4DCQA

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
LVLTQSSSASFSLGASAKLTCTLNSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLLISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKKGNKFMASSFLHLTSDQWRSHQSFTCQVTHEGDTVEKSLSPALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 3B5H10 FAB Light Chain
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA01
4LQ1A 3FQNA 4YHYC 3MRIB 2Q76B 4N8CL 1VPOH 4JHWH 1NLDL 3D85A 2VE6B 3W2DL 4LSVH 1CT8A 2Y7QA 4G7YH 2HLFC 2RR3A 4NKIL 3BP5A 5F72S 1YJDC 2FRGP 1V3LA 4NJAH 5DRNB 4PY8J 4XRCB 3HZMA 3KXFE 3G9AB 3LKRA 5CKGA 4X8XA 12E8L 2P43B 4K9EC 4MAYB 5DHYB 4U1IA 5GJTL 1MCBA 3P9LB 5A16B 1E27A 1E4XL 2J8UE 4XVJH 4BH8B 5DVLA 5BV7C 2XZQH 4LCWD 4PRDB 1FE8L 3OQ3B 4F7CA 4PGEB 4X0KA 5MP6H 5I2IB 1NMCB 1I7UA 4WFHE 2D9CA 3QUZA 4XCFL 4KVNH 2OZ4A 2K3TA 4YHNA 2GK0B 3RY5A 4OQTL 4M3KB 1FFOB 3C60D 1U3HA 4G6JL 3F5WB 1L0QA 4HWBH 3MRRA 3M1BB 2NY5H 2C4FU 2R39A 5I0DA 4YDIH 4WTZA 4G6JH 2IGFH 4YJZL 3BHBA 3HN3A 3QJFB 4WHTB 4YX2L 2RCSH 1BEYL 1IQWL 5CP3H 1ZGLA 4M1CC 1J1OH 3QXTA 4IIQB 4HGKC 1IGMH 1X5LA 5EUOF 2HVKA 5GRUL 4EEEA 1QEWB 1A6VL 1RZJL 1ZHLB 2OLDA 3Q3GA 4PJGA 5HYJD 5ITFB 1MCWM 4M6ML 1WSST 4PPTA 1FAIL 4JPIB 1B0RB 4LIQH 5CBAB 5I1LB 3DBXB 5FDWB 1N5AB 3MOBL 2J6EH 2IJ0C 3CGTA 1WWWX 3DVFA 5E4EC 3DIFB 3QIWB 4WVRA 4NN7B 5FDYA 3KDMB 5DK3A 4NO5B 2LU7A 5C07A 5MI0C 1HILA 1CFQB 1EH9A 3Q6GL 1TETH 1M7DB 2BMKA 1OOAA 2AJSL 1MJUH 3ARDD 4HX1B 1DEDA 4X9FA 5D71H 4TULL 1VB9A 3T77B 4P2QD 2DKUA 2HJLB 3PP4L 1X9QA 3RWJA 1UCBH 2R2HA 1K2DB 5EO0B 5I1CL 3OGCA 1S7VA 3O6FC 1YMHA 2FEEI 4GAYA 1XR9A 3KPQB 1WC7A 4AT6B 4Y19B 1DQQB 3T2NL 4HUVB 4KTEH 4J4PC 3ECBB 3GJEA 2UY6A 1MLBA 3VWKB 3O3AA 4DK3A 2MFNA 3LMJH 3LN4A 3TGXA 3I6KA 1P2CA 5E2UL 2XV6B 3LIZL 1I1YB 2IWGA 1I1AD 1MF2L 1G9NC 1GOHA 2C4XA 1DJSA 1EHAA 2R9HC 4PJAE 5HI3D 1MNUH 5BS0B 4XP4H 5GS1C 2IPUG 5K9KA 1N7MH 2J3SA 5IVOA 1KXVC 2PETA 2VABB 1WCBB 5B39A 4LEXL 4U7KA 1BQUA 4Y4HB 3ULVH 4MQSB 5HPOA 5DJDA 3CMOH 4GSDH 1Y0LB 3VCLB 1BBJB 1NUGA 4JFQB 5JLZA 3DTXA 5DSCA 1F3RB 4DWHA 4RQQB 4JPWL 1LEGA 1MCRA 1GGBH 1X5KA 3MACH 5C0GA 1GPOL 3QR2A 2HN7B 1H3WM 4CDHA 2CKBB 1I9IH 1T1ZA 3MLUL 5KVGH 3SO3B 3L3JA 1KCRL 1OSPH 1EHLL 1FQ9C 1E4XI 1CGWA 4L1DA 5IBLD 2AJUL 4LVNB 1U8HA 3AREB 5BV7H 4DGVL 4LMQE 1MUJA 4MAYC 2VH5L 1A6ZB 4XPBL 3B4NA 5HPMA 5EBGA 2EDNA 3SDXA 1P5VA 2ESVD 4EIZC 4KTDH 3MNZB 4HIHA 1HWHB 4L8SA 1CL7L 5INCA 4CADA 3ZE0F 2APTA 5FM8A 4HC1H 3GFUA 4KHTH 1QTYT 4MD4A 1FG2B 2DDQL 5L2JA 3KLAA 4NBYB 4HWNA 4LPYA 1Q72L 1ONQA 3D2UB 1G6RB 3CSBA 4G9FD 2GK2A 3MV8E 3NAAH 5HHME 5DUBB 1RJZA 3VA6A 2RBLA 2ZSWB 4P3DB 2FSEB 1ZGLM 3PV6A 3I85A 2X6MA 4X5WA 4JDTL 1GAFL 4XX1G 1GOGA 4XNYL 3TCXA 4NCC1 4KVNL 3TPUA 4OZHF 1H0DB 1EJOH 5E6IC 4UDUB 4U31A 2FL5A 5KVMC 1HQ4B 1QBBA 2YKLL 4NZDA 1BX2A 4U1NA 4UQ3B 1CFSA 1IQWH 2B4CC 2ADIB 1CF8H 5CGYC 3KXFA 2GCYA 3SJVD 3V52L 3B2UC 4XPTH 1A4KA 4KJWD 3DV4A 3D18A 2OP4L 4L4TB 1F3DJ 1IL1A 3WFDH 1J86A 1ZHBA 3CFBB 2R1WA 4KUCD 5JIIA 1RJLB 1JF5A 3OJVC 3QIBC 4RMVA 1D5XB 2PW1A 5IMLA 3FJTA 4KJWC 3W0WB 1GSMA 2YA0A 2A6DB 1OM3L 3U46B 3CU7A 5ISZB 4KY1H 2DB8A 2NY3B 2X1OA 2I07A 1ZGLP 3EHBD 2MJWA 3R1GL 4F7EA 2R29L 1D9KC 1I85C 3KYAA 3U0WH 3IXTA 1V7ML 2CIKB 4F7MB 3G6JF 4X7DC 1S7VB 3QIBB 1I1CA 4XH2A 3G5YA 5E94B 2NXZB 4DN4L 2AJXH 4ZAKB 3MV9A 4XVUC 4XPBH 4M4PA 5DTFB 2NR6D 4MJIE 3FB5B 4WW1B 2K7QA 3WFCL 3PJSA 1TJGL 3HE6C 4XXDA 5F1SA 1DBBL 3UTTA 1JPGA 1KG0B 4AQOA 2I60L 4CRPA 2PUQT 3CVHA 3X14B 2AQ1A 3EOTH 1E6JH 4W4NA 5JORB 4YBHA 4QXUL 1FNGB 2H41A 4NNPH 5J11B 5GS0C 1CDCA 4JKPL 4PGJA 4LIQE 2CXGA 3WNMA 4EBQL 4I4WA 5EBMA 3Q6FA 2DD8L 5KN5A 2AEIT 4KU1A 3P77B 2A74A 3CAFA 1FGVH 4J1UB 1RU9H 1JZ5A 25C8L 3EGSA 3MMEB 1NCAL 5CMAA 1NCDH 2IBZY 3PWJA 1EERB 5GGQL 2ZWLT 1BF2A 3EZ8A 1XCTA 2HN7A 4LPUA 1A21A 2WQ8A 2G60H 3MUGA 1UJTA 4HC1A 5I74C 5SWZE 4G7VL 3O4LE 4CVWA 4HUKB 1MI5E 3MRJB 3RL2A 1U8KB 2QLVB 2R8SH 1JGEA 1OB1A 3O41B 1T5WB 3AS1A 3CX5K 3WEXB 1YNTA 5CILL 4F2MA 1I1AC 1BP3B 3VXRB 2R1YB 4OZGF 5C0DA 5CP7A 5MEPA 32C2A 3FQXB 4DVRL 2CH8A 4P2RE 4PB9L 4K3EH 3WLBA 3O6KH 3MLYH 4TPRH 2VZ3A 3PIQA 1MIMH 5KJRH 1WF5A 3JXAA 1FVEB 2NXYB 5LAXA 3MJ9H 1B4RA 4A6YA 4WTXA 4YPGB 5KVDL 4PS4L 3DLQR 5DHXB 2ZUWA 5H35B 1BFVH 4QY8A 2NY2B 2Q7NA 2V9QA 1QD0A 1DVFB 5ILTH 2HJKB 4I48A 3AY4A 3JV5A 4OIAA 3RNKB 4A2LA 1OF2A 3TIDB 2J6EL 2W38A 1A6AB 4PJ7B 1OAQH 3IKCB 2EDQA 4QRRB 2A0LD 1N4XH 3HPJB 5IBLC 1AJ7H 1GHFH 4Y4FD 1FZKB 3Q0HA 4JHAH 5L2KA 5C0RH 5IBTL 1HH9B 4JFFB 4IDJL 2VL4A 3B9KA 1IGML 4OQTA 1KB5L 3BWAB 1CGXA 1JWMA 3CPLA 2UZIH 1P6AB 3KXFB 3AXLB 1FZOB 2R2CA 2ITCB 3ARFB 1FG9C 2BX5A 5JPNA 1G9EA 2J88H 3BJLA 4D9QD 2R9HD 1N59A 3GIVB 2JCCE 3BVNA 3QI9B 3BKYH 1B0GA 1QFOA 1JF1A 4HKZB 4XBEH 5EUOB 5J3HC 2JJUA 2NYYC 3T3PF 3L95A 5IQ7H 3UYPA 2JB6A 3WIIH 2EYTA 3MLSL 3RGVD 1DBKH 2VDQH 2W65B 2VQUA 2CRYA 3JTTA 3MRKA 3RZCD 1AJ7L 1XGQB 5F7YC 5DHVB 5HI3C 1OAQL 3VFGL 4QXWA 1I3GH 4G6FB 4MLSA 4TSBH 5F7UA 2XZCL 5K9OB 1JHKH 3GK8H 3BP5B 4RAVA 4X99B 3WIHA 2IC2A 1FBIL 3NGBC 2YWYA 4N8VB 5E8EA 1CLOH 2XNAA 3U6RA 4MA7H 4DGYH 3X3FH 4OUOA 1YNKL 4BQCA 1D5ZB 2MQ0A 4NPYA 1BLNA 2HT2C 3QUZD 1H3PH 