4DCQA

Crystal structure of the fab fragment of 3b5h10, an antibody-specific for extended polyglutamine repeats (orthorhombic form)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
218
structure length
218
Chain Sequence
LVLTQSSSASFSLGASAKLTCTLNSQHSTYTIEWYQQQPLKPPKYVMELKKDGSHSTGDGIPDRFSGSSSGADRYLLISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKKGNKFMASSFLHLTSDQWRSHQSFTCQVTHEGDTVEKSLSPALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disease-associated polyglutamine stretches in monomeric huntingtin adopt a compact structure.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 3B5H10 FAB Light Chain
total genus 50
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2012-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dcqA01
2MNUA 4M7LH 5C08A 3X13A 1SHMA 4JVUA 3MRMA 4UINL 4MQTB 1FNFA 3AREA 4QY8A 1AR1C 4CN4A 1MHHB 1RIUH 3DHMA 1B2WL 1FNLA 4JY5H 4WW2C 3GO1H 4ZUUB 4PJGA 3NVQA 2AVGA 4Z8FL 1CIDA 3WUWB 3FAXA 3QNXA 1BZ9A 1ND0A 4RGNB 4KDVA 4LVNB 4XCYB 4Y16B 4OLXL 4PJAE 5GRVK 4ACPA 2R2BB 6CGTA 4NN5B 1I4FB 4JRYA 3IFLH 4LSPH 3VWJD 2HG5B 4NNYB 4X9IA 4HWEH 4Z78A 4GMTH 2CQVA 4WUKH 3S97C 4NO2B 3PIQA 1Z6JT 4S0TD 3C5ZC 2DOCA 5I1AB 1E4WH 1H5BB 1IM3B 3DX7B 5GRUH 5D71H 2CK2A 4LK4A 1V3KA 2IFGA 5LXGH 4CMMA 3QXUA 1NFKA 2R4RH 3U7WL 1NBVL 3UDWC 1UB6A 1K3IA 1U36A 1JYXA 4OCYH 2GAZB 4LHUB 4JVPA 4UT9H 2IANE 1EHLL 5TJWK 1ACZA 3SDXE 1B0RA 1LE5B 4HS6A 1E4XI 1J0ZA 3SDXA 3WNKA 2QQNL 4D0CA 1HHJA 3C60D 1H8SA 4X0KB 3DJ9A 4JFQA 4X7TB 1EH9A 4WEUD 2J8UE 2P8MA 2GCYB 2ZCHL 4QTHA 4DZ8A 3VXRA 1YEKH 3QEQA 1MJUL 3KPQB 4PJ7A 1HZHL 3HI6L 4RDQF 5J11C 3EFFA 4QRSA 5GISL 4JR9H 3T0XA 1XH3A 4F3FA 4XPGL 1KG0B 4F33A 2DQFA 4P59L 3E2HC 4L4TB 1OWRM 1AO7A 4M1CD 5GS1A 3I50L 2DYPA 2Y23A 2WBJC 3M17B 2R0LL 1PYWA 4OQTA 3IJSA 3HR6A 3GO1L 2KL6A 1QO3A 3SDAA 3SN6N 3QEGL 5HD8D 1B4RA 3SO5A 3MLXL 5DLMH 4S2SB 1WBXA 3RVUD 3WS3B 4CW1A 1DN2A 1OGAB 4WWID 4LLMA 5C8JB 3O6FA 1MCIA 5JOPD 4HC1L 3O4LD 1A4JB 1P7QD 5SWZD 1DBJH 4RWYH 3HUJE 3CH8A 1NBZB 3KG5A 4GKSB 3Q6GL 5TQ0H 2BVYA 2MJWA 35C8H 3C6SA 3GSUB 4G80A 4NGHL 4GMTL 4U2ZA 2GITB 2PCPA 2Y6SD 3C5JA 4O2CA 1BFTA 4OIIH 3HNTL 4ONHB 3H0TA 2XIDA 3BDYL 2FGZA 1FE8L 4EI5C 3WIHL 1CE6B 4UV7L 1QD0A 2HTLD 3LDBC 2X09A 3AAZA 4KQ3L 3D25B 3GSWB 4ZOAA 4J4PA 3F7VB 1CICB 2WLZA 3P0GB 4OM1L 3EZ8A 3SJVE 4R96B 3VFNB 4JZOA 5E56A 5EUOE 5T5NG 4KJQD 5F3BB 1LDPL 1NEZB 5ACZA 3TBSA 5FO7A 4HJ0D 5FYKH 5IK3B 5SWSB 1J12A 1JWSA 2HAZA 5JHDB 3IS0X 1FL3A 3LQAH 3VXMD 3KYOA 2C26A 5B8CA 3UC0H 5CCKH 3HNSL 4X98B 4Y5VA 4Y4HA 4R7DA 1IAMA 3D18A 4JR9L 4JY4A 3RUGA 3WL9A 3QWOB 1F90L 4M02A 2D7NA 2FO1A 3PWPB 1PSKL 5C0BD 3CCHA 1RZJL 3WFBH 3OB0K 3QNZB 4P46D 4Y5XB 4HBCH 3QSKB 3TJEH 3L7EA 1YDPA 2H9GA 4G8IB 1VADB 3RIFF 3MROB 1QA9A 3U4BH 3X3GH 1LEGB 3K4AA 3KHOA 3PGFH 1TVBB 4JAMA 4S10A 1IM9B 5EUKA 3GZKA 2YC1A 4HPOH 4JHBA 3PV6A 4K8RH 2B2XL 1CL7H 3SE9H 3QDGD 4Y5YC 1RURH 3EYVA 3S37H 5IKCB 3VCLB 1KTLB 4DW2L 3MV7E 1QHPA 5DO2C 5AAWA 3VWJC 3BPCB 3MLVL 3SDCC 4AENB 3DURA 5DVNA 4CJ0A 3KPRB 1A9BA 3TPUB 4YXHH 5T3ZH 4ZPTA 5J6HB 1BZQK 4XWOD 2EDRA 3CVHB 2YD9A 3KYNA 1ZHLB 3BPNC 1B88A 1W2KT 2HRLA 5GGTL 1EA9C 4N8PA 3EYOA 3N06B 3WIHH 3DYMA 5C0DA 4X6CE 4TULH 4X7FC 2Z91B 3BXNA 3KXFA 4HUNB 4XP9L 4P2RA 2BMKB 2HKFL 3I02B 3FO2A 5DEFA 3BKCL 4IHOA 2DM2A 3MUHL 5T1LB 4I0CC 3OJDA 2FJFB 2Q8BL 4HGWB 3AS2A 1ADQL 1KPVA 2PYEA 4JAMB 1ZT7A 4X6DB 3EDDA 3KDMA 4OGAD 1UG9A 1XGPA 1IZKA 4UIMB 5LKNA 4H88H 2Q8AH 3DHJA 3L3OB 3RNQA 2WM0A 4OLZL 3ARDD 4FZ8L 1A7QH 1HQ4A 3UC0L 1KBGL 1EPFA 1GZPB 3BGAA 3S3PA 4ENED 4TOYH 3KPSE 3R06A 4YFLI 4R7DB 5I8KH 