4DBWA

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 2'-desmethyl-indomethacin
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title Development of potent and selective indomethacin analogues for the inhibition of AKR1C3 (Type 5 17 beta-hydroxysteroid dehydrogenase/prostaglandin F synthase) in castrate-resistant prostate cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 115
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4dbwA00
1S2AA 3DN5A 4JIIX 2F38A 1X97A 2FVLA 3F7JA 4LAUA 3T42A 2FZBA 4XO6A 3LNMA 4MHBA 1T41A 4GABA 1ZSXA 3V36A 2IQ0A 4FAMA 4JTCA 2BP1A 5AZ1A 1VBJA 1EXBA 2VDGA 3U2CA 3FX4A 1MZRA 2BGSA 1ADSA 3COTA 1M9HA 4QBXA 5DANA 2PD9A 2J8TA 4IJRA 4GACA 2A79A 2IPWA 1EL3A 1Q13A 1US0A 4WDUA 2F2KA 2ALRA 5C7HA 1GVEA 1LQAA 4G5DA 4L1WA 3GHSA 1HW6A 3R43A 4WDXA 1RALA 3UZYA 3UYIA 4JQAA 1YE6A 4PRTA 1MI3A 1RY0A 5LIXX 3RX3A 1ZUAX 3WBXA 2NVDA 3UZZA 1AZ2A 2PDNA 4YVVA 1X96A 2HVNA 2PDMA 4IGSA 3LBOA 3CV7A 4XO7A 2PDLA 2HDJA 2NVCA 2HE8A 2FZ9A 4F40A 5LIKX 4PR4A 2PFHA 4XZLX 2IKJA 3RX2A 3BCJA 2HEJA 3N2TA 2FGBA 4QX4A 2PDGA 1QRQA 2DUZA 2PEVA 3BURA 4ZFCA 3BUVA 3M4HA 4GCAA 3UWEA 1ZGDA 1HQTA 2INEA 4WGHA 2ACQA 4FALA 2I16A 4NKCA 3R94A 4XZHA 3O0KA 2IPFA 1R38A 4DBWA 4HMNA 1IEIA 2PDJA 3M64A 3M0IA 1XF0A 3GUGA 3NTYA 1MRQA 3WG6A 3P2VA 3H7RA 4DBSA 1JEZA 4JTDA 1OG6A 1S1RA 2FZ8A 4XVEA 5HNUA 3CMFA 3R6IA 1RY8A 2BGQA 2PDUA 3LN3A 4YVPA 4GQ0A 4XZNX 2ACSA 2PDFA 1ZQ5A 4PUWA 2PDKA 3Q65A 2IS7A 4RPQA 4DZ5A 1AH4A 3H4GA 2AGTA 2PDPA 3C3UA 2PZNA 4ICCX 1PZ1A 3LQLA 4XAPA 1PWLA 1AH3A 2ISFA 2R24A 3WBYA 3MC5A 3WCZA 2HVOA 2IKHA 4YVXA 2R9RA 4YS1A 3FJNA 4XK2A 1X98A 5HA7A 4FZIA 4WRHA 1K8CA 2IPJA 3RX4A 2QXWA 1EKOA 2PD5A 4JQ4A 4JQ2A 2WZTA 1Z9AA 2P5NA 3D3FA 4JIHA 4EXBA 3UG8A 3LUTA 4LB3A 3LENA 2PDQA 5LIYX 4XVDA 1S1PA 2DUXA 2DV0A 3UZXA 2IKIA 4XZMX 3ONBA 4QR6A 2INZA 1PZ0A 3UZWA 3GHRA 1FRBA 3O3RA 2PDIA 1YNQA 2HE5A 4I5XA 3V0TA 2PDBA 4XZIA 3R8HA 4Q7BA 3UFYA 4FA3A 4WDWA 1S2CA 3LD5A 1Z3NA 2IKGA 1YE4A 5KETA 3R58A 1XGDA 3ONCA 4L1XA 2PF8A 5LIUX 2C91A 3WBWA 2PDWA 1Z8AA 3LEPA 3N6QA 3V0UA 3B3DA 4R9OA 1IHIA 4GIEA 3BV7A 3G1RA 1YNPA 5HNTA 4LBRA 3CV6A 3G5EA 1J96A 4IJCA 3EAUA 3KRBA 3R7MA 2WZMA 4ASTA 4GQGA 4PUUA 4EXAA 1C9WA 4JTQA 1AH0A 5M2FX 4LBSA 5JH2A 3V35A 4QXIA 3GHTA 3S3GA 1PYFA 2PDXA 3R8GA 1AFSA 1Q5MA 4PRRA 1T40A 3V0SA 1VP5A 4JQ3A 3CASA 1QWKA 3VXGA 3LZ5A 3EB3A 3H7UA 5LIWX 3LZ3A 2PDCA 4JTAA 2FZDA 4H8NA 4OTKA 3MB9A 3LQGA 1UR3M 4GA8A 4DBUA 4HBKA 4JTRA 4WDTA 3GHUA 2PDHA 2I17A 3EB4A 1LWIA 4YU1A 3UGRA 4Q3MA 4JQ1A 4PMJA 1XJBA 3Q67A 1A80A 3QKZA 1Z89A 4JIRA 2IQDA 4AUBA 3ERPA 1AZ1A 2ACRA 2IPGA 2PDYA 4LAZA 3UP8A 3DOPA 2CLPA 3CAVA 1PWMA 4H7CA 1SM9A 5JH1A 2ACUA 2HV5A 5AZ0A 4LB4A 4WEVX 3CAQA 1EF3A
chains in the Genus database with same CATH superfamily
1JAKA 3N2BA 4YN5A 1GJWA 4KWSA 3SURA 5HMFA 1N8IA 4MY9A 3WFZA 2YB4A 4PUJA 4H04A 2GJRA 4B4HA 4M5PA 4O0QA 3U3HA 2Q71A 3OOQA 3MSDA 3VK5A 4LRTA 1NSJA 1KRBC 1SZRA 3UXLA 3UXAA 1EDQA 2NXGA 4C6FA 2J66A 1ZTVA 4HCLA 1Q7QA 2IQ0A 3W1QA 1QAPA 3S5SA 1GHSA 4J2MA 1LORA 1SMDA 2TYSA 4QBXA 3GAKA 3Q37A 2VZTA 2Q02A 2YJQA 3IRSA 1RLDA 3TC3A 1JZ5A 3P6LA 1M53A 3NZ1A 3VMNA 1IYXA 3KZPA 3IJ6A 3GXMA 2H90A 3K4DA 2VWTA 3FJLA 3JVAA 4JZ5A 4S3FA 2WHJA 4PTDA 4HZ6A 1V3MA 2HROA 1B31A 2HBVA 3JUGA 1KC7A 3ABXA 3E0IA 1A4LA 3V16A 3SY8A 2PDNA 4W5UA 2W79A 3VE7A 1R3VA 1BSLA 1O5KA 5D30A 3QC3A 3VOJA 3LLDA 1UBSA 3OZMA 4DJDC 4HU3A 5EBAA 4MUPA 1XBYA 2YL5A 1O94A 1TJPA 4X0NA 4PCTA 1TJ2A 3S1WA 3WFAA 3BUVA 3FVDA 1E9YB 2QVHA 2BSLA 2GVJA 1KA9F 4RCXA 3ABOA 1EYWA 2INEA 4WGHA 4W85A 2ACQA 3QV9A 4FALA 4AD0A 1LF1A 3KBJA 1VB9A 3DFHA 3ZWTA 3WFLA 3OB8A 3D46A 1KQYA 4M1BA 1PPIA 1XI3A 1H3GA 2ZZ4A 3AQUA 3GNPA 1OD8A 4W7UA 1PTAA 5K9CA 4HD5A 2W66A 4QM1A 4HPGA 1JEZA 1JCJA 4QITA 4JHMA 2D1ZA 3TVAA 1GKRA 1V6VA 3A23A 5KSWA 1H7NA 1F3TA 2A3BA 2REQA 1UUOA 3CMFA 3NGJA 4ZXOA 4IF2A 1NQ6A 3UQNA 2XFRA 4JOMA 1OFOA 3P0XA 5A3HA 4KS0A 3CNYA 4ML9A 4R85A 2HXUA 2HSAA 1ZU8A 3T9PA 4ZR8A 5KEZA 1JI1A 4M6VA 2Z1KA 4Q8QA 4KCWA 2VHLA 1R3TA 4DXKA 3AS2A 1ITUA 4ICCX 1JI2A 1WBHA 1CCWB 1R9ZA 1WXJA 1XXXA 3FFSA 1EZ2A 1FCUA 4NZ5A 5AYXA 1EJ7L 2FZMA 4DNHA 1JGIA 2YKKA 2X2YA 4ZEPA 5M03A 4ZXLA 1A50A 1PCKA 3C6CA 1GOMA 2Z1BA 3G1DA 4KFOA 1OVDA 1BYCA 4IZGA 2FGZA 4DJFC 2ZA1A 3G0SA 3S2LA 1YNYA 3G0XA 1FKWA 2E0PA 1V6UA 4AX7A 2PD5A 3W85A 3MQTA 1JZ3A 1XLJA 3GR7A 3VD9A 3L12A 4HNNA 4PTMA 3LRLA 3I7RA 4C7GA 4WD0A 5CSUA 2FGLA 3R8RA 3ONBA 4QR6A 2FTPA 1GHRA 1ZY9A 3AHYA 1A0DA 1LBFA 3IVTA 1FHLA 4F3HA 3E96A 1NVMA 3PFMA 1HVQA 1X7FA 4OIFA 4Q7BA 3CU2A 4I90A 5DX7A 4E5TA 2WB5A 3C2YA 5EMMA 5IFTA 3CQHA 3POCA 4A8NA 1LBMA 3MP4A 4M80A 4LY4A 4CQDA 1QI5A 3ITVA 3Q58A 2HNEA 3QTPA 4PE8A 3LM3A 2OQYA 2BY3A 3TH6A 4JEQA 1OG0A 4MJZA 1ZENA 4KRZA 4YTUA 3AYSA 1WZAA 1XIFA 2Y7GA 3WF1A 2V68A 5AFDA 1FWCC 1E72M 1PSCA 4DVOA 1KFEA 2HZGA 3EWBX 3HQOA 2NX9A 5A6SA 3BG9A 3DDMA 1GEHA 4DXVA 1TREA 3QKEA 4KIEA 4JTQA 2BOGX 2VR4A 4Y8FA 1J5TA 4E2OA 4GZEA 3SCOA 1W56A 4B5SA 2NV2A 2ISWA 1UHVA 3PVFA 1J11A 3IRDA 3GH7A 3EMCA 4HU4A 3MANA 4AHQA 2OWWA 1XCXA 1UR3M 2DZPA 1O66A 3D47A 4MZ1A 1FFRA 3F4NA 4YTRA 2GSEA 3EDEA 