4N5UA 4NQDA 1LO2H 1YDPB 3MGTA 3ZT6A 3R1GH 2VUOA 3SDYL 2VO5A 3B5TA 4QHNB 4JJ5A 3P73A 4RISH 1HSAA 4WFGE 4LHUG 3RIAF 3QCTH 1J1XL 4Q2ZA 3MLXH 5DMYA 4OFYD 4U6VH 3QEQE 8CGTA 1GGUA 3J8F7 3V0VA 3E3QC 1GIGH 1UA6H 4UI2A 2YD2A 3F5WA 1JYWA 1KNOB 3ABZA 2BNRB 3P11H 4GRWF 3FQTA 2MOVA 3O11A 4PY8I 1NMBL 2OZ4L 3BQUB 5FUOL 4ZG1A 5F9WC 2QKIB 1A1OB 2H6PA 3S4SA 4ZDHB 4EQ3A 4I0PB 3S5LG 3P9MA 4L4VD 1MCFA 4J1UA 4JFHD 4RA3A 3HE6D 5EIIA 4FQCH 3CFCH 5IIEA 2DJUA 2BVOB 3W5NA 4XNXL 4APQA 2HVKB 4CUCA 1YEKL 4NKMB 1S3KL 3BPOB 4LVHB 4LHUD 4JN2A 3BZEA 1NBVH 2UVFA 4DFIA 4XNYH 4HHAB 1WQVT 4NQCE 4D0DA 3V5DB 3RHWF 1U8KA 3O3DB 3IJYA 5ACLA 1X5ZA 1QFUL 4F9LA 2ZG2A 1JCKA 4OGYL 1U6AH 3MUY1 2MHAA 2EH8H 3O2VL 1WBXA 4M8QB 3UP1A 1OAUH 4J7RA 3WD5H 3U1SH 5GRYA 4Q6IB 2Q86B 4LCUA 1PEZA 4K23H 4PJIA 3TT1H 2CDGA 3VFSB 4ESKA 3MGAA 5LAXB 3DX6B 4LASL 3ARFD 3KPPB 3HI1A 1EVTC 5E2VH 1FLRL 3DROB 5D9SA 3SOBL 3BYTA 4LPCA 4M43H 4MDIB 4X4ZA 5HDBF 1A6AA 4PJ7A 5HHVL 3IKCA 2WP3O 3MJ6A 4XAKD 5ALBL 3OKKA 2FHCA 2F53E 4Z7WE 4KRPB 4O58L 4BKLA 4NGHH 2FX8H 4F15B 5HVFB 4R96B 4X6DF 3RIFK 1P53A 5JW3H 1WISA 3SE3C 1X44A 4TNVF 4CDGC 2H32B 5HDQL 1J8KA 3RWGB 1W0VA 4KAQH 2QEJA 4NFDA 2CLZB 1DBJL 4RZCB 3VFUA 3VXUA 1VGEL 1VFBB 3MFFB 1JFQL 5TF1L 4JQIL 1HSBA 4NQXA 4PFEA 2NYYD 1DBMH 1YPZA 3BDBA 4NQVB 4MNGE 5SWSE 2W0FA 1FN4A 1UXSA 1M7XA 1DZBA 1U8LB 1FC2D 2W91A 2DLHA 3S37L 5EC1A 4QOKA 5EUKA 4C4KO 2NY7L 4HG4K 1LE5A 1KT2B 3MBED 4PLJC 5CBEA 5KSBF 1X4XA 4WW2A 2W0KA 1X7QA 3WS3A 3MFGB 3RKDD 3S36H 2A0LC 4M6AA 1RZFL 4XBEL 5EIVA 1A7OH 1IEHA 1BIIB 4Y4HD 2B1HL 2K1MA 4RWYL 1C1EL 4R9HA 3EDDA 1EEUA 1V5JA 1I75A 3IDNB 2I26N 4QF1A 3G6JB 1MCCA 4BELD 1WCQA 1IAIH 3P0GB 5D96B 5DZOA 5HYEA 5KS9B 4LGPB 4RWYH 2R2BA 3VJ6B 1GCFA 3BRGC 4GKZB 1AFVH 5F21B 1YUHA 2PO6B 2VN4A 3LPFA 3U30C 3LKOB 5DDHB 1AGBB 4HV8B 4IDLA 2MCPL 3Q5YA 4YUEL 3DVGB 3HC4L 5GGTA 3WDHA 3AFLA 4BSVA 3PL6D 3LKPB 1FL3A 1J18A 2ZUVA 1OT2A 3FO0H 2FEEL 4G6AC 2R0LL 3T0BA 5LGHL 2IANA 2QKIA 1WBZB 4PP1C 4WU7B 1HHKA 4OJFH 2X4RA 4R4ND 5F88B 2VMFA 3TIEA 5E2JA 8FABA 4E41D 2M1KA 4L3CA 1XGTA 4DVRH 1FL6A 5CJXC 5FA4A 2C4FT 2P5EB 1T2QH 2HTKD 5A2FA 5JOFB 1INQB 1AGFB 5JOPE 2AV7B 4FFVD 3W0WD 4NQCA 2DQUL 1NEZB 5D2NA 5C2BL 2APFA 3BW9B 2YN5A 2E9IA 4N0FB 4R3SB 1CFNA 4KKLD 1AQKH 2ICWA 5DRZA 4JRXA 3U4BL 1VERA 3JTSA 1P4BH 1RVFL 2HFEA 3G5ZB 5I1IL 2E6JA 4LCCB 3QHFL 4KJYB 1N5YL 4OAWA 4OZGB 4LF3A 1F90H 4PBXA 3ULVE 5GJTH 5HHPA 3GSNH 5I1GL 5L6YH 1S9XA 1HZHL 2I27N 5CKAA 2V2WA 1A47A 3NN8B 1TZHA 5HHOD 1MHHB 4L4VE 4JDZA 1FDLL 1TZGL 1WTLA 5I15L 3A6CH 4HK0B 1H15B 1OCWH 3NIGF 4QRPA 2ED7A 3ARDA 3RX8A 4DW2L 4NM4L 3B9EA 1NDGA 1Y6KR 2XTJE 3TF7C 2DQEL 5IV2B 1SJVA 1NCWH 2O5YH 3K2UL 3BP7A 4KROB 4RDQF 5D7LD 4G9FA 4XPAL 1W8OA 4PRPA 1ORQB 3TJHC 4ELKB 1HOCA 1BAFH 2BCKA 3MLXL 5IR1A 1PZUB 4KKCC 4HCRH 2DWDB 1JGUL 3IFPA 2A74B 3OBAA 5TFSL 1T7ZA 2DI8A 5IB5B 1UQSA 4MWFA 4YXLH 1DSFL 1HSBB 2AI0H 3BWUC 3EFFB 4NQXB 4I13B 1E4KC 4WHTA 2AJYL 4MXQC 2VIRA 4HX1A 2H2PC 5IOPB 1UZ8A 2LV4A 3WNPA 4X98A 1EGJL 2BXZA 1U2CA 2D7TL 3T1WA 5BZDB 4RFEA 1FSKB 4P5TB 3EYOB 3LN5A 3BT2L 2VR5A 1KELH 3G6AA 3SGJA 1ND0B 5KVFL 3EO0A 3D39B 3IJHB 1FAIH 4OLVL 3DMMC 5C0BE 1RD6A 4RGMC 3ZKMC 5BJTB 4U0RB 4M6NL 1YEEH 1T0NA 1Z9SA 1P7KB 4Y16B 4G80A 3I50L 1OLZA 3NFNA 4FQCL 5GS1B 4PP1D 1QNZH 3G6JA 4UILH 3LDBC 5T1LD 4P57B 3JV4B 5FGBA 1C12A 2VXQH 4F8TA 1AGEB 5GZNC 1UWGL 3RVTC 2GAZA 1LHZA 4UV7H 4JHZA 1JHLH 5DK2B 4AT6A 2EYRA 5CJ5A 5I76B 1ZT7B 4I48B 3H3KA 3VGAB 2R0ZH 5DJDB 4HLJA 3SHSA 5CFHA 5K33A 4JZOA 3WV0A 4HV8A 3E6HA 5C0IA 5F7DB 1BECA 1P7QD 5TE4L 1S8DB 3VXSB 3RVXD 1XGRB 3RL1B 3UO1L 4P2OD 3NCJH 1MSPA 4RQQA 2EYSA 1INDH 2AEQL 1MI5B 3S36L 3SDAA 2ID5A 4UT6L 1MREH 3TWCL 4F3FA 2DQIL 1P4LB 3L1OL 3O3EA 1IILE 2WLZA 4ONGL 3KYKH 1KEMH 3STZA 4WU7A 1FP5A 1S9WA 1F4YL 4PGEA 3TA3A 2Y9RT 1FCCA 1YNKH 4U6TA 1P9MA 3TN0C 5DJAA 5ICZA 3VD5A 5E4EB 2BOCB 4J3XA 3VI4E 1YMME 4H5SB 2YUWA 3I02B 2Z35B 2AJUH 4I0PD 5AWNH 3V95A 4HJGA 1QRKA 4I77L 5F9AC 1WIOA 2CJUH 1CTNA 1UB6B 3JTTB 4UILL 1HCFX 3M8OL 5C6TL 4KWUA 1G6RA 5DFWH 1BFOB 1WAAE 4PJCE 1TVHA 4P9MH 2UUDH 1UWXH 3EYFA 4OUUA 3CSYA 2QJDA 4R0LA 3VXPA 4FN0A 2OBGA 2M26A 1S9XB 5ALCH 3MNZA 4HIHB 1NCTA 1JNHA 4NPYB 1DFBL 5D1ZC 3QI9D 3LQZB 3V4VL 1S7XB 5IB4A 3VXRD 1QFWH 4F37F 3ARDB 1U93A 1MAML 3FONB 3C60B 5FHAL 4NWTL 3NIGE 4JZJB 1MH5B 2ZUUA 1Z3GH 3FT2A 1U3HD 5DGQA 3GGWB 2BNUB 5ISZE 4YHOH 1EEYB 1UC6A 4MYWB 4U1LB 2AKRB 3DUSB 5JW4N 3FOLB 4FXKA 3PHOA 1QFUH 2WINB 2A9NL 3F58L 3TJEH 2YRZA 4HF5L 4GAYB 2GTZA 5E8PA 1ZS8A 1X6LA 1JPSH 3VMNA 3VD3A 4ZO6A 4JM2F 3HNTH 3M45A 1I8KA 3MJ9L 2K7PA 4XP5H 2VDNH 5GGVH 2WQRA 2MSPA 2CMRH 4EUPB 1U9KA 3A6OA 1JWUB 4A2MA 1UH3A 5D71L 4ZQKB 2WANA 2MWCA 5D7JB 3HRZA 4OV6F 3IDUA 4XCEA 4LCWB 4WEMB 1RAMA 4XVSH 1CS6A 1WZKA 1OTTD 4CKVX 4XCCL 3N1PC 3MODH 3L3OB 3VWKD 2WIMA 5ITBL 3MNWA 2C1OA 4XP6L 5EZIH 3MR9A 1TITA 1CQKA 3QYCA 1XF2A 1NGYB 3HPLA 3VCLA 4OTXH 1IGTB 3GSOB 3JWNC 4KQ3L 4U1SB 1RHHA 4EQ2A 3BN3B 2X4OB 4CU8A 2HWZH 3QPXH 4KRPC 1OTTC 3GJFH 1E4JA 4X9GA 4F9PA 3VXMD 4O2FB 3G6JE 1ZTXL 2ZCHL 1YECH 1X6NA 1EEZA 5KSAC 4PRIA 4WI3A 3HZVA 4NO0B 4ODXB 3V6OA 