1AI1H 2VXUL 4MAYD 3L7FB 5EZOL 4QXWA 5FYJD 5JHLH 4I3RL 4XPAH 3FOMB 1Q9LA 3WFHB 2JCCB 1NEZG 4L3EB 5IHUH 1IMHC 1YDPB 1A14H 1MQ8A 4PGCA 1T0MA 3VGGA 1OLLA 5D96B 1QBAA 3OGCA 2APBA 3TWCL 1PG7W 5AZ2H 3CFDA 4U0QB 1NGPH 3SE9L 2E5EA 3EDKA 1IFHL 3TT1H 3JWNC 4E0RB 2MMXA 4X80L 2EXYD 4WJ5A 4XP1H 4PRPD 3TVMC 4XGZB 5HPMA 3SCMC 3TM6A 3QXVA 5IJKC 1XF5A 3UYRL 4UOW1 2ZG2A 2BNQD 3J7HA 5T3XL 3FO9B 3MCKB 3O8XC 2FDBP 1MCRA 5HHXL 3U30C 1Q9WA 3F65A 4U33A 3ALXA 4KK5C 1PY9A 3ARBC 1N7MH 4ODHL 1QHOA 1ZHKB 1DUYB 5DA0B 4LLDB 4BQ8A 2I25N 4F58L 2IG2L 4X6DA 3D69B 1KPVB 2PYEB 2UWEF 3TN0D 4ZUSB 2OTWB 1MCLA 4B7LA 2AEWA 3CFBA 2Y25A 3L5HA 1CXFA 3G6AB 3QCTL 1UB5B 2CUMA 4DGYL 1QKZL 2IPUG 4E41A 3NCFB 1EX0A 4L5FH 1IQWH 4HK3J 4K7PX 5A3IC 5HVHB 1MF2H 3L9RB 4IRZL 4OCSH 4TRPH 4LCCB 2X1XR 4O2EA 2FEEI 4WFHD 5I76A 5E2VH 2AGJH 1A7PL 1P9MA 2GSIA 3FQXB 2GK0A 4D9QE 4QRUB 4Y88A 1P84J 2CIIB 5E6ZA 3V4PH 4F7MA 5DQDL 5E2WL 2BNRD 3JWOC 4M6NH 3SE3C 3X12A 4GLRH 1KFAH 5EZOH 4J3VA 3IAPA 4TVPH 5JHLL 3MSPA 2DQCH 2Y6SC 3SKMB 3B6SA 2Z4QA 3C5ZD 4FZEH 2KZ1B 1MFCL 3MV7D 3KYAA 4Z76B 1CN4A 3FO0L 5F3HA 1FGVL 1A6AA 2VWEC 1TENA 3ARPA 3HB3C 3LS4H 3O3BB 3I3DA 1LEGA 3ORJA 1C7SA 5E8DH 5IB2B 4ZPVB 3T4AA 3VFTA 1T1WA 1TJIL 3WXVH 3W5NA 3FRUA 2HFTA 3D69A 5DJ8B 2CUHA 4OTXH 4OZHF 1F2QA 1S9XA 2CLZA 1S7XA 2WBJB 5HYJB 4OT1L 2RCSH 4RNRB 4PJHE 2XACC 4UTBL 2Q6WB 2F5AH 2NY2D 2VL4A 4I2XE 5DMGC 2Y06L 3UBXB 4Z7QF 2VLLA 4ZAKD 5A2IH 2Q86B 3HRZA 1EUTA 3C60B 1EJOH 4I0PB 4FN0A 3H9SB 1LE5A 1GC1L 1JWMB 5C0CA 3CX2A 5FK9A 5BS0D 5DMIL 3ZKMC 2ICWA 2NZ9C 5F7FA 3RWGA 2X9YA 2R0KH 3L6FA 4KTEL 1DQTA 4FHBD 3WHE0 3PWJB 4QRPE 3QUYC 3X11A 3NPZB 1IL1A 4DWHA 5KVFH 4PGZA 1XGTA 3E6HA 3MJ7B 4OZGF 1OLZA 2MCPL 4M6OL 1LEKB 4ZG1A 4X6FA 1ZANL 2I07B 3X14A 1QR4A 4F9LA 2Y7QA 1Y6MR 5D7IF 1AE6L 3VG9C 1IGYB 4RX4A 1PJ9A 2XZCL 1R0AH 3RAJL 2F53D 2GTZB 2B7DT 3QIBC 3OKEB 1FC2D 4BSVA 3ZE2E 3CMGA 1AD9A 1I1YB 5DVMA 1N64L 1KIQA 4PJGB 4LU5H 4M6NL 1I1AC 2GFBA 3NABH 4OGYL 5DVKA 5GGRB 1NGQH 4R97B 1P1ZB 5JO5A 4LLAA 4TVPL 3BPNB 4PGCB 5F7KC 4OLYH 3DXAB 2D0FA 5GS3A 1KELH 4Z7WB 1RUKL 5LAXB 3VXMA 3G5XA 1ZE3C 3OR7B 3CLFL 4K7FB 5I6XC 4K3EH 4LQFH 2YRPA 1A1OB 1NJ9A 4QF1B 3IJSB 3LS4L 2GI7A 2BNQE 1YEIH 9CGTA 4M61A 1RJZA 5KS9A 3UZVB 3HAEB 4RAUA 4Y5XC 4RFEB 4JFYB 4Z18A 2GJZA 4Z7UA 1AFVL 1MCOH 2BRQA 4GAFB 2EE9A 4KKAD 3MACL 5HVGB 1JUFA 2AV7B 1CYGA 5JW4M 4O9HH 2X4QB 4DGIL 3HE6C 1S7XB 2WBJA 5HYJA 1Y18A 3RU8L 5C9JB 4U6TA 3QDMD 3HE7A 1MQKH 4U1MB 4Q6YA 3RTQC 3UYPA 1RQ5A 3ELAT 4Y7MA 2UWEA 2J7LA 5EBWB 3ARED 3DX6A 1FC1A 4A2MA 3EDEA 5E08L 4EIGB 2VLMD 5E7FA 3SDCB 4HIHB 1H9VA 3FQUA 2YUXA 5T1MA 15C8L 1NFDA 4KDTA 2D3VA 4H1LH 2DTMH 3VA2C 4GUPB 2HWZL 3DIFB 4FQCH 1I9IL 4NJAL 4F3FB 4GAYB 3LQAC 4LHUD 4JFEA 1D5ZA 2ATKB 3NA9L 3S4SA 4U1MA 1KEGL 4PJ9A 1BWMA 3DYPA 2A2QT 3A6CL 2BJML 3ARWA 2QEJA 4UQ3B 1WJ3A 4MCYA 2MCPH 3V52L 1L9NA 4YWGL 1ZHKA 2O5YL 2WWMD 5I8EA 3DSFH 3IVKA 1RULH 1YMHB 4IRJA 1QLEL 1S7QA 4U49A 5F6HJ 1KIUA 1XF4B 1XF5B 5HTSA 5ID1B 4GS7B 5JZ7C 3GIVB 1LK2A 1LO5B 1QEWA 2UY7A 4K7PL 2VUYA 4JFQB 2IBGA 4YPGA 4IMKA 3VFSA 1IRAY 2ZP0T 5I0DA 4RMVA 1DQML 3MJ6A 1W72L 3HN3A 4P2QA 4R4BA 1KCUL 1IAIH 4NPYA 3RDTC 1KTRL 2CDFB 4H5SB 1FDLH 3LKQB 1AXTL 1B90A 4M43L 4QRPD 5HDOA 2A0LD 3KYKH 3THMH 4MLIA 1T0NA 1U9KA 2DMCA 1TZIB 1G1CA 4PJ7E 1N3NA 5J1AB 5GS2H 3E6FB 5TH2B 1AFVH 1MCOL 1D5IH 4UB0L 3K3QA 3GB7B 4UNTA 2CJUH 3GSQA 5EBLB 3U46B 5L7XL 4AG4H 4PJXB 1WAAE 1UM4L 1D5BB 3OKOB 1N5AB 3FO1A 5DJDB 4Y19D 3BZDA 4MQ7B 3P9MB 3IDXL 4QOKA 1JV5A 2VO5A 3UTQA 1TTGA 1BECA 3IDMB 5CILL 3ALPA 1P7QB 2PO6B 3A67L 4TVSa 5J9PA 1YMMD 1FQ9C 3V4UH 5B21A 5E08H 