YCKX 3PTKA 4S3GA 1FWFC 3G22A 3QV6A 2VFEA 1VB9A 2AQVA 1X6UA 9RUBA 1F7BA 2BSLA 4OJYA 3VNIA 3VKKA 1A0DA 1NDVA 1W3NA 1O6IA 4IISA 2JFEX 3W38A 3K4WA 3VPLA 4U4MA 3KHJA 4XZBA 1XLJA 3ATZA 1C7SA 1XIEA 2FGZA 2J7GA 2PF8A 3QOKA 5AYBA 3KP0A 1TJ0A 3CS2A 2FVLA 4UIOA 3DHFA 4ZENA 3WFAA 3CO4A 3HPXA 3RMJA 4RV8A 4G5DA 3RDKA 1YTKA 4C6BA 2ZRXA 1B5TA 3NOEA 2DFAA 1CGTA 1JCYA 3A3HA 4GI4A 3XIMA 4JX6A 1YKWA 3HF3A 3N15A 2WKJA 2ISWA 1J8VA 2PCEA 4RW3A 1JAEA 5HOSA 1V0LA 3AXXA 3WNMA 2HPIA 4FR6A 5EYWA 3GVGA 3LY0A 5K3VA 2EPLX 2OOGA 1SW0A 1EGMA 4FF5A 2OFJA 2H90A 3NG3A 5DT5A 2A0NA 2Y4SA 3SY5A 3MWAA 2C19A 2ZX8A 4L1WA 1UA7A 3A3WA 3KM8A 3WDHA 1YHTA 2YBUA 1A0CA 2ACQA 4RXFA 4O1CA 5AC5A 2GOKA 3VIGA 4UTWC 4JTEA 1S2TA 3DEQA 1Q6OA 3GBEA 3A47A 2CLIA 3AJ7A 3WEOA 3IIOA 1CENA 5ECUA 1OFBA 3VKAA 5A8GA 1ZJHA 2PTDA 1W5MA 1FVPA 3S1WA 5A2CA 4FIQA 3VIKA 1RXOB 3MHUA 1TYGA 4F0KA 1QMLA 3APGA 3SCWA 4DY1A 5AYXA 1N8FA 1XC6A 4Z2LA 4PC8A 1ZB5A 3AYTA 3OEXA 2X0SA 3AIUA 1XICA 1L2UA 1DHKA 1RV8A 1SM9A 2A7PA 3EDFA 5HMFA 1AJZA 4IP4A 3FEMA 2R14A 1VJSA 3V1PA 4Z0SA 1TTIA 4DF0A 4O11A 4HMNA 1PX8A 1KXTA 2VZUA 2IMRA 4MY9A 1WE5A 2OCZA 5HWJA 3IIPA 3NQGA 2PCQA 3T0TA 1E9ZB 2QGHA 3MBFA 3PUOA 3CT2A 4HMDA 1U1UA 4JOMA 2Q09A 3W00A 3LERA 4UMBA 4C1KA 4XO6A 4A8IA 4MF4A 1JYWA 3NGJA 1EGZA 3VM7A 3WMLA 1I0BA 1F61A 3UESA 1JDDA 3PWGA 2PWGA 1SR9A 4DJDC 4ZZ9A 4OOUA 4AAJA 3TJIA 3U5YA 4IPIA 3THAA 5DXYA 4IFOA 3OVQA 4G2DA 2D0GA 1BG4A 4TX9A 3C2EA 4EWND 3G1AA 2EG6A 1D7KA 2V2HA 3P14A 4GZIA 2YCLB 1PCWA 3A4WA 2LLEA 1WXZA 1G7VA 1HL8A 3LCIA 4EWJA 5EL1A 3AZSA 5CSYA 2QJJA 4NIRA 3WF4A 2J7HA 4UOZA 2EKGA 3P8IA 4O0ZA 2VFFA 3R79A 4XZNX 4U10A 3CL7A 3RLUA 2B81A 2PC8A 4Q6JA 