1IEBB 3DXAE 4OB5H 3SGKC 3TVMB 5JR1L 1H9VA 4PG2A 4PG9B 2O61A 1UZ6F 3G5YB 5T1KD 2OP4H 3W11C 3U0WL 2XN9A 4LKXB 4RBPH 4M1GH 4O51A 3UJIL 4M9OA 4PRBB 4YE4H 4Q9CA 3ZKXC 4XZUB 1T3FA 4X7FC 1JNNL 3ROLB 5IJKA 1T5XA 2N56A 3PNWB 4HIEB 4FQPA 1CFBA 2AK4E 5KSAD 5MENE 1FAKT 2PCPB 4YO0A 4WU5A 4BJLA 5HHQB 5BO1H 2X05A 4HKJB 3MBXL 3BUYB 4MZ3A 4OZHB 3OV6A 1VGKB 5CGYD 4R2GC 1I7RA 4LAQL 4R26L 3KLAB 4WI5A 4M1DL 2NTSP 3UBXA 2A73A 5EZJB 1SJHB 2ZZUT 3WJJC 2HFGH 1X5HA 4OGXL 2D2OA 4FOMA 4OCYH 1KJ2B 5C0JB 4GKOA 4QYOA 1L7TL 4NQTA 2DLFH 2HRPH 1IM9D 1YN7A 2BSTA 4X9IA 4WY7L 5CMAB 3VWJB 3WN5C 3FQXA 2PXYB 1WICA 5DD6A 3KPRE 1MY5A 3O4LD 3GSRB 4PV8A 5EOCJ 2XG5A 1BX2B 4UQ3A 5T5NG 4O00A 1RK1B 3UTPD 1RZFH 2YA1A 4ZXBD 3VFMB 4YNYA 3QUKA 1HWGB 4M48H 4WHCA 1A0QH 4RMQA 5CEZH 3ARZA 3WFDL 5EA0L 1T4KA 3DI2B 2QHRH 5ENWB 1WLHA 5FO9A 1JUFB 4Q6YA 1Q8MA 4J6RH 3T2OA 3GMLA 5IB4B 4MS8D 3PIQB 1D5XA 1NC2A 5AUMA 3DJ9A 3CC5B 4FQ2L 4EI6A 4UB0L 5HBBA 1JWMB 3U46A 5JHDE 2PO6A 1LDPH 4IRSA 4JRYA 5KTEL 3ARGB 3O6ML 5CUSH 3CFJA 2AK1H 5ADOH 3V0AC 3IDXH 1G6RL 5F9JA 2D0GA 3MCKB 4U1LA 2AKRA 1B0GB 1DLFH 3HPJA 2GEEA 3FN3A 1JF1B 4H26B 2UZXB 2EDBA 4OCWL 3X3GL 4IRZL 4GW5B 1HH9A 4JFFA 2X42A 1TZIA 3GRWH 1IAII 2PW2A 1WT5C 3CXDH 3HUJB 3WFBL 2G5BB 3SKNA 5T5FH 3EJJX 2QQKH 4PREB 4L3EB 4L8CA 1JWUA 3BXNB 2HFTA 5I9QC 2EDKA 1UM5H 3NFPB 4LEXH 2ARWA 3JUYA 2BJMH 2FJGB 1DQDH 3BDYH 1QSVA 2FJFA 1D5ZA 2ZPKH 1P4IH 4LLDA 3E6FB 5CD5D 5H2BB 3WFEH 4AG4L 4Z6AT 3O45A 4IHOB 1O7VA 4G43B 4APQD 1BBDL 4ZPVB 2HFEB 1BVLA 4HKXA 1F2QA 3QUYA 4FQHB 4OAWB 3FN0H 3LKSB 4XNMB 5E00A 4QRSA 5C6TH 4KTEL 4JQXC 1KFAH 2DJSA 4M6MH 5HYFA 1KC5L 1ED3A 2VDPL 4E41B 3RX7A 2W0LA 2VZ1A 2FYYB 4PJ5A 3UAJD 2NQCA 1QZ1A 5CINL 3HZKA 1G84A 5FGSA 1S7WA 4ORZC 1JJUA 1BEYH 5IMMA 5IW6B 5E5UB 4M4RA 4LCYB 3SE4C 4ZUWB 3DXAA 3U36B 1IEAA 5DT1L 2AJSH 3EO9L 2OMNA 4KRLB 4LL9A 4ODHH 4NHUB 1HSAB 1CVRA 4HWBL 1F4YH 3BOVA 3C09B 1MFCL 1MCWW 2M8XA 4KMTL 3IJSA 4YHKH 1S9VA 5EUOE 5DR5H 2CSPA 3MJ7A 1G7PB 4L5FL 4AJ0A 1EGJA 4LBEA 2PXYC 3VXUE 5E6ZA 4WCYH 5FKAB 15C8L 1MCJA 4XP9H 2EDRA 3RAJH 3O11B 1N0LA 5CIPH 3ZKQD 3PQYD 3QWOB 1FNEA 1QHOA 3EFDL 1CICC 1O0VA 3GSUB 4UINL 4Z0XA 3EO1A 1RIVL 3NCYS 1HK6A 6FABL 1BFTA 3DVNA 4Y5XA 1RUAL 1M6OA 3GMPA 1F6AB 1BOGB 3EYVB 3VFVA 5DD5L 3OZ9H 2Z31B 5T3XH 5H8DA 3NGBB 1QO3B 2B4CH 2C5DC 2FO4B 4HS8H 2HFGL 5CEXB 4B41A 4L4VB 4RMTA 1QFWM 3EOAB 3RWFB 1TENA 3CVHH 4PGBA 2EXWC 2VR9A 3K4ZA 2NY3C 4JHWL 4P2RA 5CINH 1V7NH 4EJ1C 3C5ZB 4X6CA 2F8OA 3E2HC 5GS2D 1PLGL 4MAUH 2VYRE 3U7YL 5J13C 2XZQL 2Y07H 3U7AA 5HHVH 1EVUA 1MCKA 3WO4B 4ZTOH 1JGLH 1FL5B 5T3XD 3B2UD 4ONOA 1FLRH 1PKQB 3P4OB 2XPGB 4R4BB 1R3KB 1ETZA 1IGFL 4ODUB 4B50A 3MRKB 4ODSH 3UJTL 4BFBD 4KHTL 1OGAE 3RWGA 1LMKA 3UYRL 1EFQA 2DQFB 2P8PA 4JZOB 3BH9B 3ZKSD 1UJ3B 2WK2A 5DS8B 4OB5L 1T66C 1RJCA 1N64L 5F7DA 4LVHC 4G8IA 3RL1A 4JDVA 4KC3B 4JFEE 1E6OL 2UZIL 1B9ZA 3X13A 4GBXC 3QPXL 3AS3A 1IGYB 3CVIL 2HJFB 2YD8A 4K8RL 1U8LA 3MXWH 4TUKL 1IE5A 3F62A 3VFWB 1F4WL 5JXEC 1F4AA 5I17A 1S9YA 3C8KA 4X4MA 1DVFC 3BSZH 1JZ4A 3BYYA 5DEFA 1UM4L 4S2SA 3VE0A 3I6GA 1MPAL 3N85H 3IAQA 4M93B 4YDKL 5AAMA 2CLZA 4NM4H 1FFNA 5HGAB 3HR5A 2F5BL 5CEYA 2OXGA 5SWSD 4HUUB 5I16B 3PQYB 3S5LB 5J57B 1FDLH 1TZGH 2VL5A 3DO7B 5GSRA 5SWQA 4QF1B 1BPVA 4BSWB 3LZFL 3B8SA 2Q3AA 1ZEAH 1H5BC 3TV3H 2YSSB 5KS9A 4I0PA 2BERA 1D5IL 3N1QC 4PJAF 5IF0B 5FHBH 2ZUYA 3KYOA 1A9EB 3D85B 1MNUL 2AJVL 1OY3B 1Z9LA 4FFZH 5ICXA 5AG8A 4RGMB 3KAAA 5GGSB 3L9RB 1KELL 1H8OA 1P4IL 4M5YL 1VEMA 3MRFB 4DCQB 1UKTA 4MAYA 4LSRH 1IT9H 3QH3A 4LNRB 1HHGA 5IMMB 5IW6A 3H0TA 5A16A 2VLLB 5IG7B 5FK9A 1AI1H 4ZUSB 4KQ4H 1L0XA 1NCCL 3UTZA 1AXTL 2AVGA 3ALWA 3S88L 1G7IA 5ECJE 4NQEE 4YXLL 5BVPL 5SX4H 2DTSA 3BD4A 5HVHB 4CW1B 3L3KA 2WP3T 3DUSA 1XF5A 2DLFL 2CDGB 2OQJB 3DVGA 4Z7QF 3VFSA 3QA3B 4JR9H 5K9JH 5DURD 4Z95H 2CLVA 2WINA 3WIFB 4DN3H 1T7VA 4NNYB 1WJ3A 4X6DB 2AV7A 3SGEI 1N6VA 2HYMA 3GHEL 1U58B 2WIIA 3HNSH 1ZE3C 2XA3A 2IAMD 4U1MA 3DROA 4GLRI 3EOBB 1U8QA 2GYSA 1G7LB 1PG7H 3QSKB 2MNUA 1E6JL 1YJDH 5DO2D 2A77L 1KJ3L 3QJFA 4LHUA 2ICEA 4PGDB 5GS2H 1KTDA 4PYHA 2HLAB 1DBAH 5L9DL 4KJYA 2KZ1B 4MDJB 5ESVA 1OCWL 3OAZH 3PGDB 1NGWA 4G3YH 2AGJH 2FZ3B 5ICYA 4ZUUA 2IBBA 1J88A 4XNQA 1QRND 5DD5H 4YK4B 2NY3D 2OJEA 2B1HH 5KSBB 3KLSA 2YPLE 1KCSL 6FABH 5DRXA 2X7LA 4N0UA 4G8GE 4F15C 1IBGH 1PYWA 1RK0A 5IWLA 2V6HA 3N9GL 1S7TA 1AXSA 3X12A 3L5WA 4NQVA 2VLJE 2DBJA 4JM2D 4XMLH 4FNLL 4IIQC 1I85A 1MCSA 2E6PA 4PG9A 5IESH 1I7TB 4TSAL 2V2WB 4XBPB 1M05B 2E8ZA 2JIXD 1CE6B 3FCTB 4WY7H 1R6VA 5T1LB 4LU5L 3L7FB 5KVEH 4NRXA 1T3FB 3I6KB 5C6PB 2VXUH 1HN1A 2OCFD 1A22B 2YZ1A 4QCIA 3C5ZC 5ERWB 43C9A 2AGJL 1UQSB 4RSVA 1LO4L 2VC2L 3WDJA 1KPRA 1CXFA 2OTWA 1Q9KA 4JFED 4JAMB 5FYJU 5L9DH 1TLKA 4EVNA 4MXWH 3MREA 4OFYA 4D0CA 2H32H 3HUJF 4MVBC 5E9DB 1S5IL 4NYLA 1KF9B 1Z9MA 4EI5B 2I9TB 3PUCA 4HAGA 1FO0L 4QYOB 5C0NC 4HPOH 5KSUB 4JFQA 2AXGB 4Y16C 1EX0A 2LABA 5DJ0A 1S7UA 3GHEH 3KPNA 3MJ9A 4PJCF 5DI8A 5C9JA 3STLB 5IB5A 1X5XA 2QV2A 3DHMA 4LP4A 3DMMB 2AV1A 5C09B 5ELIA 3QT2A 1F11B 3KPMA 4OLXL 5C3TA 1OGAD 1XFPA 5JPMA 4P5MB 2FH8A 5F9WB 4WENB 1IC7L 3MGOB 4U6HA 1BGXH 