2AJXL 4CU6A 4LVEA 3QPQC 4OUUB 4XCFL 3X13B 4L4TE 1KCSL 1MHEA 5DHVA 2VB5A 4WI5A 4GG6F 1U8PA 4KJPC 2H8PA 1YMMB 1ONQA 5E5MB 4MA3A 1UWXH 3G6JF 4IDJL 3C5JB 4O2CB 3T2NH 1D5MB 1FNEA 1U8QA 1L7IH 4O51A 4M7LT 2DBJA 2V5MA 4NQXA 4PJ5E 3VXQA 3ZSSA 3RPIB 3TA3A 2B4CC 1DE4A 5GIRB 4NZJA 3BHBB 1GHFL 2CRMA 4F8QA 3LN5B 4PJXE 1JGDA 4NO5B 4XAKD 5EC2B 4GXUN 1IJ9A 3SJVD 3HRPA 4WV1B 1DVFD 1YC7A 1CXEA 4Z7WE 5CUSH 1M71A 2G2RA 4LSRL 1KTDA 1TCRA 3KNBA 5CP7A 3AXLA 1QSFA 3MOBH 2ZKHH 1MEXL 4UI2A 3T0DA 3REWA 4B7IA 5MENE 1T5WB 3GMMB 4JREC 3ARUA 4P46B 3ZSTA 4I0PC 4Y19B 3RWJA 3B43A 1OAZL 4I3SL 1FDLL 3CSBA 3FHAA 3JVGC 5M94B 4LSPL 2ZWLT 2E7BA 2A83A 3GMNB 4HKZA 4Q6IA 4XAKE 2FEEL 2BERA 2OJEB 4F57H 5LVEA 2XY2A 3HB3D 1RD6A 3TO2B 2GAZA 1D5IL 4WO4D 1J86A 3MZGB 4MGXA 1OSPH 5E95B 3SE8H 1B0WA 4S11A 4QRRD 3VD3A 4XHJC 5SX4I 4KVCH 2OK0L 1G7QA 1JJUA 1R3LA 1R5IA 2VABB 5H94B 5CGTA 3MRFB 4AH2A 1BFOA 3DO7B 1RK0B 3VD5A 1G9MC 5I1DA 4MXQD 1JZ8A 1EK3A 5HDBE 3QIBB 4FFZH 4F7CA 4NRXA 1UVQB 3T3ME 1RHHB 4WHYG 3IDIB 2WINB 3LEVH 4GKOA 5IR1B 2VZUA 5B3JF 3DTXB 3IF1B 5C07D 3CC5A 1LEIA 4KI5F 4TNVF 3QQ3A 5I66A 4HLZG 4JGMA 4KROC 4NM4L 2E8YA 2NX5D 5J3HD 4IS6A 1UGNA 1YEGH 4J1UA 3RKDD 1KIRA 2PO6C 2NMSA 3C60C 4RCAA 2Z8RA 2D0HA 5TF1H 2JJSA 1B6UA 2R0WL 3L1OH 3NFNB 2HMID 1WVZA 2AI0L 2O93L 5HGAB 1Q94B 3IFNH 3Q5YA 3MGOB 1FZKA 2VAJA 1QZ1A 1HIML 1KJVA 1XR9A 1VPOL 5BQ7A 5LCVL 1MI5B 2XQBH 4LIQE 3QFDA 3WIFB 2OTUB 4LPTA 3RVXD 3HE6B 4IMLB 5IMOA 1CGVA 4AT6B 5E03A 4P4KA 3E0GA 1JRHH 3HC0A 4JPIA 4Z7VA 4HIJA 5IJKA 3WS3A 4QRRB 4JZOB 1TETL 4R26H 3DGGB 3BKYH 5BZDB 3PQYB 4F7TB 4JRYD 4NFCA 4XBEH 2VN4A 3LMJL 1A9EA 3D25A 5C0AB 2CD0A 1U8IB 4UU9A 3U4AA 2XKNA 1JWMA 4M48L 4CKVX 3I2CH 2HT2C 1N0XL 1WC7A 3LKQA 3QUMH 3H0TB 4PS4H 1NGWB 2B4CH 3QFJA 3L3GB 3O41B 1BD2A 2HFGL 2CMRH 2MHAB 3GRWA 4GW4A 2Y5TA 3DX8A 1OCWL 3C6SB 4N1EA 5HI5D 1IT9H 2X6MA 3SDXF 3RNKB 5D6CB 5DK3A 2XZAL 2Q6WA 4P46C 3RX5A 3RWCA 2I9TB 3QH3B 1S7TA 4QHKI 4MJ2A 2I9LA 3SGEI 5DUMH 5C9KA 1A3QA 4HK0A 5EC1A 5BS0E 4OV5B 2YOCA 5DJ0A 4AM0A 3R4DA 5MEPA 4JKKA 4Q97A 1QBLL 1SYSA 3HAEH 1J0JA 3UBXG 3LQAL 1GAFL 5F7WC 2ADIA 3BP7B 3QCUH 2I26N 4HGMA 3TFKC 4MD5B 2Y36H 3U2SA 4G7VL 4YE4H 1I7TA 3UTZA 4POUB 1G7IA 1FV1A 3PJSA 4GG8B 5F70A 5DR5L 4YHIB 4I4WB 1A9BB 3TPUA 3BO8B 3ULVH 1OAYH 2NY5L 2BSED 3TJEL 3IDJB 1NUNB 3U79A 2JJWA 3FHQA 1A7OL 1A5FH 1G7MA 5D2NE 1GGYA 3U0PA 3ZKNC 5DRZB 5HHQA 2AEQL 4PY7B 1I8KB 5K59F 1UB5A 2EEDA 3DROA 4NIKB 4HPOL 1MJJA 2WSKA 1GC1C 3GIZL 3CFBB 3ARTA 2X4PA 4HKJB 1LP9B 4HS3B 5DJCB 1TETH 1DN0B 2DLEA 4R26L 1FGNL 1L7TL 1UCBH 3RY6A 1B0RB 4F9LC 4MXVE 1WCBA 1AIFA 2HN7B 3DMMA 1FG2B 4M1GH 4Q9RH 4M61B 1IARB 5LQBH 2FBOJ 1BEYL 4JFEE 3T65B 1N0XH 1HYRC 1U8IA 4K8RC 1JGEA 4G6AD 1TFHA 1T7XA 2ZSVB 1FNHA 2WIIB 1NGXA 4JKWA 4XVJL 3RA7L 4ZDHB 3LSOA 1U0QA 2MKLC 2J6EL 3OR6B 4NWUL 3NCYP 5FO8A 3NCBB 1A2YB 4KK6C 3BW9A 3C9NA 2HYMA 5F9DC 3QWRA 1C5DA 4ZFZB 2VOTA 5KSVB 5E7BA 2XT1B 4YAQB 5DUPL 1WEJH 4X4XB 5IJVB 2I07A 4YDJB 5BV7C 3LS5H 3T09A 5EZJB 5IVZA 3W9DA 1CDBA 3O3DA 4JQIL 4CVZB 4EVNB 1F58H 2MPAH 3QUXD 3X11B 4H5SA 3QPXL 4YE4L 3HMXL 4L9LB 4NBYB 5TE7L 1U8NA 2BDNL 5FYJE 4GKSA 4JFPA 3ULVL 3IF1A 3MOAL 3VI3F 1A4JA 5FK9B 3QISA 5JXED 4JFXB 3ARBD 4I0PA 3ZMRA 1W0WB 2G9HA 3EOTH 2BHUA 2R1YB 5HGGS 4F7CB 1J1XL 5MP6H 4K3HA 2AEQH 3U0TB 4YHZH 3S7GA 3CAFA 3BQUC 1URLA 5BS0A 1BFOB 2FX7L 2F74A 3DUSB 4NQUA 3K1KC 4E42B 2MQ0A 3ULVE 1ORQB 4NQEA 5FXCH 4YDVA 1J0YA 1RK1A 3B5HA 3I75A 2JCCE 1F3JB 4M62H 3VXTB 3CLEH 5KJRH 4Q2ZA 3DRTB 3VXUA 2BNRA 4QRRE 2Z92A 1P7HL 3EZJB 4NKMA 1MH5B 2FGWL 5E4IA 3HPJA 4QHUA 5JIKA 5HHXH 2PTTA 4HWZB 2HMIC 