3AO0A 4K3ZA 4FK9A 1JYNA 4MYAA 2B7QA 5D9PA 4AZ6A 1FQ0A 3VC6A 2J79A 2OGYA 3VTRA 5AVHA 1MYRA 1XJBA 3UW6A 3VOCA 4BF9A 3N3TA 1NTHA 4IFRA 3ZJKA 3AHVA 1GOXA 2ESCA 5C0QA 2PA6A 3VGFA 4ZO6A 2Z1SA 1RQHA 1GK8A 4LEQA 4AHOA 2O4QA 5IOBA 3GIYA 4MKNA 3S6OA 2GJXB 2OFJA 3F1QA 2HCVA 2OYMA 5ABHA 1X97A 4MJ4A 1TJ0A 1AL7A 4CU6A 3D5HA 2ZVRA 3SCVA 2VFFA 4Q4SA 4H7VA 1E6SM 2C18A 3LBCA 2OT0A 2J7GA 4A3UA 1WKYA 3WQWA 2BWGA 1WCGA 1RCOB 3WH9A 4E2DA 4MGGA 1ZSXA 3KDNA 3S1GA 2P10A 1TCMA 1OGGA 3FYYA 3WLQA 3PY2A 2VDGA 4H9XA 3BARA 4Z2LA 3WNNA 4LALA 4UFIA 3M9YA 3APGA 2PLJA 4CU7A 3RUBL 2A79A 2FH6A 4UIOA 1A5NC 2ATMA 4JTFA 3HO8A 1EL3A 1QWGA 4AIBA 3CH0A 3MDUA 3LCFA 3WMBA 4A8LA 2QW5A 2ZA2A 4S23A 4MY1A 4Q4QA 3RNDA 3DC8A 1BSIA 3EPNA 4E8GA 4P8VA 1YTDA 3QQ1A 3DG3A 3BCDA 4YHEA 1N7KA 2QIIA 1UWRA 4AXKA 2PGWA 3I65A 2CZVA 5C5YA 4D71A 1F05A 3ZQ9A 3N73A 4PFHA 2CNCA 2E7FA 2WBKA 3OQ8A 5CJNA 3NCOA 2PP1A 4OBSA 3KZSA 3VX0A 1MRAA 1OYBA 3TWBA 2HE8A 4TU1A 3GG7A 4LX4A 2YOCA 1Q6CA 4HYWA 5MF5A 5FAJA 3EDFA 5ABFA 3TKFA 3SQMA 1KWKA 1IWPA 3P0WA 2BHYA 2V9DA 4XAGA 5K2ZA 2OEKA 4GCAA 3RU8X 4BWLA 3VMOA 3NO3A 1LYXA 4UR8A 1J6OA 2YYTA 4OUIA 1EIXA 2B81A 2DZBA 3N2OA 3R79A 1EA0A 3B9NA 2VZUA 5CGQA 3HMJG 4G7FA 4HMNA 1TO3A 4D6JA 4GY7A 3EWZA 1NP2A 2ZUVA 3LCGA 3MUXA 2XM1A 4RE2A 3SGZA 4D9PA 3PBGA 3UXIA 3GUGA 2RDUA 4QSHA 2DSZA 2ZX8A 2CESA 3LOTA 2O7QA 2OPJA 2JQXA 4RJEA 1UH2A 2FVKA 1ZJBA 3CPGA 4MNKA 1YKWA 3GR4A 2YLLA 1EQCA 3MKCA 5E0FA 4Z2JA 5D02A 1HL8A 4PRWA 1ISVA 2ZVIA 2CLMA 4CKQA 4MB3A 4YCOA 4DI8A 3GY1A 1VC4A 1NFPA 1Z44A 5GJPA 1XL9A 2XM2A 3CEUA 2J8FA 4K2SA 4BQ5A 4WZHA 2YX0A 1H0GA 3NOEA 2QUNA 3GTIA 3S6DA 4EAYA 5FJJA 3LPFA 1SFTA 2X41A 3QF0A 5CPNA 1YYAA 3LS9A 1FY6A 1AH3A 4B3LA 4CD8A 3PAJA 2Y5EA 2VEKA 1F9CA 5EPDA 1Q6LA 2I9EA 3EOOA 3CQ0A 3NPUA 2CHNA 1JAEA 2ZWZA 1D7KA 1QW8A 3NL5A 5FESA 1MW0A 3M43A 3AALA 1XYLA 4L9ZA 3QZEA 3ZOAA 5I77A 1EKOA 4JQ4A 4OV9A 2XFFA 1W5OA 3LCLA 4C65A 3WK1A 3KCJA 3DBNA 1EO5A 1DYSA 2Z25A 2OLSA 3CO8A 1JULA 2FHBA 8XIMA 3LENA 3URQA 5GVJA 3C2EA 2A21A 2GVYA 1V77A 1ZBWA 1PBGA 3TQPA 3V0TA 3W1LA 3G22A 4H1ZA 2D2HA 1U83A 4UFHA 4DJED 3S83A 4J28A 2DY3A 4H8HA 5LSMA 4LYRA 3MJYA 4KESA 4HOXA 5FJTA 2CIPA 5CXPA 3RITA 4Y9MA 1ITCA 3QZ6A 3UCQA 4NNAA 3C2VA 3E1F1 1KCLA 1ICPA 4DI9A 4D1JA 4A3YA 1EUNA 1XGDA 5ABFB 1OM0A 4Q4RA 4JN7A 3RDKA 4GCXA 4BEUA 2C91A 1OD0A 1KXTA 2PDWA 1YLVA 2VEPA 5HWNA 2G95A 2X1UA 3CL6A 1WAUA 2DH3A 4OUEA 1KRCC 3W38A 3KCOA 1W1TA 1UA7A 2P1FA 4AZCB 3U57A 3HQNA 5HXMA 1YXDA 5I02A 1GT8A 4XKYA 3G8EA 5T9CE 3N9KA 3ZJ6A 4J2PA 4PEKA 4EXAA 1C9WA 1TJ1A 4ADUA 1H62A 7CGTA 1JZ4A 2CLHA 1T7LA 1QI2A 1L8NA 4DEFA 5LNWA 3KW3A 3IIOA 1X38A 5FEWA 1K1DA 2Y8KA 3M44A 4V1YA 1GOIA 4K37A 1UR8A 2E77A 4JCMA 3W7RA 4GXWA 5FJPA 3L4VA 1V51A 5I3FA 3CUZA 3HF3A 2FZDA 1UKSA 1F8MA 1BVWA 2L5HA 3MI6A 2GSHA 1UWQA 1RAKA 4JTRA 2I14A 4RE4A 2F8QA 1RD6A 3LHZA 3ZM8A 3WJSA 3SN4A 4LYQA 4PMJA 2XFYA 3Q67A 3HPZA 4LYKA 3BLIA 5L6UA 3N34A 2IQDA 1SO6A 1GZ1A 3IJDA 3GE7A 1RCXB 5CLTA 4BR1A 4JAWA 4AISA 4WJEA 4LNCA 5LNVA 2J13A 4HA1A 3FW6A 3TYBA 4Y2WA 4I6KA 3V5CA 3TEVA 2EPMX 3ATYA 3W3OA 4B9YA 2PBOA 4A8IA 4QTGA 1DIDA 4F8XA 3IJ9A 1MQRA 4IX2A 2VYOA 3IIZA 4C7FA 1V93A 3F7JA 1G4EA 2HTMA 1OF8A 1R3YA 6ENLA 4NHVA 2PUZA 4HZMA 1P6BA 2OXNA 2CCRA 2DPEA 4GIYA 3W2JA 3QQ0A 4GI4A 1VBJA 2PAJA 1P0DA 1UH4A 2HNHA 3FX4A 2W0UA 1ZLPA 1TV2A 4HU8A 3MS8A 3LHWA 3COTA 2X05A 1T8QA 4CNNA 3SFKA 2JIWA 3KL5A 1TPC1 1JPMA 2O92A 4NX0A 1ZAHA 4ZCWA 5CC5A 1PTDA 3VGEA 5D2YA 4UNLA 1EA9C 3O6DA 4KEMA 2WLZA 2ZZ2A 4MAVA 4UTTA 1C7TA 1PIIA 5HQMA 3QMSA 3GM8A 3P62A 3EX3A 4DJEA 2Z4GA 2QULA 3XIMA 4LVFA 1RXOB 5I0DA 1W5MA 3K1GA 4J40A 1AW5A 4GVGA 5ABEA 3THCA 3RM9A 1ZUAX 4QG8A 2Q3OA 1TUXA 4BCEA 2WM0A 3LI1A 4A22A 2BVDA 3LBOA 1RVKA 1R3WA 3M7SA 2VCBA 4XO7A 2DZXA 3TC7A 1OX5A 4HOWA 1DHPA 4XZLX 3TN5A 2VO5A 3W7DA 2XVPA 1FWSA 4K8EA 2FGBA 4Q33A 1IEXA 4JX6A 4PCSA 4O0ZA 1E0VA 1DJGA 3OVRA 1XBZA 3D0CA 3NEVA 1CXLA 4PSRA 3TQ0A 2GQ8A 3PWIA 1TPDA 3STFA 1HL9A 2XSBA 3WQ4A 2NT0A 3MI2A 4BZYA 3ZIZA 4DF2A 4WY0A 1Y5VA 2AAMA 3QR0A 3CUGA 3NWRA 4D6EA 3B4UA 4KCUA 1H1YA 4ZODA 3H7RA 1BYBA 1MXGA 1W17A 1DJNA 3INPA 2EPKX 4QISA 3REQB 4CU8A 2VC9A 1WX0A 1H09A 3NZQA 2G41A 2ONEA 1TB3A 5I6SA 1BKSA 4GX9A 4IL0A 4A2SA 3AFBA 8TIMA 4GZ7A 3K13A 3BMXA 1ZQ5A 4IMCA 3H2MA 1EYEA 4IMEA 1TA3A 2OQHA 3BSMA 3BL3A 4HSOA 4ZSUA 4F9DA 4AWSA 4M82A 3NZPA 4YPJA 3MCMA 1XIEA 4KH2A 4GYJA 3EOUA 3H4GA 5E9AA 3UR7A 3GZAA 7ENLA 2J25A 5E0KA 4PL2A 3T4WA 3O06A 1I1XA 4XAPA 1E0XA 2YB1A 1WZKA 2ZE0A 3EX6A 2ZBTA 1W3JA 4TXEA 1M5WA 1BWVA 3GC4A 1XC4A 3ARQA 2A6LA 4H9VA 3FLUA 2PWEA 1ZJAA 3WD0A 4ZBCA 1D3HA 3S5ZA 4FLQA 4O12A 2OYKA 3AMKA 5K4XA 1CGXA 5AHIA 1EC8A 1XLAA 4DO6A 1OZQA 1HJXA 3S2MA 4I6VA 4HK7A 3VX1A 1KFBA 3A4AA 3EKZA 5D2TA 1ESWA 4Q4MA 5I3DA 1LCOA 4UTHA 4QDPA 3DU0A 1EC9A 1E9LA 1DKWA 2JF7A 1KM0A 3MTWA 2JKPA 3PFRA 3KHDA 1QCWA 2GDUA 1RPKA 3CUHA 1DIKA 2OWCA 1WB0A 3PP7A 3WQ8A 3C0LA 4L7ZA 3QPYA 3M6YA 2Q6ZA 5PTDA 5A2CA 2IW0A 4PBEA 3PBYA 4UFJA 1LLOA 2XIJA 4CCEA 4N9EA 4C1LA 1AW2A 1OZMA 1GONA 5K9XA 3H53A 4CD7A 3H23A 3DYPA 1UD3A 2QS8A 3NR0A 3SSJA 3N6JA 4PBFA 4UMCA 2VNCA 4AQLA 2AL1A 2DIJA 2E67A 1P6WA 