4DCQA

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
LVLTQSSSASFSLGASAKLTCTLNSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLLISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKKGNKFMASSFLHLTSDQWRSHQSFTCQVTHEGDTVEKSLSPALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3B5H10 FAB Light Chain
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA01
3QFDB 3B83A 3FB8A 3PWPA 4PJIF 2NY7H 3ARWA 3T1FA 4K8RC 1ZT1A 3O4OB 3EYFB 1T1WB 4HS3B 4R8WH 5EUOB 3T8XB 2Y06H 3WFDH 2YPLB 3ZTNH 5L2KD 5BVJA 5DI8A 5IFAL 3I02A 2BOBA 1LDPL 4LSPH 1EHNA 5DUPL 4A6YA 5JR1L 1WIUA 4FQPA 2ZSWA 4OI7A 4JLRB 3K4DA 4G8IA 2VLLA 5DRZA 5FUCE 1QHOA 4HKBB 4MCYA 4WHCA 4P3CH 3X3FH 2CUIA 2W9EH 4NDMB 2VXVH 4XNXL 5IR1B 2P8PB 5EU5A 3KPRB 5GGTH 1I7TB 1ZHLA 5F93C 5JA9A 4IRJD 4D9QD 2P8MA 3QNZA 1C5BL 1D5BB 3VDBA 2XRAL 1FC1A 4P23B 3TPUB 4UQ2A 4AEIH 1YY8A 4UAOC 1WZMA 2X70A 3OAUL 4E41E 2HVJA 1WT5C 4JFQB 1IGYB 5DDHA 4E41A 1I7UB 3SQOH 5HHXH 4UUJA 1A3RH 1UA6L 2XTJC 3NFSH 5GHWH 3ARDA 3T3PF 3IJHA 3CH1B 3E3QC 1MRCL 3H8NA 4JFOA 4S1DC 5JPMA 1V8HA 1NCBH 3JZ7A 3RWFB 2ARJB 2L7UA 3O4LE 2MQ0A 5EIVA 1IM9D 3RRQA 3O4LA 4AIZA 3VXNB 1KN2L 2NZ9D 4HZAA 4AL8H 3TVMB 1RUMH 3HE7D 5E2UH 3O6FA 4QY8B 2AV1A 1AHWA 1A5FH 3VXME 4DZ8A 4WO4D 2XY2A 5E08H 3B8YA 3VXMA 5I8EA 4JFPA 4Y4HC 3QDHA 4JHZA 4GRLC 4KK8D 1PSKH 3MLXL 1J0YA 4YE4H 2XZQH 5C7XH 3JWNC 4PIRF 4DGVL 1N0XH 4I18A 1ES0A 2DAVA 1A6AB 5JOFB 5C3TA 5CSZB 5E56A 2AEQL 5GZND 3WEXA 5CLWA 1JGEB 3H2WA 1DQTA 3AAZA 1I3GH 3RDTB 1A0QH 2R4RH 4JDZA 1ZAGA 5DMIL 4IS6A 1NGYB 4OJFL 2X9WA 4WV1B 4FQHB 3IFNL 2WWKT 1A6PA 4AM0B 8FABB 2DDQL 2YSSB 1UB5B 2QR0A 4WFGD 1MFEH 3UJJH 1KEMH 1MRFH 3P4OA 3BO8A 4QNPE 1D5MA 3K46A 4OF8A 2FB4L 3SKUD 1YQVL 3GUTB 2NY1D 5IHUH 4CUCA 3S96A 5I19H 2CRZA 1WZKA 1UKQA 4LPWA 4RMQA 1I4FB 5DJ0A 4WFEE 4M5ZL 1T6WA 5HYQA 5HDBE 1CZ8L 1T3FB 3KLAB 4JZOB 2CLVB 1D9KB 1A02N 4IOFD 3IU3B 4O02H 4YDVB 2IWGA 5ECJE 4QWWC 2X4RB 4G6FD 1K9TA 1LK2B 3IYLW 1JMZA 4F8TA 1QLFB 4IMLB 1J11A 3KYMA 1OTSD 4JQIL 2FNBA 1KF9B 2EE3A 2YK1H 4P4KB 5AWNL 1DBJH 2VLJE 4PJHF 2C3XA 1C08A 4YBHA 4XBPA 1A1MA 2AGJL 2VLJA 1W72H 3GMNA 4OQTA 3TEUA 1QP1A 2AJSL 2E9BA 3KYNA 1JNLL 4OF6A 2CKBB 1H0DB 4JQVA 1JV5B 3C2AH 3GI8H 4TYUA 1UZ6F 1KCLA 4UZGA 3BE1L 3LKPA 4XP6H 2DD8H 3V0WL 3LKQA 3IFOB 5I66B 5D7IB 2BHZA 4PGZA 3BRFA 5FYJU 4YEEA 5D4QA 3U79A 4MA3B 2D7MA 4NPYA 2C4FU 4LRNH 5D1QC 1MJJA 1UYWL 2X10A 4NN5C 2WWMC 2ZKHL 2Y5TB 4J1UB 3SDXB 4NN6C 5I17B 3LN4B 3S4SG 4L29B 2YRPA 3GK8L 4KMQA 4MXVF 3SKJH 1VFAB 3L3OA 1PJ9A 4L8DA 4OIAA 4NKMA 4C54A 4LPUA 1MHHB 4RFNB 2AXJA 2NPLX 1ZTXL 4LCUB 4H88L 3QQ3A 1LE9A 3EDFA 1RJYB 2HMIC 3UTQB 3TM6A 4C56B 2CSPA 3MRRA 3KYOA 1EZVX 3AS0A 5JA8B 3HRZB 1DVFD 1F4WL 1MJ7L 1JYXA 5ALBL 1HIMH 4DN4H 2A77H 4LCCA 1FVDA 1XEDA 2X41A 1F6AA 5KOMC 2A9MH 1E4XH 3KJ4B 5TE4H 1X9QA 4DVBA 4KTEL 5E9DE 1C5CH 2M26A 4ONFH 4RMUA 4WHTA 4OGYH 4LIQL 5E9DA 4LAQH 1P53A 4PLJC 2YD1A 4AENB 1F4AA 5I30L 3U2SB 3C60A 2YC1A 1A14L 2DN7A 5D7JB 3PDOB 3VFTB 3EYVA 2BK8A 4F7TA 4MZ2A 5D71L 5BO1L 1UM6L 1FL3B 2VDRL 2JJSA 1F02I 5FDWA 4X5WA 1QO3A 2CDGB 5C3LD 2HFFA 5DWUH 1BZ9B 2IQ9L 4X5XA 5I71B 5DEFB 3QCUL 1IAOB 2VISA 3BP5A 2CMRH 5H37G 2UWEB 3MJ6A 3RVTD 1JHTA 4JQXC 2X89A 1BZQK 4ZFOB 4NQUA 3VWKB 3D39E 2R0ZH 2VN7A 4LVOB 1J05A 1MEXH 1W2KT 3D39A 2QQKH 1PKQE 1OP3H 4FZ8H 4UQ3A 3T3PE 5IK3B 1QFWH 1B3JA 2VN4A 1PKQA 1LP9B 4KK6C 3DI2B 4YHMH 1EMTL 2A73B 4PJCF 4WU7A 2FD6H 3DX7A 4HV8A 3VG9C 3L95A 3LOWA 4NC1E 1S7XB 1QRNB 1NGPH 2D31A 3G5ZA 3SDDC 1NAML 2FBJL 4XVTL 4PRNB 3WCYA 3QCTL 3ZKMC 4OLZH 4QHKI 3MRKA 4QYOA 3SGJA 3RZWA 3VXUE 4MNQB 4LVNB 2IGFL 3FO0H 3VXUA 4D9RE 4KRPB 3WJJC 4JRYE 2AK1L 2E7CA 3QO1B 4JRYA 1T6VN 5INCA 5LQBL 3LSOA 3WHXB 2XOTA 4ERSL 4AK1A 4QEGA 2AAVA 1IGJB 2K9UA 2HTLD 2GIYA 4M6OL 1HYSC 2DQEH 2B2XH 1LK3H 2J8HA 4JAMA 3NIFF 5ID1A 4PJFE 5T33L 3S4SB 4OLUH 1UB6B 4RFEB 3QG7L 4PJFA 5JIHA 5MEQB 2Q7YA 3HAEG 1SJEA 4M43H 4PY7A 3CDGB 4LHUG 4IIQB 2ZUQB 3MRHA 2FZ3A 2QHRH 5I9QC 1T1YA 3K7UA 4ZTPL 4KPHH 3V4PL 4LSTL 3W9EB 1CLOH 1SEBB 2C3HA 4NQDE 4NBXB 2VYRE 3Q5YA 3WJLA 3MR9A 1A6UL 4NQDA 1KELL 3VH8G 4UV7H 3Q6GL 3EIFA 2AK4E 1XR8B 4PJ8D 1H5BA 4XWGH 4OCWH 1GGCL 2AK4A 4FABH 1MIEH 1SBBA 2V2WB 3QIUC 4F7EA 4R6UA 2LU4A 2VZVA 5DO2C 5F8QC 1CBVL 4MVBC 5D7KE 2GJZA 3G08B 5C07B 2OTWB 1CE1L 1E6JL 4PY8J 2AERT 3ULUH 1DEEA 4U6TA 1ZOXA 2Z91B 3SQBA 4PRDA 1VGKB 5CJBA 2RFXB 3O2WL 1K4CB 2F5AL 3MRPB 3QJHB 4ZO6A 1SHMA 1KXTB 4LLVB 3UYRH 1INDL 3U4EB 3MXWL 2BC4A 2VWEC 3RNKA 5EU6B 1S9VB 2CRIA 5T3ZD 4OZHF 4PJHE 1ZLSH 2DYPD 4PJ9A 5FYLD 1YMHA 4PJHA 1QKZL 3D3VB 5HPMA 5EBMB 2EXWC 2GAZB 4HCRA 3DMMD 2HWZH 4OUOA 5DS8B 3L5HA 4NZRL 3W11D 1GAFL 3ULVL 1UZ6E 4JKPL 3HA0A 4X6BA 2V7HA 4JR9H 1AO7B 5IROA 5DMKA 4P23C 5IGXL 1NFIA 1Q9KB 4YXKL 3TBSA 1CK0H 4S2SB 3IU4H 2DQDH 2YD6A 4QHLA 3VE0B 2O5XH 2CIKA 4M03A 1GCFA 3VXPA 3RVUD 4MA1C 4PYGA 1RU9L 3LS4H 4Z7QE 1KC5L 3PABA 4Z76B 3V5HB 3LEXB 3M17B 4I77L 5F89A 1F11A 3CXDL 1MJUL 5BXFA 2J2ZA 2PW2B 3F5WA 2ZUTA 3H0TB 2ZG2A 2OJEB 5IIEB 3WNLA 4JG1L 2XQYG 2APXA 2AXGA 2W0KA 3EDJA 1RIVL 1MHPH 1R5IB 3MO1A 1OAXL 5K9QG 5E1HB 4DVRH 5KN5A 1KIQA 4ZS7H 