4ODWA 1C1EH 3H7LA 4O4YL 3TIEB 5DQJA 15C8H 4NNPL 1A3RL 4JVWA 4MJIA 5HYSG 2F8VA 1G9NH 4FXGA 1P6FA 1MRDH 4Z7NE 3BN9C 1BREA 4DJMA 2V17H 5GS0L 5I1AA 3RNQA 1CZ8L 1KB5A 3ZDZE 5IFJA 2OX5A 5CWSB 4WWID 4ZTPH 3TLRA 3ARBB 3EIFA 1NBQA 3BW9A 1CCZA 1GC1L 5L2JB 1I8IA 3QQ9C 2J5LC 4OM1L 4R3SA 2X4QB 5FHBL 7FABL 2DWEB 2J2ZA 4MXVF 3ZTJG 3FOMB 1A14L 4N0UE 4F7TA 3FZUC 4Z5RA 5DK2A 4UOW1 3OGOE 3QNZB 4ZOBA 4HFWB 3FB8B 3NCEB 1MVUA 2UYLB 5C0AB 2YA2A 4LEOB 1DQLL 3L3KB 3ZE0E 4BZYA 2OZ4H 2Y6SD 4E0RB 5HGHA 3AY4C 1U8MB 2BNQD 5F6IC 3RPIA 5I1IH 1T1XA 4WTWA 3SKJL 4YGVB 3QG7L 4CGTA 1AQKL 1MI5A 2LU4A 1CFSB 5F7WC 1MRCH 3D69B 3LIZH 3IGAB 3RIAK 5IROA 3K4AA 4HCRA 1EV2E 5DD3H 1ZMYA 2DQIH 4PREA 4YDLC 1HI6A 3N0PB 4JFXB 1VFUA 1KCVL 1C5BL 3P0VH 4P2OC 2N1KA 5HVGB 3BGAA 3D6GA 1SM3H 2VLRE 5MEQA 3EYFB 3QEUB 1K3IA 3UTSD 4XT1C 4X80H 3DRQB 4GAJL 1ZANH 1UXWB 3RGHA 5CHNA 3ARTA 4M7LL 4XPGL 1Q38A 4XCYB 4WJ5B 3TFKC 4Y5VA 2ATPA 4XPFH 5M95B 4MMZC 4NQDE 2I07B 1UVQB 3VXRE 4PJ8D 3G6DH 1CI5A 1K8DA 5IFAL 1HINH 4DKDC 3ZKMD 3FO9A 3UDWA 3B9DA 1ZOXA 5JA9A 1IAMA 4OLVH 1IC5L 3RVWC 2VDRH 4G9DA 4HIJB 4ZAKA 4FQQA 4I5BA 4OFVA 2V2XB 5IM7A 2JCCF 5T5NF 3LQZA 1HH6A 5GRXG 3ALPA 5I1HH 4KPHL 2GUOA 5FOBB 2D0HA 2AJXL 2X4PB 2FIKA 5FYLL 1MHPH 3CIQA 3AROA 4X7SH 4JFYA 1GGTA 3GMOB 1KB9J 5D1ZB 4XCEB 4C4KT 1ZGLB 2XWBA 4OFIA 4PJXA 1RZIA 1DVFD 2Q87A 4LBEB 2H9GA 4UT7H 2H2PD 4BFIA 4LRIA 4UINH 1CDUA 2BC4B 5I66B 3WN5B 1QP1A 1ZT7A 1RI8A 5CSZA 3H7BA 5F8RC 2MQCA 3LS5H 4XNZC 2ZSVA 4JO2L 4IMKA 4S1QL 3OWEA 2VAAA 3QP3A 2VLKB 3NACH 5E2TH 4JFEA 3EGSB 1H5BB 1FYTA 3K74B 2EIBA 3V6BR 4NQCD 1MCEA 2R0WL 5ACZB 5F96H 3REWB 3C5ZD 1DANT 4BFEA 3U4EA 3QG6A 1KCUL 4FG6D 2B2XL 3HG1E 3OKNB 4JVUA 4J3SA 3RWDA 4BQ8A 3C9NA 4XPTL 4Y4KA 3WKML 3FHAA 4PTTB 3NA9H 4PLKC 3VWKC 5DUMH 1QR4A 3IKKA 1YMHB 4DGYL 1TQBC 1OB1B 2AJZA 3MR9B 5FGRA 5EWIH 4P5KA 4QWWD 5C09D 4NQUA 5I71B 4NZRH 1IC4L 4PJAB 5GRWA 1I3UA 2H26B 5IJVA 3MV7E 3L3IA 5E9DE 3DGGA 4NKOB 1G9ML 1J8HA 4K55A 2ERJB 4EOWH 1MLCA 5IHUL 1I1YA 4B53A 2YPLD 1JPFA 4OD3L 1BD2D 2W60B 1K4DB 3GBML 3WMSA 5E7FA 4OZHA 3FTGB 1RZGA 3G6DL 3HS0A 1A9BA 4PJ9A 4WI2A 3F12B 4XNUH 3O9WA 1S5HA 5GGTL 4KZDL 2PKDA 3BD5A 3ALXA 4Z5RB 4DAGH 1WIPA 4HJJH 3D0VA 3TT1L 3CFDA 3EDJA 1QA9B 3FB8A 1ORSB 2WWMC 1XH3A 2R23B 1Y0LA 4HCRL 3ROLA 4KZDH 1EA9C 3K8LA 3VI3F 4JFOB 1AQDA 4JHBA 4EI5D 1R24A 5DJ2B 3BIAX 3AM8C 1UB5A 4CMHC 4QHKJ 3OHXA 2YMXL 1QBLL 1G1CA 1GYAA 2DQCL 4HEME 3EYSL 3CPLB 1SEQH 1OARL 4JM2B 5IB3A 1WTGT 3STBA 4IOFD 3ARSA 1CR9L 2P8MA 3QDGD 2EDJA 3ZHDA 1GGBL 5DA0B 2IQAA 1FFNB 4OCXL 4K3DH 1EEYA 3LB6D 4ZSOE 2NW2B 3TV3L 4PBWD 4FXKB 1AD0B 5FO9B 1ES0B 1LDPL 3BE1H 4MA1B 5KOVC 4WUKH 3MX0A 1GGIL 3M1BA 5C0ND 2YEZA 1V7MH 2E9BA 2NY6C 3D85D 1PEWA 2F19L 4PJHB 4CN4A 1ONQB 4FFYH 2CIIB 2JJTC 3QUZC 4LCWE 4X83A 1LEKB 4EUPA 2IMMA 3ESUF 3AGVA 1T0MB 2BSSA 5K9OA 1HYSC 3QUKB 3WJLC 5D7JA 5ANMB 2AQ3A 1IZKA 4NZTL 4WGWB 4HMDA 4NKQB 4WFFE 1NLBL 2AAVA 1GGCH 1I1FA 3H9HB 5EA0H 3HNVH 2AJ3A 1A1NA 2FBJH 3I3DA 4P5TC 1Z3GL 3DV6A 3MNWB 1NAMA 5IQ9A 1HH6B 1RUPL 5IG7A 3QQ4A 2WUCH 2RB8A 3WNOA 1ITCA 4JZNB 3NCFB 5JO5B 4TUOB 2ADIA 1PSKH 4TVPD 3RVXC 3PHQB 3P30H 4PJBA 1Q1JH 5I30L 4ZFGL 3ORJA 2W9LA 2X2YA 2WBJC 3V0VB 3IRZA 4LVNC 2AABH 1TETL 5CCKL 1A4JA 4WV1C 3GO1L 4I2XE 5E56A 2PR4L 4GRLB 3S35X 1T22B 5CJOL 3PV7A 3ECBA 4WDIB 5CJ8A 5L2KD 5D1QA 4K9EL 4XC1H 3U7YH 4OCSH 4O9HL 2VLKA 5E03A 4HG4J 1P2CB 2A1WH 5IKCA 3IFOA 1PX4A 4NT6A 4PJCB 2Y5EA 2BNRD 1Q72H 4XBGA 3GJFB 4AH2B 4HKJA 4M62H 1KCKA 1VEOA 3ULVF 2D7NA 2XTJB 4XRCA 1RIUH 2ZOLB 1JTOA 3VGHA 4F57L 2EKJA 4ZUUB 3MCG1 5K9KB 3O8XA 4J4PA 1KIQB 3EYQC 3HI6H 1OP3H 5DEZA 4M61B 5HHMD 4MA1C 1CLZH 5FB8A 5DTFA 2IMNA 4MJ5B 2IPTL 3ILQD 4YR6B 3PJSB 3O45B 3VRJB 2Z91A 3DGGB 1NL0H 4NKOA 5JIKA 5C09E 5DC9B 3MBEC 4P2QB 4PLJD 5DD3L 4Z7NF 1QQDB 2WNGA 3F8UB 5HHOB 3T0EE 4OGYH 1EXUA 2BFVH 3N9GH 1PG7W 1BD2E 3MUJA 2Y36L 1YMMA 3F12A 3DSFH 5JQ6L 1S5HB 3MRLA 2ATKB 3UTSB 3GB7B 2EDHA 4K2UL 3VRLF 1OLLA 2P49B 3TO4D 5FO7A 4QHUB 4QWWC 2VE6A 3MV9E 3A6BL 4WEUD 1OAXL 2Q8AL 4IRJD 4AMKL 2Y23A 1DN0B 7FABH 4FQXD 3WHE0 1ZHNA 4I8DA 3BO8B 4ZO7A 1A6TA 1FSKC 3RU8H 1Q0XL 3MBEB 3OAUL 4QRPE 5I73C 5HHNA 3QEQB 4M03A 1MRDL 1XGYL 2ZCKH 5E6IB 1L7IL 2AEPH 5HYSA 2ZNWA 1P7QA 4ZFFB 5J1AA 4H1LA 3OKMB 5JZ7D 1OAZH 4HF5H 4NRYA 1VFBA 1NC4B 3MFFA 1G6VK 3INUH 1IFHL 3FT4A 3NAAL 4FXLA 5GS0D 1ZLWK 4K71B 5CEZE 3DVNB 4MNGB 1KN4L 2E7CA 5D5ME 4RISL 3TPUB 3C6LB 1U3JA 5GS3A 3VFVB 25C8H 4EN3A 4R8WL 1KN2H 1IAOB 4EBQH 2XPGA 2D31B 4UBDD 5LVEA 4LSSH 4C54A 1ZHKB 3BGMB 3MV7A 4HWBA 3OAZK 3WS3B 3V4UH 1TFHA 4ONFL 4OGZA 1B6DA 3MV8D 4K7FB 3SE8H 3QFJA 1BM3L 3LN4B 4JKPH 3C60C 4Y4FC 4JM4L 4KKNA 1FO0A 1IL1B 4IJ3C 4H20L 3MLTA 1AE6H 5T3ZL 3WIHH 1KUMA 4KHXH 2KQNA 3I3BA 4PJ8C 4MJID 4ZUVA 2C3XA 3GRWL 4BUGA 1YYML 5L2KB 2E7MA 3RZWA 4OI8A 2FJFB 2OTPA 5I6XB 4IRSD 5LG1A 1FFPB 1WIUA 2PW1B 3DMMD 2FGWL 2JCCB 1IVLA 2XZAL 4CMMB 3QHZL 3KYMB 3D3VB 2DQTL 4ZPVA 4G6AD 4FMFA 2SEBA 4TSCH 1FZOA 4I3SH 4ZPTA 3WXWH 1W72B 1AY1H 2CJUL 1W0YT 2Y7QB 1FFQA 2D3VA 1PGRB 3IFNL 1KCUH 4YXHL 4MGXA 5FECA 1A6UL 4MZ2A 1OP3K 1BJ1H 1FJ1B 1Z6JT 2BRRH 3HE7C 3S5LA 4Q9QH 