4UTIA 3W4RA 1YNPA 4E3VA 1J93A 2YCKX 2XIMA 3KRBA 2VZVA 1GVSA 4FPSA 5DFAA 5AC8A 2FTYA 3H2CA 3VE9A 5J5DA 2O9PA 3IWPA 2QZRA 1EGVA 4WY0B 1E0TA 2GUYA 1KR1A 2E68A 4O8RA 2QDEA 2EEXA 1X7IA 4R88A 2H3BA 1PYFA 1V6TA 1FWNA 3U5YA 2PURA 3NVTA 3UBPC 1W5NA 3AYRA 3RJXA 4OZOA 3H7UA 3T07A 3H2FA 1OFDA 3MB9A 4WKAA 4UTJA 1TPUA 1PEZA 2HMCA 2V5LA 4XAFA 1IEQA 2WO5A 2ZZ1A 1QO5A 1YW1A 2OQLA 3B0XA 4B2DD 5JXQA 3EB4A 4QDWA 1U5JA 3QKZA 1OSEA 5ABGA 5FEXA 1BLIA 1E9ZB 1KKRA 3JU2A 1A3HA 1FHUA 5FSEC 2IPGA 2PDYA 1XR2A 2WPBA 3SB0A 1T99A 4AMAA 3AISA 2WNQA 1OABA 3VC5A 1XGEA 1UKPA 5T26A 1PWMA 3A64A 3ITXA 4PB4A 3LCIA 2WJZA 3UWVA 1T8XA 1V0LA 4H6RA 2QIWA 2G5WA 1Z41A 4RNHA 4RL3A 4Y96A 5IBXC 5CLWA 3R4IA 2FVLA 1JQXA 5FI8A 2I9UA 2X09A 4DN1A 3PSVA 1M68A 3FEQA 2V30A 1EQPA 1HNYA 4X3ZA 3WQEA 1OK4A 1W1A1 1X39A 2FZBA 3VKJA 4KGLA 1SW7A 3VA8A 3R0KA 4P8WA 4J3UA 1F6KA 5LHFA 4PB3A 3RR4A 1BTCA 4GYPC 5CZ0A 1O7AA 3GBDA 1O12A 4LUYA 3R10A 2J9ZA 2BGSA 1HKIA 4DAIA 2YL8A 1R8LA 1MQQA 3WJYA 4KCVA 3WNMA 4IJRA 4KW2A 4D6DA 2YBTA 1EGZA 4EIVA 5BOFA 4PODA 1M3UA 4DJDD 4WDUA 2F2KA 2XISA 4HHLA 4W86A 4WUIA 3WLHA 2YL9A 3MZ2A 1FBAA 1MW2A 1QNSA 4GUJA 1HW6A 4XAYA 3BXWA 4I5UA 2PGRA 3U0HA 2CZDA 2ODOA 1NU5A 1LUCA 1WQ5A 1YIXA 3SJ3A 5LXEA 2I56A 3RHGA 3G1HA 2JKEA 4TO8A 3KE0A 3FYPA 1E15A 2ZC8A 4FLRA 5E6ZA 1BGAA 1KV8A 2OEMA 5HAOA 1B9BA 3VGDA 4U4MA 3UU0A 2QV5A 4W84A 1B0IA 2VFHA 1C91A 1F6YA 1GKPA 3FCPA 2CEQA 3CIXA 4JD4A 3BOLA 5D38A 2ZUTA 1UMYA 3FIGA 1DL3A 1XLLA 4D8ZA 4E38A 3W81A 3USZA 1E70M 1ZGDA 5K4ZA 4FIRA 3ARTA 4C6BA 4DBWA 2DDXA 2Z26A 2DT1A 1PE1A 1M7PA 5AYZA 2J77A 3OODA 4N0RA 1NJJA 5D8ZA 1Q2SA 1LRNA 3M0IA 1NWTA 4MLRA 2YCIX 2Z2AA 4IIGA 3EWXA 2Z6IA 4JTDA 1F3WA 5HQEA 4QJ5B 4AYSA 4B2DA 1DIEA 2EXOA 1H0IA 3AIRA 3E0FA 1E4MM 9XIAA 4U3AA 3R25A 3CHVA 1B54A 3MT1A 4WJ8A 2ZXDA 1Z69A 5IFPA 2XVNA 2GVLA 1VAHA 3FK4A 5C55A 3OBEA 4S2CA 1F8IA 3ZS4A 4FSAA 3QGAC 3WK2A 1D2KA 4FNQA 3G24A 3C3UA 1MDRA 3RRAA 4GIAA 1P7TB 3W7PA 3WDQA 1HO4A 4AIOA 3PZNA 4JIPA 2D2JA 1S2VA 2UY5A 5FF0A 4Z1AA 1TTIA 6PTDA 1UR4A 2J75A 3JZUA 1CPUA 3WCZA 1VJIA 1RBAA 1HGYA 1M65A 2Q8XA 3G3DA 2J6VA 2EJ1A 5KMYA 1Q6EA 2XWEA 1QUMA 3HGOA 4JGDA 3RPMA 1BXCA 2OKOA 5TBOA 4NJGA 1H41A 4V33A 3WO8A 1M41A 3GYCA 1QOQA 1S5WA 3SM0A 1T6MA 4MDOA 1SW0A 4WQ6A 1LUCB 3F2BA 1TWSA 3FKKA 5G2WA 2VD9A 4A3RA 5AHLA 1GQKA 2Y5SA 4UXDA 4Z0JA 3G77A 1FA2A 1H60A 4I5XA 4XZIA 1UPPA 4WVXA 4EPEC 2E6YA 1KTCA 3HPAA 2V3FA 4N6FA 4DAFA 2W5FA 2VM8A 1IZJA 3WELA 1Q6FA 3QV8A 3M47A 3SGUA 2OSWA 1W9VA 4Z1DA 2W67A 2WVSA 2VZOA 1D3CA 1VRDA 5JIPA 2BMBA 1QI0A 4R33A 5LIUX 1XRSA 4H01A 4C6OA 4I9MA 1JFHA 4DWSC 3N2MA 3WENA 2QDDA 1RR2A 4AMCA 1U22A 4GVFA 4R9OA 5H91A 3W7CA 4TIMA 1ZP3A 4GY1A 1E1CA 1ME7A 4IJCA 3QR1A 3VM7A 1DQXA 2ZRWA 3IVSA 1V02E 1XH1A 3WLJA 4B5VA 1G1YA 5HNRA 3NJ3A 3LGGA 4XX6A 1JDEA 4LU0A 4UTWC 1W3KA 3VIHA 4RZ6A 3GHTA 3ITCA 4LPCA 4XD5A 5B80A 4PUMA 2NUWA 1GOWA 1N55A 3LTSA 4PRRA 3QLDA 4EAMA 4O50A 2EG7A 3V0SA 3WQPA 5A95A 3NVDA 3CASA 3HG3A 4OU1A 3GNDA 4LV9A 3V1PA 3MBFA 4R5EA 2CITA 4W4QA 1CB7B 1FFQA 4INFA 2G0WA 2A3AA 4KRTA 3WQ6A 1RPXA 4E8CA 1NQKA 3SUWA 2YLAA 3MP3A 2VP8A 2QCDA 5IDIA 3WKZA 1BQCA 1R86A 1BRLA 3I7QA 4Q3MA 3W1TA 1JZ8A 2WQDA 4YNGA 2QUMA 3HMCA 4PCPA 3T40A 1EX1A 3OYXA 4P7RA 4DUVA 3PK7A 3UP8A 5D9MA 3HGSA 5AHEA 1H5YA 1YDNA 4LS0A 2FHCA 4A35A 2GPTA 5AZ0A 4LYPA 3DG6A 1EF3A 4DLFA 2OZ8A 1C8XA 5A8PA 1R47A 4A2RA 4XUYA 2WJFA 3FA3A 4QAIA 2VCAA 2W9MA 1YBQB 4WOQA 3T78A 4TQTA 2VELA 3KOXA 1GVYA 3LCWA 2XGIA 3KBSA 1GZJA 2GL5A 2HPMA 1QNVA 1XUUA 4M6UA 2FQIA 5HUPA 3UJ2A 5HINA 3ANYA 1VZWA 1AUSL 1HUVA 1MNSA 5LNRA 1F4AA 3QZAA 3EOSA 1EXBA 1RJPA 1UOKA 3AIVA 3W73A 1ZBVA 1ADSA 4ZZ9A 3MMDA 4QIUA 5DANA 2PD9A 2V67A 3VO0A 1NP0A 2XDFA 1CGVA 3SUSA 2QDHA 4KGJA 4J5NA 3HU7A 1W8SA 3QHOA 2VOTA 3EPOA 3KHJA 2ZZ6A 2ALRA 4HQVA 3MMWA 3IJ8A 1KV5A 2OO0A 2D0FA 4Y9NA 3UWZA 4O4WA 4HA0A 2SFPA 5FF7A 3RGTA 4ACZB 3W23A 4X9SA 2PODA 4K7YA 3A4XA 1MWOA 4IG2A 4QS5A 2LLEA 1RY0A 4WXZA 1JUEA 3HB9A 1YDOA 2YFNA 3E3HA 4J35A 1E1CB 4YWIA 2BY0A 3EGJA 4PN2A 4XV0A 1ZJHA 1DJXA 4JX4A 3GYEA 1GPWA 2WMHA 2ADAA 2FZ9A 3UR8A 2QCEA 1REQB 1CT5A 3M0JA 1ZJIA 2VVNA 1XP3A 3RPDA 2IKJA 4NZ4A 3A4JA 1AMYA 5LYRA 3RRXA 3UXDA 1EJTC 2VL4A 2QF8A 3Q2DA 4FLSA 1PX8A 3AICA 3CYVA 1O6IA 3VD5A 3QOMA 4KRUA 1L6FA 4GUFA 1O5QA 1XLFA 2XH0A 2ABAA 1S39A 4O1FA 1NEYA 2QCDB 1GW1A 1OX6A 2GOUA 4ES4A 3MHUA 3IGXA 2ZX7A 4IPJA 4HNLA 1FXQA 4JBRA 3PNZA 1KM2A 2ZUMA 2DSVA 1A5UA 4BEQA 5CC3A 3NOYA 1RHCA 3P2VA 4HYRA 1EHAA 1S1RA 5A6BA 1V3KA 3U2ZA 3G2GA 2NSXA 5HNUA 2CFFA 2ZRZA 3MUZ1 1X6LA 2TRSA 3DX5A 3MBDA 1XLMA 4FF5A 2Q8ZA 2D0HA 3L5MA 4O57A 2HK1A 3FXGA 1YDVA 4DRSA 5IHSA 2PDKA 1ZCCA 9RUBA 1GYNA 1SFSA 4RE0A 3Q94A 2YFOA 1E43A 1UROA 2XGBA 3O1NA 3V18A 1E3ZA 4AEOA 4LUTA 4MPKA 4H9YA 2OKTA 1G5AA 3AXMA 1UBPC 9XIMA 3N04A 1VFSA 4AW7A 1ONRA 4L5ZA 5DY2A 5DRIA 1L2UA 2HVOA 2IKHA 4L4OA 5BU6A 2IMRA 3BOXA 1V5XA 3UZ5A 1UWAA 4LS1A 2PRHA 3CZKA 2J7HA 4XTIA 3W7OA 3N14A 1F6PA 4QJ1A 5BOOA 4B9ZA 1SJCA 2CLOA 1UIOA 4MJMA 4YJ5A 1J9YA 2B7OA 2RGLA 3QYQA 3UG4A 2DZWA 4IH3A 1K8XA 1GQIA 1OC5A 2YCLB 4JTIA 1K7FA 1ISZA 4MWAD 1PHWA 3E74A 1F4HA 4H7ZA 2EJAA 2CYGA 1OADA 