1BJ1J 4LHUA 5CBAA 2IBZX 3HZYB 1KG0B 3EJYC 5I15H 4KY1L 5ICYB 4L1HA 2HN7A 1M7IB 5KSAB 1EZVY 2Y25A 4WU5B 2Q3ZA 4KKLD 1L7IL 3NN8B 4X4YA 4P5KA 3I75A 1DBMH 3C6SB 3HAEB 5EPMA 2WK2A 1XGPB 2G75A 4WFHD 3P11L 1RUKL 3ULUC 4IEFB 4XBGB 3HZVA 3MUZ1 4MB4A 3KHQA 2PTUA 3HN3A 4LSRL 2A74B 5EZOL 4JPIB 5LG1A 1NC4B 1WBXA 3QFJB 4Q9QL 4WV1C 3NH7L 3PGFH 4AQOA 2YA1A 3VH8B 1D5XB 1FAIH 1YYML 1YYLL 1VCAA 1DQJB 3MLYL 3F7YA 2W92A 1N3NA 1UM5H 1AGBA 2ORBH 3BIBX 3FO2B 1GYAA 2Z35B 4Y4FD 1BMGA 1ERNA 3HPLA 4U1HA 5ANME 1QLRB 1KCUH 3O8XD 1AD0B 1WEJL 2PO6B 1OVZA 3QI9C 1NMCB 5ANMA 1A6VL 1WC7B 2CDFA 3NABL 2Q6WB 5HI4D 2ADJB 2HLAA 3MODL 4L8SA 2I60L 1JZ7A 2P8LA 4LLWB 5IM7A 2R1XB 2CH8A 4J6RH 4DFHA 3SO3B 2DM4A 2GSIB 5DJ2A 5CGTA 5I18L 1D9KC 4IRSD 3BSZH 4PJCE 1J1XH 1XGTA 4J4PC 2YKLL 2A83A 4Y2DC 1JN6B 1MNUH 4PJCA 1OGAE 1W0YT 4U0RC 3H9HA 3N1QC 3GNML 1ORQB 1OGAA 2FX9H 4Q9RL 1S5IH 1JL8A 2NXZB 1FIGH 3AXLA 2XWBA 3MACL 1RY7B 4RAHA 2JJUA 4HQQH 1A3LL 3ES6A 1OPGH 3OKEB 4JFZL 5DUBA 3TO2B 4FFVC 5KVFL 4KQ3H 4O51B 1U93A 3HG1B 3OKLA 5IKCB 4M48H 4NZUL 4WWKD 1ONQB 3QNYB 4X4ME 1NC2B 5T1DH 4X4MA 5DRXA 5CEZD 1F3JB 1QVOB 5HDLA 4L4TE 5FHBL 1QA9A 4L4TA 5DD1H 3RBGA 3VFOA 5DJ6A 3PGCB 2ZUSA 3KPSE 3NIFE 3KWWB 1FNAA 2LAGB 2A6JB 3KPSA 3LEVL 4MJ2A 1EFXB 2MQCA 4TTDD 3TCLA 2KPNA 3S7GA 1X6NA 1ZXQA 1ZEAL 1G6RA 2COQA 4QRPB 4LPTA 2VZOA 3P0YL 5IF0B 2YEZB 4U6HA 3BW9A 5L6YL 4XRCA 5IG7B 1IFHH 4EKXA 4F2MA 3FOMA 2FGWL 3T1WA 4ZMAT 1G7JA 4DK3A 3TH4T 3RWEA 2XA3A 4PLOB 1TZHB 3T2OA 3QHFL 3UTTE 1K4DA 4NGHH 5SX4H 2NW3A 1WWBX 3C08L 3UTTA 3PWJA 1TQCC 1YZZA 1YECH 1G9ML 3G6DL 2EC9U 4NBYB 1KJ2L 3GKWH 3KJ4C 4PJXF 3G04A 5I1CH 3U9PL 1B4RA 3LRHA 3RWDA 2YZ8A 4R4FH 5E4EC 1U6AL 3STLB 3PHQA 3SGEH 2H9GB 1SBSL 2NY6B 3HNSH 2VDLH 1WBZB 3OTTA 1RPQA 2JJTA 3AREA 5E8PB 3CUPB 3ARGB 5CAYB 3WUWG 4OZHE 5D7JC 2ICEB 1EGJL 2J88L 2EEDA 4OZHA 1ITBB 4P2QE 3FFCB 4OZGB 2CKNA 4P2QA 4PLKC 2B5IB 2E6QA 3QIWD 2ZSVA 3GSWA 4P2OB 1Q9OA 2X4UB 2BCKA 3QO0B 4O4YH 5I71C 4ONGL 4MA7H 3V4VL 1JFQH 1MCOL 1U58A 4N0FB 3HI5L 3KPOA 4NQCE 4KVCH 2Z31B 1DN0B 2JIXB 4NQCA 3CK0H 4M6MH 2W65A 4JFFE 5E5UB 1CLYL 3PIQB 3EAKA 4JFFA 4PJ5B 4LVOC 1CICB 3PQYB 5HHQA 1QFUH 1GOGA 3J8F7 3PWUB 3DHJA 3HFML 1OTTD 2D0HA 3WIFB 4GW1B 1RZJH 1I1AC 4Y1AB 2GITA 3VG0L 1S7QB 4M1GH 4QRQB 4YHZH 4S1RH 5I1EH 1B0GA 2EXYD 1DZBA 1E6OH 5I8CB 1EAJA 4RWYH 4EXKA 1CGTA 3MJ7B 4HEME 4LVNC 3KPLB 1E0OB 4EDWL 3QNXA 4YHKH 1RJZA 2MNUA 2IBZY 2Y07H 4NWTL 3GRWL 3O2VH 3VD5A 2W0FB 3G5VA 1CXKA 3FB7A 1HCVA 4KQ4L 4QOKE 3EYUH 3V8OA 4NM4L 4U1IA 4QOKA 2Y6SD 5HYSB 4OLVH 1KB9K 1WT5A 3REWA 4KMLB 2XTJE 5GRJL 5DZLA 3E3QE 5L9DH 5D70H 5EZIH 4OLWH 5TDPB 3LKNA 2EIZB 4Y5YB 1MVUA 4LQFL 3T65A 4KXZI 1I7RA 4IIQC 1Y18A 2ZUQC 4GH7B 3RI5F 4EI5B 5C6WH 3NGBC 4X6CB 3S9DB 1DQLH 2VKWA 4RFOL 4XP5L 1YA5A 4KUCD 3MV8E 4BK4A 3U4BH 4EOWH 2QL1A 4YHIB 4G7YH 2A1WL 3MV8A 3BKCH 3C6LB 2AV7A 1BQUA 3OKMB 3KG5A 3ABZA 4QXGH 3G5YA 1PQZA 4OCYH 1E27A 2B0SL 4Y4HA 4GXUM 1FIEA 1W0WB 4XHQA 7FABL 4GRLA 2H6PB 3RHWK 2FECL 3TN0D 1EUUA 4P9HH 1CD1B 4XGZB 4O2FB 3SE3C 1IVLA 2ATPB 2O5ZL 3NACL 3BIAX 4O2EB 4X9HA 2F53E 2YBRB 4MJID 5C0GB 3EBAA 4KKCD 2F53A 4PG9B 5C0FA 3T4AA 2QBWA 2H2PD 1MI5D 3O6KL 3B9KB 1KULA 2IH1A 4J3SA 1MY5A 4OF5A 2VDML 3RWCA 1G7HA 3BKML 5I8KH 1P7QD 1UACL 4HWZA 4HXBL 4TNVK 1SEQH 3QUML 2GCYA 3GMMB 3WFCH 3IDIB 1OGTB 3NBNA 5I1DA 2VIRA 1QSFD 5M94B 5IVXF 1TVBA 4ELMF 1FGNL 3JTSA 4DGIL 3SDCB 4UT6L 1BQSA 3GHEH 3HUJB 3DO7B 5GGTA 1X7QA 4B53A 5ID0A 4M7KH 1JK8B 2HKFH 2KQNA 4JN1L 2WBJC 4AZ8A 5EUOF 1ADQL 2IMMA 1CDYA 3O6MH 5KAQG 5IHZB 1H3TA 4K3DH 2B1AL 1JPFB 4JPKL 3FTGB 2H45A 1NBVL 1IEHA 2FEEL 4N9OB 3WFHA 1UM4L 1VADA 1I85C 3MRGB 3L3DB 3O41A 3WNNA 4U1NA 1NCCL 3EW3B 1NAKH 3RY6C 5MI0B 1UJTA 1JWMA 2NY3C 1QSZA 2V7NB 4ZFFB 3HI1A 4NNYB 3MGOB 3MLTA 2NY0C 5DK0A 4LSVL 3WXWL 2VLME 3BQUC 3QH3B 3MCLL 4MD5B 1MY7A 1GHFL 4DGYH 2ICCA 2IC2A 3WLBA 1ZANH 1Q9WB 1HH6B 2EDKA 3ZZ1A 4LU5L 3CXHJ 4XZUA 4M6AA 4PJXE 4LPYA 4QXWA 2VITA 4YHPA 4Z77A 4WENB 4PJXA 5D1QA 3DBXA 4AH2A 1PG7H 3OBAA 4KUZH 1F90L 3L6FB 5LKNA 3CSYB 5BV7B 1R3HA 4WCYH 4WY7H 4QRSA 1TNNA 1QSEE 4NCC1 5FYLL 1LE5A 2VC2H 3KPQB 1QSEA 3QEGL 4I9WE 3BP7B 5TQ2L 4E41D 2IEPA 5GS3A 1CL7I 3HE6B 3K4AA 4DEPC 3ARDD 1C1EL 5DJYA 2YOCA 1BWMA 3G6AA 4OGAD 5IB5A 4AMKH 4M7ZB 4N8CL 4NJ9H 1NDGB 3DECA 4Z0BL 5HGAA 2X4OA 4GKZA 4N9GA 4Q74A 2F74A 5GGSY 3O4LD 3MA7B 2PO6C 3TBYB 5CCKH 4U1MA 3V4UL 4P3DA 1JF6A 2FJFB 1CDBA 4NIKB 4LVEA 2EDNA 1KIRB 4HWBH 4HFUL 3AS2A 3DX8A 4LGRB 5GGRB 3U36A 2HLFD 1IEBB 4X4ZA 4PD4J 1KCVL 4KROD 4E5XB 3U1SL 5DMGC 3HZMA 3SO3C 3ULUF 3FO9A 3BPLB 5JNYA 2JLLA 5GGUB 1JZ5A 3H9ZA 3AROA 3FCTB 3ULSB 3OXSB 4GRWB 4M8QA 4EXPX 1QEWA 2DMKA 1BQLL 2NXZC 4OM0L 3S35H 5EWIL 4WHYH 1N0LA 3H3PL 4YQXH 4Z7VE 2VDKH 3VA2C 4Z7VA 2R39A 1T66C 4FS0A 4G43A 4HWEH 3JWDH 1YNKL 5J6HB 2EDBA 2DIAA 2V2XA 3TJEL 3ZT6A 5GS2H 4JQXA 4NSKB 3QHZH 5D8JL 2H1PH 4TPRL 4P5TB 4ZS6C 5E2TL 3RWIB 2APWA 1F4XH 4LAJH 4HD9A 5I16B 5F44A 4YUEH 1QFWM 3DUSB 1RHFA 4JFEB 4TVPH 3NFPB 4HSQA 4EUPG 4Z7OE 4UBDD 2AXHA 4F7PA 3SDDA 1T1ZB 1AGEB 4F15B 4WFED 3CVHB 4OD3H 4BH7A 1SY6H 2OR9L 4U7SA 1CXLA 5TDOA 3FB6B 4K3GA 