5DRWB 4OGAC 3QIBA 1OPGL 3MRBA 1MJJB 2A83A 2BHUA 1WK0A 1RZKL 4LK4A 4YBQC 4ZUWA 1RULL 3BPNC 2NY6B 5E2WL 5DMKB 5F7MC 1NDMB 2HT2D 4XCFH 4PR5A 1UWXK 1INDL 4OZGE 2EZ0C 1I9EA 5TDPA 3MXWL 1BF8A 4Y2OA 4TTDD 2QADD 3GMQA 3F7VA 1H3PL 3P4NA 4PJBE 1AGFA 5DVKA 3MLVH 5I16A 3C5JA 4MD0A 3TN0A 3A67L 3WSQL 4DZBB 5F9OH 1NKRA 4X6EB 3QH3B 1KYOK 3QXDB 2JJSA 1FG2A 4JO4L 4Y5YC 1FBIH 1N0XL 4Y5VB 3LV3A 4FQXC 3LSOB 4QNPF 4P59H 2NNAB 4JPKH 1PZ5B 4Z0XB 4ZFOA 1IC5H 1QRNE 1FIGL 2P47B 3BQUC 4GBXB 5JXED 4D8PB 2NY2C 5I71C 3JWDH 4M00A 5HHOA 1I8MB 3K0WA 5GZND 5DYOB 1AD9A 2Z8WC 3I6LE 3RDTB 4L9LB 2EH7H 5D5MA 4OCLC 3GHBL 1PLGH 3QIUA 1DQJB 1CR9H 2FL5B 3BJ91 3OJ2C 3ZE2F 3TH3T 3KHOA 2GITB 5E8OA 4D9QE 5B38G 4NO2A 2G60L 3DIFA 3QIWA 5C0CE 3LKNB 3TBWB 3CVHL 3QO0A 5SV3A 1HDMB 5E8DL 1QLEH 3HZYB 4DGIL 3OX8B 5CP7B 5MEPB 5T3XL 3D18B 5GRVK 4JFHE 2ORBH 4NKMA 3V4PL 1A7OL 5KS9E 4Z76B 2QQNH 4K94H 4KXZI 2FLBT 5HI5D 1RY7B 4LP5A 1J0ZA 5C07E 2YPVH 2BNRE 1F58H 1T83A 3FT3A 4M7KL 1BAFL 3H9SB 1LE9B 1I1AA 2F54E 3DYOA 4OKDA 4JFFD 5DRXB 2EXWD 2GTWA 2KL6A 3KLHD 4RBPK 3FT4B 2DOCA 2FD6H 1NH6A 4LHUB 4Z7UB 4ZNEE 5ID0B 2NY6D 2QTEA 1FH5L 2HA1A 3KXFD 3SJVA 2R69L 1C16B 2XI9A 3PWLB 5D1XA 4NZUL 4P2RD 4Y4KB 5TQ0L 4L1HA 4OIIL 4WFHD 1U2HA 3BN9D 4HD9A 3DX6A 5I73B 1JE6A 3UROR 4BUHA 2DS4A 2APWA 2LVEA 1RV6X 4GW1B 1IM9A 3LOWA 1U8IA 3CFCL 4WWKD 3ZE1E 4GKSB 3VI3E 1JTPA 3BPNB 5GZOC 1CGUA 4QCIB 2N7BA 3TEUA 2IPKA 3V6ZB 4QT5B 5FUOH 3QFJE 1NPUA 1ZWIA 4WWKA 1BVKA 2VL5B 3QNYB 3JV4A 2VDMH 3EJYD 3W9EB 3LKQB 4JM2C 4R96A 2EC8A 4M9PA 4OD1L 5E99H 2VXVH 1I7TA 4XBPA 1YEIL 5I76A 1S7RB 2DQUH 5C08E 5B38B 4EI5A 4FZEH 4PJ9D 3SDDD 5BQ7B 3KJ4C 4WI8A 4ODTL 1BJ1J 43C9B 3H9YA 1II4E 3MRMB 5L7XL 5DRWA 5LKNA 5MEOB 2HG5A 2P46B 1KPRB 4LSTH 5IJKC 4HULB 5GGTH 3MRBB 5IP4A 1MHPL 2YD6A 4KFZC 5JPMB 2EKSA 1XIWD 1FO0H 4V1DB 1G9MC 4JFZH 4RIRA 4ALAL 2ICWJ 5ADPH 2NZ9C 1YDPA 3BDXA 4L3EE 4OD3H 3NA4A 5HJ3A 3GK8L 4NYLB 3SDXE 5DURB 4NC0B 5B3JF 2X1QA 4OT1H 1A7QL 3WJJA 2D4FA 5JMOC 4EXKA 5BS0D 4L4JA 1L6XA 5JXAH 4PLKD 1RZ7L 4K7PL 2H8PB 4L9DA 4ODVH 1Z5LA 4U1NB 1ACYH 2VLRD 2EEBA 3CJJA 1DSFH 4N90D 3QCVL 2HT3D 2VLME 1LEKA 4QY8B 1MY7A 5C92A 4XCNA 5IIEB 2R4RL 2PF6A 1J12A 1GIGL 1UA6L 3L6FB 3VW3L 4L9LA 4EDWH 1LWRA 3ULUL 2G75B 3OPZL 4R7NB 5E99L 3I6LD 5D6CA 1D6VH 1FE8H 3MNVA 4LHQB 3DV6B 1J0JA 5CEZL 1T80A 3EAKA 4JHAL 5HD8C 2QQLH 3HAEH 3ZT7A 3GSVA 4ERSH 4K94C 3KR3H 1K6QH 1V05A 1EZVX 1JGEB 3O41A 3TNMB 1ZA6A 3LY6A 1BOYA 4ONHB 4ZNCD 3C09C 4F7CB 2NY1B 2P4AB 1TNNA 1B2WH 3MRPA 5D7KD 2FBOJ 5I15H 3IXTB 4DUWA 4P2QE 4LCUB 3C2AH 3EZJB 1R5VB 2BK8A 5D1QD 1XAUA 4XH2B 3WXWL 4OGAD 1NLDH 3UTQB 3HI1B 1AKJB 4JKWA 4FG6C 2OR8A 3U0PA 4WI6A 1RZ8A 1CFNB 3QWRD 2D7QA 3W0WE 2FGWH 4NP4H 5I18L 5HHXL 4YHPA 2JKXA 4Y1AB 2GY7B 1JI1A 5DLML 2YPKA 3HE7D 4MNHA 4HIXH 1AR1D 1U91A 5TPWH 5D7SH 5IFHL 4OZGA 5C2BH 3QDJB 1QSEE 1MCPH 1JPST 5TDNB 3QRFM 1CU4H 1NBZB 5LGJB 1W72H 1CXLA 2Y72A 3NMEA 5DVNA 2NTFA 3NIDE 4FQQB 4I5BB 3B9VA 3PDGA 1BLNB 3ETBF 3GMNB 1T20B 1NCDL 3IFNH 3VRJA 2Z91B 5ID1B 5BV7L 1KULA 3NCCB 2X40A 1G7JB 4U3CA 2ZG1A 4LASH 4KDTC 1N59B 4M5YH 3MCLH 1ZWIB 3KHQA 5L88L 1BJMA 1MCDA 5EU7E 1KACB 1UH2A 3RVVD 3M07A 4AEHH 3QDMA 2AXFA 2BY3A 1RZIB 2HWZL 1DLHB 1EDQA 1KPUA 5C86A 2ZKHL 4MSWB 2CGRL 4FFWC 4JY5L 2VQTA 4FTVB 4MB5A 1X5GA 4YHML 4G6KH 1YN6A 1T5WA 2VB5A 1FVDB 4MHHG 4O2CA 3BAEH 1A6VH 1RZJH 4ZDHA 5C0CA 3O3AB 3ULVD 5KJRL 2DMBA 4JY4A 3S98A 4O4YH 2VWEE 4P59L 4XAWL 1BZ9A 4DW2H 2KDGA 3O6KL 5KSVB 4LSSL 5FO8A 4PRNA 1S78C 1UH4A 4PJ5E 5C0CD 1A14H 1SMAA 1UZ8B 4LLWA 3D9AH 5JTWA 5JW4R 4TUJB 4IJ3B 4V1DA 3QEHB 3IDJA 1N8ZA 3L5IA 1TJHL 2B0SH 3PWPA 2ESVB 1QSFB 3VH8G 5D2NE 4CVXA 3VJ6A 3EYOA 1P7QB 2VZUA 4G42B 1KENH 1YC7A 3D39A 5D7LE 3REVA 1T04A 3PWPD 5C0AA 3TJHD 3BZFA 2IALA 2NX5E 1T0NB 4MQXC 3ET9F 1KPVA 1I1RA 5JLZB 1FYTB 5E1AB 3VWJA 2WBWB 1VKXA 1T66D 3D39D 1ZT4A 4EDXA 5E9DD 4A6YL 4P4RB 1N64H 3NBNA 4JCMA 3U48A 3SDYH 1IAOA 1EAPB 3UTSE 3OKNA 1QYGH 4KK8C 3FRPG 4C83A 4KZEH 1LP9E 3MQIA 4WEBL 1GZPB 3ULUF 3AXLA 2WWMD 2BVYA 1UM6H 2AJZB 3MA9L 2VN7A 3IDYC 1T4KB 4C57C 2YN3A 2AXJA 3SDCA 3K7UA 4DKFH 1A6ZA 3OKKB 3O6LL 3S36X 4TSAH 3L95B 2YOCA 3FO0L 3VRLE 5LBSH 4JZJC 4Y19D 2AP2A 3BZDA 5D5MF 1UWEH 2P24A 5SX5K 3NACL 3SDAB 1KIRA 1I3GL 4TSBL 2W1NA 5C0BD 4XCYA 1WGOA 4JDTH 3QFDA 1ZA6B 4HT1L 3JTSB 4JM4H 1JV5B 4KROD 4YQXL 3K1DA 2PR4H 3F7YB 4UT7L 4DUVA 2BRRL 1VACA 2MHAB 5EU6B 5DJAB 5ICZB 2ZSWA 4N8VA 4P3DA 5IQ7L 4GO6B 4TVPE 3WYRA 5KVEL 3U6RB 3SY0B 1TDQA 5GZOD 4LGRB 1ES0A 4UDTA 4QRUA 1BFSA 1M4KA 3V5KA 5IMOB 1JWSA 2NW3B 3K8KA 5DMKA 4JB9L 3VH8B 4OM0H 3VXTA 5BS0E 4W4OA 2PYFB 3T0VA 3WHXA 1FNFA 3BKCL 4MDIA 1REIA 1A7PL 3FFCB 1MWAH 1TQBB 1ERNA 1JGVL 5EZIL 2X1WL 1QHPA 1WBYB 2DJ4A 4R7DA 5FYJL 3HNSL 4MD0B 4RMWA 3TN0B 4ELKA 1X5AA 3QWRA 4UMGA 2BCKB 4LLMA 1AGDB 4OZFA 4LSPH 3HE7B 2FIRT 4G3YL 3G04B 2RGSA 2UV3A 3BD3A 2ADGA 4JZNA 4AMKH 4KKBC 3UJJH 1D7FA 1H5BA 3B9AA 2YRLA 5CZVH 4LOUC 3JWOL 4N1HB 3MV7D 3T65B 2O5ZH 5CGTA 1P1ZA 3RWDB 2FYYA 2J5LB 4PJ5B 1KPUB 4WI9A 1HKLH 4JN2B 4YIQB 1B0WA 3MLZH 3UMTA 1CFTA 1KCVH 3WL9A 4XXCC 4NCDA 2DLGA 3QDHA 4UIKL 5D1ZD 5TPWL 3VG0H 