1D6EB 5E2TL 3QO1A 3F7YB 1I85A 2AXFA 1QFHA 1IEHA 3D3VA 5FF6A 3P4OA 4OGZA 1OB1A 3EGSA 3BT2H 4HK0B 5D7SH 5EC1B 4P23A 1FFNA 2ZUSA 2IG2H 3VXPA 3OJVC 3IJHA 1DFBH 5DMKB 3OBAA 1XCQA 1YECL 1U6AL 1CWVA 3WN5B 3NFSH 4X0KA 2XZQH 3NCYS 3BVNB 1T4KB 4MQSB 2XRAH 1II4E 1HH6B 3P4NB 4GW4B 4UT9L 1EHLH 2PYFA 3ARBB 1X5ZA 4JEGB 2GJZB 3FCTB 5DZOA 1RK1B 3MV9D 5HBBA 2FL5A 3EYQD 4RGMB 4BSJA 1FNEB 5IHLB 1QRKA 4HWBA 3S34H 3ZDXE 1T2QH 3L5WB 5GRJH 5ICZB 1EJ6A 5E94A 3O4LB 4LF3B 1WCQA 5DQDH 5E2WH 2PR4L 4CN6A 1HE7A 3VRJB 1UKQA 3PWNA 2DIJA 5B4MD 3Q6FB 1ZK9A 2NW3A 1T83C 4RIRA 12E8H 4PV9B 2ICEB 4JVWA 1JHTA 1XF3B 1KCVL 4OCWL 4PJDF 4QHMA 5DJ6A 5ADOH 1KJ2L 2OP4L 2NX5A 2BOBA 3WDJA 1SJEB 3MYZA 4PTUA 4R8WL 4ZXBA 4MX7B 4F15C 3LPGA 2GJ6A 1OVZA 1ZHNA 1HH9B 1WIPA 4G3YH 1TJIH 3WXVL 1SJXA 2RBLA 1N2RA 1LK2B 4RGNC 4LNRB 1KCLA 1ZLVK 3T0EA 2BNQA 1EAJA 4NN5C 1FO0L 5EBMB 3L6FB 3B9KA 3BEVB 3ZYOA 1NAMB 2F5AL 5E8OA 1QACA 1FORH 1K4DB 4NYLA 1J1PL 5JXEC 4P3CL 1OQXA 4UQ3A 1GJIA 3P0YL 3NA4A 3B5TA 1RFDL 4PR5A 3X3FH 1V3JA 2E6QA 1CZ8H 1G7HB 4OLUH 2VAAB 3DARA 2WLYA 1S7WA 1TJHH 3L7FA 1INQA 1Q94A 5F21B 1HH6A 4PJHF 3DROB 5IB5A 4OIIL 5I1DB 2C3VB 1IBGH 5SWSD 3ROOA 1DFBL 2YK1L 5CS7A 4ZSOA 4D0BB 4RBPK 3TZVC 3NZ8A 1VEPA 5ALBL 4LPXA 2H32A 4HUUB 1AD0B 1YPZA 1J18A 4WUUD 5B39G 4PJEB 3QNYB 2CH8A 2C3XA 3TBYB 5ADPH 4M7JL 3EBAA 2NY5C 3ZKMD 5E1AB 1KCRL 1Z3GH 3PWPD 1RIHL 5FOBA 3U6RB 2Z93B 1DN0A 3BWUC 3P40A 3FCTA 1PX4A 2NY6C 4QXGH 2NZ9D 5HYSB 4UTAL 1OL0A 4U1LB 3MRPB 1T2JA 2CKBH 3KPPA 4GUPA 5C09A 1S9YB 4DOHE 4HH9A 2ESVB 3WUZA 2M2DA 3GMOA 5IQ7L 1NCNA 4LU5L 3B9VA 4MDJA 4A6YB 3MNWB 5KBNC 1NGQL 5D2NB 4QOKD 4WI9A 4XVUC 4HZLB 4WUUE 2X7LA 4I13B 3I9GH 4LCWE 4N8VG 4JG0L 1QFWH 5JPMA 1FAIL 1PSKH 1R3KA 2HFFB 1OSZA 3FOLA 3VG9B 5HHVL 1CGTA 4KRMB 4JFED 3FRPA 5I76B 2BSSB 5ESAB 5KSBB 2P44B 4R0LB 2W92A 4PG9A 3L5JA 3OKKA 4ZUVA 4LCUB 5FHBH 3VFVA 1BBDH 1YY8B 5DJXB 3OG6B 1A3LL 4PLJD 4KQ4L 4IIQB 1X44A 4Z7QE 4FFWC 2LVCA 2R15A 3KWWA 5BMFH 1FO0H 1SYVA 3MODL 5D1XA 4DW2H 3V0VB 2O5XH 1H0DB 5CJBA 4EXPX 2OL3A 1A6WL 3KPOB 3O45B 4NN6B 1I1FA 1P4BL 3GSXA 3VDBA 4TSBL 2F8XC 3PWLB 2QKIA 4WEBH 3LN5A 2XG5A 1YN6A 4YGVA 3CFEB 2YK1H 4KKNA 2ZUQB 3QA3A 1D5BA 3OKOA 3VXRD 5HXMA 2ICWB 4QHLB 4W68A 3QPQD 3LKNB 2OMNA 2Y72A 4P5MB 2D4DA 5EU4B 4C56E 3A6CH 3QULB 2R4SL 4HJGA 4LHQB 1KCRH 3V52H 4KJQC 1OW0A 1ADQH 4NQCA 4Y4FB 4NQVB 3T3PE 1FFRA 3HE6A 3RIAF 2VLRB 3ZDXF 2F9BT 3F7VA 5DS8B 3FOMA 4FZ8H 4WNQB 4YFDB 1ZGLP 3MGAA 3NAAH 1U8LB 4D8PA 3CDGB 4XP6L 1KBGH 4K7PH 1K4CB 4EZMA 4FA8A 4PJFF 3GIVA 2QKIB 3RGHA 4KKAC 4QRTB 3B2VL 1I1FB 2IF7A 4C57C 2HLAA 2GITA 4PGBB 1OAKL 1EIBA 3QUZB 1RK0A 3QB7C 3IJHB 4LVHC 1DDHA 5T33H 3THML 3RVWD 1T7YA 4F80A 5MI0B 2D7TH 1W8NA 4TSCH 1RU9H 4AEEA 1TIUA 1J5OL 3ZT7A 2WBJD 5HYJD 3M1BB 5IP4A 1YY8A 5AZ2L 3ZO0A 1T04B 1GGIL 1YEFL 1MFNA 5CAYB 1IFHH 5T1LA 3MLRL 4XCNB 1K6QL 2NNAB 1JNLL 2BFVL 1NL0L 1NFDF 5KG9A 3IFPB 2YD4A 1ERNA 5DJZB 3TESA 1P4BH 2VZ3A 4BUGA 1BREA 1WZKA 1X4XA 3MLPA 4DUVA 4MJIE 3CUPA 1R3IL 5INDA 4IMKC 2KQNA 1CLOL 4ZPTB 3I3BA 4JKPH 1YNKH 1NC2D 5ESQA 4JHAH 1CFNA 5I2IA 1GGCH 1OARH 1U2HA 1G7IB 2OR9H 3T0EC 2VYRE 2VZSA 1GGTA 4KY1H 6FABH 1JPGB 1FVEA 2G75A 2N4IA 1RUPH 2IFFH 4JKLA 2HJLB 3OTTA 4YHPB 2BRRL 3QZWG 3BHBA 5L6YH 4X8XA 4V1DE 3V7AE 2VN7A 1I75A 5D6CA 5K93A 3UYOD 1JI1A 4KWUA 3HAEA 1WLHA 3QFJD 2CK0L 3SDCA 4XXDB 1LP9E 3CVIL 1C7TA 4PJEE 5IBTL 3WN5C 1EEYB 1MUJA 4PJEA 3DNKA 4XMPH 5C0AE 5C0RL 4XHJD 2DQJL 5F7EH 4C56B 4TRPL 1UXSB 3WD5L 2P5EB 3G5VA 2J8HA 3MCLL 3HE7B 5T1KD 5LWYH 2C3VA 1K2DA 3NTCH 3C5SA 4HCRH 3DVNA 3FZUC 3UJJH 1F42A 2IADB 3D6GA 1QNZH 3JWDL 5JR1L 2NZIA 