5A1AA 3GDBA 4YHGA 2WK2A 5BYWA 2ZXAA 4IIBA 3VPLA 4K38A 3R8HA 4YXGA 1E56A 1XUZA 1E9IA 1EOMA 2OWXA 2R94A 4FA3A 4J7RA 1CNVA 3LI0A 3AWNA 2YBUA 2C79A 4PMVA 4G1KA 4R34A 1W1VA 3NDOA 4V1XA 4OVXA 5IM51 1AG1O 1E4NA 2PTWA 3M5XA 1UH3A 4QEHA 3E6EA 5JMUA 4QS6A 1SZGA 3RO6A 3VKCA 1DHKA 1KM5A 1RP8A 4PMUA 4U2ZA 1W37A 3BLPX 1HFBA 3RU6A 1OX4A 1WP6A 3C5QA 4IPIA 3SRDA 1P6CA 1HP5A 2FJUB 4UC5A 1WA3A 4NRRA 5HULA 1QPOA 4RZ5A 1DWAM 3NURA 1AH0A 4GG9A 2C14A 4AHPA 3KP1A 2QNEA 1B3WA 2QCMA 1SO5A 2P8CA 4CNSA 4JTEA 1AFSA 1W8GA 3MUCA 4U5IA 3WQCA 2A4AA 1HT6A 4UQBA 3GTHA 3W7MA 1ADOA 3TLLA 3AUOA 1U2YA 3TZFA 3MCNA 1PV8A 5DY3A 1PS9A 1FTXA 3E2QA 1E1FA 2PS2A 2DW6A 3M5YA 2VGFA 1P0NA 4HNUA 1J2BA 2PSNA 1OFRA 3CHDA 2V0TA 1VEOA 3W26A 4GJ1A 3VIOA 3AWOA 4AUBA 4HT3A 3FXYA 3IV8A 4LAZA 4LUTB 3STPA 1M01A 3EX4A 1J79A 5HJYA 4NJIA 3DFYA 4GC4A 3IVUA 3L0GA 3TN6A 2FH8A 1DWHM 1PDYA 1UMLA 3IAQA 4GO9A 2R8WA 3URAA 3NL6A 2V82A 4BKNA 1JUKA 5L9FA 3O6AA 2FJKA 2VEMA 2J6XA 2V3GA 2QQ6A 3T0TA 1H50A 3TFXA 4LAUA 1K3UA 3U7BA 2VC7A 3CL8A 2F6XA 4F79A 2E8YA 4WCJA 3WMSA 3KX6A 1X6NA 2OX4A 3B0UX 2WMIA 3OEXA 4NYUA 4QJ3B 1RQBA 3OU8A 4RZ4A 2OR2A 3WDJA 1NWUA 3UGVA 3PZGA 4CUCA 3QFEA 4GH1A 2PC8A 4ZTXA 4WIWA 3W1AA 1K9FA 3T2PA 1TRDA 3OLDA 5JVLA 1XKYA 1H49A 4P8XA 3NXLA 2OLHA 4AZBA 2ZC1A 2B7PA 4MWAA 3VCCA 4QNWA 2OO6A 4F2TA 4G5DA 3L7RA 1Q65A 3SUTA 1Q3NA 1IEWA 3L4WA 4AEEA 3AHXA 3AS1A 4LWWA 2BVWA 4WDXA 5C9RA 3FA5A 4JQAA 3W82A 4A05A 2FYMA 2AOSA 2E9BA 2XIBA 4M24A 2PGEA 4US6A 4QRNA 1OX4B 1QHOA 3V1HA 4YVVA 5CG7A 2JGQA 3CTTA 2PDMA 2PBGA 3DFQA 2HPIA 3PPGA 3E2VA 2BHUA 5FJRA 1N8WA 4QCEA 4DYEA 2PDLA 3P84A 2DEPA 2NW0A 3QY8A 1AQHA 1UJPA 4JNZA 4GWEA 3U4AA 2QLYA 4CEUC 2CLFA 1VCFA 5HNNA 5CJMA 2ALDA 4AIUA 3KP0A 5HK4A 2NUXA 3R94A 4NAEA 2UY4A 3EDDA 2IPFA 3UR5A 3FAXA 5GNYA 4JL2A 3F4DA 3T2OA 3W1XA 3WF0A 5I3IA 2H8ZA 3CUIA 1K9TA 1IEIA 1CBGA 5CGTA 3W1MA 3NQBA 5AC4A 3B4YA 2O0TA 2WPGA 3VIMA 4CQCA 3LNPA 4IMGA 4M51A 1QOPA 4F0LA 4J27A 3ZO9A 4GX8A 3WDHA 4FMVA 3U7VA 3G1FA 3JS3A 1W3NA 3V5OA 2PDUA 2OMAA 1JNDA 1H11A 1XIDA 3ITTA 3HOJA 3FSUA 2OX1A 2BLEA 2PDFA 4GJJA 5DXXA 4NP7A 1QMLA 4O18A 3JW7A 3G1SA 3O7UA 2WMIB 2WCSA 3W2KA 3ZR5A 1I2QA 3SCUA 3W6LA 1RVGA 3BZGA 3WLPA 1AODA 1I60A 1WO2A 1OK6A 2D2GA 5CPQA 1JCXA 4ZQCA 4DY1A 3FOKA 1ENUA 4AC1X 3VIFA 1X8FA 3WBYA 4GMEA 3P82A 2FB3A 5D2VA 2ZWYA 2YCEA 4YTTA 4UCFA 4HZ7A 1OYAA 1K8CA 4R53A 4I8DA 5AYIA 4WKFA 1UJQA 2IPJA 4MWAB 4IWWA 2QXWA 3F5KA 1VENA 3RX4A 1O4UA 3VMPA 1W2VA 3G8RA 1V8EA 1J0HA 3DHFA 2XSXA 3BMWA 4RNFA 4H3DA 4W89A 7ODCA 3W01A 4QROA 4ERGA 5I3JA 2C7FA 2R6OA 1GQLA 3B06A 4ORMA 2GLKA 3PHAA 4D8LA 3E5PA 4BJHA 4DBEA 1W3LA 3LHYA 3GTNA 3K8LA 1J18A 2PDBA 3W86A 3EKLA 1XCWA 3FHQA 2Y85A 4WDWA 1W2PA 1FDZA 4IIEA 2ZKMX 3LD5A 1P5BA 3GW3A 1EC7A 3W6MA 5C7VA 5EB8A 2NV9A 2G96A 1B5TA 2ZX9A 1F2JA 5ENLA 6TIMA 1P4CA 1EJUC 2Q01A 3TSBA 1G7UA 3BVJA 1TE6A 1XH0A 2PCQA 3WLLA 1ICSA 1IIGA 3WLRA 4CN4A 3B3DA 1HVXA 2QCGA 2VD8A 4LBRA 4ZO8A 2VQUA 3CV6A 4NAEB 3GXIA 4B3KA 3TQVA 3OTRA 4YCPA 3W9ZA 1P48A 5G4EA 4OOUA 5BXPA 5BW6A 2NSOA 1UD5A 3QPEA 1EZWA 4QXIA 1E4IA 5SWUA 1WAWA 4MTVA 3VZXA 2CC0A 1QPQA 4V15A 4CQ8A 3W0KA 4KWVA 3SO7A 5F1UA 2VFDA 4TVUA 2DGAA 3BDKA 1Q6OA 2OSYA 4M56A 4B16A 3QFWA 1LQ2A 3T7VA 1B2YA 4GA8A 3W84A 5DCBA 3DAQA 4LCRA 4HBKA 2R1MA 2CETA 2WZHA 1DQUA 1JYWA 1A3XA 1NF0A 1TPWA 3BGJA 1BVNP 3BH4A 3VYLA 2DFAA 3ZZ1A 1DXFA 4JTJA 4C6KA 1VEPA 4JIRA 1EP1A 4MKSA 2CLIA 3BGGA 4CN6A 3DOPA 1XICA 3T1GA 3P8IA 1SZNA 1B90A 4NZJA 4PTXA 4JN8A 3BAXA 4LB4A 4JFVA 1VBHA 4QNEA 1KBJA 3BG3A 3U4FA 4M7TA 5AVNA 4D2JA 2F38A 3CLWA 2QCLA 3N4FA 1KGUA 4LS2A 4PUEA 3LPOA 4NRSA 3EKGA 1W31A 3ZJ8A 4C60A 1DJIA 1ZNNA 4DX3A 1Q85A 2OGJA 3LNMA 4NIRA 3DC0A 3WLNA 4A4AA 3MUIA 1V0MA 4GNKB 3HV9A 1TX2A 4BI7A 1V6WA 1VF8A 1PX4A 2ASHA 5AECA 2Z29A 2EAWA 1XWYA 1YADA 4BY3A 2A3EA 2G3IA 1KFLA 4LF2A 2PU1A 2A0NA 4H6KA 3QVQA 1A47A 5AC7A 4OE7A 2X0HA 1VLWA 4DYKA 1QPNA 5FF4A 3K8KA 4UTKA 2I5GA 3WD2A 5LGXA 3KRUA 3AI0A 4XBSA 3GFYA 2Z7KA 1FCQA 4OGZA 4C6JA 3W7IA 3S8HA 3MY9A 4RDVA 3BZJA 5EU9A 2E1WA 4HTYA 1DTUA 4MB1A 1W9PA 2VOMA 1E55A 3GG8A 3SJNA 3W1UA 4OV4A 1O60A 3UZZA 1HJQA 4HPJA 2BXVA 4ENLA 3RM8A 1EDGA 2XH2A 2BB0A 1MUWA 4OFCA 1ML1A 4HVXA 2Y6ZA 2I5IA 4GLEA 1I0DA 1V03A 4ICMA 5F2LA 1XBVA 4F40A 2V2HA 3J7HA 3PZTA 2P3ZA 1J8VA 4NG3A 2INFA 4ICNA 5EFFA 1DWFM 3H24A 3SCNA 1MEHA 2IQTA 2FPVA 4C1NA 1EO7A 3WNLA 2PTDA 1J4EA 3VNYA 4TV5A 4WY0F 4ERIA 2GWGA 3U2EA 5G2IA 3JRKA 3CJPA 4LUIA 5AC6A 3AC0A 2YBVA 4NJJA 3AXHA 2PWVA 1M6JA 4H83A 1BAGA 1QPKA 1TV8A 4C5YA 2JEQA 1FKXA 1Y5XA 1MNZA 1I6NA 2VXNA 3L21A 3SFWA 2DSWA 1ALDA 2PU0A 4JKLA 3GSMA 2DVUA 4DBSA 4PUDA 5HR6A 3HA1A 3EYPA 2CWNA 4RXFA 4ORIA 3EMQA 2TMDA 1W1IE 5A6TC 1CIUA 4LF1A 2C8NA 1LG1A 1YDYA 3GC5A 4PMXA 3TR9A 3K8MA 4YVPA 3SY1A 4YMZA 4HNCA 5LA2A 4DQWA 3W2LA 2IXVA 2V3EA 3S2CA 1E6PA 3HBLA 2V2DA 3TYAA 1Q6DA 3SQLA 3W7QA 4QCFA 4RPQA 3AZRA 3PTDA 4DZ5A 4AAJA 4F9JA 5C9ZA 2WVUA 2PDPA 3N3MA 3WQVA 1AJ2A 2X1TA 4B5UA 4HMCA 1WKFA 2G8ZA 5M5DA 2OB3A 5I78A 4LV4A 5I24A 3C2RA 1IGWA 3NFUA 1VJZA 2ZE3A 1MO0A 3M0YA 5DN1A 3SCRA 2R9RA 1UCWA 3KS6A 3GDTA 1Y8BA 5H2ZA 2EO7A 5E5CA 1I9CB 1UUQA 