1KCLA 4CAGA 3T0WA 2FX9L 5I1JH 4JANA 3CX2A 4HXAL 3CCHA 4MQ7B 2V7NA 3OF6D 2X4TA 4LSQH 3MLZL 4AQ1B 2XIDA 4RX4D 1MAMH 5CS7A 4DEPB 4PJCA 2FLRT 3QG7H 5F7KC 5HDBE 1H3GA 2NZIA 4LDLB 4EIGB 5CP3A 3T2NH 1CYGA 5D2LA 1OSZA 3IAPA 3MLWH 1INQA 2VDKH 4KI5E 1UZ6E 4PJ9B 4F33A 5MHSE 3O81A 2OI9C 3RTQA 1MFBH 3NZHL 3MZTA 4YHZH 3HG1A 2OSLB 5KANG 4D0BA 1WEJL 1ZXQA 1K6QL 1MIEL 4XC1L 4JPWH 5AD0A 4JO1H 4TQEH 3CMGA 4AIXA 5EO9A 3WFHB 1NAML 3QO1A 4BSVB 1QO3A 2FO4A 3TBYB 4JKKA 4U05A 1HHJB 3CXHJ 3VXME 2L7JA 3ISWA 2X89A 4WO4A 3SGEH 5FIEA 4L4TD 3O8XB 3C87A 2R0KH 4ISVA 4PJHF 3GB7A 3L5JA 5B3NA 4NO0D 1CG9A 1U41A 3MA7B 4WFEE 4RZCA 3DX9B 4M3JA 5TDOA 1N6UA 4G6MH 1T5XB 3PNWA 4OLXH 4HIEA 1K5NB 2D4DA 2OYPA 4UTBH 3KR3L 1BVKB 3QNYA 3WHE1 4LLUB 2QHLA 5IW3A 4PRPB 4UIKH 3VG0L 2NY5C 1KEML 1OM3H 4ETQB 2OL3L 1EUUA 5GQBA 1D6EA 4GBXD 4MCZA 1TCMA 4Z7UE 3S37X 2C1PA 3UO1H 2ILLA 4JN1H 5D4QA 5DRZB 1JV5A 3Q1SL 4YXKL 4L3AA 4OZIA 2F54B 2D0FA 1UJ3A 4H1LB 1FCGA 4NM8L 5ETUA 1C8PA 3HMWL 1TVHB 5KBNC 3RA7L 2BY0A 5DQDH 5GIRA 3ZYIA 1LILA 4BK5A 4QRPD 3SY0A 1L0YA 2HG5B 3TCLA 1G7HB 5HHPB 1CD9B 1YYLH 5DEGB 2FHFA 1OAXH 2Q8AH 1N6QL 3V2AR 1SQ2N 5I0ZA 2QADC 1ACZA 4PV8B 3PWPE 4Z78A 1IAKA 3P0YL 5DQDL 1IKFL 5I17B 5BW7A 4NCC2 4HBCH 1MEXH 1TCRB 3LN5B 1LK3L 3O3BA 4H0IA 3PHQA 2EE2A 1JK8A 2I25N 3RJQB 4EKXA 2WLYA 4U49A 3ARFA 3BUTA 4UTAH 2E7BA 2GSIB 4GRWH 4ZYKB 5BO1L 4E5XB 1CVSC 1LD9B 3PF2A 4I9WE 1NAKL 3FO1A 4G80B 3IETA 4HEPG 2Z92A 4RFOH 4OLEA 4FQ1H 3G5VB 1IAIM 4P2YA 1NGQL 3IU3B 4IRJC 5F1NA 4CNIB 3HRPA 1T22A 3AMKA 5EBLB 2VAJA 3E1F1 1IGIL 4EI6B 2FX7L 2G9HA 3SBWC 1A9EA 1KSRA 3IU4H 1A7BA 3L7EB 3VDBA 1A6WH 3L6FA 1Q9LA 4HSQA 2G5RA 2IQ9L 2P5WB 1HXYA 2VDLL 1MCQA 1HXMA 3O9WD 4YWGL 4X98B 1CD1A 2XNAB 5LGKA 4KJPC 3ELAT 5I19H 4HH8A 1NEZA 5D2NB 4ORGB 3W9DA 3H0TB 3DECA 4MCYB 3ZHKA 4XC3L 5FB8B 3ULVC 1VADA 3ARED 4DKAA 1J05B 5T3ZH 3WIHL 4MD5A 4DTGL 2YR3A 3SKNB 5JOEA 1IGTA 4PR5B 4G8EB 3SE3A 2J12B 5HVHC 4OZFH 2VLJB 4IRZH 4JJ5B 5KAQF 5AZEL 2OJZH 3C6LC 4H25B 3SO3C 2OM5A 4YAQA 4GT7A 3ROOA 4XPGH 3MV9D 5KVDH 3NFNB 1MFBL 3QA3A 4OFDA 3P4NB 5DJXA 4HMCA 3IDXL 2GSGA 2CMRL 4KK9C 2BVUA 4FZ8H 4Z7VB 3HTLX 2DN7A 2X41A 3I2CH 4LLDB 4JKLA 3QDJD 5F96L 5EB9A 1KFAL 3S6CA 4OD1H 4UUJB 5KOMC 3VFRB 5SWSA 3X11A 4X4XB 5A40E 3IDIA 2CUHA 4QHUA 3S3PA 3P9MB 4NJ9L 3I75A 3FQNB 4P49A 3MRIA 1IT9L 4WW2C 2FBJL 2IAMA 4KRNA 4F9PC 3UZVB 2R8SL 1U8NB 3PL6C 1U3HC 5HHQA 3WFHA 5IT2L 3F7VB 4AG4H 1MFDH 3RDTA 1FVCB 3UTPE 3OJMB 3QULB 2WBJD 1N3NB 3QCTL 1T21B 4NJ9H 3HZKB 3KPRD 1DUYA 3OAUH 1CTOA 4LCYA 4ZFFA 2XWTA 3H2WA 1FGNH 3V4VH 4BZ1L 2A2QT 3T8XA 3V0WH 1TTFA 2J6EA 4CJ0A 3TBWA 4J4PD 3DX8B 1AGCA 4J3WA 1LK2B 2YD3A 1ZLVH 4HWZA 1KJMA 1KGCD 4J23A 4DVBB 2EICA 3TVMD 1B3JA 3GKWL 4GRLC 1JGDA 4Q6IA 4NQDD 1D6EB 2EH8L 3O2VH 3WO3B 4S1QH 1HE7A 5D5MB 3VFGH 4XMKL 3HC4H 3UAJC 3L3GB 4RGND 5TH2B 2X44D 4NUJB 1MWAL 2F54A 1T03H 4C56D 2P44B 2YRPA 4TVSa 1JVKA 4KMLB 1XIWC 3RBSA 3MCLL 5I19L 4K8RH 2DKSA 3KJ6H 1IGCL 2ORBL 4GS7C 5EORL 4ZQKA 1L4IA 2F54D 1EHXA 1WV7T 3WBDA 4LCWA 3LRGA 3O6FA 4GUPB 1D5BA 5DC0A 2GT9B 5JMRA 4YDIL 5F1IB 1N8ZB 2H1PH 3T0AA 3QCVH 1KXQE 4L4VA 5T1MB 1NMCC 2I9TA 3RI5K 5FUCC 5BMFL 1K8IA 1XZ0B 3U82B 1IM9B 4U2YA 3VA2C 2H45A 3DETD 2WBKA 3BZFB 3D0LA 5I2IA 4UNTA 1ZKAA 5E70A 3KPOA 2E7HA 2YHGA 3GGWA 3PG2A 2FB4L 5D72H 4IMKC 4Y2DB 3LEYL 2VR4A 2EDOA 2DLTA 1Q9OB 4Z8FL 2YWZA 3DUUA 2B39A 3KPSA 5FKPB 4NDMA 1CDIA 5EU3B 5HHOE 5INDA 2R2HB 4QTIH 1V3JA 4Q9QL 2G5BA 2VC2H 3EJZD 4IRSC 3CUPB 1LE5B 5F70A 3TT3L 1I8KB 4MNQA 4OKVA 3VWKA 4X6BB 1YEDA 5DMJB 4BH7A 3R06A 5HDQH 1CF8L 5BV7B 1WWCA 1U92B 3MA9H 4G8IB 4G8GB 5JW3L 3CFEA 5J6HA 4BYHA 3MRMA 2ARJQ 3MV8A 2YKLH 2UZYB 5C07D 5KSBE 4WFED 3QUMB 4BFGA 4H1LH 1VGKA 5E2TL 3MLPA 2ZG3A 3TBTA 1ZTXH 2EKSB 2H3NB 5EH1A 3TO4B 1GAFH 2XTJD 1WCBA 3LEYH 4X6CF 2VTFA 1GOFA 5DEFB 3BGFC 1BFOA 3SJVE 4FQHA 1MVUB 1A3LH 4JG0L 2NMSA 4JY6A 4XNMA 3LKSA 5E00B 3HI5L 4QGYA 5A2IH 4WHDA 5F1KC 5BQ7A 1HQRB 4GXVL 1VCAA 4L8BB 4TYUA 3S96A 3AS2A 1QVOA 4IMLB 1JBJA 3CLEH 3C5SB 1E4KA 4UTBL 5BVPH 4OCRL 4NWTH 1OP5K 2J88L 4N1EA 4PGZA 1JWSB 2NW3A 4ACPA 3EKCA 1SY6L 1TTGA 4KRPD 4F7PB 3GJEB 3U1SL 1UEMA 4M6OL 2WWKO 4MXVE 4ZTPL 4NOBA 1WITA 3SGJC 8FABB 1HDMA 1NFDF 4YK4C 2IBGA 2X9YA 5LCVL 4Z7UF 2ZP0T 1MUJB 2VOTA 4MQTB 1JPSL 3PWVB 1NBVL 3FOLA 4Z76A 3MROA 1UXWA 4LLMB 2Q6WB 3ES6A 1CE1L 1G7QB 1B6UA 2JJVA 3SE4A 5C6WH 5M94B 5HGBA 3MLRL 1P84J 1SJHA 4YX2H 2BDNL 4HUMB 3GKWH 1YEKH 2CDEA 4WFFD 3UEZA 2J8UF 4IS6B 4DN4H 3QDME 5C0JA 3BRFA 1J11A 3N1GC 1KN2L 1KJMB 2IPTH 4OCRH 5EZOH 3RY6C 3RWHB 1QACA 3CFJB 4TTGA 3V0WL 2RHEA 1U8OA 3SJVB 3WS6C 4DUXA 2OK0L 3PXJA 2Z31A 3H9SE 2VZOA 3QZWB 2PXYA 2BVEA 5ITFA 2FEDD 5EG6C 4XPHH 4LSQL 3P0VL 4NNYA 1OD7A 3KS0J 5E95B 3U4BH 2BFVL 3CDGA 1JN6B 1T0PB 3SDAC 4S1RH 4KGJA 3U0PB 5F71A 4MA8L 3IB4A 3ZKND 3CZFA 4XB7A 4U6VL 4FFZL 3FB6A 5GHWH 4POYA 4IOIA 2EO9A 2KPNA 5SWZB 1LO2L 1NCBH 3V5HB 1QBMH 1LK3H 2DIAA 3MYJA 1YMMD 4J2XA 3ULSB 4D2NA 4WUUD 1D9KD 2EDWA 3HFMH 2GT9A 3A6BH 3KS0H 2V7HA 1GRWA 2DKMA 1ZHBB 1TPXC 5I8EA 5D96C 3OG4B 4MD4B 1WC7B 1DQQA 3QB7C 3LRSA 4WRLA 1NUNB 2X70B 3DSFL 1DBAL 5JQ6H 4PB0H 