2AK4B 3PHQA 1CK0H 2R69H 2EDYA 1P69B 3QAZC 4UOJA 1AGCA 4Z7OE 1KUMA 3DVFA 3GKWH 4KGLA 1LO2H 5GGUB 4FQ1H 3RPKA 5JHDA 4F57L 3ULUH 2DQIL 2PN5A 2X4RB 4XNXL 5BW7A 4XPHH 5AG8A 3TNMB 5C2BH 4NP4H 2P49B 5SWQA 4JREB 1EAPA 3QUZC 4G7YH 4XNQA 3RZCD 1MJ8H 3K80A 1P1ZA 2KDGA 3KXFD 3MLYL 4A6YH 5M95B 3ULVD 4P2RD 4M4PA 3GNML 4MXWH 5K9KA 1NGYB 1RZKC 2ARJB 4X8JB 1T20A 4K94L 4ZMAT 4LRNL 3AREB 4QY8B 5GJSL 2DQUH 2NX5E 4NUGL 4PY8J 3DTXA 3OXRB 4HEPG 3GI8L 1I7UB 4ZD3H 5C0CB 1T89C 4OJFH 2VIRA 4M6ML 3R8QA 3MRRB 5D1XB 1UENA 1UVQA 4R90L 4HUVA 3X14B 3QI9D 1UWEL 1P4LA 3B8SA 5BVJB 4HPYH 3U0PB 1FIEA 3NZHL 1I3VA 2P8PB 2ICES 3S3SA 3TZVD 4Z0XA 3SDYL 2DDQL 1VGEL 3QXTA 5IFAH 3MMEB 3MUZ1 1EEZB 3LEXA 5T3ZD 4EKXA 5AD0B 2R0WH 1QRNE 4MA1B 3VH8A 3QG6A 2HJKA 5EO9B 4FFWD 4HEME 3W39A 5F96H 1IGJA 4WW1A 4PLJC 1FJ1A 2NW2A 3T3PF 3T1FB 5IEKA 3K7UA 1F6AA 3O3BA 5TQ2L 1ETZA 4G8GB 5CLTA 2HVKA 3T2OA 4KVNH 2N7AA 3PXJA 5D1QD 5DO2D 2R29L 4JFHE 2DLFH 2H2SD 2VXQH 5LGJB 4FNLH 4W6YB 3RVWC 3MRKB 1QNZL 3JWDH 4HHAB 3F58L 5IBLC 4PRPA 2CIKA 5FA4A 3OF6D 5KW9L 3U9PH 4FXGB 1Y18B 3BPLC 5EC2A 5C09D 3GK8L 2B8OT 2NYYD 4IRSA 5JPNA 3UTSB 2VITB 1FL5B 1AGDB 3HE7C 1JUFB 3QO0B 3ULUL 1LMKA 4DZBB 5TFSL 2HFGH 1MIML 3OAUL 4LP4A 3IFOB 1BGXL 1L4IA 5CMAA 4YDVB 5KG9B 3QIUD 4HIEA 1PEWA 4G5ZL 4NDMB 5T3ZE 5B39B 2W91A 3EAKA 4MDIB 2C4XA 2BOCA 2XN9A 1PLGH 4QCIA 1U8OB 2JE8A 3QIUB 3BAEH 5BOZG 3DX9A 5ISZE 4NO5A 4U1JA 1Q9KB 4PREB 2IEPA 4OJFL 2VSCA 2ILLA 1AY1L 4LHUG 1Z9OA 4X6CB 2BCKA 4E5XB 5L2JA 3ULSA 3BKJH 2YN5A 1WBZA 1WTLA 4OIAA 4BK4A 3VFWA 3FT3A 5I71B 4U0RC 1PG7H 4J3OC 2DDQH 4BH8B 4ODWB 3ESUF 3H3PH 3QQNA 4Y19E 4ZUTA 5AYUL 1QSZA 2LAAA 1QRNA 2EDQA 2R23B 3VXSB 1I9IH 5JNYA 1W0VA 3ULVF 3LKPB 4MMZC 5I9QC 3K0WA 1T0MB 5D2LA 2KQMA 5HHOA 2A6JA 3VXSD 3BI9X 1G6VK 3QIWA 3MCKA 3JUYA 5KSAD 4AJ0A 4JO3L 1UT9A 3AAZB 4XVTH 4KZDH 2KZWA 3IAQA 3O81A 4Y4FC 5JQ6H 2HRPH 3EYSH 1GPOL 4PB9H 5HPMB 2VDRH 5HY9B 3OHXA 2FECI 1B2WH 4JY5L 3QXDB 4NKDB 2FNBA 5I6XB 1PAMA 1OQOA 2BVQA 5KW9H 4OB5H 4Z8FH 5LQBL 3CXDL 5E8NA 4XX1E 2D7MA 4X6CA 4E5XA 3RJQB 4CDGC 1H3GA 5DDHA 4KMLB 3D1MC 4PGDA 1A64A 4N5ED 4Z5RA 2IPTH 1F5WA 3O0RL 4UV4L 5D5MF 4FFYL 4NWUH 1OY3B 3WHXB 4YDKH 4I77L 1FSKC 3MRBB 4MSWA 1NSNH 3QEQB 3TO4C 2YSSA 1MHPH 2FIKA 3MLWH 3QHZL 3VFPB 3RTQB 5D71L 4JDZA 4NRYA 4I2XB 2BHZA 1KC5H 3SKMA 1GGUA 3VI3E 4N0CD 1DTUA 3MR9B 4YX2H 2GJ6E 3J8F7 1IC7H 4NO0B 3EYOB 3QDJD 4H20H 2GK0B 5DUBB 5CGYD 2AJXH 3UTOA 3TH4T 2MSPA 5DJ2B 2I24N 3RWIA 2IH3A 2IAMD 1G0DA 1VDGA 2AK1L 4O4YL 5D70L 4APQC 4U1KA 5H2BA 4N0UB 1A4KA 3KPPB 5K59E 2ERJC 2C4FU 1X9QA 5KS9B 4G6AC 1X5LA 5EU3B 1OPGH 4P59H 1K4CA 4Y2OA 1SJVA 1VGKB 3L95A 3WHXA 2D7OA 2YBRA 4R2GB 1I3GL 3MRGB 1JPTL 1N5YH 2EDNA 2I9LB 3SJVA 3I50H 4JFPB 3GRWH 4KZDL 1F02I 3QG7L 4P57B 5IBLD 2I9TA 1F8TH 2XWTB 1JTOA 2NLJA 5DC4B 1W0YT 5MEND 3QUZA 1AQKL 2VLJA 4HSQA 1MFAH 5C07B 1CL7I 1BQHA 4ZSOB 4D0BA 5IW3A 1P4LB 3PNWB 1BD2E 1UJ3B 2UV3A 2VDNH 2QSVA 2V9RA 3QDMA 3OKDB 4HC1H 3CD4A 1BPVA 5F3BA 2ICWJ 1G9MH 1X5KA 2WW8A 1FCGA 1BF2A 3GSOA 4L4VB 3SQBA 5IK3A 2YZ8A 4DK3A 5CJQH 3HNVL 3LKRA 4R96A 1NMBH 5ACZB 1K5NA 5EN2A 4YO0B 5SWZE 3HNTH 3PWJA 4Z7OF 4Z7VE 1U6AH 1FP5A 1MI5D 3P3YA 4JY4B 3SDAD 1KJVB 3G5VB 2OR7A 4YX2L 3OQ3B 4B53A 3OKDA 4FABH 3H9SA 4G80B 3ARRA 2DD8H 5MERA 4MS8C 5C07A 4S1QL 4ODSL 4GKNB 3ULSB 3M45A 3TV3H 4HUXB 1WBZB 2MKWA 3SDDD 4NC2B 4U1JB 4PJGF 3D39E 2QHRL 5GPRA 4AQ1B 3A6BL 3BPLB 4PBXA 2NW3B 3VA6A 3W0WA 4AMKH 1VFUA 4C83A 5E9DB 2DICA 4FTVD 4NZUL 5D7KD 3MV11 2NY1B 4OZHB 3IXTA 2GIYA 5ITFB 5TF1L 1SYVB 2IPKB 5ICZA 1V7MH 1GOGA 5ISZA 5ERWB 1AO7B 3BISA 4HV8B 4L4TA 3DRQA 1F8TL 