3WSUA 1XLHA 4LTSA 1KXHA 2WJEA 2QUVA 2ZICA 2WM1A 5TNVA 2Z2UA 4IP5A 5FCZA 1H7WA 1OGBA 3KLKA 2ICSA 3B0PA 1D7FA 3GQYA 3MHFA 3A24A 1B3ZA 1S1PA 1EJXC 3BLDA 3GXDA 1CZ1A 5HPCA 1FRBA 8XIAA 2XZ7A 3T0AA 5I2UA 4O10A 4AVFA 3UPMA 3ICJA 3ARZA 1SQ7A 1JUBA 5DXYA 3OGRA 2WC7A 3SAZA 3CH9A 3VILA 1VBGA 4MPQA 1JD9A 1TVPA 3GXFA 2Y7EA 3TTEA 2ZRUA 2YPIA 2JFEX 1IWBA 1YRRA 2VZSA 4CCDA 4DUXA 5CBIA 2UBPC 5CH9A 3QGVA 4S39A 3PZQA 2VR2A 4PMOA 3ONCA 5ABTA 4L1XA 4JPGA 3MW7A 3BJFA 2JKAA 3GXNA 1KWGA 2J7EA 1QK0A 5C2XA 4C1NB 3AZSA 3CQIA 3C3NA 3KEHA 3NQ7A 3SCSA 1SJBA 4FOUA 1EBGA 1IHIA 2A3HA 2GVEA 3BV7A 1KCXA 3G5EA 3ANVA 4ZQNA 3DCPA 2QUTA 1XYFA 2VMFA 3O6YX 1CENA 3DGRA 4GQGA 2FPTA 5F2GA 2QMJA 4GIRA 2C19A 3TK7A 2PRMA 2TAAA 1CTNA 1Q5MA 2FB2A 1K9DA 4TMCA 4MJ2A 1ECEA 4DNMA 4FP1A 5I3GA 3OGVA 2J88A 3GIPA 3PZMA 4Z1CA 4EF8A 5U4NA 1UOZA 2VX4A 4DF1A 4FR1A 1LM1A 5FF2A 1DXEA 1PHQA 3GKFA 2ON3A 5I3HA 4XG1A 1EPXA 3N2CA 4YYFA 5CPOA 4R3UA 3VGHA 2DU2A 3P74A 1PXGA 4UTLA 3W2NA 4RV3A 1GVFA 1H61A 4E4UA 1FP8A 2WMFA 1DIOA 1HJWA 1UZDA 5FJUA 2X7VA 3C0JA 4ZB2A 3N25A 1XSKA 1XRFA 5HBFA 4DZAA 1HX0A 1ISWA 2QGHA 1PCWA 4D6FA 1XIJA 3NL3A 5D2XA 3JR2A 3AUJA 1MXDA 3T05A 2ZFAA 1HJVA 1XRTA 3ZR6A 4PMQA 3ITYA 3P81A 3M41A 1JXJA 2NQJA 3MUAA 3CMJA 3CM4A 5G1TA 2J24A 3GNOA 1GVOA 4LAOA 3ZVHA 1L6WA 5C9WA 3H2AA 4FOKA 5TD4A 2PLKA 3CPUA 3F5JA 5XIMA 2C13A 3W25A 1NM9A 1NIUA 1WOAA 3CC1A 1XV8A 2NX3A 1J10A 1DJHA 2I1OA 1TQXA 4A6GA 4G7EA 2HS8A 1WDRA 2OOFA 2A3LA 1EGMA 4HSNA 1S5MA 4EK7A 3VD3A 1XINA 1H63A 2WNNA 1RA0A 2Y7DA 3WUEA 2X0YA 1XG3A 3HQPA 3GWQA 1N2VA 1PKNA 3KRSA 3NIYA 4HGXA 5IDZA 4GUIA 3V3WA 2MANA 1TJRA 1IZCA 1UP3A 4IPPA 3FKRA 3EOLA 1Z7AA 4ZE4A 3ZT5A 3ZT7A 4W9TA 4JKMA 2C0HA 3QM3A 4QSFA 4RPPA 3GH5A 1LROA 5FKYA 3HG4A 4D8AA 1UUMA 3TX9A 4M81A 4X2RA 1AQMA 3TONA 1K7EA 4KPLA 2XTKA 5T91A 4UFLA 4NILA 1E6XM 5LXXA 3PPHA 3MO7A 1POJA 4O53A 1YTEA 2WCAA 3QEZA 3LPGA 3L9CA 3OLGA 4JNYA 2POZA 4F0RA 3DG7A 4GFSA 1G01A 2XWDA 1K6WA 4BWLC 4M1RA 2WKJA 2XYLA 3WLKX 4Z1YA 3TYCA 3AS0A 3N15A 5H8UA 2PP3A 4RZBA 3VI2A 3MU7A 2NZLA 2PEVA 3NQGA 5CZKA 1WDDA 1XLCA 3TW6A 1TSIA 3QLLA 2BV9A 4N4QA 4EANA 4DF0A 3SQSA 3NPXA 1XX1A 3ITLA 3IIXA 3G1AA 3PJXA 1EXPA 2VFEA 3AIQA 4X60A 2UY2A 3UERA 4IFOA 1DP0A 3SCWA 4HCHA 1IXNA 1FWHC 1BFNA 3GU2A 3VNJA 3NM1A 1UQYA 1I1WA 2ZA3A 3L68A 3S1VA 3TTYA 1MRQA 1QOXA 4GZIA 5BRPA 2HVMA 4HU0A 3TYEA 2I5QA 1WKEA 2F84A 1JDFA 3VKAA 3U5UA 3CMGA 1FWDC 3KLLA 4LSBA 4B92A 2JALA 2VGIA 1R3SA 5F4WA 3W2UA 1HJUA 1US3A 4J3SA 4B90A 5ECVA 4XIMA 2A7NA 4P61A 1ME9A 2TPSA 1XG4A 4HYVA 5DT5A 4NNCA 1Q6GA 1U30A 1E4LA 3QY6A 5BNKA 1CI1A 3THQA 2IS7A 3NXFA 1KO0A 3BPWA 2Y89A 3TW9A 3VM5A 3NO5A 1I8JA 3BLLA 4AY7A 1TWZA 3PULA 1AMKA 1UP0A 1XM3A 4AB4A 1MZHA 1O95A 4KF1A 3TMQA 3PB0A 4HJFA 1FP9A 2R24A 4ZGYA 3M5VA 3IV3A 3QN3A 3YPIA 2P3EA 2Q8LA 3GLCA 1VCVA 1FWFC 3MC5A 3CB8A 4PA8A 2REQB 3EBVA 4JXCA 4J3WA 4OECA 3W2MA 1R7OA 2NX1A 3WH8A 1TMHA 4Y9OA 4D6HA 1R2SA 2AAAA 2F7FA 4F2BA 1YMYA 2JK2A 3B40A 2QT3A 3W7LA 5EFDA 3ALFA 6REQA 1BF2A 1B4EA 3HPFA 3TJ4A 2PDQA 1ZS2A 1S2WA 4L9YA 2X40A 3TP4A 4JKKA 4NSBA 4CEXC 2QCNA 4DO7A 4CVUA 3ELFA 5KZDA 2G3FA 1XW8A 5A6JA 4IIDA 5B7YA 1PUDA 4FNRA 1DEDA 4FXJA 1IT0A 1N82A 3PWAA 3W1NA 1BXBA 3AIWA 4H8VA 4W88A 1LL4A 1QATA 3LHVA 5BMXA 2C3ZA 2OEJA 5DRCA 2WV8A 1ONEA 3R58A 5F7UA 3TYDA 4L9XA 3RPTA 1ICQA 1OFQA 1VH7A 3L2LA 1Z48A 4IQEA 4GQRA 2YW4A 3HPSA 2DSKA 1XLDA 3IK2A 3MVTA 3B04A 3IPWA 3V0UA 3GVVA 3TA9A 3RLHA 5D37A 1EJWC 3BLFA 2RDWA 3DUGA 1VFTA 1RH9A 2EKGA 4MYXA 1E6NA 3VNMA 4ZENA 1F76A 3PJWA 1DWGM 1AK5A 4H41A 1YEYA 3HIJA 4ZQOA 1R30A 4KKXA 3S3GA 2MNRA 3R8GA 4JFSA 4M0XA 5CC7A 4QE5A 4ZOBA 3QYSA 1I2NA 5CGMA 3ARUA 4DWDA 4CLMA 3WNPA 1CLVA 2VVSA 5LIWX 3P8JA 2PDCA 3LQGA 4DB7A 3WK0A 2XPKA 1TYGA 5B7ZA 4LC6A 1VPXA 4L6HA 4WDTA 2PDHA 2DSUA 1LTDA 2C1HA 3STCA 1OBAA 2W62A 3G6LA 4LH8A 4YU1A 2NV1A 4FNSA 3MI3A 5A2BA 4HA4A 1BHGA 1A80A 3WBAA 3ERPA 3OVPA 2PC4A 1P1XA 4WKHA 2ACRA 3STEA 2VT0A 2Z7GA 1UIPA 3W75A 4LUJA 1W5QA 2OG9A 4PTNA 1E6RA 2OT1A 3PJTA 1GYLA 4JEJA 1LG2A 4C6DA 1YQ2A 2HV5A 1P0BA 2NT1A 9CGTA 4AZHA 1EF2A 3W1RA 4R27A 3VINA 4EOUA 2E3ZA 2E09A 2GK1A 1S2UA 2J78A 3WY1A 4YLWA 1TFVA 3SRHA 4LCSA 5E93A 4NYYA 3AU2A 1X6UA 4IICA 4RDZA 5C70A 1J5SA 1LP6A 3CHCA 5FEPA 6REQB 3ARWA 3V36A 3TOPA 5CG0A 3UYCA 4ROQA 1ISXA 2DIKA 5E09A 1M9HA 3WBEA 1TE1A 5GJNA 1IGSA 1VFMA 2B0MA 4UTTC 2RFGA 2O9OA 4UOQA 4WJXA 4UQDA 4JDYA 5BROA 4JTLA 3PUGA 3S42A 3OZOA 4IISA 1K03A 1XPYA 5E9XA 5IXEA 5JIWA 2ISSA 2Q3RA 1O5XA 4O16A 2OZTA 2OTDA 1M04A 2WOQA 4MUZA 3RFAA 3TSDA 4Q4PA 1QNPA 1PIFA 3GDRA 1MVYA 4PRTA 1TV3A 2YA1A 3ALGA 6ALDA 5I07A 1L6SA 3IARA 3PTQA 4GE8A 1ECQA 3BV4A 4H2HA 4I7UA 5TAOA 3VCRA 1AZ2A 3ABZA 3VOFA 5AYBA 3DKLA 1Q63A 5CPLA 1X96A 1KB3A 4M6QA 4JHOA 1K6AA 3ZMRA 2A6NA 2DUAA 3PSWA 3H55A 1A5BA 2EG6A 2NVCA 4PULA 3VZZA 3LTYA 3LHTA 3ABRA 3ES7A 1KLZA 4LVBA 1FWIC 2XN1A 2E40A 3W72A 4IIHA 3R11A 2BVTA 3MYPA 2J47A 3MHGA 2V3DA 3HGJA 3M4HA 4DPQA 4IJBA 4YTSA 1PKLA 1GJUA 3VNLA 1DE5A 3CLMA 2VFIA 4FHAA 1I75A 1OEPA 2CU0A 2YDRA 4O1CA 1QFEA 3FA4A 2C71A 3B9OA 3BW4A 2G3NA 7XIMA 3O16A 1I4NA 1XF0A 4UTFA 1U1UA 3WMCA 1K70A 3SUUA 5G5IA 