3N4FA 4KFNA 3Q4DA 4M3PA 1TV7A 1KRMA 4ZQNA 1V08A 1JZ6A 3LYEA 4NI3A 4GC3A 1WKEA 1FRBA 2CLEA 1GVFA 2BXVA 4NNAA 4I5UA 1DORA 2CETA 4NASA 3FAWA 2FZ8A 3FDGA 2XIIA 2Y62A 3EXSA 3BG3A 1UUOA 3ZT6A 2PGRA 2YLLA 4QQ3A 4TUFA 4Z1YA 1TO3A 1OABA 4A21A 4FNSA 1TTJA 3FY1A 1HVXA 4KMQA 2P50A 1L2QA 2BHYA 3EA3A 1WZKA 4GC4A 1R85A 2YXXA 3OPSA 3ATYA 4GG9A 4MJZA 3CWHA 4MYAA 3F5KA 4GOAA 4N9CA 3PFRA 1JAKA 2A3EA 3RPDA 4HKPA 3GHRA 4CUCA 1FDYA 3UXLA 1TRIA 1C9DA 1NU5A 1RQHA 3GHTA 4RW5A 3ZOAA 2OJPA 3AHZA 4NRRA 1XLMA 3L4UA 1AUSL 2G3FA 4N9BA 2PTWA 3V7PA 4DB7A 4XAFA 4FAMA 4DJEA 1DPMA 4MVAA 1FH9A 3OVGA 4KWSA 1H5VA 2GSJA 3BOXA 2VVSA 3UG3A 2DP3A 2D2OA 4DWSC 3GXFA 3QV7A 3V0UA 2HTMA 4FLQA 3SUVA 3E0LA 1KBKA 1R7OA 2ZXDA 2E1DA 3TMQA 1R87A 1J0IA 4GYJA 4WKFA 3LPPA 4I3GA 4RDZA 4LS0A 4O12A 1GG1A 5TD4A 3ZIZA 1A3HA 1KFWA 4V2XA 1GWJA 1J10A 2C1IA 3QBUA 1G01A 1DVJA 4I8YA 1Y5WA 1KCKA 2JE8A 2VRJA 1FWNA 1VPXA 2PZNA 3UZJA 5CXPA 3CLMA 4DBSA 4H9YA 4I9TA 2C7FA 4NJIA 4AHQA 2F84A 3GVVA 3TP4A 4CCEA 3S1GA 5AY7A 3HM7A 5HJYA 3P0WA 3UPBA 3E38A 4GCAA 1KA9F 5FSDC 3RX2A 3ANYA 4LAUA 1LQ2A 2YA1A 4A3YA 1KRBC 1W1TA 3K8LA 4XZMX 2XZ7A 3GSMA 3ABOA 1RR2A 4X63A 4EPBC 3N17A 3PS7A 1W9DM 3A64A 5AYYA 3ES7A 2BWGA 4W87A 4L65A 3ITVA 3B8SA 3S5ZA 2VEIA 5G1MA 2HK0A 2CPUA 2YA0A 4UR8A 3ZJKA 1XJBA 4DUOA 4TO8A 4MJ4A 1A4MA 1Z44A 1H0IA 3BTNA 4GMEA 4GZEA 1CGXA 2CHRA 2RGMA 3TJLA 3M7SA 3MV11 3E2RA 1HKIA 3UZ5A 1MFUA 4WVXA 1UQYA 1DQWA 5KMYA 1L9WA 4R9XA 4MAZA 2RDTA 3SUWA 3MMDA 2V63A 2XVLA 3CC1A 5M5DA 4CLMA 4QFUA 3WD0A 1FWSA 1UWUA 3S47A 1JRCA 2JKPA 2EKCA 2XGBA 1XYAA 3C5QA 1BHGA 2DZTA 3ERPA 5HNNA 4A22A 3U5UA 1OYAA 4AMCA 1E4MM 9XIMA 4R7JA 2GGEA 1PWLA 1EHAA 2HE8A 