4DVBA 4NOBA 2FR4B 4MA1C 5KOMC 4PD4K 3NIGF 3QXAA 3SKOA 1OGTA 3UCRA 1JTPA 1EERB 3MJ8A 4ONGL 4GRLA 1D6VL 1IEBB 4PRHA 4F37F 4PYGA 4EDWL 5FIEA 4X6DE 5C08E 1R3KB 1WZ1L 2VH5H 4ERSL 2X4QA 3ULUF 5TE6H 1RURL 2Y9RT 1QO3B 3SDAB 1IILE 2Y4SA 1I8IA 1ZT4B 4IBLT 5DI8B 5ICXB 4P2RB 5DJ0B 4LARL 4P46A 5GRVL 3I2CL 4HWZA 1INEL 3GMQB 5T3ZL 3ROOB 1DQDH 2AJYH 2OI9C 1MPAH 3CVHL 4S1DD 1A3RL 4HD9A 4PJ7F 2Z92B 3WKML 1G7HA 5ISZB 3PQYE 2NW2B 2DQFB 5ABDE 4TUOB 2BC4B 4YBHA 3ECBB 2FATH 1O7VA 1T2XA 4LDEB 4PJ8A 1OTTD 2R2EA 4FQXA 5DDHB 1H3WM 2ARJQ 2WAHA 1YPZB 3IDNB 4NQTA 5FYKU 5EDXA 1Z3GL 1NMAH 4OKVB 4ONOA 2XNAB 3S5LA 4CDHA 4YHLH 1WZLA 4UILH 2PW2A 4PG2A 4B50A 1NC2B 3H9ZA 2V9QA 3P0VL 1WWBX 4Z77B 5DC9B 2F5BH 2RFXA 2WZPD 2XA8L 5FHAH 4NZUH 4OZGE 1M4KA 1DQLH 2YUVA 1DCLA 3O6MH 2ZOKA 3G08A 4LLWB 2WUCH 2AXGB 3N9GH 1KCKA 3OPZH 2V5SA 3CIQA 3FMGH 4U1GC 4JE4B 3O8XB 5D72H 1QYGH 5DD3H 3NFNA 1JHLH 1JV5B 3UTQB 4KFZC 2ZJSH 5HD8C 4JRXA 3OB0H 1CXLA 5HHMD 1JF1B 3CU7A 3RVUC 4ORGB 2E27L 3CX5J 4ORZC 5B4MC 3V0VA 1PQZA 2ENSA 2VDLL 3BD4A 4GW5B 1RZGA 3T0WA 1U8JB 3BRFA 4XXCA 3MODH 1HSAB 1L7TH 1UCBL 2GT9B 4M4RA 1RHHA 3U0WL 3ROLA 2BX5A 5HVHC 2P5EA 5F97E 1CF8L 2YKLH 5F9OL 1BEYH 4P4RB 1ED3A 4PGEA 3N50A 1INDH 3H9SD 5H37H 2BOCB 4P2QE 3V8CA 2QV2A 2PW1A 4Y16D 3MRGA 2ZCLL 2Q7YB 5F71A 1WK0A 4WUUA 3RUGF 3VWKC 2YD8A 3SGDI 4ONFH 3WFCH 4APQB 1OTSD 1N59A 3MV7B 2J6EH 3MRQA 4XAWL 3D0LB 4Y4KA 3RL1B 2X05A 3TLRA 3B2UC 4GAGL 3D39A 1FVDA 1I7ZA 2A6KB 4JGJA 1EXUA 3I6LE 4G9FD 4YIQA 3MRJA 1R24B 5I1IL 5DSCB 2EDLA 5AWNH 3V4VL 1A8JH 2FO4B 1JCKA 3MBXL 4X4ZA 5DUPH 5JLZB 2AJZA 5HHMB 1Y0LB 3ZE2F 1OB1B 2A9MH 3DIFA 4OCSL 4JQVC 2G2RB 1R5WA 1WTGT 3EO1A 3PP3H 3F8UB 3NAAL 3T2PA 3PL6A 5FUOL 4ZO9A 5IT2H 4FQQB 4HFUL 4MDJB 2V7HB 2HLAB 2DKMA 2R1YA 4XC1H 1YEDA 3OXSA 4I0PD 3S37X 1J0IA 1S7WB 1BLNB 4LKXB 3MV9E 1EFXB 3RL2A 2ADIB 5E8EB 4K9EC 4MD4B 2QHLA 4JCMA 4MA7H 1HWGB 1X5GA 1XR8A 4X7DC 4XB7A 2YZ1A 4FQIH 3BKML 5D5ME 4X7EC 1EFXD 2YD1A 1E6JH 2DIAA 1H15B 5DD0L 4JN2A 1X5HA 2C4FT 4MJIA 5F1OB 5E6YA 3MLRH 5F7DA 5F7HA 4LVHB 3LD8B 4M7ZC 2W9DH 4Z7NE 4YZFE 3VXOB 4X7SL 3ARQA 1LO4L 1FVCB 3VGBA 2YUZA 3WLWD 1IGML 5GJTH 3U7YL 4TTGA 2X40A 4JJHA 4CVUA 1JWSB 4LSVH 3H7BA 3CFDB 3FQWA 1UM6H 4DQOH 5E2TH 1MHHA 4LSQL 3VFOB 3LSOB 4JHAL 3TBVA 2JJUA 4XAWH 1KEML 5F6IC 3V7AG 1FFOB 4MNHB 4AEHL 2X4SB 2NTFA 3VG0H 1C08A 5F7YC 4FG6C 5BZDA 1RUPL 2IFFL 1XGUA 2R23A 3RP1A 1YECH 2Y7QB 1T0NB 5CBAA 5BV7B 4K2UH 4X6FB 5I8CA 3MFGB 5DRWB 3G6DL 2VDKH 5C6WH 5DMGD 5EUOA 4CUCA 4K3JL 2XRAL 1T0PB 1T83A 1HNGA 2CRIA 2X5PA 4KTDH 4LCYB 4PBVC 1BZ7A 5DJ6B 1JPFA 3K1DA 4LCUA 5DD6B 1CGYA 2R1WB 5D9SA 1P9MC 2FH8A 3P4LA 1NAML 4L9LC 3ZTJG 4U1IB 5F7EL 3MO1A 1OT1A 1MFDH 5LWYL 5FUOH 5IT2L 5DHXB 2VDMH 5A1AA 4HFUH 2NY0B 2E9JA 3DWTA 4MA8L 2P24A 3O6FC 5E8PA 1JRHI 1NKRA 1SJHA 2E7LC 4S1SL 3VE0B 4MHHI 1A1MA 4OAWB 1EEYA 5EZLB 4NDMA 5C6TL 1T1ZB 2QADC 3K2UH 1KJ2B 2ED9A 5F7LB 5DA4A 1LK3H 1YEKL 5DFVD 5E8EA 4OCWH 3RDTA 2IALB 2DQIH 1Z0MA 2W0FB 1KJ2H 1QP1A 3LEYH 4XNXH 3V5KB 4FTVA 3W2DL 4R8WH 1CLYL 1JYWA 5DD0H 1MCSA 5DFWH 4V1DD 3FQUB 4CRPA 1XCQB 3TF7C 4RGOL 2B0SH 1G7LB 4HZLA 3IDUA 3CFIC 4HT1H 5TGBA 4K94H 1ZTXL 4HUUA 1TZGL 5GJSH 2H3NB 2YWYA 3QUXC 5GS0H 1GSMA 3CSYB 2NXYB 3IKKA 2HT3C 1B0GB 4P3CH 3KS0H 2X42A 1UWEH 2I5YH 2YUWA 1D3CA 3GBNL 2LU7A 4OIBA 4UOW0 1RFDH 3NZHH 1I7ZB 2A6KA 4Q9QH 4NN7B 1A0QH 3LD8C 4PRBA 3LN4A 4HWUA 4Y19A 2DIBA 5DHVH 1MNUL 3BE1H 2YXFA 3TBYA 3AREC 3QUYB 4PJEF 2BSRA 3D0VB 3CUPB 1ES0A 2DTML 3RTQD 1UZ6E 4WU7A 2Q7YA 4U6VL 4FQCL 5DD5H 3P30H 4HF5L 3HCVA 4NFBA 1MIEH 1VACB 2COQA 1KEGH 2JELH 1X5XA 5D7LE 2QSQA 3BDYH 3GUTB 