3NYZA 4Y9AA 3PTMA 3K30A 5GPRA 3ZSSA 4Q4OA 4MFDA 4O15A 3GZ3A 3KTSA 1E1EA 3GFXA 4UOJA 2VR5A 1XSJA 4AH7A 3CK5A 1JD7A 1JPHA 2QAFA 3FS2A 1KW1A 1KFWA 2GK1B 1VFLA 1IZKA 4G2DA 1PO9A 1VBUA 1VGAA 5GNXA 3S0CA 2DQWA 4MZYA 1F74A 4W5ZA 4GQBA 5EYWA 1DWJM 1E5JA 1RZMA 3CZLA 1RCQA 3RCNA 1WDQA 1W1YA 1P0EA 1Q2RA 4REQA 2X0SA 4DO4A 3TA6A 1UA3A 3PBVA 4HK5A 2P88A 4PBGA 2BVYA 1I2RA 4PH6A 4WRHA 1JJKA 3KBWA 4HIBA 1FWGC 4MB5A 3UJRA 5FL1A 3LM7A 3HM7A 3BCFA 1MMFA 1V3LA 2Y63A 4BI6A 1R3RA 4DYJA 3BAKA 3QHNA 4FEZA 4HNVA 1PZ0A 2EPHA 2NLIA 2VGBA 5EMLA 3O3RA 4N7QA 5HMEA 2HE5A 4X63A 2OYLA 1U5VA 3PBMA 3VD4A 1Y0EA 4K6AA 1DJZA 2WMGA 3BW2A 5TQLA 1VIZA 2VFGA 3RMJA 3O2LA 1KM4A 2E5BA 2XFWA 1WE5A 5K7JA 3ARSA 3S9YA 2I57A 3BAYA 2X30A 1IT7A 4AY1A 3EEGA 5D32A 4HKPA 3RLVA 4Y90A 1TV7A 3DKJA 3R0DA 3GVQA 3G3MA 4O17A 1V6XA 4QG6A 3VNZA 4LEFA 5FA5A 2FFCA 4IQLA 3LEPA 1S46A 1Z32X 1G4SA 1XPGA 4TTUA 2ZDSA 3WQ5A 2VRKA 7TIMA 3LY0A 4K8GA 3LSBA 3WN6A 3N17A 1J96A 4Z2GA 3W37A 2QUUA 1G9HA 2IXUA 2A1YA 3CV1A 3LX9A 2YDAA 2CBUA 4RW5A 3WDIA 3I6EA 4I9AA 1FH8A 3KOZA 4DXXA 1V0KA 2J7BA 4JHZA 3W88A 3G6MA 1R6WA 3H2OA 4U28A 4G8TA 3CQKA 3TJIA 1X1OA 3G1VA 3L65A 1XDLA 4FXFA 3UETA 2C6QA 4JQ3A 5D4YA 1DBTA 1K4GA 3BWWA 4JTUA 4RNJA 2FZNA 4AVOA 3LHUA 1F61A 3LXBA 3M07A 5F4SA 1XSIA 3LDVA 1G0CA 3ARXA 4LAKA 3MYOA 3F03K 1ONXA 1XDMA 3WX7A 1J0KA 4GY0A 3A5VA 3IEBA 1UZ1A 3USBA 7REQA 4XKYB 2QYGA 1PJ9A 3N11A 3P61A 3OVQA 5E0CA 3CT7A 1EWDA 3TQKA 3M0ZA 2O7SA 3A47A 1R2TA 1B3YA 4QG9A 3N4AA 1OCBA 3BICA 5HJLA 2W3ZA 1C8YA 4Z42C 4REQB 4UMAA 1W9DM 1V79A 4BQ4A 2QKFA 3BTNA 1K02A 1SR0A 1C29A 1LRQA 2YGYA 5DLCA 4MZ8A 3UF9A 5AB3A 3G1XA 3CQJA 3LV5A 4R7JA 3ZLFA 1VHNA 3OP2A 3GK0A 3QMRA 3P5ZA 1A0EA 1K7XA 4HJWA 1LLZA 4E3TA 3ARPA 3K4AA 2P53A 4Q4KA 1JFXA 1HGWA 1KFJA 2P0OA 1TKKA 1SJDA 1J2WA 2ZX6A 4L4LA 3T0CA 3PBWA 1F3EA 2E6AA 2PTYA 3IK4A 4ROPA 5MHBA 4AF0A 2CXGA 4HMEA 3FHAA 3EEZA 3H21A 1SFJA 1KFCA 1Q13A 2BDQA 2H6RA 5CEWA 4UZSA 3S5YA 5C7HA 1EFZA 1MUMA 1H7RA 2EPNA 2JE8A 3F2DA 4NZ3A 2WANA 3SIMA 2E8ZA 3KVKA 4FX8A 3WDRA 1GOQA 1WNOA 1UR2A 4I8YA 3NG3A 5GNZA 5CSRA 1A5KC 5HANA 3ZJ7A 4HPNA 3A9IA 2UV8G 1FWBC 5HOSA 2YA0A 3QSTA 3I3DA 3S5OA 4A21A 1CECA 1P43A 3PPFA 3CT2A 3HTWA 4U3CA 2X8RA 1W1PA 3ECQA 2B7NA 1RLCL 3SW6A 3CV7A 3I3EA 2J7DA 3M46A 3I7SA 4P5UA 4I7WA 4IUGA 5JBEA 1L6GA 2WHMA 1W1B1 3OJGA 3E2SA 4U31A 1LWHA 3BGAA 2XIIA 4KERA 3E02A 3NPWA 1K8ZA 1WV2A 2KAUC 1TVNA 4N2YA 5AYYA 3W1PA 4WSJA 2DZSA 3KBMA 4N02A 4MAZA 1XD1A 1XC6A 2DORA 3MP5A 3WEZA 3TDFA 3V4BA 3DGBA 1EEPA 2GQ9A 3GNRA 3OIHA 1AD4A 1JNEA 3AIUA 4XZHA 5DBUA 3LBMA 1MXSA 3W7EA 3NUKA 3QXBA 3ZSTA 4G6CA 3I3BA 7REQB 3TR2A 3EWYA 3SBFA 1JRBA 1XKJA 3HG2A 1GOKA 1L6YA 3NTYA 5C9XA 2VENA 2NQ9A 1HN1A 2XVGA 2QF7A 3WH6A 1OG6A 2RDXA 4XISA 4D6CA 4XVEA 3NQ6A 3M0LA 4NNBA 3AXKA 2WKGA 4C7DA 3WZ0E 3HFYA 2BGQA 2Y0FA 1UKQA 3P93A 1H51A 2HS6A 3OVGA 4XBJA 3T0DA 1PL9A 3A21A 2W4XA 2ISVA 4ZMGA 1UWIA 2ATSA 3SCPA 2AGTA 1L8PA 1N8FA 1FXPA 1MW3A 4JFTA 1PZ1A 1OC6A 4HHMA 4L6DA 2C15A 2FHFA 1PWLA 3H7VA 5MKGA 1VYRA 2FTWA 4NX5A 3T2QA 4DO5A 4IT1A 3M6DA 1PIGA 1OJXA 4YVXA 4ZO9A 3WL0A 4AF0B 1B9ZA 4X2PA 1SR9A 5CJ5A 3L0NA 2QEZA 2V69A 4O1EA 4EP8C 4IGNA 2R1PA 3GDKA 1FHVA 2J9XA 3ORWA 3DBPA 2E25A 4U10A 1TA3B 4WSKA 4FS9A 4NXKA 3ME3A 2ZYFA 4JIHA 4DBDA 1LT8A 3RYSA 1CLKA 4UCGA 4J3XA 1OT2A 4DM2A 4KQNA 3MSGA 5EA9A 3UZXA 4XZBA 4XZMX 3T55A 4C6LA 3L23A 4XBKA 1SMAA 4WK9A 3AHTA 4W8BA 4IMDA 5U7SA 4F0KA 2GOKA 4WXYA 1C90A 4K1WA 1NH6A 2NLYA 4NUWA 4RDWA 2BTMA 4XD3A 3GG0A 2QPSA 5CC6A 1ONWA 3GU1A 3BQ6A 1EBHA 3RILA 4JR5A 2GGGA 1A4MA 4M7SA 4XB3A 4NVTA 1KKOA 2VC6A 1C8VA 3MPGA 2HQAA 3OHMB 3LPPA 4C6NA 2X42A 3KUMA 1S2TA 4P7NA 4IMFA 1QK2A 1C3FA 3W7KA 3PZ9A 2Z0IA 1O68A 3UJSA 1W3HA 4OJYA 4PYSA 3WYZA 5JU6A 2X1IA 3GB6A 1VD6A 4H2CA 4ASTA 4PUUA 3CXOA 4B5NA 1UZHA 3P60A 2ANUA 1VPYA 3UVIA 3Q45A 4EX4A 2VUYA 1R85A 8RUCA 1NFGA 1QDSA 2WQPA 3KRZA 4S38A 5KZ6A 1KM1A 2C16A 3RO8A 5CQ1A 3B0VC 1TV5A 2YR1A 4JFUA 3VGGA 4H8UA 1T40A 5I23A 1D3GA 3EA1A 1C9DA 3F2CA 2VDHA 3XISA 1V3IA 2GJXA 4AVNA 1SVDA 1EWEA 5FIPA 4H8NA 3GX9A 1KM6A 3C86A 4KT2A 3AXXA 4AD4A 4H9TA 2I17A 4O8AA 4D6GA 1L9WA 5G2HA 4C6EA 4JQ1A 2Z00A 3P80A 1RV8A 4DHGA 1Z89A 5EMUA 1KTNA 3CBWA 3TZNA 2JGYA 3TYUA 3FJ4A 4HA3A 4JY8A 3DHPA 4YYCA 1TIWA 5MKGB 4S3DA 2RKXA 3GNNA 3IGUA 3EA3A 1WXZA 1S2AA 1XFBA 3R2GA 2ABBA 4F48A 2VDIA 3U9IA 3KL3A 1D9EA 3ARYA 1ITXA 3L5AA 5M17A 4MNLA 4GYFA 3IJLA 4ZOAA 1R2RA 1HO1A 4GI8A 3WH5A 2DT0A 4CGTA 2PWFA 5DBTA 1TR9A 1VPQA 4JYEA 3LXCA 1JZ6A 3ATZA 5C71A 4W8AA 4ZSTA 3WLSA 3O07A 1D8CA 2X1SA 3N12A 1TTQA 5H6HA 1EDTA 5A8QA 3T09A 1E40A 4HOZA 3SADA 1NWSA 3S1XA 4DJFD 2Z1VA 3MCOA 5EY5A 4ACYA 2WKLA 3CZ8A 4PMRA 1BYDA 2IPWA 2ZTKA 4D1IA 2QR6A 5AY7A 2OZ0A 3OG2A 3UNDA 1HXJA 3TNBA 3WF2A 2J7CA 4LW7A 1IXQA 1CEOA 1J01A 1DVJA 3UXKA 3L4UA 5CSYA 3SEPA 3B05A 1JCTA 3ZR4A 2ZXQA 3CAKA 3R43A 4LT9A 4UQCA 1PTGA 1CX9A 2BNJA 3KAOA 1YTKA 1MI3A 2F9RA 2DIEA 3MMTA 2D20A 4UQ9A 1S5VA 3VIJA 4KEUA 2QJMA 1YXCA 3PPCA 3QHMA 3RX3A 1CB2A 4A3QA 2WSYA 3IUDA 3PNUA 3W7HA 1US2A 3WBXA 3CHFA 1KLYA 1ZFJA 2P0IA 4GXPA 2RDTA 4XQ6A 1JCLA 4ZB5A 4A8RA 1Y5WA 2Y5JA 3SRFA 4NXSA 2XSAA 