3IXAA 2XZZA 3FHAA 1RUPH 3NTCH 3PGDA 4ZFZB 3WJJA 5FUOH 3GSNL 4NN7B 5TGBA 1EO8L 4FXGA 5FEBA 1EFQA 5IW1B 5J6GB 4QLRA 3MFFB 2BJML 3QQ4A 2F8VA 5C71A 5LGJB 5D7IF 4JY4A 4NO2B 1EVTC 3DWTA 4HT1L 1U95A 2EYTA 5BRZE 3IKKA 4P59H 3EZJB 5D1ZC 4LLQA 3FONB 5BRZA 3FT4A 1UZ8A 5C0IA 1NCDH 1P4IL 3SDXF 2EZ0C 2NY6C 5HYFA 4LKXB 2ZCLH 3PXJA 5C0CE 3BWUC 3ARGC 4LGSB 3X12A 5C0CA 5GPRA 3P77A 3ORJA 3DRQB 5A1AA 5B38A 2DQTH 1CF8H 1HH9A 1VHPA 1TJIL 4R4NC 4I48B 1RZ7H 2KKQA 3L3KA 4NZTL 2C3VB 4GUPA 2YUVA 1SMOA 4K23H 2GTZB 3WFBL 5F72S 2R4SH 2X4TB 5GS1C 1DBAL 2Z31C 3BDYL 4L8CA 3VXRB 3JWDC 3EYFA 1K8DB 4HS3A 2JJWA 5D6DC 3T8XA 4JZJB 5IMOA 5HY9A 1XGUB 3DX9A 4CVXA 1RZFL 1MCKA 1CICC 2Z8RA 5F1NB 1RUAH 5KJRH 4D0CB 3ARBB 1NCUA 1ZGLM 2VWEE 4RDQG 1UWXK 5CUSL 1CD9B 4G9FB 5L8JB 3WD5L 4DQOL 2R69L 4CVZB 2FX7L 1D6VL 1PX4A 2EDRA 4HKBA 3VGDA 3NCYP 5L0QC 3LB6D 3ESVF 3ECBB 2CIIA 3TT3L 4KMTH 3AY4C 3U0WH 3MXVL 4NDMA 1LO5A 4ZODA 4HW6A 3U46A 3C60D 4U6YB 2UWEF 3IDJB 5J56B 5ADOL 4NCC2 2Y36H 5JZ7C 5FA4A 3EJJX 2DQIH 1WCBA 4P23A 4K07A 3TPUA 4LLUB 1TXKA 2YD5A 3JV0A 5EBWA 2JK5B 4JFQA 3RUGE 4XAKD 1MWAB 4X7TA 3SPVB 3FRUB 5TH2B 3RUGA 4UTBL 1FVEB 1LP9F 3I6GB 4EUPB 3CH1A 3EOYG 5T5NF 4U31A 3V0VA 1GJIA 2ARJA 1L4IA 1GRWA 4EI5C 2X89D 3VXNA 3DSNA 4MA8L 3D39D 5CJOH 5F7EL 2VQUA 5I1GL 4J23A 4QRTA 5DTFB 4LP5A 1RZKH 1T2JA 4OFYD 3C6LC 4NCDA 5F6IC 3QR2A 1WWAX 4JN2B 3DV4B 1KN4L 2P5EB 3E8UH 4NKOB 1MRDH 4QTHB 4N5EC 3FOLB 3VW3L 1A7NL 1YMMD 4DW2H 2HYMA 4W81A 3OB0K 1MIMH 1MCJA 2EH8H 1HHGB 5TE6H 3ULUE 1A6AA 2QADC 3VXUD 2Q8BH 5JOFA 3S8WA 5BV7H 1GPOL 4RBPH 3SOBL 4EIZC 1QLEL 4D9RD 1FO0H 2ZOKB 1DSFH 4M7JH 1O5DT 2H2SC 3OJVC 1NGYA 5E5MB 3UO1L 1YEFH 4WV1A 4FQHA 2Q8AL 5FYKU 5D2NC 4LSQL 3BZ4A 5ESVB 4XPFH 2NTSP 2YSSA 1UB5A 1Q9LA 2R9HC 1ACYH 1YNLL 4OFKA 4ODVL 3OKKB 3SDCC 5IMLA 1WIOA 3SBWC 4R3SB 1MUJB 1RFDL 5ILTH 3QI9A 2QQNL 3SDAB 5GGQH 4YK4B 4NHCL 1A9BA 5HI3C 4LPVA 5E8DL 1A7BA 1T3FA 3KLAA 3PWLB 4NQDD 3LH2H 3VMPA 1T20B 1OARL 1GGTA 3T0EB 1NGZB 1D9KA 4PREB 4YIQB 4GRWH 4YDVA 4J4PA 3QEQB 4Y2DA 3SKOB 2AK4D 2X4RA 3NCFB 2R2EB 3GJFK 5F7FA 3FZUD 4DKFH 4PV9B 1XF2B 3HZKB 3QZWB 5D7KD 1LEIB 3QCVL 2QSTA 4QHKJ 2R8SL 3N1MC 4XCFL 4NQEB 4YPGB 5T1KB 3IDYB 2VLKB 4QF1A 3KDMB 3N85H 4TN9A 1RZKC 2VDOL 4X9IA 2J6EL 1HHJB 3GMOB 3P9LB 5DQDL 3AVEA 4N0UE 3LHPL 1EJ6A 2X1PA 1KFAL 4N0YH 3R8QA 3UTZB 1EXUA 4NFCA 4PJ9D 3MJ9H 3F7PC 3NA9H 3IFOA 1U8NA 4OI8A 2FLRT 1W0VB 4U3XA 1EEYA 3IDXL 4YFLI 5E8NA 5KG9B 3JBG7 1IGIL 5BZDB 4U6XA 3S34L 1NLDL 1X4ZA 5IBLD 3SDXE 1NCAH 2WQ8A 5C0AE 4Z78B 5ITBH 5BV7C 2VL5B 4KKNA 3SDXA 4P48A 3A6CL 5I17A 3LN4A 4XPHH 2EYSB 1DBKH 3CVHH 1VPOH 2ZCKL 4KZEL 2PUQT 2BOCB 1B0RB 4DKDC 1VFAA 1K2DA 15C8L 5KVGH 3A67L 5CEXA 5AD0B 5IVZA 3F58L 3MOAH 4PJGB 3HE6C 4HUNB 1MHHA 4M7LL 1WUNT 1MSPA 2HH0L 1QBML 4XCCL 5D1XD 4C56E 3U0PB 4LCUA 4X6EB 2X1OA 4ODUB 4M7ZC 4C56A 3O9WC 3K1DA 3HRZA 5T3XH 3S98A 1MCEA 4X6FB 3FB5B 5K9KB 5BW7C 5F96L 2A6KB 4K71B 4M1DL 1SYSB 3N1PC 4LHUD 2DLHA 3LAFA 3BPLC 2VSDA 4HUVA 1AH1A 5EO9B 2D7OA 3FT3B 4GW5A 4BUGA 3I2CL 4AENA 5C92A 2VRAA 3RNQA 3U2SA 1OP9A 1A7OH 5D7JA 5JORB 4B5EA 1JPSH 1NCNA 2AJXL 3CFBB 3UYOD 1KB5H 3TYGL 3VFGL 1DLFL 1SJHB 2CDGA 3KPPA 3MTRA 2R56L 4H0IA 4NHUA 4NOFA 5LJYH 3W39B 1G1YA 2D9QB 2QQLH 3GHBL 3BP4A 2BNQE 2VTFA 2X1XR 5GSRA 3LQZA 4FQXB 4AT6B 2BNQA 1GIGL 3JUYA 4KV5F 2GSGB 2AQ2A 3LIZH 3B2VH 1A6ZB 3DOSA 3K3QA 1MFBL 4APQB 4HIJA 3D25A 4P5TC 4QT5B 4MD4A 2AJYL 3UJTL 2MWCA 4U6VH 1HSAA 2A73A 3ZT5A 1OP5K 1I1AA 4JJ5A 1DLHA 2AP2A 4UIKL 1QRNE 1LD9B 3TBWB 4X99A 4YDKH 2DLFH 1QRNA 3BGMA 4OV5B 5D7LE 4F15C 5I8OH 1E28A 1I9RL 4TUOA 2GJ6B 5D7LA 1TNMA 5IVOA 3MQIA 2EEBA 4JDVB 4Q58C 4WUUE 5GRZA 4XMKL 5SWSE 1RULL 1IAIM 2HKHH 1ZT7B 4WUUA 4HJ0D 2BMKB 5DJAB 4G6AC 4NKDB 2BVUA 1HYRC 5SWSA 2GT9B 2QKIB 3QO1A 1LEKA 5GGVH 1OGAD 1HXYA 1TTGA 4ODXB 4QHNB 4DKEL 3UMTA 3WHXA 1HINL 3X3GH 3UDWC 4CNIA 1IGJA 1MWAH 5IFJA 2CR3A 4FA8A 1JHKH 4LMQE 4M1CD 4D2NA 4H5SB 2X6MA 4FXKA 1FZKB 4EUPH 2M2DA 4TULH 2V5MA 3HC3L 1NL0L 2E9WA 2XA8L 2H8PA 1CCZA 4NP4H 1OHQA 5FUZH 5MEQA 3T77B 3HB3C 3CDGA 3MLWH 4I5BB 4IIQA 2QHLA 5HGHA 5DURB 4O5LH 4L4TD 3ZE2F 2HRLA 5I6XB 1RSFA 5JPNB 1EBPA 3IAQA 1YEGL 4Q0XH 4MGXA 4OZIE 1BFSA 1M6OB 3KPSD 1MCWM 1BFVH 1HOCA 4OZIA 1MAML 3OPZH 2HT4D 1YY9D 3V6ZB 1NPUA 5JUEH 1RJLA 5ALCH 1AJ7L 3BUYA 4M9PA 4A2MA 3OKDB 1MLBB 4LHQB 4OD1L 4Y5VB 3U7WL 4OT1L 5C07E 3RIFF 3SHSA 1IC4L 2QQQA 4KK5C 2JB5L 3SE3A 3UTOA 5AAMA 3G08A 5C07A 5MEOA 1IMHC 4RAUA 5HHOB 1DFBH 2FCBA 5AUMA 4YHNB 4JZJC 5J11B 3CAFA 2Z91A 2IFFH 1A6TA 3V0AC 4OF0A 3ZKQD 3BZEB 1KTLA 1X5KA 1OL0A 2RCSH 1K4CA 3ARBC 3NMEA 3UTTD 4LLVA 3O3DA 4PRIB 1FNFA 4XP9H 3RWJB 1YN7B 2GK0B 4OZGF 3MBEB 3CC5A 5I1HH 5LGHL 2XN9E 3D18A 5A43C 4I0PB 3VFSB 3MA9H 5IEHA 1X5ZA 3PJSB 2KQMA 5DS8A 3PP3K 1QBLL 2CGRL 3DRTA 1R3KB 1B2WL 1AO7E 1IC7L 3H42H 1MCNA 2F54E 3ILQC 4ETYA 5AZEL 2Y72A 1Z9SA 1AO7A 4JO3H 2WBJA 4ODSH 2F54A 4OQTL 5GS0C 3JV5A 5AZ2L 1JF5A 3M8OH 1Q9KA 4S2SA 4MZ3A 4B0MM 5K9JH 3VE0A 2IAMB 3ARVA 4GT7A 4XVUD 3BWAB 3PDGA 4D0BB 4V1DB 4PB9L 2JKXA 3V5HA 3LEXA 1I85A 4K8RD 4ZXBC 2PW2A 5EU4B 2BY0A 3H0TA 2OJEA 3MCKB 5BS0B 4WW2B 5HBBA 3RY6A 