4WGVB 4JFEB 1RUKH 3VGDA 3BP6B 4J6RL 2A6JB 1XF4B 2HFFB 3MLVL 1PG7L 1U95B 2I9LA 4JG1H 4WU5B 4KV5E 3MOBH 3GI9H 3QQ3B 3X13B 3QG6B 1CGSL 4PRIE 4QHLA 4QHKI 2IH1B 2FB4H 4E41A 1JZ7A 5GISL 3BKCH 1SJEA 2AXHA 5DZNA 1OD9A 4H8WL 3IT8D 3UBXB 4Y8AA 5ISZD 4Y7MA 4M93C 5B39B 3GRWA 5T1DL 3ILPB 4NQEA 4GMTH 3WNLA 3Q48A 1IAIL 3DX9A 4N90E 3D9AL 1A4KB 3EBAA 1JP5A 1RFDH 2MTPA 1A1MB 5DK0A 1K5NA 5DSCB 3QXAA 5EN2B 2W60A 5LXGH 1IGIH 3QPQD 3TZVA 5FM5O 4OV5A 3OB8A 1JPTH 2FJGA 2CO6B 3L3DA 1VFAA 5JHDB 5JXEA 3DHJA 2PTVA 1DLHA 4KUZL 4HWEL 3LH2H 4WNQA 1FRGH 2ESVA 1QSFA 3P9WB 5TGBB 2EIDA 4JG1L 1IM3B 4NZTH 4HS6B 1A7QH 2VLKE 3VFMA 2ZKHH 1E28A 3UXFA 1YN6B 3PGFL 1BVLB 4HKXB 1BQLL 4OI9A 3VI4F 5K59E 4XMKH 4P4KA 3P77A 4FMKA 4JQVC 3L3HB 4JFZL 4ALAH 4GOSA 5C2UB 1BZ9B 1UB5B 2JF1A 1MEXL 3GMPB 3LRHA 4JE4B 3PXHA 1A7NL 3OXRA 1IKFH 1HHGB 4LHJB 4Z7WA 4I0PC 5D7IE 5IBUG 3E0GA 4EUPG 1IEAB 4ODWB 1J9CT 1CU4L 4G42A 4R8WH 5BRZD 3CVHB 3JVGA 2NX5A 2P7TB 3QXWA 2O5XL 3O4OB 4XNUL 3BP4B 3PWVA 4U0RC 3SDDC 4BA8A 3DGCR 3RAJL 3CXHK 4I18C 1Y18B 5C0DB 1TPXB 5IVZB 1NMAL 2IG2H 5IFJB 4HUWA 3E8UH 2WM0A 1I4FB 3W5MA 3BMWA 5KSAA 1OAYL 3CDYA 4G8GD 1R3KA 4KTYA 2VDML 2A6KB 3SGDI 1DTUA 1J8HD 4CVZA 4HDIB 3SGKA 3QISA 4Y1AA 1F00I 1V3KA 4QRRE 4XHQA 4J8RA 1Q0XH 2ZUTA 1DQDL 1OF2B 2O26U 5DUML 4AEEA 4OLZL 1SHMA 3CSYB 4R0LB 4KK8D 3H9HA 1QR1B 5T1KB 3Q6GH 4ORGA 5GPRA 4E42B 2BDNH 4U6YB 5EOTB 1AHWB 4DTGH 1VADB 4JPIA 4PJ8A 1UENA 4ZTOL 3BWAA 3CZFB 3WKNA 3RGVC 4IHOA 3QQNA 5JHLH 5ID1A 5I8OL 2A6DA 3QFDB 3S4SG 4X9HA 3C6SB 3U9PL 5F1OB 1HILB 1ZLVK 4YAQB 4S0TD 1IC4H 1I7UB 3PWUA 5TF0A 1SEBB 5HYJE 4NC2B 4YHNB 4YHZL 1BGXL 4BK4A 1RIHL 1F97A 1AR1C 5HHMB 4MVBD 4XMPL 3I3EA 3O2WH 1VA9A 3ARVA 1AFVL 3CMOL 3HE7A 3KPTA 2GTZB 3VRIA 4Z18A 1J0KA 2IFFL 5T33H 1MFEL 4UUJA 3VFRA 3X11B 2EDDA 5IKCB 3UC0H 1IMHC 4DGIH 3INUL 5J6GB 4JLRA 5DQ9A 2R29H 1W72L 3UTOA 5HYQA 1IKNA 3OKOB 3GI8L 5A2KH 2IG2L 5FYLE 5BOZG 1TMCB 4HXAH 4ZUTA 4KK6D 4IIQA 1G9MH 1T21A 4WCYL 4R7DB 1F4HA 4TUJA 3MV01 1QSEB 3VGEA 3AU1A 4UTAL 3LD8B 5IB2A 2CXKA 5E2UH 4HW6A 4OCMC 1B0RA 3MJ8B 3QEGH 1NGXB 4L29A 4YR6A 4B0MM 4LLYA 4X7CC 2WZPD 2IADA 3P0YH 1FV1A 3MRGA 3RWIB 4APQC 5JPNB 3EO1B 3WLWC 4HUXA 3EJZC 4FZ8L 4ZXBC 4GRMB 5L8LB 1M7DA 2BMKB 1UACH 3QI9A 2VXTH 3SN6N 4WEBH 1A2YB 1S7QA 5EUOA 5JHDA 5JNYA 1JHKL 4JKMA 5F89A 1BVZA 3HMWH 4X6FA 2CKBA 4D9LH 4F33B 3TVMA 4A6YH 2AW2A 4NHCH 4NUJA 5D72L 5JHDD 4QHMA 5ESQB 4HZAA 4X6CB 1AXIB 3S4SB 3HG1B 4ONGH 3HNVL 5E2WH 4LFHG 1EO5A 5I1AB 1NJ9B 4N0CD 3THMH 4YO0B 3CK0H 5F1IA 3DNKA 4PLNC 1DEEA 4OFKA 4KH2A 2Y6SC 2IGFL 3RY4A 3SQBA 3D25A 1A6UH 4P23C 1C7SA 3FOMA 3LVEA 4S1SL 3VXSD 3LDBB 1K8IB 4YFLI 1ZT1B 2MQ3A 4LLVB 3WUZA 3B8YA 5EORH 4HJ0D 3BH9A 4TRPL 4AEIL 2XYCA 4L4TE 4NRYB 4N0CC 4ODVL 5C7XH 1VACB 2ESVE 2ADFH 3FMGL 1F4XL 5HYJA 1Y6NR 4JDVB 2R56H 1Q9OA 1T03L 1XGUB 3QJHB 3B3IA 1H0DA 5EOCL 3QDGA 1H3UA 5HSFA 3TNNA 3TESA 3HS0B 4JFDA 3VH8A 3VXTB 1HHJA 3ZYJA 3WLWD 3S8WA 1A6PA 5J12C 3O6LH 2Z8SA 2C1PB 2J8UB 4AENB 4ZFGH 5I75B 2BOBA 5IB1A 5ADPL 2YPLB 2FJHB 5ETUB 3BVNB 4U6XA 4D94A 1ADQA 5MEQB 1S3KH 1EGJH 1H3VA 5B4MD 1CK0H 1SY6H 3PQYA 1EBPA 3RVUD 1G1YA 5T1KA 5C0BA 1R24B 4JREB 3DO7A 4LLUA 1FNSL 4N0YH 2X09A 1CQYA 4IOFC 3TO4A 1IFHH 2A9ML 3K2MC 5FV2A 3T04D 5AYUL 3IDGB 5FYKH 2RFXA 1KN4H 1UG9A 2C3VB 4JM2A 1OTSD 5J11C 3BPLC 5EC2A 3O3BB 1E27B 1I3RA 1QSZA 3X3GH 5F3HB 4KI1A 3ARGA 4HQQL 5T3ZD 4AIZB 3KPNB 1HKLL 5DI8B 1KENL 1CICA 3SOBH 1FJ1A 4XP6H 2IBZX 5A43C 1WUNT 1WFUA 4JEGB 4TN9A 1OTSC 2DD8H 5D7IA 2HT3C 2NLJA 3LAFA 3N06B 3BPLB 3U7WL 2UWEE 2PW2B 1EZVY 1SYSA 4H0HB 5CBEB 4V2BA 5D9SB 3BFOA 2UUDK 3U9UB 3BKJH 1BQHB 4G9FE 4K2UH 3TYGH 4CMHB 4Q0XL 2FO1A 3DSNA 3GUTB 5J4MA 5L6YL 5TQ0H 1NMBH 1S7SA 1XF5B 2PYEA 1LD9A 5IEHA 2Y36H 5FCSH 3GSNB 1JRHI 3G9VA 4G8FA 2I5YL 1I9RL 5F6HJ 3NH7H 2I60H 1NANH 3CFIC 4OF7A 1DQML 4MCYA 2X4QA 2RCSL 5FAAA 4DOHB 3H7BB 1M7IB 3DBXA 1W0WB 5D6DA 4POZC 4HUXB 1FRGL 5BOPA 2PTUA 4LQFH 1KIPA 3ULUD 1QG3A 5GRZA 4AYFA 3VFPB 3MSPA 5C07B 4YE4L 3MLWL 1QFWL 5AAWA 5D2NC 4Y1AE 2W9DH 3QO1B 1XEDA 5F89B 4LRIC 1T1XB 4JVPA 1FN4B 1UXSB 1FNAA 2HKFH 4LQFL 2C7UB 4LSUH 4OGXH 3CDGB 1JHTA 4QHMB 1A7NH 1K2DA 1EFXB 1OQOA 3O3DA 5ESQA 3HB3D 3P9LA 1NEZG 2A77H 5HI5C 5E5MB 2HTKC 4WUUA 4ZODA 1YYMH 3ZTJH 3O0RH 5CSBA 1I9RH 4H8WH 1E4XH 3HZYA 2F58L 5KZCD 2W0PA 3M8OH 1U42A 4HBCL 1PDKA 5I75C 3VFOA 1CXEA 5LWYL 2P5EA 1KB5B 3H42L 3DRQA 3HG1D 5E0QA 5DMIL 3O6MH 1DCLA 3MRNA 5E6YA 5IGXL 3FCTA 1ZT1A 2DWEA 4NKIH 3FT3B 2BNQA 2P5ED 5HYIA 3C2AL 3JWDC 4MJ2A 4PJBF 3MRCB 3QNZA 5DJ6A 1W2KT 3W81A 5GIRB 4YXKH 3BHBB 2FR4A 4XP5L 1QQDA 4RFNB 4WTZG 3LN9A 3TCLB 1G7HA 5J06A 4YFEA 5T1DH 1L9NA 5D1XB 3B5HA 3QJHA 1Q9KB 4DZ8B 5B3JE 4HH9A 3PWJB 3PHSA 4ERSL 5ESAA 5IEKB 4UIMB 1XCTB 3KWWB 3T0ED 3NCJL 3BKMH 5CZKA 2A6IA 2V2XA 5IK3B 5IM7B 3UPRB 1TQCB 5I1LA 3CD4A 1JK8B 2EIZB 5ITBH 3QRGL 2BOBB 5IB1B 3DO3A 2YPLA 2DM7A 5DJ0B 4TOYH 2LAGB 4U6XB 3QXAB 4R90L 1ZEAL 2ZOKA 5J0BA 4WWKB 5DJZB 5IVXF 1UKSA 4UNVA 1R5IA 1QOKA 5IW1A 4C59B 3QHTC 5JOFA 1A6TB 3SDXB 1RPQA 4I3RH 4PRHB 3RKPA 1YJDL 4L8SB 4UU9B 2YEZB 4PRAB 4MB3A 2EYTB 4CADB 3H42H 5CSGA 5JW5A 3OGCB 3MRRB 