3UA4A 2VTFA 4E8DA 4UOQA 4PFMA 2PDCA 3WNKA 1KQZA 5BOFA 3H12A 3PAJA 3VC6A 3PANA 2YZRA 1ZJIA 3EWBX 2VUYA 3A4AA 1PYFA 2DUXA 5I79A 1I6NA 2Y7EA 4A3RA 2EGZA 3V4BA 2PE4A 1TZZA 3CM4A 4HZ7A 2FH6A 1E5JA 2A3LA 2E0PA 3LPOA 2WNWA 4GZ7A 3CHFA 3WL0A 3C86A 3FK4A 5A6SA 3P67A 3LENA 4XO7A 3L5MA 2O0TA 2VQUA 3RRAA 5BOOA 4JS3A 2FPVA 4Q8UA 1DWIM 4YJ5A 4X3ZA 2DZPA 3MO4A 3NR0A 2Q3OA 5LNWA 4PCNA 4K38A 2OQYA 4U2YA 1IWPA 3MMTA 5F1UA 2GGIA 2HQAA 4RNHA 4WRHA 3WQ4A 3T2OA 2A7RA 4YTQA 3M0XA 2QF8A 4B2DD 3DUGA 5HMSA 5GNYA 1EC7A 1GTEA 4F2UA 3SCRA 2GVEA 3HJZA 1P4CA 4Q22A 3JW7A 1N55A 5FACA 3VD4A 4H7CA 4O16A 1K8ZA 3UF9A 5G4WA 4M0XA 3TK7A 2BGQA 1K77A 4DZHA 4GO9A 3MUIA 4ZODA 4ERGA 4C6OA 4N42A 4FEZA 4E2VA 2PBOA 2QV5A 1M7PA 2CLFA 2FGLA 3S2NA 3I3BA 3VGEA 4HCDA 4PUUA 4PB5A 3PZGA 4LS1A 1KKRA 3BH4A 1C92A 1E56A 1EUNA 3DOPA 1S2VA 3FS2A 4JYEA 4HBKA 1TX2A 4M29A 1S39A 4E3TA 2EPMX 1TPWA 3B0UX 3UNTA 1B9ZA 5FJJA 1XYMA 4URIA 1S3HA 3ZFHA 3PB2A 4N02A 1VJIA 2CESA 2QCDA 3VCRA 3B8IA 2YYTA 2WO5A 4UR7A 1X96A 1OFDA 2AGTA 5C70A 3INPA 3VKBA 3DGBA 1E9LA 3PBVA 3LV6A 4A35A 1TPC1 4MYXA 3VINA 3BC9A 3N6HA 2PRLA 3GG0A 1Z32X 3XINA 2MANA 3IVSA 1Q8AA 1QPKA 2BP1A 4IG2B 2INZA 1TE1A 3SY8A 1KFEA 1W3JA 3NZ1A 1K70A 4U31A 1H62A 5ECVA 1NIUA 5DQPA 4V1XA 3STEA 5FF3A 2PDYA 4EXQA 3LCGA 4AVFA 1MXGA 2C0HA 4ADTA 3N2TA 4CN1A 3EEZA 1FP9A 1TPVA 3GVQA 3LLFA 4LX4A 2C0AA 3PBUA 2H3BA 1MUWA 1GOMA 1YE4A 4JIHA 1EBGA 1HKJA 1OSEA 3CB8A 5D33A 2IKGA 1XX1A 2WZHA 2XDFA 1XDMA 4OOZA 2D2HA 3R58A 3M46A 1TFVA 1JUBA 2FVKA 3F4VA 3PUDA 2WZEA 3TYDA 2L5HA 4GYKA 2GQAA 1UB3A 1MSSA 2C3ZA 4LBRA 3P80A 4QSHA 3I10A 4P8UA 4RZ4A 1GORA 1J0HA 1HGYA 3TLQA 3EWWA 2INEA 1QNSA 5BW6A 1B9BA