4R2GC 2BRRL 1KBGH 2ERJB 5JW3H 4MQSB 1R5WB 4W6YB 4X7SL 1T2XA 2HT3D 1AGCA 2EKSA 3NIDF 4NJAL 5CINL 1NFDB 3BQUA 4QRRD 2YMXH 4ZD3L 1ZVYA 1R3IH 4GG8B 5ICYA 2GJJA 3WMSA 2PXYC 4HMEA 3SKMB 4F57L 4WU5A 1JPST 3TA3B 3RAJL 3HNTL 3NN8A 3KJ6H 2JCCE 3LQAL 2DIJA 2CK2A 4JO4H 4FG6D 3FN3A 1LO0L 2JCCA 4F7CB 1XGPA 4D3CL 1CT8A 1K5NB 2ZUXA 5FYJE 2FATH 4HGWA 3QUKA 1CGXA 4JPIA 4X6CF 1NC4A 3QFJA 2VH5L 1BJ8A 4GO6B 1NCTA 3UZEA 1D5XA 2PN5A 1F4YH 3RA7H 4YGVA 4HIHA 5C9JB 4O9HL 4K9EL 3L3GB 3RVXC 4S1DD 2EDEA 4OCSH 1D5IH 1EHLL 2DI9A 4MXWL 5HGDA 4HLZG 1S7UB 2RBLA 1IQDB 1A64A 1AD0A 2PO6A 1G7LB 3SDAC 2Q6WA 4TQEH 4U1GC 4F37K 1IKFL 4YK4C 5HHNA 1WICA 5IT2H 4LLWA 1JYNA 2R1XA 3MV8D 5EOTB 2BVPB 2OP4L 1T04B 4UT7H 5IMKA 4DFIA 3C5JB 4GRLD 1JN6A 1XGQB 3ZDYF 3MUGB 1OTUC 3T2NH 2R23B 4BQ8A 2A0LD 4KI5C 5DJ8A 1ORQA 3MPCA 3LDBC 1FG2B 3DGGB 2XQBH 1YEJH 1X5JA 4G8FB 3C5ZD 4PUBL 5IWLC 3OKEA 3HG1E 3UAJC 5HD8C 3TO2A 5F7NC 1IQWL 4O51A 4ZDHA 3HG1A 1QACA 1KGCE 5FM8A 4OB5L 3VI3E 3QNYA 3O6LH 3HUJF 2FSEB 4Y7MA 1QZ1A 5FF6B 4QXUL 1VESA 4JRWA 3VD7A 1QVOA 1MPAL 2XTLA 3AFLA 1V05A 1NSNL 4K94L 3MROA 1XF3B 5L2JB 1RQ5A 3KWWA 2B4CH 5HXMA 2BSSB 5DYOA 2FRGP 1DCLA 2A6JA 4QRPE 4IMKC 3OG4B 4HXAL 4L9LB 2HFGH 4KKBD 4QRPA 1D5ZB 5E6IB 1Q94A 4NNXA 5EOCH 4S1SL 1VSCA 3CU7A 3LS5H 1FDLH 5FCSH 3ARSA 4Y16B 4F3FA 1OCWH 5K9OB 3WIIH 4P57A 1NMAL 3L5JA 2QSCH 3FMGH 5L88H 2Z92A 5B3JF 5CD3A 3C8DA 2UYLB 3OQ3B 4ODWB 3FT2B 1X4XA 1MQKL 5SX5K 2MCG1 5TPWL 1DL7L 1L7TH 3QIBB 4WUKL 2NY5L 4PGJA 4PGDB 5IB2B 4W4OC 4WWID 3IDGB 2BVQA 3HKFA 4G7VH 3QDGE 3JSSA 5CD5C 2Z0BA 5HI5C 2BNRD 2HFEB 5D1ZA 3QDGA 4HWBA 4BELD 2YXFA 3IFLH 3TESA 2QTEA 5IFHH 3STLA 3VCLA 1BFTA 4P2RB 1KJVB 5ACMA 4UB0L 5E8PA 1HWGB 1DQQA 3EOBA 3VFRB 3ARGA 2DQCH 3FFCE 2ZCHL 4F58H 1J1PH 4X80L 1PYWB 3FFCA 5D1QD 1JBJA 1T03H 3W82A 2WWMD 2YPVH 1XF5B 4WTZA 1MQ8A 2X4UA 3QO0A 5K33A 1FV1B 1NGWA 4GSDL 3U0TA 5ISZD 3UZVB 3EHBC 4YBLC 5CFHA 1A7PL 3CZFB 5DVLA 1JWSB 4N0FA 5EU3B 3O2DA 4OUUB 1JWUB 1QSED 5GS1A 4FQXC 2Z31A 2D4DA 2JIXA 1ORSA 3D0VA 3EGSB 4PRAA 4PJ5E 4HCRL 5D6DA 2RAMA 5IFAH 1MHEB 2R0KL 3PIQA 4PJ5A 4JY5L 1LDPH 1CICA 1YJDL 3D2UA 5DHVB 3D85B 2OZ4H 3LZFL 3ARFB 3PWUA 2B4CC 1HHHB 2X05A 4LLMB 2BSRB 5KANI 4GRWF 3LRGA 4H8WL 3WIFA 1XGYL 2FX8H 3N06B 4UILL 4QRQA 5ERWB 1UXWB 1PY4A 1AD9A 2NNAA 4JFDD 1BWWA 1NAMB 3AY4A 4HJJL 4PRHB 3QUZB 3T0XA 4YJZL 3MJ7A 4WDIA 3NIDE 1SY6A 1NDMB 2QSVA 4DK6A 5FYKH 5D9SB 5E0QA 4ZNCD 1BD2E 4ACPA 2VNCA 3ZL4H 5KAQF 1QFPA 3WDHA 1JGLH 1BD2A 2ITDB 1CFSB 2W0FA 5CHNA 1DBBL 3Q1SL 2AABL 1MFNA 3O3UN 4HF5H 4OZ4A 1GGIH 3HTLX 4X7FC 5HYSA 2E27L 1CL7H 3NAAL 4JO2H 1REIA 3KXFB 2DJ4A 4KHXL 5DD0H 4NO3B 1UA6H 5C08D 3ZKND 1MRCH 2OK0L 2EIZA 1T80A 4JPWH 4G8GD 4X6CE 4EI5A 3P2TA 2AJZB 4KJQC 4X6CA 3GSUA 5I6XC 3QHTC 5ELIA 3U9UB 2DJSA 1NUDA 5INDB 1BQHG 1N5AB 4RISH 4UNUA 4NO0D 2LAAA 3C6LA 4PGCA 1N7MH 4X4XB 5I1LA 4TOYL 2PYEB 1YC7A 1LO3L 4NZJA 4P9ML 5CLTA 4V2CB 2ZWLT 2H6PA 4WI2A 3PHSA 2DWDA 4Y5VC 3ZKMD 3DUUA 2E7HA 1PDKA 1J8HD 3F6LA 1QQDB 1XCTA 3VGGA 1V5JA 4Z5RA 5DLML 3OKOB 1S78C 2YD4A 1AGFB 4HUUA 1HN1A 3B2UC 3BIKB 5T5FH 2OSLA 4JKKA 3O45A 5IBUG 5I1KH 1DQDH 5I1JL 4HK3N 5I0DA 1R0AL 1ZA3B 4XI5C 5J4MA 2O5YL 4OJFH 5D2NE 1FL6B 3MV7B 4RMTA 5F1SA 1HYSD 4CN4A 3QXTA 5D2NA 1JRHL 3IDIA 4YHOH 5F7WC 3SKNA 2V9TA 3MRJB 3MBEC 4K2UL 4HK0A 1OGTA 2X4NB 5BRZD 2D7QA 4NQSA 2WLZA 2P5WB 4FNLL 1I1RA 3UCRA 3MLUH 3CLFL 3SDCA 3SBWA 1R24A 4RGNB 2ENSA 1GZPB 3HUJA 3DO7A 3WNPA 4Q6YA 5KVMC 5DD6B 5C0CD 1FZOA 4XCNB 3RTQB 1WTGT 1VDGA 1F8TH 2IAMC 1B9ZA 1MCQA 4OIIL 5EULV 5CILH 4LL9A 5DJCB 4HC1A 3RU8H 2F8OA 3M45A 3QIUD 4MXQC 1FGVL 1BVKB 1RD6A 1KLFA 2DQJH 2Z93B 1N6UA 5AWNH 2HRPH 4LKCB 1AIFB 4WGWB 3P0VL 5SWZB 1G6RL 1VENA 4NNYA 5E6YA 4FQIL 4ZAKB 2X4PB 5B3JE 3DURB 3QH3A 4ZSOB 1X44A 2UUDK 3BE1H 1NGQH 3OV6A 3LKRB 5H8DA 1Q9WA 4JZNB 5L2KB 3A6OA 1IGFL 1NLBH 2EXWD 4AY0A 5EC2A 5F1IB 5F88A 4H20L 4XC1L 3P73B 1KJ3H 1GZQA 1IM3B 4I0KA 3BN9C 1TCRB 3CSYA 2VXSL 5HVHC 2UVEA 2IPKB 1FO0A 4WI3A 1BQHB 1S7RB 4YBQC 3RL2A 4OLXL 1Y6NR 3VRIA 4WEBL 2DLTA 4N90E 4S1QL 4YXHL 1CDHA 2FEDC 4Y5XB 1WV7T 4HBCH 5DJDB 5FGCE 4R97B 3HE6A 1G9NC 4L3EE 5CJQH 3JXAA 4J3TA 2UZIL 4FFZH 4XCYA 4L3EA 1L9NA 4BFGA 2C1OA 4P0DA 3MRQB 1NDGA 3O9WA 4IRJB 6FABH 3RKDC 2IG2H 2MHAA 3A6BH 3V95A 3TBYA 3VI4F 2VR9A 1KCRL 2FJFA 3GMQA 5BW7A 1WLHA 3UZQA 3I6LE 4AEHH 1BP3B 3E2HB 4KTEH 3PF2A 5IBUB 3Q5TA 4NNPH 2AVGA 4G42B 2X9XA 3JV4B 3BHBB 5M7QA 1EBAA 3VD3A 2ID5A 1KEGH 5LBSH 1XAUA 5JXAL 2FHCA 3EJYD 4K8RL 3FQNB 3MNWB 4GRWE 3FCTA 4XPBL 1T5XA 4MJ6A 5I30H 4ZUWA 3PL6C 3PWNB 5DFVD 5GISL 5T1MA 5EIQA 1T2QL 3HE7B 3UJIH 4UDTB 5DJZB 4XAWL 4PRPE 1WFUA 4RGOL 4PRPA 4WO4B 4EN3C 3BD4A 3QCUH 4G5ZH 4LBEA 4XNYH 5BZWB 1BF8A 4I3RH 1EK3A 1CGSH 2N4IA 5I74B 3G6JB 3AMKA 1JZ4A 1JP5A 4HUKB 4OBSA 4Q2ZB 5DHVH 1ZLUK 2XZCL 1A22B 4R7NA 2AXFA 3MJ9A 3H7BA 4P5TA 4L8BA 4KTDL 1JGVL 2E7BA 4ZUTB 5GRUL 3ARXA 5I16A 4GS7B 5JDSB 1U2CA 4JFEE 2BFVH 1CFBA 3QI9D 1S9WB 1UH4A 4OKVB 3AM8C 4JFEA 1Q72H 5GGSB 1LHZA 4Z8FL 4RZCB 1CFQA 1IGTB 1NAMH 4G6KL 1WBYB 2FBJH 3KR3L 2N7BA 1I3VA 4ENEC 2EE2A 3CVHA 2Q86B 3TV3H 2M1KA 4HPYL 4OCRH 4ZTOH 2P45B 4Y16C 