3RK8A 3E0VA 5E1QA 2EG8A 2W6RA 4JCLA 4AD1A 1QTWA 3C4UA 4UTMA 5BWFA 3P14A 3RLGA 4GISA 4MIMA 4PR4A 1TZZA 3T8LA 3T08A 2HRWA 2HEJA 1VRXA 5HR7A 2EF9A 1QXLA 4E6MA 2P76A 3UEQA 4A29A 1CXEA 1ZCOA 2FLIA 1JCNA 3LB0A 3A22A 5CKSA 4DJDA 4ZVJA 2A2IA 7TAAA 2XIQA 3WLTA 4DM1A 3RJYA 2WW5A 4L65A 3O8AA 1MSSA 3FDGA 4RNIA 3NQ2A 5DELA 4UQEA 3AYTA 4FXRA 2X16A 5D9OA 3WUBA 3AJ7A 3H26A 4HK6A 2CBJA 1P0KA 1NELA 3LLXA 2WZIA 1DTNA 3UCDA 2J7FA 3NAVA 5FJOA 2AGKA 1S38A 4HN4A 4PMDA 2XJ7A 2Y24A 1VYSX 3OGSA 4HP5A 4GINA 4NU7A 4RR4A 3VIGA 3M7WA 5BU9A 1RY8A 3B8IA 1V02A 5A8OA 5HMDA 4XZNX 1VEMA 5A2AA 2ACSA 2AQOA 4DPPA 3OA5A 3KVMA 1F7BA 1FDJA 4MOZA 3VFLA 1QT1A 1CGYA 1S3TC 4K7VA 1LLWA 4PUNA 1LOSA 2O9TA 4WLCA 3TUUA 3O05A 2PZNA 3PUOA 1AW1A 2XVLA 1FWTA 3LQLA 4Y9PA 4CQ9A 2DT2A 1E71M 1JPKA 2DJLA 2ISFA 3R13A 4Q8VA 4RXGA 4AC7C 4GFIA 2PI6A 4GPNA 3KBVA 3W22A 3OZYA 4PCFA 2D24A 5BOEA 4M8UA 3UCCA 4AZ7A 3MV01 1X98A 5FEZA 4QE1A 2J27A 4FZIA 1H1NA 1GG0A 5G4WA 5LKYA 2OJPA 3F5LA 3DXIA 4LVAA 5C8BB 2P5NA 5EL1A 3H4XA 1KGXA 1FWWA 1LJYA 4UBPC 4DJFA 3UG8A 3LUTA 2AL2A 4XIAA 4XVDA 2DV0A 1A0CA 1KBKA 3MKVA 2INZA 1DORA 1Q7ZA 4RK8A 3EWDA 1FOBA 1NWRA 1NDZA 3TFCA 1G4PA 2GWNA 3TLQA 3HFTA 1JDAA 3CGTA 4AZCA 1XFCA 2CKSA 4J3VA 3B8TA 4W7VA 1S2CA 4LC8A 1UR0A 1V7YA 1XYZA 5C6MA 1FDYA 4DUOA 1IWAA 1GW9A 3C8FA 2KX9A 1YE4A 2PF0A 3I10A 1UG6A 4JS3A 3TCSA 1MFVA 1R87A 3VAVA 1Q45A 3UPWA 4H9ZA 1SW3A 2J9YA 3OBKA 3WK3A 3N6QA 1V3HA 3I6RA 3WEOA 3P67A 3MWCA 4S1FA 2YIHA 3UA4A 2WAGA 2CWXA 4P7OA 2GJPA 1UD8A 2ZZ5A 1ELSA 3IAPA 3ZWSA 1WDSA 4AYGA 1UD2A 3M0KA 5C2GA 4CQBA 2AMGA 3L4ZA 1QW7A 1UKTA 5JH2A 1QJWA 1JQVA 2RAGA 2XU2A 2V5JA 4IX0A 3H54A 3PUDA 1KCZA 4IXHA 3VXGA 1UKOA 3BAWA 5D03A 2RJGA 4PTVA 1GQNA 1GTEA 3LZ3A 1PB0A 3OA3A 5FACA 4E2VA 4DBUA 3L4TA 4AFYA 4L80A 4P7QA 4D72A 3K1DA 5XINA 4O11A 3ZLGA 1R46A 4JX5A 3UGRA 3NM3A 3SN0A 4NL1A 1HKKA 3UWUA 4CCZA 4OT7A 1IR2A 1JGMA 4J9JA 1AZ1A 3BLOA 2D3LA 4L61A 4GVHA 1J6PA 4JNMA 4AD2A 3WH7A 1I45A 3CAVA 1SM9A 1IQ8A 3DFSA 3C61A 3T8QA 1SSDA 3IACA 5HDRA 1UC4A 1CXKA 3TCEA 3APTA 4WF7A 3DN5A 1KFKA 1W0MA 4OKDA 3LU2A 1JCMP 4IHCA 1XH2A 1FH9A 2R1LA 3R12A 5CBJA 4IP4A 1Q7MA 3D6NA 5CZJA 1FWJC 1SGJA 3A3HA 2V5CA 3T42A 4B4FA 2TSYA 5DMYA 1OFEA 3DI1A 4XO6A 1UW9A 1BRLB 2AL2B 4DZHA 4ZO7A 4AXNA 3QTGA 4V27A 4I5RA 1LQ0A 5AZ1A 4Q8MA 1X1NA 3QBUA 3U6WA 3HQ1A 1W6TA 4S3EA 3N9SA 1UC5A 4OBRA 4MWAC 3WQFA 4S2BA 1QHZA 1VQTA 3VDHA 1WKDA 2NQLA 2X7WA 3S1UA 3UVAA 4H6QA 5F4XA 2GUUA 1TG7A 1YHTA 3PB2A 1G94A 3TXZA 1FWAC 1H2JA 1GVQA 4QQUA 3RCMA 1EUAA 1ZZMA 1UWUA 1BQGA 3DFPA 1RALA 1VHCA 4PMZA 3UYIA 4NI8A 1E73M 5GQBA 4JTHA 5A6LA 3GU9A 5C54A 5FL0A 2R1KA 2J74A 3S47A 3EXTA 4LY8A 3ABQA 2QPXA 3KOYA 2YSWA 1XYAA 4PMNA 4AZGA 2QJNA 4EXQA 2E5CA 2DZTA 2QAPA 1AVAA 4HZ8A 2Q09A 4XTDA 2MUCA 4U2YA 4LVGA 4JTSA 1JDDA 5HATA 4QEEA 2W91A 4GO8A 1SPQA 3UR2A 3REQA 4Q6XA 3M0XA 4QX4A 4I7VA 4UFKA 4TVDA 3KM8A 1XD0A 3MSYA 2E9MA 4U5KA 3ZLHA 4ZL1A 2Z2BA 4IOTA 3HJZA 5DCEA 3A6OA 4O0KA 4IG2B 2UZ9A 1ZAJA 2CW6A 3UWEA 1HQTA 3RM4A 3NQVA 4NKCA 4FR6A 3PZOA 4TVCA 3O0KA 1XIHA 5ECUA 1R38A 4LAMA 2PRLA 3GTFA 3LCHA 3C2OA 3GUWA 2ZRVA 1S5TA 4MFEA 3M64A 3QPZA 4X22A 5REQA 2GVGA 1GGOA 3T0BA 4CNOA 1Y7VA 3M16A 4P2VA 2WJDA 3NQEA 4RDYA 3LSCA 4BS0A 2CKRA 3VNIA 3BW3A 2CBIA 4HHHA 3IUHA 1F07A 1VR6A 3B8UA 3NQMA 2G3MA 3G18A 4KIRA 3LXAA 4UQAA 2YXXA 3CUJA 1BKHA 4JN6A 3DENA 1NOWA 1TPH1 4ZOEA 3POHA 1JYVA 1W5PA 2E5DA 2VURA 4PUWA 4O1BA 5BXSA 3EWCA 3KVLA 3KS5A 4PB5A 2XUCA 4Q8NA 3CZGA 1J0ZA 4QQ3A 1XYCA 3Q65A 2NQHA 1HG3A 3N13A 3ISIX 3UT0A 3W02A 1I0BA 3L2MA 2ZZ3A 2YDQA 5FAGA 3DHDA 3II1A 2P8BA 2R82A 2GYIA 2XN0A 2CZ5A 3B9AA 2VCCA 4XWUA 4Q8WA 3H8AA 4J4KA 2GDVA 1KXVA 4AD3A 5A69A 1XGZA 4ECLA 4C91A 4KEZA 3WLIA 2A5HA 3A9BA 3OZPA 5HA7A 2GGEA 2OSXA 2D3NA 2C1IA 2BX7A 3K5XA 2NVAA 4WX2A 3CV2A 3SN1A 2A3CA 2W92A 4EXBA 1GORA 3MDWA 4I9JA 3UD6A 4AWEA 5LIYX 1Z6KA 3QGKC 4QLJA 4YWSA 4H9UA 4CN1A 4NAFA 1V6YA 3SY5A 1UWTA 3DECA 2YYUA 4W8LA 1Q6RA 2WLYA 1GVRA 4Y7EA 4IUOA 4HN8A 1YNQA 1GZGA 5KTLA 4C6CA 5KINA 3C0SA 3T44A 4R7OA 3UFYA 1F3XA 2CLEA 2WVVA 2WYSA 2RH9A 3VDAA 3NYDA 4Y6GA 4MSSA 1VCGA 1AQFA 4G9PA 2OU4A 3GVRA 3PF3A 3UPBA 3N29A 1EJRC 5KETA 3PM6A 2ZDRA 4Y8EA 1YPXA 3FY1A 3EB2A 5KZEA 2ZOXA 1BGGA 3BQ5A 3BG5A 3NPVA 3LMYA 1QW9A 1W3TA 1KTBA 3WBWA 2V5KA 4KEVA 1Z8AA 3O63A 4Z0SA 5LA0A 1Q6QA 3THUA 4BA0A 1U1JA 2QDGA 3QW4B 4HPHA 3R7MA 1SUXA 4UB9A 1CGUA 1X8CA 1EP3A 3HGRA 1UASA 3APYA 3LV6A 1UPMB 5REQB 1R5YA 3WQGA 1ZPTA 5CSSA 2XGZA 4TR9A 3SZ8A 2G4FA 1CGTA 3VKKA 3OQEA 4MLJA 4O52A 1XQKA 2R91A 3QOKA 2E6DA 1BXNA 3VDCA 2PWHA 3NQDA 4X0VA 4JY9A 4O28A 3LA4A 1Y65A 4AWTA 2ZXBA 1IF2A 4L56A 3TE9A 2BG5A 1TZ9A 2Y8UA 2UWFA 4ERAA 1R0MA 3WMLA 4P8UA 1BEUA 1H7PA 3GO2A 4N9BA 2F6UA 1W91A 4C6MA 4GZJA 1B4KA 1DV7A 3UESA 4AU0A 2G97A 5HWMA 3EA2A 4YIWA 4Z2KA 3CUXA 5CZSA 3GHUA 4MNJA 4IL2A 3DIPA 1OCQA 2D23A 2XH4A 4XZWA 5C9UA 5I06A 1WBJA 4NF7A 4UR7A 3LTPA 4UOZA 2PP0A 4C6QA 5A8MA 4PCNA 1A5SA 3AMGA 3DYMA 4UNIA 3EOEA 4W7WA 5D09A 3A5FA 5HWJA 3FNDA 4Q7IA 2A7RA 4MADA 3WF4A 8A3HA 1GWJA 4Z17A 3BJTA 4H00A 1POKA 3NDZA 1WXYA 2BY2A 3S9IA 4NI3A 1A49A 5DCDA 5EMKA 3ZYZA 1VFFA 5JBDA 