1FNHA 2XG4A 5IR1B 4RGNC 1XR9B 3KPQA 1HINL 2BVPA 4UBDC 1I3RB 2QBWA 1WZLA 4NSKB 3TO2B 1T0MA 2BSSB 2VAAB 1PG7X 2NXYD 3DYPA 3HC3H 1RJZB 3RNQB 3FO9B 1NCWL 5L2KE 1DANU 4ZFZB 2GJ6D 4GUPA 4JGMA 5DGRA 2KBGA 4OBRA 1E6OH 5D7IB 5FKPA 2QSQA 4JDZB 4ZMAT 4Z7VF 4OZ4B 4ZD3H 1N5AA 4OLZH 3RVTD 1CBVL 3QUXC 5IHZA 1KEGL 2AQ2A 1YUHB 3HFML 1A6WL 4G8EA 3CH1A 4UQ2A 5SV4A 4ODTH 4BZ2L 2OXHA 3K3QA 3VE0B 4Q9RH 3I6GB 3ARPA 5DD1L 3QFJB 4ODSL 1BBJA 3FKUS 2OI9B 4LEOA 4HLZH 3TP4A 5MI0B 4R2GD 4LCIL 3DI3B 1MLCB 3CFKB 1OAYH 1JNLH 1MRCL 2FNBA 3ZKNC 5CD3A 4OCSL 1PQZA 3VWJC 1A3LL 1C7TA 3NZ8A 1RZGB 2X9XA 3AUVA 1AGEA 2XFXB 4LPVA 4K07A 2CUIA 5EIQA 3B5GA 4YBQD 1HHHB 2CRMA 3AREC 2XXMB 1VFMA 5HDLA 3D0VB 4ZPTB 3U79A 3U2SA 1UCBL 4X5XA 2HTLD 5FA4B 1MQKL 3FRPA 1T6VN 3WFCH 3O4LA 5FGCB 1G0YR 4QOKD 4WV1A 1KTRL 2JJWA 3IXAA 4UV7L 4NFBA 1OP9A 4PJIE 3MNVB 5J6HB 2N7AA 3O4OC 4MNQE 2C7UA 2XN9E 1KJVA 3ZO0A 5DD0H 5FYJH 4OJFL 4NZUH 4D0DB 1QLRA 3QHFH 1VFOA 4RMUA 4F80A 1EEQA 4NZJA 5EOQH 3IS1X 1ROWA 2XRAH 4R0LC 2Y5TB 1MJ8L 2CR6A 2IH3B 3F58H 1EJOL 3ULUH 4OF5A 1WFOA 2F53D 4LCCA 2NXZD 3DTXB 5EFIB 3EOYG 4J3UA 4Y16A 4D9RE 4JB9H 3BT2H 2VKWA 4M7KH 1QFPA 1RZKH 3D87B 4NQSA 1NFKA 3NN8A 1TZHB 1X5YA 2CLVB 4U1GC 3S97C 2F8XC 4Y16D 4X6DA 3O9WB 1F3DH 5I1DA 2LE9A 3FQTB 1NL0L 1YEGH 3UPCA 4OSUH 1RHFA 2GJ6B 1PZ5A 1S9KC 4JFYB 1KLGA 1YY9C 3LS4H 4XHJD 3BO8A 1XGRA 1AD9B 1S5IH 4MDJA 5ESVB 2EYSB 4MAUL 4NN5C 3QEQA 2NTFB 2VISB 6CGTA 2QQQA 2R1WB 1XF1A 3ULUE 3N50A 4XNQB 1QUNA 5HYSB 1SBSL 3IDMA 4LLYB 2HTLC 3D2UA 4QRTA 4CU7A 3FB7A 5KSBA 1Q9WA 2ZUQC 3TA3B 2O5YL 1CGYA 1JZ8A 3RKDC 1PY4A 3KPOB 4GRMA 2ZOKB 3BESR 3VXUB 2IAND 3MTRA 3PV6B 3U83A 3QBTB 3REWA 5E5RB 4LU5H 3QDMB 5FYKD 3VXRA 1SY6A 4OF6A 4ZXBB 5MERA 5C08B 1H3TA 4UU9A 4PRPE 3QZWA 2EE3A 1PSKL 3T0XA 5MENA 3ULVL 2MPAL 4XMLL 2ITDB 2C3HA 1FVEA 4L8SC 3P30L 1LGVA 4RNRB 5DJCA 5CIPA 3T0EC 3THML 2CIIA 1QBML 4NOFA 1T7YA 3H9SA 4XP4L 4XXCA 1I1AB 3OR7A 1DN2A 5IROC 2Y06L 4JY4B 4JPVL 1PFCA 1FO0B 1XF4A 3UBXG 1Z2KA 4U1HB 4P99A 2FX9H 4JFFE 3MLUH 2I9LB 3HHRB 4EN3C 4NRZB 4PJFF 1K4DA 1DEEB 1I1FB 3PWLA 4TNWF 2ZOLA 3D3VE 3BZ4B 4QGTA 2KUTA 1Y6MR 2YS4A 1DQLH 4AL8L 4XP1L 4JQIH 4M61A 1I9JL 4MJ5A 3FONA 3K4DA 1CGTA 3C60A 1YQ2A 5FXCH 1UWGH 2VH5H 2DQJH 3LQAL 4Y4FA 5LQBH 2OTUA 3G5XB 1FH5H 3BX7C 1ACYL 1NFDB 5EDXA 2BY1A 1FGNL 4K23L 1QNZL 4LSDA 1QVOB 1HEZA 4I0KA 5D8JH 5CD3B 3FAWA 5B4MC 3RUGA 5ACMA 1MFAH 4Y8DC 4KKBD 5CILH 5F6HI 4O58H 3STZB 1RZJC 3C6LD 1AO7A 3QDAA 2E7LC 1T7XA 1AE6L 5F44A 5D8JL 5D1QB 3TFKD 1G6RH 3V9FA 4F8QA 5J1SC 1XGQA 1GJIA 2IQAB 3BDYL 1SEQL 2XY2A 5FO7B 3X14A 4YBLC 3UC0L 5GGQH 3T0DA 2YMXH 2Z35A 1R3LA 3BEWB 3OKDA 2C3GA 1J1PH 3ULUC 1EAJA 3ZSSA 4XP1H 3A0OA 1BJ8A 1RU9L 5GGUB 4TOYL 3UYRH 1F5WA 2BXYA 4NQCB 5TFSH 2ENYA 1I8LA 4Y2DD 3VXOA 4XVUD 2HRPL 4A6YB 1AP2B 4GG6A 3Q6FB 4HIXL 3BKML 3EW3B 4OLYL 2OMBA 3O6FD 5GISH 5EOCH 4AIZA 1MFAL 1LO5B 1F8TL 2YZ8A 3IF1B 1J8HE 2EZ0D 4M7ZB 4XI5D 2XA8H 2B5IC 1FIGH 4NWUH 4XC3H 1PW3A 4WUUE 4PV9B 2H8PA 5J1TC 5KTEH 5DD6B 3TYFA 1N0XH 4Y5YA 2V9TA 5I1DB 2PO6C 5SX4I 4RFNC 1E0OB 1OGTA 4HXBH 1UT9A 4YWGH 4MS8C 2PYFA 4G5ZH 2XQBL 2XN9B 4LKXA 2IANB 4OZIF 3BGMA 3MV7B 5FFLA 3BQUA 4OZFG 3C8HA 4IOIB 1UACL 4PJBB 4LRNH 5JDSB 4RGOH 4OSUL 2XOTA 1WAAF 1FL6B 5EIIB 4KVCL 4MXQD 1MWAB 4KJPD 3VFNB 4QTIL 3WLBB 2E9JA 1WT5A 1R0AL 2BRQA 1ZS8B 3DX7A 4HAFA 5JOPD 1NMAH 1NC2B 5AUMB 4PJ8B 2D7OA 3VW3H 2NY1C 3CC5A 4FQJL 4W70A 4CVZB 2NY0D 1F6LL 5TE7L 4K3HA 2SEBB 3FQWA 3RDTD 3LEXB 4XVJL 2GJZA 2Y4SA 3QUXD 5IMKB 5IVNA 3GJFA 4AH2A 5IVXB 2VIRB 1AY1L 1CDHA 4PJEE 5E8EB 3FHQA 2V9RA 1SJEB 1SMOA 4WHYG 4YDVA 5C8JA 1YY8B 4KAQL 2DBLH 3R8QA 4E42A 1RFDL 2DL2A 2Z4QA 1MJJA 2A83B 2GFBA 3QUYC 2H2SD 4K3DL 1CXKA 4PTUA 3VRIB 1OWRM 3EUUA 4HK0A 1CLCA 1MJ7H 4HXBL 4GKSA 3NVQA 2CK0H 4L3EA 4IDJH 4QHNA 5IV2A 3P73B 2F74B 1YNLL 4ZO9A 5GGSY 4MAYD 4NRZA 1G7MB 4G9FB 3I84A 1JUFA 2LAAA 4L3ED 4M43L 3S9DB 1MHCB 3GMMA 1BM3H 4Z7VE 5I8KH 3ARWA 4ENEC 4M6OH 1JPTL 4IBLT 1RJYA 4NFCA 2GAZB 4MJ4A 1T89A 3WNKA 4NJAL 3PP3H 3WCYA 2DMCA 4YEFA 3G5XA 2IADB 4JO4H 4GAJH 2VKXA 4TPRL 2FR4B 4FQIL 4GRLD 1YECL 1JYVA 4PB9H 5CJBA 4HKBB 3VFUB 5MEOA 3GSWA 1T2XA 3RZCB 3ZTNH 2D03L 4P2CG 5T5FL 4LGSB 4O02H 1R3JB 3RDTC 1KGCE 1HHIA 1UFUA 4R2GB 4P5TA 1S9WB 5IHUH 4EOWL 1MVFA 1CG9B 2ICES 3MA7A 3H3BC 4NO2B 3KNBB 2Q7YB 3BXNA 1QKZH 1DUZA 3SO5A 3OKYA 1OVZA 3LZFH 4ZS7L 1Y18A 3ARUA 3QIUD 4JRXD 1WBXB 4M8QA 1KEGH 1AO7D 3CLFL 3NA9L 5GSVA 3GSRA 1WZMA 3GNMH 4PRAA 3SCMC 1NGZA 4U7MA 3BAEL 5ALCL 4HDIA 1YQVH 2VJXA 4Q6IC 2DQGH 5C0AE 1ZLUH 1N2RA 3LSOA 4KKAD 2R69H 4LLVA 1P69B 2JELL 3VG9B 1FNEB 3CSPA 4PRPD 1OW0C 1QA9A 3OXSA 5D1QC 3RVVC 2YK1H 3GSUA 4O2EA 1F4WH 1UM4H 3H8NA 1XIWA 4GAGH 1S8DA 1KXTB 4QXTB 1ED3B 2Q3ZA 4U6YA 3VD7A 3RVUC 4PJEB 4Q9RL 2UWEA 3QDGB 5DWUH 3O3EB 3OAYK 4C83B 1PAMA 1NCAH 5DA4A 3V79C 3B83A 3V8OA 4ONHA 4GW1A 2MPAH 3NCBB 1XT5A 2E5EA 2J8UA 4X4ME 3X3FL 5D1XD 5KW9L 5J13B 1B88A 4JFPA 4HJJL 3S34L 4KJQD 2NW2A 3KYKL 3RWCB 2NPLX 2PN5A 1XGUA 4GW5A 2FH6A 3UTQA 4CNIA 3W9EA 5L8JB 4JG0H 2OL3B 4LARL 1PKQA 3P4OA 4R4BA 5FKAA 2MMXA 3JWOC 1UB6A 1JYXA 3ILQC 4F58L 1KT2A 1YEFH 2LU3A