5I73B 2IGFH 1F3DH 3QEHA 1MFCH 4LARH 4ZYKB 4J4PD 3EFFB 4Y2DD 5F3HA 1URLA 2AK1H 1TZGH 4XWOC 2NY1B 4KAQH 3SJVD 4ZOBA 3EFDH 2PKDA 5LQBH 1UEYA 5IW1A 1U41A 3ET9F 2J1KA 1FLTX 3UDWA 5LGJA 1UT9A 4FFVD 1C12B 4EDXB 2H26B 3L7FB 4LP4A 3DETC 1GVIA 2WAHA 3AB0B 3FHQA 3FONA 3ZYIA 4G6FB 2FR4A 4DCQA 2NY7L 3QWQB 5HVFB 4KTYA 3D87B 1AC0A 4R8WL 3WFDL 2Y06L 3TIEB 3ZTNL 4K3JH 2CD0A 5EO0A 4LSTH 1T0PB 5C0EB 3OR7B 5HHME 1IAMA 1MLCB 4LSPL 4Q6IC 4PJGF 1A6UH 1SYVA 2HAZA 4MAUL 5JHDD 3Q6GH 4YR6A 1KB5A 3GMRB 4I48A 1CS6A 4N1EA 5C0AD 2C3VA 5MEPB 1U42A 4WI6A 5DVNA 5IQ7L 1GGCH 1RZ8A 3BJ91 3THMH 3V6OC 2X4TA 5JXEC 4YAQA 1CBVH 2VUOA 4HJGA 4P3CL 5DVMA 3X3FL 1MFDL 3W2DH 2W9EL 1KSRA 4GLRI 2VXVL 4UU9B 4JZJA 1QSVA 2P49B 3VGAB 2B8OT 5GGTL 2PR4H 1IEAB 2YWYA 4D0CA 3ARBA 1INDH 4HKJB 4D9LH 3CXHK 2FLBT 4JFYB 1OW0C 3P4NB 2FO4A 1XGRA 4FP8H 4R0LB 4AEIL 4RNRB 4JGUA 4ZO8A 1IBGH 4Z7NF 4CVZA 3LRSB 3L3IA 3F7VA 5TF0A 4GRMB 1BIIB 1QKZH 3RPIA 3SQOL 3ECBA 3WL9A 4Y19E 5HHXL 3RZCB 1A3RL 5GHWL 3NFSL 3GSOB 3TBVB 2DWEB 4HS6B 1FFOB 4Y19A 3H9SE 1NCBL 4LLYA 3H9SA 1ZHBB 4U6YA 1DVFB 2YRLA 3IDJA 3GSVB 2K7PA 4NBZB 2PTTB 3K8KA 2EE9A 4JDTL 2WZPD 4AL8L 4PLKD 5E2UL 4GG6B 3BPOC 4L3CB 2BY3A 2XQYK 4ODHH 2C4XA 2JK5A 1A5FL 3C8KA 4OCLC 4GW4B 3V7MA 1BREA 3SPVA 3FRUA 5TH2A 2I25N 1KC5H 5E08L 3HHRB 5EC1B 3OL2A 3QEUB 1CQKA 1PSKL 2APBA 1HI6B 1Q8MA 4YE4L 1DQMH 2W91A 2BNQD 2XZQL 5C7XL 3HC0B 1EPFA 1N0XL 4MS8C 2V5TA 2NX5E 4O58H 4S0TD 1XIWD 4OFPA 2NX5A 1I1FB 1S7SB 5C0JB 1OB1A 5DTFA 1FFPB 4HHAB 1U8HB 1A1OB 1OAKL 2Y9RT 1I1AD 4JN2A 4GOSA 1G84A 1A0QL 2R4RL 1UKSA 4NKOA 4BKLB 2PXYA 3VI4E 1KLUB 4JG0L 3H6JA 5D7LD 3V5KB 2KZWA 1MFEL 3QUYC 4BH8B 4M9OA 2P24B 4RSVA 3UJJL 1KEML 5EN2B 1MRFL 1U36A 4WUUD 2WWKO 2W1NA 2EICA 3HPJB 2ZG3A 4R9HA 5SWSD 3MLSL 5ACZA 5D5MB 5I19L 5GJSL 2P4AB 3CGTA 5J1AB 4PLNC 5E5MA 3NH7H 4L4VD 3OG6B 1AP2B 4X5LA 5ESQA 1BOYA 1A21A 4JY6B 5ESVA 3BYTA 4O02L 5FO9A 3RGVC 3FO1A 4R3SA 5L7XH 3X13A 1WEJH 3NABH 4NUJB 3SDAA 2Y5EA 4GXUN 4MWFB 1OSZB 4I3GA 2I60H 3ZTJG 1DBJL 3QDMB 2BY2A 3EYQC 3CPLA 1Z3GH 5J57B 3T0VA 3WE6A 5DHYB 3ZDXE 1FN4B 2F9BT 3PWLA 3C8HA 1T20A 5HJ3B 2XNAB 5I18H 3TO4D 4YIQA 3HS0B 1J0HA 3KS0H 3O3EB 1T21A 3R1GH 1S7TB 5I1AB 4KI5E 3GI8L 5H94A 3MV9D 3S36H 4LEOB 3GNMH 3IGAA 5FKAA 4XP6L 5C8JA 2DD8L 4RMVA 2C26A 1XF2A 3HZKA 3MGTB 1X5HA 5IWLA 4LRNL 4I13B 5KVFH 3VXSD 1WF5A 4JRXE 1A4JB 2VLKE 4NZUH 1HILA 3OKYA 3ZMRA 32C2A 4JRXA 5C0NC 2VLKA 2WM0A 3KDMA 4FQ1H 1BJMA 1HHJA 3GMOA 1FVCB 1UCBH 1ZWIA 5KS9B 4PV8B 4WJ5A 3MRNB 5FHBH 3SKJL 4ALAH 5L8LB 1J0JA 2YN3A 1I8MB 2VZ1A 2LE9A 2X40A 4N1HB 1W0VA 1KIPA 5KG9A 2APTA 2YWZA 3LEVH 1ZA6A 5HGBA 2XN9D 5KTEL 3OHXA 3TFKC 4JKWA 4IMKA 4JVWA 2HT2D 2V5YA 1QG3A 2VL5A 3ZHKA 1HIML 4DN4L 2EYSA 3QB7C 2WBJD 2A77L 1VFOA 2F54D 3KPMB 4HFWA 4WW2F 1U8PA 1QHPA 4XC3H 2A9ML 2DYPB 2EH7H 1E4XL 3X11A 5TE4L 5JIKA 1PEWA 1EJOL 4ONFL 4PJGE 5AD0A 5J13B 4OGYL 1ZGLP 3IETA 4LAQL 1INEH 4MAYD 4PJGA 1T7WA 2EYRB 4LPCA 1DE4B 3DMMB 1NFDF 2XXCB 3QHFH 5F9WB 5E5RB 4OTXH 4XP1H 1H3XA 5ETUA 4GAYB 4ODUA 2VAAB 4ORGB 3C08H 2C3GA 1MCPH 1MCFA 4DUWA 4MQXC 5J9PA 2NY3D 3FB5A 4UV4L 4W4OA 2E5EA 5K9KA 2Z8VC 1UWGL 5B39B 4GBXD 5C0BD 3E2HC 1H8SA 1RUQH 2NY0D 4Z0XB 4XMLH 4UOJA 5DWUL 3BQUD 3TH3T 1A1NA 1ND0A 5LXGH 4MSWA 4NO5B 1SBSH 2I9LA 3E6FA 1M7XA 3G5XB 3B6SB 3MRCB 3O81A 4Z7NE 1GGBL 1X4YA 25C8H 3FQTB 5JORA 1Q0YH 2R0ZL 4Y2OA 1TVDA 3CDYA 1MEXL 4Z7UB 4POZC 1WAAF 4FZ8L 1SJHA 1FNEB 4IJ3C 5FB8B 1JPTL 4YHML 2FD6L 4HKZB 3W39A 3RFZC 4BUHA 2YUXA 4D8PA 5FYJD 3V4VH 4V2BA 3HI5H 3BEWA 1NGPL 1N6VA 4KK8C 3EYOB 4FQXA 2VXQL 4LLAA 3GDBA 4OLZL 3OZ9H 4X0KA 1MCRA 1HWHB 4MNGB 2EDWA 1JZ6A 2G2RA 4WVRA 4WI4A 4QT5A 1PW3A 1CI5A 3VGHA 5CIPA 5CWSB 3RWGB 3EZ8A 4GS7C 1R3JB 2YA0A 4L3AA 1EX0A 1BLNB 1V3JA 1G7QB 3CFCH 1HSBA 1OY3B 4J8RB 4TRPH 3TLRA 2LVEA 4OV5A 2B2XL 3NFNA 1LK3L 1JMXA 2Q20A 1T5WA 2VXTH 4OLUL 5I73C 4Y4FB 4OCXH 3GEWB 2NYYD 3LMJH 4RGMB 5DJAA 5JHLH 5F9JB 2GT9A 3O8XB 2NY1C 3UTSE 2QHRL 4MD0B 4QHNA 3UTSA 4Q9BA 4KPHL 1OOAA 5GRJH 1CE6A 1L0XA 3BH9B 2DLEA 3KPNA 1T66D 4IOIB 3P3YA 5DEGB 5D6CB 4IRSB 2BVOB 1KGCD 1X5LA 3AB0C 3GBMH 1EEQA 2J8UB 4KJYA 4KRNA 4XWGL 1BOGB 1I1CA 3T77A 4FABL 1MIEL 3RQ3A 4I5BA 4W68A 3PV6A 5EFIA 2A6IA 4XP5H 1AQKH 4ZS6D 3SCMD 3ULUL 4B41A 4N1CA 4POUB 2D0GA 1FP5A 2ZNXA 5B8CC 4WWKB 4QXTA 5HHPB 4DKAA 3UYRL 1T7ZA 4MJ5B 3OKDA 4TUJA 1MLBA 1CGWA 4B7LA 4Y5VA 3CZJA 5KZCD 4GXVL 3E6HB 2A6DB 2LTQC 4H8WC 5HHOE 1HHIB 1VKXA 1YPZB 5HHOA 1PAMA 1CU4H 5IQ9A 2EC9T 1BIHA 5FO8B 3VGAC 2HWZL 3SY0B 3BZEA 4F7MB 2OZ4A 5DT1L 3BDXA 1WIPA 4JR9L 4QHUB 3BKMH 3ZYJA 1UWXH 4HXBH 1CK0L 4R90H 2ADIB 2O5XL 5FHAL 3PWVA 1YN7A 2BDNH 1AKJA 5D1ZD 3MBEA 5IB3A 3QDGD 5FXCH 1OM3L 2GHWB 3LN5B 3RZCC 1FGNH 3LS4L 4I0PA 1R5VA 2ZPKH 5E8EA 4UT6H 2EZ0D 3PJSA 5FYKE 1A9EB 1R3KA 1LEGB 3BZFB 4JN1H 3D5OF 4CMMA 4HG4J 1FSKB 3UTPE 1P6FA 1LO2H 2P7TB 2B1AH 1DP0A 1RK1B 3CVIH 1AY1H 4R4ND 3WNMA 4DVRL 1IAII 2IAMA 3QRFM 4ZS7L 1VB9A 2CLRA 3BWAA 2DKMA 4D0BA 5ABDE 5CZKA 5F9AC 3TZVB 3CFDA 4U1SA 4G9DB 3FQUA 4E42A 1TZIB 2Z31D 5BS0E 5EU4A 3MCKA 5BS0A 1OD9A 5DD5H 5F1OB 3VRJB 3D2UD 5HTSA 2A9NH 5IHBA 4OKDA 1MCDA 3QIWB 3WKML 