3E5BA 4ZFMA 5T8GA 4GYKA 4ILSA 3VNKA 2WHKA 1EJSC 3N19B 4MMWA 3TTQA 1PX3A 2XG9A 3GBEA 1JRCA 2BS9A 4NJKA 1BPLB 4BI5A 3KWXA 3I4EA 3TXVA 3WL1A 3SDOA 4NAFB 1NDVA 2BODX 2WVTA 1T96A 2YCJA 1UQZA 1OIFA 1MZRA 2A7PA 1ZHAA 3TWAA 4ADTA 2TODA 1IV8A 3P5YA 2V2CA 4H9MA 2UY3A 4QP0A 3QR3A 2ZTJA 5A6KA 2WVVB 4J3ZA 1PAMA 4XAZA 4IMAA 3ZFHA 2XN2A 1I2PA 4YTQA 3ARRA 1KXQA 2ZUWA 3E9AA 4PL1A 1EJVC 5HJXA 3UZYA 4LUSA 3FGCA 2WCGA 2HXTA 2CPUA 2Y61A 5D2WA 4Q7NA 3AMCA 2OLAA 4O19A 2PTXA 1RK5A 5LIXX 3A4WA 3BAJA 3CZEA 1RP9A 3AYVA 3AIEA 4WSHA 3KBNA 3LK6A 1JDCA 3UWQA 5A8GA 3SECA 4ONVA 1XS2A 1W9XA 2D0GA 4TX6A 3W7NA 4FNUA 3B8VA 3GIQA 1XLBA 4NT0A 4GBUA 4HNTA 1LL7A 3O6CA 4GRSA 4ML4A 1TWIA 3TYZA 3MJMA 1JPIA 2Z1WA 4N42A 3H22A 1JF5A 3DYOA 4Z1BA 2PFHA 3UZJA 1HZYA 4K39A 3S6TA 1XLIA 4X9YA 4US5D 4EE9A 4ZFCA 2HK0A 3CEPA 1NDYA 2DZVA 2WWDA 1TR1A 3C56A 4AZ5A 1ZALA 2AQWA 2OCZA 3H4WA 1UWSA 1H5VA 3NDYA 3VGBA 4BFAA 4ZOCA 1IT8A 4O54A 3PANA 2QCFA 1TIMA 4ATLA 1FH7A 4C90A 2RGMA 3H70A 2VUNA 4MKVA 1P7TA 3W83A 4WOZA 3VVGA 5CAHA 4P7LA 3UNTA 3HZ3A 2WWCA 3IGHX 4ZQRA 5BXTA 4Q8TA 4RV8A 4EACA 1OCJA 4NY2A 3EX2A 3OO2A 2XIOA 3VKDA 1DOSA 3H6OA 1SO4A 1M1BA 1WZLA 2Y62A 2XH7A 1J12A 1V0NA 2QPUA 1H7XA 3SRKA 2X1RA 3RG6A 2CLLA 2ZX5A 2QMKA 4XSMA 3NQAA 3GKAA 4HCDA 1HKMA 2VRJA 4F66A 4J3TA 2CXEA 1ZAIA 3GVGA 1K9EA 4C6PA 4LNYA 3PC0A 1JG9A 3PZUA 4ALDA 1WDWA 4RW3A 4GBDA 1VS1A 4XK2A 3IANA 1KGWA 3VNDA 1HKWA 3CL7A 1MEWA 4S3KA 3LYEA 4JQ2A 3DESA 4B15A 2J4GA 1G67A 3LERA 1UD6A 3NNTA 5CCZA 2VI0A 1OFAA 1GPFA 1ME8A 4LUSB 3FGCB 3N6HA 4QE4A 1TVLA 2GFTA 2PPGA 2XINA 3PAOA 2WHLA 2V8ZA 4V2XA 4MF4A 3WNOA 4TUFA 2GDQA 2PDIA 5FD0A 5GJMA 3VU2A 4S3AA 3KWSA 2WZEA 4CQAA 1JPDX 4FF7A 4GI6A 1FVPA 4JTTA 3LCXA 5I03A 3OPSA 1QR7A 4UZUA 1EPVA 1C8QA 1A5AA 4UWMA 1Z3NA 2CBVA 4LQ1A 1ZP4A 3QJAA 1RBLA 2IKGA 3A13A 3K46A 3L66A 1IIHA 1PKYA 1XLKA 3IJ7A 2YZRA 3L67A 4GKTA 4RKAA 4IFKA 2PE4A 2HISA 3DZ1A 1H4PA 1QI4A 4NJHA 1PVNA 3EWUA 1GJPA 1ODZA 1IR1A 4IQDA 3WJXA 3VIKA 4BK9A 1TX0A 3MV11 3W07A 1HIZA 1Q8AA 4US5A 5G1YA 3SGGA 5M2FX 3U8GA 4DZIA 3EZ4A 1HJSA 4JTGA 4GK8A 2PDXA 1TV4A 4LANA 3WJWA 1FHDA 2FKPA 2DP3A 1VKFA 3B8DA 3EB3A 2YW3A 1V7AA 3RXZA 7A3HA 4GKLA 4OTKA 4I3GA 3IJIA 4FI4A 3TMLA 3TJLA 1M03A 1YBQA 2W27A 1EOKA 4AEFA 1ZRQA 3EX1A 3WUGA 1LWIA 2V81A 2F2HA 1EIBA 3QH2A 4X61A 1TUFA 3SSZA 4GNVA 4ZQPA 1QNRA 3AZTA 1WZMA 1NOFA 4PGLA 2BZNA 3KTCA 5M3WA 3R0UA 2ZADA 2PZ0A 4EPKA 2ACUA 4KWUA 2BXYA 5EGRA 3R1ZA 1TWWA 2CHOA 1KD0A 1QPRA 4AZIA 4KETA 1M7OA 3CIWA 4IPLA 1QO2A 5D9NA 4GHRA 1CXIA 3MUY1 3AMLA 4EWND 3A3XA 5LNUA 1S3HA 1QVBA 2BOFX 1XIMA 4NZCA 2YA2A 2G3JA 4ACZA 1OYCA 4Z2HA 5IBXA 4K36A 4MHBA 1A5LC 3LMZA 4OQVA 3DI0A 4TMBA 3O15A 4YL2A 3LLFA 3V5FA 1U5HA 1OY0A 3PZVA 2ZZ7A 2BP1A 2OZ3A 4HTBA 2KZHA 2JF6A 3CWHA 3U2OA 3PG8A 3W6YA 5D04C 4JICA 1TPB1 2YZ5A 5FF3A 5XIAA 4HB7A 1AQ0A 4B5WA 4GACA 3S5NA 4GYPA 4LOCA 3DERA 2HBXA 3LGEA 8CGTA 3RAOA 3I68A 1E0UA 4XSLA 3VUSA 5BRBA 4H19A 1REQA 2WMKA 3EXSA 1VFHA 2EGZA 5A6AA 3BJSA 1RA5A 2CZFA 4QGCA 2PMQA 1JXKA 1YE6A 4G1NA 1K8YA 4IFKB 4HMDA 3NGFA 1W54A 1ZBKA 3PR2A 3MMUA 1R9YA 1VFOA 3M1ZA 2V5BA 3F4WA 4NQ1A 5F2IA 5A6BD 2ZRXA 3VDGA 4TV6A 4L4MA 3MSRA 2QJGA 1FWEC 6A3HA 3LRMA 5DMMA 5EMJA 3DFTA 1K4HA 2BASA 3KOFA 4LVDA 3FDKA 1PYMA 4DELA 5C2CA 2FIQA 4GD0A 5EKYA 3FEMA 1VIWA 5I09A 3BCJA 4DWSD 4QLLA 3KFTA 3UJFA 3N2TA 1GUVA 1IXOA 5BCAA 2VEIA 2PLMA 2QJJA 1TPVA 3GR8A 3I4KA 3W27A 3BURA 3S9ZA 4UMBA 4B3ZA 3NZRA 2O56A 4S3CA 1QASA 1E5NA 1VFUA 5A5WA 4OBTA 3W7GA 5D33A 4C6IA 1UYQA 3TW7A 3W87A 1YPIA 3ITOA 1OCNA 3TAKA 2PWUA 1XLGA 1JVNA 4AG0A 1KBBA 1UR1A 4UUIA 4EVZA 3MVIA 4F0SA 1XIGA 1WUEA 1TRIA 3R89A 2Z27A 5CPTA 4LXFA 2OELA 2NQ5A 3N9RA 4WGXA 3WG6A 2GQ3A 1AD1A 1HF6A 1KRMA 2VEGA 1QNQA 2NUYA 5T9BG 3WF3A 1CWYA 1WUFA 4ATDA 5TF0A 3RF9A 3RIKA 3E0LA 2FDMA 2VWSA 4LFYA 5DF0A 3C52A 3LN3A 4GQ0A 4F0HA 5D05A 4R7WA 2QJHA 2GGIA 3GXPA 4NASA 2VX7A 2YL6A 3OW1A 2YCLA 2XHYA 5E6YA 3AXIA 1TMQA 3LGDA 4TTGA 5KITA 5CPMA 1LBLA 2BY1A 4KFPA 2VGGA 3AOFA 2QJIA 4H4IA 3BSHA 4TX8A 3NSMA 3RN6A 3QV7A 1E3XA 3CWOX 3WNKA 1G69A 3T81A 2RHGA 4YS1A 3S4TA 4E8DA 5DMNA 4JL1A 3C2FA 3B9EA 3ES8A 4KCTA 3UG5A 3WIJA 2V6AA 1W9BM 3GVWA 3M0VA 1DQWA 1XLEA 1LDCA 2WZTA 1Z9AA 3THAA 1LL6A 3UG3A 4IQJA 3D3FA 3OHIA 1AJZA 3W00A 2QCHA 2GGHA 3E38A 1CXFA 3HN3A 4LB3A 4Q32A 2H8XA 1TPEA 1XISA 1GG1A 4OOZA 1UZ4A 4AWUA 4EF9A 3UY8A 5LA1A 3AU6A 4F0MA 3AMDA 4F2UA 1Q4WA 1GTHA 4URIA 4UNKA 1GNXA 3F4CA 3G1YA 1FCBA 5J5RA 1KM3A 3FYOA 5HQLA 2EKCA 2NWRA 3VKBA 1L2QA 4O4VA 4QHRA 3ZT6A 2PWGA 1I2OA 1ISYA 2A85A 2J62A 5J8LA 1BWKA 5M1TA 1QBAA 1LRTA 4ZE5A 2ZUNA 1NFBA 3ARVA 1OF6A 3ITGA 4I9TA 3L4YA 2ZQ0A 1GCYA 4XD6A 2Y7FA 3MZNA 4WR3A 3DFNA 5HNTA 2Y88A 3EAUA 4DWSA 4V28A 5AOUA 3PG9A 5A94A 3O9NA 3DHUA 3THDA 4L4PA 5CPSA 1MW1A 3LRKA 3PTKA 3S2NA 3HG5A 1WDPA 2EPOA 5AHMA 2QHAA 4TX9A 2WMJA 2WC4A 4BQ2A 5LGZA 5RUBA 3FJ6A 2Y4SA 3BSGA 1C93A 4K8HA 2W63A 3K4WA 4UTWA 2V38A 3ENLA 4JTAA 4A3HA 4R9XA 3B03A 3BLEA 5A8NA 4Z08A 3C0QA 5BZAA 2ZUUA 3RLUA 4FX7A 3EMZA 2FMNA 2DW7A 2POTA 1PZ2A 4H6EA 1PKMA 4O14A 5H8PA 1A5CA 1E51A 5F2MA 5FJIA 2IUZA 3TAOA 4HNOA 4B5TA 4BQ3A 4L1GA 1OIMA 3OG3A 1Q8JA