4L8CB 3MRLA 2XYCA 4UQ2A 1MAMH 4XPBH 1FG9C 5CEZH 2PYEE 4ZFOB 5DD6A 1LO3L 1JMZA 1CE1L 1XZ0B 2YHGA 3T4YA 4DKEL 2A0LC 3G6JB 1ZGLM 3CDYA 5DWUH 3GMRA 4R97C 3N1FC 4FXKB 1AD9B 1I1YA 1KJ2A 3K4ZA 5KVDL 3I84A 3JV6B 1A22B 5BJTA 4LASL 5HGAA 3BPOB 2J1KA 3U9PL 1FL6B 3ILPA 4FQ2L 1QFWL 1CDJA 4ZUWA 1IL1B 4OSUH 1W72H 4YDJA 4JZNA 1KCUH 4CGTA 3BH9B 2YD7A 2ZSVA 1KB5A 5EIQA 3NH7H 1AJ7H 4L3AA 3MJGX 2GJ6B 3EHBC 3QT2A 1HNFA 3SKNA 1JBJA 1I85C 4JQXC 5IGXL 1SJEA 4PTUB 2SEBB 5FCUH 3VXOA 5HYJE 4DCQB 1G84A 3WS6C 5JORB 4RMWA 3PWLA 5F7DB 4AG4L 2EH8L 3KPOA 3E2HB 5JUEL 4I48A 4WTWA 1M7IB 3QULA 4OZFH 2X1PA 2WIIA 1YUHA 2W59A 5FA3B 4EN3B 5J1AA 1IGTA 1MLCA 4XPTL 5ACMA 1CL7L 4WWKB 3GBNH 1NFIB 3UZEA 3HMXA 1D9KA 2YD2A 4NHUA 3S37L 1A0QL 4DKFL 5HYQA 5ENWB 1E4XL 1J8KA 3IETA 3QUZD 1ODAA 3KPSA 5FGBA 1AP2A 3MLVH 1HSBA 4U4BA 3ULVC 4IRSC 5E2UH 5IV2A 4JHZA 3AUVA 1MFBL 1LP9F 4FFVC 3ARFC 5AYQA 4YXHL 3GGWB 2HKHH 4BKLB 4UIMA 1L9MA 4HF5H 1F4YH 4EI5D 3T8XA 1EFQA 3BD5A 3MREB 3EOAB 4I8DA 3GJEA 1T5XB 4FQHB 5KS9F 1KTKE 1NQBA 3QEUA 3OJDB 4J3WA 1GRWA 4M5ZH 3S36X 3QRFM 4EI5B 3RDTD 1F2XK 3BUYA 1KB9K 3B5GA 3TVMA 2B20A 2V5TA 4NZRL 3LDBB 4LSUH 4OFDA 2ESVA 2Y5EA 4HKZB 3SE3A 3HTLX 3EYSL 4LQ1A 1XF1A 2CGRH 3N1GC 2R8SL 5I9QB 1PBYA 1F6LL 5TDPA 1F3JA 3H6JA 1ZV5A 3RDTB 5GIRA 5HYQB 4I9WD 3NIDF 3O9WA 3P4MA 1PZ5A 5E5UB 1BQHG 1OSZB 2LFGA 3FOLB 3RQ3A 5EIIA 3FFCD 3S88L 5ACLA 4BUHA 4ESKA 2GTWB 2IGFL 5GHWH 3U36A 4WCYL 2ADFL 1UA6L 4YEFA 1QQDB 1KJ3L 4P9HC 1QR1B 5ALCH 1K8IA 4ODUA 5CSZB 3QQ9C 1JGVH 5JLZA 4I77H 3BD3A 3HZVB 5DSCA 4I48B 4J3TA 4PLOB 5KVGL 4M8VA 5DMJB 1E28B 3U6RA 2J4WL 1WBYA 1KIPA 3IXAA 3MUGB 4NN6C 2BVUA 5MENA 5CZVH 2L4OA 1T21B 1NL0H 5DK0B 3FO1B 3RWEB 5ICYB 2F8VA 4NC0B 2VTFA 2FB4H 3GSQB 3KAAA 3U46A 2HVJA 4DKFH 3HC3L 1A1OA 2JB5L 4JCLA 4QWWD 4CVZA 1KGCE 3HC4H 4MXQC 2R0ZH 4XRCB 5HGHB 4FQLL 5ITBL 2KKQA 3VJ6A 1BQUA 1ROWA 5E99L 4ZFZA 3Q1SH 4P4KB 2ZOKB 5JO5B 3LKNA 1MWAA 2A73A 1YEGL 5D70H 1F4YL 3VXSA 2BRRH 1HN1A 1TLKA 3NCMA 1Q9LB 3WFHA 1U3HC 1MI5A 1QSVA 3SBWA 4PJAA 2GTZA 4GJTB 2EEBA 4CVXB 2APWA 4ETYA 5IB4B 2QQKL 1MVFA 4POZD 2HJFA 1K2DB 3OR6A 2UZYB 3PG2A 3DECA 4TSAL 4J8RB 1F11A 5LG1A 2AV1A 2VLJB 3O11B 1RMFH 1CFVH 1KIRB 1RZKL 3MXWL 1XGQA 4J6RL 3C8KB 4K3GA 5I1KL 4NQEE 2EEAA 2FLBT 1MLBB 3NTCL 1HHIB 4JO2H 4IM8A 1FH5L 1QLFA 2V5RA 3UPRA 1IQWL 4MQXD 1CIUA 3HZMA 4AQOA 5HGDB 1CBVH 1ZWIB 1JN6B 4H1LA 1K8DA 4ZS6D 1CK0L 2R69L 5GRZA 3O6FB 3HZVA 4LBEB 2XN9E 3O2VL 5IW1A 4S1RH 3MNVB 4YR6B 2FJFA 2V7NA 4UQ2B 3ZHLA 5FUCC 4NUJA 1CXKA 3HNVH 4IRJB 4PS4L 1SY6L 1I8KA 2Z91A 3BXNB 3NIDE 1DBKL 3K8KA 2DF3A 1NFDE 1WT5A 5DEGB 5IFJB 1UJ3C 3HI1A 1ZVHA 3M17A 1QSEE 3BIBX 4GKZA 1AHWC 4LDOB 4OKDA 1J1OH 4WY7L 4XI5D 1KJMB 5CZVL 3HPJB 4QHUB 2ATKA 3S4SB 2HT3D 3U2SB 2FJHB 5DUML 2XQYG 3W81A 4M8QB 3MA9H 4JZJB 4LRNH 1ZGLB 3DRTA 1BAFL 2UVEA 3NMEA 2PNDA 1CFSA 2WWKT 4ODSH 5GS0C 3MBEB 5DT1L 2BY0A 1QBLH 3ILQC 2JIXA 4ODVL 1WIUA 4G8GA 4L8SA 1D9KB 2IPKA 4UTBH 3ARGA 3MREA 4XMKH 2AJZB 3OKNA 4G7VH 5SV3A 4YZFF 2E8ZA 3ULUC 3CZFA 4ZNEA 3DOSA 5DR5H 2BVTA 3MNVA 4PP1C 5CJOL 3U30B 2QQKH 2VLKD 2V9TA 4Y5XA 7FABL 4DAGL 5JOPE 3FAWA 2R9HD 4KXZI 1JNNL 1P7QA 5C6PB 1WITA 4Y8DC 5HJ3B 1H8OA 2H6PA 3UTSD 1NUGA 5CFHA 2DAVA 2EO9A 5F1SA 3H42L 2DLGA 3OG4B 4N1HB 5I1AA 4M3JA 1U3HB 2R29H 3N85H 3QWQB 4LPUA 4EDWH 4EN3C 3OAZK 2RIKA 2VKXA 1WSST 4AIXA 5K9KB 4JM2C 5LBSL 4LGSB 2F19H 3ULUE 3HFMH 4OGXL 4IRSD 4GSDH 1H3PL 2K1MA 4IMLA 4XWGH 2ADGB 4D9RE 4CU8A 3GK8H 4P3DB 4QYOA 3QRGL 3LQZA 3IDMA 1DQDL 2YEZB 1N6QL 5TFSH 5I75C 25C8H 5EU6E 4KPHL 1MIMH 2RFXB 3CXHJ 1NC2A 1RUKH 2DJSA 2ZNXA 1CDIA 3CNKA 3O3UN 3PNWA 