4WFFE 2LFGA 2EDLA 2EDOA 1AI1H 2NXYC 2ADGA 4KJPD 1U8JA 4I3SH 4P46C 4X6DF 1NEZB 4A2LA 2I9TB 3FAXA 4GG8A 4FZEH 2K1MA 3INUH 1T0MB 1GHFH 5C0DB 3PGFL 3GI9L 5IJVB 3WN5B 3OB0H 1OAYH 3IF1B 1TIUA 2H3NB 5EIIB 1KCUL 3O3BB 5T3ZH 1DUYA 3QDJE 1BD2D 2VERN 5JZ7D 5FYLH 1A2YB 1FYTE 4HGKC 1G1CA 2DI7A 4ETQA 3U6RA 3GIVB 1FYTA 2BHUA 1TJHL 1WAAE 4J6RL 4ELKB 1WJ3A 1WAAA 3VRLF 3L3GA 1YEHH 3R4DA 3S5LB 5A2KH 2FX9L 2X4QB 1S7UA 1S5IL 1IQDA 1R3LB 2XXMB 1DUZB 1FIGL 1G7LA 3BGFB 4GFTB 3RL1B 3T3ME 4HQQL 4MCZB 1OPGL 4HFUH 4KQ3L 5EOTA 3QULA 4H25B 2BVPA 4G3YH 3U1SH 4M48L 4MQ7B 3LKOB 3CMOL 5FK9B 2XKNB 4HS8H 4N5ED 1MAKA 2WUBH 3EOAA 3C5JA 4NQXB 1XGQA 2VKXA 1M7DA 2GUOB 2R23A 3PL6A 3VWJC 2DJUA 5DD1L 1FG2A 3CD4A 4OV6F 2QADD 1NJ9B 5BCAA 4U1KB 3HRPA 4K7FA 3L5XH 2F19L 5DK2B 4YFLF 5F70A 4EN3A 3WDJA 4YHYC 43C9B 4N0CC 3V6BR 2H2SD 3TN0B 3JV6B 3ULVF 4AJ0A 4YO0A 3TJEH 4MJIB 2IPUK 2BERA 2R0WH 1XF3A 2F8XC 5EBLA 4FTVE 1MI5B 1PZUB 4BZYA 3OMZA 1I9JL 4ZUVA 3AM8A 2BP3A 1YECL 3U7AA 1MFAL 1C5DB 2D0FA 1P7QB 1E4KC 2OL3B 5KVEL 1U8MB 4BK5A 3EJZC 3GKWL 3IDNA 5I1CL 1QSFB 4LNRB 5J13C 2EDQA 4Y16A 1OAUH 4NQVB 1RMFH 4R4FL 2E7LC 1QD0A 5K9OA 3IKCA 3DMMC 3DVGB 3QT2A 5FGSA 3HNSL 2E9JA 4M5YH 4J12A 2VDLL 1U8QB 5F9WC 4UNTA 1Q0XH 2FJGB 1S9XB 1CFTB 2UYLA 3FT2A 3GSQA 1ZE3C 5K9QI 3SEPA 4ZPVB 5F7DB 1SMAA 3BD3A 1NCWL 3IDGA 2HG5B 3TJHC 3RHWF 3UBXA 4HAFA 4HT1H 4K7PY 4MHHI 4X8XA 2HFEA 4PP2B 4O4YL 1KJMB 3OJMB 4IRZH 4MA7L 1JFQL 2D4FA 3T1FB 4H1LG 4KVCL 3VFMA 2DKSA 4NUGH 2R2HB 3VFRA 4M6ML 3VXQA 1KTKE 4Z95L 4HGMA 5DI8B 5FIEA 3I02B 4F9PC 2BOBB 1NKRA 3H9YA 5LCVH 4Q6IA 2IH3A 4A6YB 2EIDA 4TNVF 3P40A 4XMPH 1CLZH 5CEZH 4KKAD 1FV1A 2CO6B 3V6OE 2D03H 5IOPA 6CGTA 4M1GL 4YHZL 4S1RL 3V6OA 5I1EL 2PNDA 5EU3A 5JXEA 5DC9B 4KKLC 4MX7A 2V17H 1OF2B 2QLVB 2X4SB 4OZFG 4RWYL 4N90D 5DQ9B 3DXAD 3HE6D 3ZKXB 1TPXB 2DLGA 1MHEA 1RZFH 3WIHH 5IMMA 1CD0A 5DHVA 1UVQB 1ZHLB 5LAXB 4L3ED 4YHKL 1FPTH 5T1LA 2Y07L 3O9WD 3DVNB 4ZNEE 2P8MB 1HHHA 5CUSH 5L8KB 1YDPB 3CLEH 1CG9A 3O2VL 3L1OH 4ZNEA 1OW0A 1ZHNA 2AEPL 2IBBA 2WSKA 2RQ8A 1Z9LA 1YY8B 3Q2CA 3WD5H 4DQOH 3EYUL 1OP5H 5ADPH 2X70B 1KPRA 2HVJB 5SWQA 1KT2A 4OLVL 2DIBA 1N4XH 4E41B 2VR4A 4PRHE 3I6LD 1DN2A 2C7UB 2X1QA 5CMAB 4UUJB 4MDIA 1HDMB 2CPCA 3ARDB 5C2UB 4PRHA 1GGYA 5D70L 3J7HA 4JFOB 4OLWL 3QG6B 4Y4FC 3VA6A 4X6DE 4EVNB 2XG4A 1IAKB 3BPNC 4X6DA 2WINB 3O4LB 4LQ1A 4BA8A 4LOUC 3G6JF 5HI4C 3NIGF 1DQLL 3QXDA 3U4BL 4EOWL 1MH5A 3BZDA 5ICXB 3QBTB 4G7YL 1VEMA 1AHWB 3BKCL 4DZ8B 4KROB 5IB1B 3WUZA 1I75A 4QXGL 4PRPD 2A38A 4X7DC 5I8EB 1UH2A 4Y0GA 4OCYL 3WNOA 1EEUA 1HE7A 1ZGLB 3DLQR 4P9HL 1MJ8L 5HDQH 5K59F 4I18B 3QDAA 1ES0B 4HMCA 3V5DB 3PDDA 4MA8H 3U9UA 5INDA 5DMJB 3DVFA 3WEXB 3ALPA 2PYEE 5FYJL 4WWKC 3AAZB 5DF0A 4XNQA 4KRLB 4JDZB 4H1LA 2PYEA 4PJBE 2DBJA 5IEKB 4IS6B 2OI9B 5I8KL 4PJBA 1SEQL 1N64H 3MRFB 5EDXA 5FOJA 1FBIH 1H9VA 2QR0B 4OM1H 3QUYA 2Q7NA 1AGFA 3P4OB 3BO8B 3BIKA 4LVHB 3SOBH 3WO3B 1D5MB 4TTDC 1CIDA 3GHEL 1LVEA 3ZHDA 4GMTL 3S96B 1YEEH 4M7KL 1RHHB 4G6JH 2HKFL 4RCAA 1F5WA 1ZA3A 4J3VA 4CRPA 4OZFA 1FL6A 4FQQB 2Q8AH 1JGUH 4K3DL 2J5LB 3RGVA 2GY5A 1X3DA 1YNLH 1EHAA 3Q3GB 5KSBE 3GBNH 1GZPA 5CBEA 2BNUA 5H2BB 5KSBA 3T08A 1NAKL 4NYLB 5DD6A 4H0HB 2C1PB 2P1YA 4LEXH 1C08B 2IALB 1BFOB 1A1MB 1FSKC 3GMNB 2CO7B 3QA3B 5HHMD 2O61A 4CW1A 5DJCA 4HH9B 4HEPG 3TZVC 3ZSTA 3LKPB 1IGCH 1UJ3C 3LKQB 1AXSB 4DGYL 1ZANL 4BSVA 3B3IA 2Z93A 3HCVB 1AIFA 3TYFA 4XCFH 4KUZL 4WGVB 2EO9A 2X4PA 1F6FB 2E8ZA 1HZHH 4WCYL 4WY7L 2GTWB 4PJIE 2J6EH 2HTKC 4JREB 4PJIA 2VC2L 1ZKAA 2ICWJ 4LGPB 4NKIL 3B9VA 3LKRA 4L8DB 4R7DA 4JZNA 4NKMB 1EEZA 4GG6F 1GOFA 5F1IA 4PGEA 2IBGA 4Y19D 1LE9B 3V7AE 2ILLA 1NLDH 2ZOLB 4PR5B 3WN5C 5KOVC 1IM3A 4KH2A 4NJ9L 3H9SD 3GO1H 4JPVL 3MRRB 1TCRA 2IADA 2HJKB 1IGMH 5FCUL 3EUUA 3ILQD 3MRDA 5FV1L 5BQ7A 2OL3H 5CCKL 4LCCB 1FVDB 5GS0D 2BXZA 2ZCKH 1F6AB 3GIZH 5AAWA 5IW6B 3CCHB 4HWBL 4DVBB 1YQ2A 2Q87A 2V2TA 3FL7A 3F8UB 1FL5B 1J5OL 3MLVH 4CADA 5DJDA 2YR3A 2OMNA 4D9QE 3RVVC 3C60B 2CRYA 1I3UA 2YC1B 3MRQA 4ZXBD 1IJ9A 3PXHA 1L9MA 4J3XA 1A7RH 4R2GD 3S35L 4C59B 4OQ1A 1DANT 5FDWB 4X5WB 1QO3B 2NX5D 4YDJB 4YQXL 2NY2C 5I2IA 2VDKL 2HFFB 1T7VA 4G42A 4X5XB 3OSKA 5DR5H 5FM4A 5E03A 2ICES 4N8VG 2VISB 3O2DL 1Q38A 5D5MF 5I0ZA 3MNWA 3JWDL 2PXYD 2L7JA 3NPSB 4DTGH 5GRWA 1VA9A 4XPTH 2AJXH 1J05B 1GSMA 2H1PL 4Y4KD 5AYUH 3D39B 4A6YH 3TYGH 4UQ3B 4LPXA 3GMPA 1F4XL 5DJZA 1PKQB 3BT2H 4LSUH 4PS4L 1AQDA 3W0WD 4PPTA 3G6JE 3PE9A 1ROWA 3NIGE 5DRNB 1YMMB 1GIGH 3G6JA 3MRKB 4QYOB 4OD3L 5CZXC 3G9VA 3L3JA 1SY6L 4UINH 5KSUA 3VXUB 1BBDH 3RVXD 3KNBB 1F97A 3P30H 3ZT7A 1RUPL 3NTCL 3CFEB 3FQXA 3TT1H 4WEUD 5DVOA 5JDSA 5INCB 1UC6A 1OLLA 1S9WA 4OKVA 3SDAD 5JDJA 3MLRH 5F6HJ 5TE7H 5GGSA 4RQQA 2YD2A 3FQWA 3I50L 1IGTA 1WBYA 4OF7A 1FLRH 3S35X 1I9IL 4JAMB 4U0QB 3B8SA 3GMLA 5ID1B 2P48B 2Q86A 2XV6B 4P59L 2ADFH 4PJFB 2Q7YB 1NCDL 4ZYKA 3FQRA 1SJEB 4PY7B 3V8CA 2FIRT 3MRHB 4G6MH 2FZ3B 4DZBB 3AS1A 4KI5D 1M05A 2ZCLL 4FHBD 3WKNA 5KS9F 1T1YB 3WHE0 2P42B 35C8H 3O4OC 3REVA 5SX5H 5HD8D 2DQTL 1C12A 2VLRE 2H26A 4NQDB 1IE5A 5DJXA 3F65A 2VLRA 1RZ7L 3OXRB 2I07A 4JRXD 3QPXL 2ESVD 3RIAK 4O00A 4I8DA 1FHGA 1BZ7A 1P6AB 3QWOA 2AK4B 4K23L 1FFQA 4H26A 5D2LB 5A3IC 4F7EB 2OX5A 3MCG1 1I8KB 2GJZB 5HYJD 1I1YA 4N8VA 1RUAL 5B8CA 4M8VA 3L7EB 3B5GA 3GMRA 4NFDA 1YNTA 3E1F1 3STZB 3QP3A 3RNKB 3SGDH 5MEPA 4CU6A 4PJ9B 5E4IA 1JJUA 1YMHB 4PJHB 4UI2A 2R1WA 2YRZA 1A6WL 3VU2A 3U0WL 3ZKXC 2X7LA 4EBQH 4LF3A 1BJ1H 4HIXH 2BRQA 1S9YA 1D7FA 4OGZA 4X6BB 2V7HB 5FFLA 4JFYA 3P4NA 1FNGA 3MSPA 4MXVE 2DQIL 1K8IB 4KK9C 3ZLQC 4RNRA 2JELH 4QHLB 2CIKB 1L0QA 5HI5D 4Z7UF 3TVMC 1BIIA 4HC1L 5HYEA 4KDTC 1EAPA 3SE9H 3RZCA 2CKBH 3GSOA 2DWEA 5D1XB 2D3VA 5F89B 1F11B 5BXFB 3MREB 3F5WB 1ZHBA 1B2WH 1A47A 4MHHG 3GSVA 3K8MA 1LGVA 4GAJH 1Q1JH 2AXGB 1IRAY 3ROOA 3WBDA 4U1LA 3MO1B 4L3CA 3LCYA 4LCWE 1RZKL 4M7LT 1KIQB 4LHUB 5CBAB 5J8OA 4LCWA 2J4WH 3EHBD 3QUXD 3E8UL 1MRDL 2VE6A 1LO4H 5EC1A 3QEUA 1DR9A 4FQXD 3EDEA 3RDTC 3VXOB 1HI6A 1AR1D 4Q7DA 4DW2L 4P5KB 2P43B 3UC0H 1MIML 2BRRH 2GKIA 3I75B 4LASL 5EPMB 2EH8L 3KLHC 3HLAB 2FO1A 5E00A 4XB8A 2G75B 2Q8BL 4WEMB 5BV7L 4X7SH 4X83A 4MB5A 3HZVB 1FO0L 4HHAA 1U8HA 5CINH 4M7JL 4P46A 1F42A 2FJHA 3CSGA 4BSJA 2Z8SA 1J0ZA 1YEFL 1KLUA 2ATKA 3VFUB 4JB9L 2IANE 5DQJA 4XPFL 3V5KA 4AYFA 3S97C 1AGBB 3EO0B 3GM0A 2IANA 1G7MB 1ACYL 3RIFK 2P24A 1PVHA 4LVHC 4U1HB 2J8UF 2DQFB 1FRGL 5ILTL 3V52H 3QRGH 2CDFB 3FRPA 5GGQL 2HLAB 2MJWA 3UTSD 3CX5J 4L8SB 4QRUB 4E0RB 5J1AA 4BQBA 1R6VA 1GGUA 1U8OB 4P4KC 4AIOA 3LH2L 4KJWD 4C83B 4JY6A 1Z9MA 2J5LC 2A83B 5DVKA 5E2WH 1ZT4B 1OAQL 2ZJSL 4MXWH 1OGAB 4DKFL 3X14B 3AXLB 1RIUH 2WV3A 2XWBB 3U83A 3QDME 3ARPA 4NUJA 3IVKA 1IKFH 1ZLVK 1OSZA 3JWOH 3CMGA 5DUBB 2NQCA 5DZNA 3QDMA 3WDIA 4OGXH 4NRYA 1U93B 3GBLA 1YPZF 4PGBA 5DHYA 1FAKT 3W5MA 1FN4A 4XTRC 3NZHL 4JGJA 3LVEA 3GSXB 3N85L 1JUFA 1JNJA 3HS0A 5CZVH 3DTXA 3O3EA 1S7TA 3LPFA 5I76B 4N0YL 5BOZG 5KVDH 3VWJA 4L4TB 3MJ9L 2DBLH 2XG5A 3VFOB 2ENYA 2WLYA 1S78D 2OR8A 1YEIH 3KPSB 1FG9C 3TCLB 1IQWH 4RFNC 1A4JA 1G6RB 1NCAL 4OB5H 3CSPA 5ITBL 2VZ3A 2OQJA 3MOQA 4XI5D 1DBKL 4U3HA 4JREC 3CVHL 1VPOL 1HCFX 4PV8A 2W0PA 3FOMB 4CL7A 5KVGL 1G7JB 2WANA 1AKJD 4LSSL 2JB6B 5E99L 2AJ3B 3MOAL 3MMEA 3RX7A 3T0WA 3VXTA 4JFHE 2NW3B 4MDJA 2XWTB 3UTTB 3PWJB 1BEYL 1KNOB 4XNMB 4PJEB 2NLJB 3KPMA 3K4ZA 1E4KA 2ITCB 2DYPA 3MRLA 3G04B 3UTPD 1ZHKA 1JNHA 3QQ9D 3RWDB 3MNVA 3STBA 2E7LA 3C87A 4OSUH 3OJ2C 1DE4A 3DMMA 4ORGA 1A7OL 1MQKH 1NGXB 1JPSL 5TPWH 1N59B 2NY5H 1QFHA 1AGDA 1KB5L 3VWKC 3ROLA 2ZSVB 5EZLA 5B39A 1JYWA 3RY5A 3JWOC 1Q9OB 1CVRA 4ZUSB 4Y88A 4Z0XA 4R26H 4JM4L 4EJ1C 1U58B 3KPOB 4NO5A 4Q97A 3LD8B 3NPSC 3G5XA 3B6SA 2R0LH 1FZMA 3MRCA 1C8PA 3LIZL 3B2VL 4R96B 4F9PA 3NCJH 1IL1B 2ZCHH 5HHQB 4FQJH 2XZAH 5H37H 2Z8WC 4UDUB 1IAIH 3VDAA 5I75B 5E2JA 4U6VL 2GQHA 4KRPC 4QRRB 2FYYA 2GITB 2P47B 3QDJD 4HUWB 2E6PA 4YDKL 4YBQD 3I3BA 1B0GB 5MP6H 3K0WA 1FYTD 5I8OL 2FEDD 2MTPA 2CDEB 3VMNA 5DFTA 4AIXA 1ZLUH 2HKHL 1RJZB 3RWGA 4GQ9H 5GS0L 5GGVL 3MZGB 3RKDD 4O2CB 1XGYH 4M61A 3FB7B 4UILH 5HHVH 3X3GL 4UAOB 5TFSH 3WXVH 3BH8A 4U1IB 4J8RA 3KLDA 1MWAL 1QPXA 5F71A 4KUCF 5C09D 3REWB 5I1IH 1QR4A 4HJJH 4TULL 5F21B 3LKNB 4NP4L 5FUZL 4UTAL 4Y4FA 1MVUB 2XYCA 3T65B 1I7RB 1MCWW 1Y18B 3MLWL 3PL6D 5F9JA 1FJ1B 4O5LL 4MD0A 4LDLB 4Q0XL 3BEVB 3HAEH 3S88H 3KPTA 4HBQA 3MV8B 1CFVH 3AGVA 2Q76A 9CGTA 5JUEL 1H8OA 4EN3D 3IJSA 2QSQA 4P99A 1PQZB 2DTML 1E27B 5DEGA 5ALCL 2BVOA 3WUWB 4IDJH 2G9HA 2VQTA 2APFA 1ZVSB 4JM2D 4HUXB 2MPAL 2V6HA 2W59A 5CEYA 3QQNA 1RZJC 1FORH 3C5ZB 3MYZA 1DFBL 3LEYH 3T4AB 3K80A 3Q5OA 4YEFA 1ZLWK 1U8LB 2IFFL 4FQLH 2RCSL 3K81A 4FTVD 4WWKA 5CEZE 1LO3H 3MRMA 3VFPA 2DM7A 4HWZB 4XP9L 3W5NA 4GQPH 5CP3H 3SE4C 2GCYB 5E1AB 4ENED 1HHKB 4L4JA 3E6HA 4RAVA 2A6DA 3DSFH 5I1DB 2VIRB 4X8JB 5I1HL 1HHIA 5E95B 1TVBB 2VZSA 1LWRA 4WI8A 3JTSB 3MJGX 3VJ6A 1YPZA 3MA9L 5F7MC 2L4OA 4F37F 5IBLC 3I9GH 3PWPD 1X7QB 3S3SA 3WIHA 5ID0B 3H42L 3S3JA 5TQ0L 4ODSL 1MREH 3RWHB 2GEEA 5K9JL 3LN5A 1UXSA 4KU1A 5HYIA 3CLFH 5D1XC 4UT9H 2FWOB 4YHLH 4XP4L 5DZOA 1VADB 5B3NA 3O41B 1LDSA 5TDNA 5KSAC 1LEGA 1U92A 3MLZH 1KBGL 2D7TH 3MLTB 1KTDA 2PW1A 4P9HC 4XPAH 5MHSE 2P7TA 2BNRB 1RK1A 1T4KA 1HQ4B 5DK0B 5MERB 4OIIH 1FNSL 1Y0LA 1C16A 2YMXL 4KFZC 1R3IL 3TZVA 3WFZA 4C4KO 1FGVH 1PLGH 1UJ3A 5HPOA 3KGRA 1PG7W 4XZUB 5B4MC 43CAA 3KJ6L 2VITB 4YHPB 4JO4L 2VB5A 5D1QB 3DBXB 1CFNA 4AH2B 1G6RH 1K6QH 3B9DA 1KCSL 3WFEH 1QYGH 5GZOC 4KHTL 5T1LD 1XF4B 4BSWB 1S3KH 4NN6B 5ISZB 4QRSB 3TWCH 3I85A 1NEZA 1U8IB 1QSEB 1NMCC 1JZ2A 1U3HB 3TNMB 5C0DA 2JF1A 1XCQB 1IGFH 4CN6A 3D69A 1F4YL 3O6FD 2F15A 3UPAA 3RA7L 4EI6A 4KVNH 5DJYB 5FOBA 4XC1H 4MLIA 3G6AB 4X98B 5EOQH 2BVTA 3WN5A 1OT1A 5B38G 2VOTA 5DFWH 4OLYL 3VXMD 5DC0A 1D5IL 3RX8A 5HGAB 2HA1A 1XF1A 2H3NA 4N9GB 2VXSH 5EIIA 2NMSA 3ESUF 3HI6H 3O3BA 5CKGA 4MJ4A 3BOVA 4TQEL 2F58H 1PGRB 4GKSA 2XPGB 3DX8B 5IT2L 4XVJH 3U36B 3T0BA 4JFDB 4PJAB 4YXHH 2G60H 1PEZA 1U2HA 4UT7L 5IB4A 1SJXA 1S5HB 2DQHL 2UZIH 1MF2H 1W72A 4HJ0C 4M8QB 1JHLH 1TQBB 1QEWB 1RK0A 1CDCA 1R3LA 1YEJL 1DUZA 2VDPH 3RL1A 5J1SC 4M1CC 2MOVA 5GXBB 4Z7VB 3GGWA 3HNVH 4H25A 4WRLA 1A3QA 4QTIL 5C08B 4PB0H 4HULB 3O6LL 4XXDA 4QNPF 5FK9A 4X7EC 2XKNA 3DJ9A 4G8GB 4NQXA 2V2XB 4FFYH 1QUNA 4YX2H 3B5TA 2IPUG 4LCYB 4JANB 3ISWA 5E7BA 5LVEA 3QUYD 4XPGL 2B4CL 2FHBA 3KAAA 3L5WA 1NJ9A 3T04D 5C6TH 4NO0B 5DK2A 1YY9C 2HFGL 5F97E 2IQAB 3EDDA 43C9A 1V3LA 4ESKA 3JV6A 5EOCL 4MJIE 1J8HB 2VABB 4BH7B 1ZSDB 2GK2A 1FDLL 3LS5L 3O0RL 2NY4D 1SQ2N 1I3RA 1Z5LB 4MJIA 2VLJD 1TFHA 3RGVD 1OCWL 2EDDA 3WIIL 4Q9CA 5IVNA 3FMGL 5GRUH 1F58L 5TGBB 1MI5A 1CYGA 2OTUA 4ZFGH 4PYHA 3QQ4B 2D7NA 3LPWA 3EYQD 1P7QA 1INQA 1WZ1L 1X5XA 3DUHA 4L9DA 4XNUH 2OL3A 1AE6H 2AI0H 1GL4B 1U95B 4KC3B 5IVXE 4M93B 5BRZB 4ELME 2B5IC 3IFLL 3QYCA 4NQVA 4P2OC 5IVXA 1WGOA 5IFHL 4ELMA 3UPCA 3DVGA 3QFDA 4XCEB 3O3AB 5I9QB 3X12B 4AG4H 3F62A 1S9XA 1CFTA 5C0CB 3P77B 1UQSB 2DQCL 5EUOE 4LCIH 5F7DA 2YPLE 3OJDB 4F58L 1KIUA 5B38B 1J1PL 1T1WA 1HH9B 5EUOA 4IOSD 2YPLA 2HG5A 2YPVL 4PP1C 4XVUC 1J18A 4GUPB 5C0ND 1CLCA 4PP2A 5MENB 1KJMA 3HMXH 1GC1H 2LV4A 3QIUB 4MNHB 4HG4K 5C0RH 1I7ZB 4L8CB 4JLRA 3VMOA 1J8KA 3LD8C 3L5IA 2R2HA 5EU7C 3K8LA 5IMOB 2DM2A 5HY9B 3DX9B 4CVXB 3WLWC 2OZ4L 5E9DD 3TFKD 3KPRE 4MAUH 5IR1A 2HT3C 2P8PA 3KPRA 5I75C 1I7TA 3MOBH 5IQ7H 2FX8L 4JHBA 3HR5B 3UYPA 1FCCA 2GYSA 1D5BA 1RV6X 4HKXB 2R29H 4BQCA 4CU8A 1FH5H 2C5DC 4BFIB 4L1DA 1MFDH 2CIIB 1OF2A 2X4SA 4HDIB 5DQ9A 1LO5B 1JE6A 2D2OA 5EBGA 1IGYA 4FG6C 3U7YH 5AG8A 1I7UA 3MX0A 3GZKA 1BM3H 1UVQA 5LAXA 5FYKL 3U46B 5BVPH 5CSGA 3DVNA 3ZL4L 4MQXD 1YDPA 1JGLL 5FA4B 3RWFA 2EDFA 4Y5YC 1WCBB 2VJXA 1FCGA 4HF5L 1GGIL 5EBWB 4X7TB 3OAZH 4MA1B 1CL7L 3TVMA 4JO2L 1J10A 4RX4A 2C7UA 4KDTA 5CMAA 5DD0L 3RUGB 3C5SB 4QY8A 1HDMA 5EZJB 1V3KA 3BN3B 3V0VB 3B5HA 3QG6A 4JCMA 4JPWL 1IC5H 4EVNA 1IAKA 3IRPX 3TPKA 2WINA 4CKVX 4JDTH 1B4JL 4POZD 4QRTB 1T1XB 4RISL 5ICXA 1RIHH 4OFDA 2CQVA 2DS4A 5IB1A 4M6NL 1N7ML 5CSZA 2VDQH 1UH3A 1HKLL 3B9KC 4JRYD 1JGEA 4B50A 2FIKB 2R15A 1ZGLA 3RDTA 3K2UH 2A0LC 3TH2T 1GC1C 5SV4A 2BVEA 3I3DA 3C5ZC 2W60B 3V5DA 4QCIB 5AEAA 3KYAA 4AM0A 1DEDA 4WTWA 8FABA 2MQ3A 4GMSL 5T5FL 3S6CA 3D48R 2W9DH 4PJFF 4OFVA 5I1KL 1VGEL 1OAKH 1DQDL 5IUSA 3GUTA 5IEKA 4D0DB 2WUCH 1G9NL 4JG0H 4DN3L 3BZ4B 3LPGA 3MRFA 1I4FA 4YHOL 4LDOB 3BESR 3OKNB 1OLZA 1Q9LB 2R1YB 5D72L 2AQ1A 3MLUL 4JZOA 5IMLB 2CLVA 3D6GA 3IU3A 1LNUB 3IT8D 3MLSH 3OGCB 3QI9B 5D2LF 3BI9X 4KKBC 5GJSH 2YN5A 1P4LB 1LK2A 1RHHA 1C7SA 1A9BB 1QLFA 4IMLA 4DAGL 1X5GA 5MI0C 1UWEH 4FQQA 4P4KA 2EE6A 2VLRD 1F8TL 1BGXL 1CR9H 1JIBA 2R2CA 1LQSR 4QKXB 4Y2DB 5CILL 1AC6A 2EO1A 1MELA 3RU8L 4U0RB 3KYKL 5JW4R 3Q3GA 3F7QA 2CKBA 1H0DA 3MRIB 4PG2C 3SJVB 3ZKSD 1JV5A 5H2BA 4BZ1H 4UOW0 5T5NG 2CJUH 2DQJL 4NYLA 5D7IE 2HRPL 4XBEL 2DRUA 1P5UA 2C1PA 2IALA 1BFOA 3NCYS 5E2VL 5I66A 5D7IA 5CP7B 4MA3A 3QA3A 4EZMA 3MUJA 3BKJL 3BUTA 4QF1B 1AXTH 3QAZB 2Y5TA 5ITFB 4J1UA 4M62H 4HH9A 1EXUB 5FO7B 4N0UB 1NGQL 4L29A 5BMFH 1E4WL 1L0YA 1AXSA 1U8NB 4IBLT 4TVSa 5TF1H 1EEYB 5E8NB 1ZMYA 1NLBL 2DQGH 4NWUL 1P7HL 3HCVA 4U6XB 1FE8H 1KJ3L 4ISVB 5JHDB 1CDUA 2BXYA 4C55A 2VDNH 1EVUA 4Z7QF 1A8JH 5C0AB 1RJYA 4AEFA 3UTQA 1TLKA 2GTWA 1JI2A 1X5FA 1IILE 1J1OH 3ETBF 1K2DB 1U3HC 3Q48A 3VD9A 5CEXB 5IVZB 1D3CA 2ZUWA 4FFWC 3T09A 4B7IA 1J88A 3Q0HA 4HBCL 3JTTB 4BM7A 3RZCD 1P2CB 4HX1B 5CJQL 5KTEH 3BFOA 2ZOLA 4FFZL 4PR5A 4C58B 4RWHA 1OSPL 4OLEA 1TQCB 4K3EH 2HJKA 6FABL 2IG2L 3A6BL 1EHXA 5JQ6H 1H3PH 3PDOA 3VFTA 4KGLA 3QXWA 5IW6A 2PTVA 3CCHA 4AEHL 1EJOH 4NNPL 1FL3A 1FL5A 5BJTB 1TTFA 4LCWD 5E4EB 4HUVB 1KEGL 5LBSL 1NBYB 4GW5B 1BZ9A 3D9AL 5A2FA 5DEFA 3RNQB 1IAOA 2UWEE 4TSBH 1TQBC 2UWEA 3S37H 1Z9OA 4JE4B 4UV4H 5EA0H 4YXLH 1CGVA 1UWGH 3UJIL 4ZFOA 1CDGA 4XAKE 3VWKA 4YDJA 5DUMH 4NHUB 2H32B 3KPPB 2AEIT 3D1MC 1LP9E 1HEZB 2NXYD 4G5ZL 3ZKNC 4XHJD 4PJDB 4P46D 4XNYL 5IK3A 1QOKA 1LP9A 2EECA 3BYYA 3BP4B 4XVSH 5GSRB 4I3RL 3LQZB 1CGSL 4EQ2A 2BNQB 2KL6A 1S7XA 1GGBH 4HIJB 3D25B 4PRNA 3L9RB 1XIWB 2IAND 4TSAH 4MNQE 4MD4B 5LGKA 1EO7A 2GI7A 4MNQA 4OFYA 1JPTH 1HSAB 3BGAA 2P46B 4OF3A 2BFVL 1I1AB 4JJ5B 5EORH 1DLHB 1IC1A 3NCMA 4NN7C 1Q72L 4X99B 1WFNA 3ALXA 3DX6B 1YMME 3BGMB 2VXQH 5DRNA 1E28B 1YMMA 4TUKL 4TUOB 5D7LB 3TV3L 4OCRL 3VFWB 4ZTOL 1MFCL 4LARL 3IDMB 2YZ1A 3KNBA 4WUUB 4S10A 4CMHB 3S4SA 5SWSB 3CFEA 4RFEA 1LEKB 1UB6A 2HJFB 1TZGL 4KAQL 1FNHA 1HXYB 3EFDL 1UCTA 5EUKB 1ZVHA 4CNIB 3QDMD 1KUMA 2MCPH 4HLJA 5IFJB 2IPTL 4L4VB 4K7PH 2FH8A 4FXKB 4CN1A 3W9EA 1SEBA 1KYOJ 5D7SH 4M93C 2H8PB 4NM8L 3MBXL 3BPCB 1MCLA 2AJUH 1XR8A 5HGHB 3VWJD 2SEBB 3NGBB 4DZBA 1T22B 1KENL 4U1JB 2V2WA 4G80B 1IZKA 4K3JL 3CDCA 3WSQH 4N68A 1P4BH 2V5RA 4P4RB 1HOCB 2OTWA 4OZIB 4NRZB 1FFNB 1RJLB 4PRBB 3M07A 1VGKA 5KW9L 3OXRA 3TO4B 2RFXA 4JVPA 4N0CD 1MOEA 1F2XK 3BUYB 5D2LE 3MRPA 3QJHA 2DB8A 3BP6B 5GQBA 5D2LA 3MV9B 4WW1B 3THML 5EU6E 3U4EA 4PJEF 1N5YH 1I8KA 5MEOB 5EU6A 1S9VA 4RAUB 3W2DL 5AUMB 3D3VE 5DMYA 3VXSB 1A6TB 3D3VA 4YC2B 1KTLB 5EBMA 2PR4L 2OCFD 2GAZA 3L7EA 4JFHD 4FQCH 2VR5A 2X2YA 3O3DB 4D9LL 1TJGH 1AFVH 3ARED 3STZA 3HC4H 4KRMB 4FP8L 4ZQKB 5HSFA 4FMFA 2ZUYA 2YPKB 4HZLB 4ODTL 5IBTL 1IBGL 4GXVH 3SE4A 3WS3B 3EJZD 1P1ZB 3CC5B 3EO9H 4OCMC 4P2QD 3D18B 4KDWA 5IEHB 2DMBA 2XN9B 5C2BL 3DRTB 5DT1H 4Z76A 3M17A 1XFPA 1V7ML 2WBJB 2F54B 1G7PB 4NQCD 5A2JH 4J3WA 3HMWH 5IIEA 2FBOJ 3SDYL 1K8IA 1QNZL 4MYWB 3TJHD 4JFFD 5DD3H 5FHAH 4ODHL 5JO5B 1P7KB 4I1NB 1OM3H 4MAYB 1PD6A 4C4KT 1R5IA 5D1XA 1OD7A 3SO5A 3WS6C