4Z77A 3RI5F 4PJ9D 3Q5TA 3PHSA 5EZJA 3W9DB 3BZFB 1A6UL 5EZIH 3C08L 2CSPA 1GYAA 1H0DA 3RVVC 1KPRB 4WFED 2DWEB 4M00A 2CKBB 2GUOB 1H15A 4NO0D 3DVNB 1ZEAL 4IRJC 1L0XA 4LFHD 4XB8A 5C92A 4H8WH 2GSGB 2I60L 3KLAA 3D0VA 4P57A 4XCEB 3KYMA 2EDBA 3Q3GA 1KB9J 1HXMB 4LGPB 1AY1H 2UYLB 4ODVH 5E6IB 1B3JA 3IXAB 5JDSB 5C0EA 2W9LA 2R1XB 3LV3A 3QDHA 5J13C 2WQRA 5HVFB 2IBZX 5HPOA 3HS0A 3PWUA 5IESH 4NZTL 5GGQL 1PG7L 4O02L 4JN2B 3KR3L 4AEFA 2NTSP 1QQDA 1HQRB 3DSNA 4QRPA 3O3AA 3KNBB 2P47B 5T1DL 1RZIA 4EQ2A 4IRSB 5JPNB 4OFPA 4R7NA 3BX7C 1U95B 5HHPA 5F93C 2O5ZH 4LLVA 3ARFB 1CFTB 4MCYB 3ZKXC 1W72B 1YN7B 3ZL4L 3BRDA 2APFA 2GSIB 3QO1B 3GBML 4EUPB 1I1CA 3TO2A 1RUMH 1FVDB 4W6WB 1RJCA 4Y4KB 4PY7A 1PKOA 4XPFH 4YIQB 4Q2ZB 2FD6H 1GPOH 4PB9L 4YPJA 1Q38A 2YSSB 3ESVF 1T1ZA 4TNWF 1TXKA 1N8ZA 4KV5F 5A16A 4E41E 4OB5L 4APQA 3TCLB 1J8HA 4FQHA 2DQGL 2X70B 4L4VD 4PJDE 5C0IB 3WFDH 5E00A 1MJ7L 2G5RA 5CWSB 3T0ED 5E6ID 1QSFE 4CMMB 4C4KT 1T89A 2VC2H 1P2CA 4TYUA 4JG1H 1AXIB 2QQLL 3MRHB 1Z9SA 3FT2A 4XP4L 5F88B 4DN3L 3ROLB 5HYFA 4MWFB 5JW4R 1I9EA 1JZ4A 1A6UH 3DYOA 1RZ8A 1FFPB 4OZIA 1KIQB 4RISL 1AXTH 4LEXL 1MWAH 3ARGD 4NHUB 4X5XA 5EOCH 4XH2A 1U3YA 3KYMB 1HILA 3G6JE 3BEVA 2AEPL 3MOQA 4XGZA 4NQDD 3V4VH 2C3HA 5EBLA 4JQXA 3WJLA 3RGVC 1TVBA 4GG6E 4X7CC 5IB1A 4G9DB 1QFWI 1IC7L 2IPUK 4U0RB 3E6HB 4J2XA 2YPVH 4QNPF 2MQ3A 4HIJB 1S7SA 1ZLSH 4OCYL 2DQHL 2NYYC 3MRCB 5EN2B 4D9LH 4WFGD 1BQLL 3CCHB 1EAPB 4U7SA 4Z0BL 3WIIL 5J9PB 2AXHA 3VXNB 3WIFA 3T0VA 3R0NA 1XF3A 2B39A 2PR4H 4Y4HB 2C5DC 4Y0GA 4ALAL 4O58H 3DVIA 1QSEA 1CLCA 4NHCL 4JM2F 4K23L 3MTRA 5GGSY 2EDKA 4DTGL 1KCVH 1IC4L 4Y4HD 1OPGL 3CFEA 1OP3H 3W11C 3QBTB 4QRRA 4LF3A 2XPGA 2VDQL 4H8WC 1HZHH 3HI6H 4FP8L 1AHWB 3KGRA 2FSEB 3KJ4B 1E0OB 5F88A 3O8XA 3V6ZA 3ECBA 3RNQB 2AXGA 1MCWM 4TTDD 2HTKC 4L9DA 4JFFA 5HVWA 1HHGB 1X7QB 3O3EA 1T66C 1XIWC 2X70A 3MBEC 5KAQF 5EWIL 4YC2C 1LO4H 1D9KC 1Q1JH 3O4OB 1JYVA 4BSWA 4U6XA 5FYLL 2JB6A 4XNMA 4WFEE 5C7XH 3TNNA 1FORL 3FT3B 4PJ9C 1S3KL 3HCVB 3TP4A 4MLSA 1UM6L 3QZWB 3OKNB 3VD4A 5CUSL 3MLZH 5F3HB 2J2ZA 5FYJH 5F9WC 3WLWC 2DI9A 2BY1A 1ULVA 3IVKB 4ZYKA 1CFBA 1TJHL 3PWPE 5DJYA 3MLUL 4RFNB 4PRDA 2OJEA 4NKMB 5EOCL 1CD1A 2P42B 3ET9F 4Q6IB 1MCDA 3MV8B 3KPNA 3ZDZE 2X7LB 35C8L 1BFSA 4N0UA 5B38G 4JM2D 2VQUA 4R0LC 4OM0L 5INCB 4AEIH 3SE8L 3VW3L 2N7BA 5H94A 3CDCA 1S9YA 4JDZB 4NRYB 4L8DA 3MV7A 3T1FA 5IEKB 1BHGA 2OK0H 3MV8D 3W0WE 5KANI 2BK8A 1MCPL 1ZLSL 1C1EH 4MMXC 5ITFA 4JM2B 4IIQC 1NCBH 4JZJC 4OZHA 3O9WC 1FYHB 1J11A 3VH8B 2P5WE 2ZSWA 5IQ7H 5FA4B 5ESVB 3BQUD 4R7NB 3FQNB 5CGMA 4YR6A 4JFDA 4EDXA 1U8KA 4HULB 1SQ2N 5HDQH 4HC1A 3WNLA 2ZUUA 4KI1A 4RWHA 4K23H 3K2UL 3QXAB 3I9GL 2UWEE 3QCVL 3IU4H 3R1GL 5ANMB 4DVBB 4JDVB 1FAIH 3KXFE 2BXZA 2BY3A 3D18B 4LRIA 4RZCA 1ZVSA 5IHZA 3BZFA 3VDAA 3PDOB 3MRBA 2NY7L 4MSWB 1YEEL 1OM3H 5IEHA 2Z8WC 4P0DA 1A1MB 4OAWA 4OI9A 5D7KE 1QA9B 3HHRB 4B5EA 5DHVB 4R6UA 3CDGA 4U3XA 3KPRE 5CGYC 2E6PA 4KQ4H 3RHWK 1D6VH 3U1SL 3UP1A 1DUZB 2CLRA 3JTSA 3BESR 1JZ7A 1P4IL 1A6ZA 3V7MA 3X3GL 3AMKA 3NN8A 1PY4A 3FFCB 1FZJB 2F58H 5JW4Q 4XBPA 5EIVA 1W0VB 2ESVE 2DS4A 4MQ7A 1EHNA 3QFDB 3MRDB 4PTTA 5FYJL 5FO8B 2B2XH 4UDTA 3LHPH 1A6WH 1YYLH 3VMNA 3REVB 4X5WA 2RQ8A 4HXAL 5A2LH 1ITCA 1MPAL 3Q48A 3CVHH 3FB8A 1M7DB 3BE1L 3QUMB 2VSDA 5GISH 5E70A 3WKMH 3NGBC 3RKPA 5HJ3A 4G9FB 1KXTB 4OZIE 3RWDB 5IIEA 4N9GB 2NQCA 2BCKB 5I75B 3D5OF 4L3EE 3R0MA 3FQWB 4DN4L 1DL7H 1WBXB 4XP5L 2PYED 4PB0H 5GGTH 1QSED 4PJFE 3TN0B 2R4SH 3GM0A 3RBGA 1I3RB 1L6XA 2J8UB 5IB2A 5EU5A 5CEZD 2ORBL 1GZQB 5CEZL 1P5UA 2D7PA 5A40E 1PX3A 3MRIA 1OP5H 4OZ4B 4XH2B 3MYJB 5AUMB 1YQVL 5GXBB 4QT5B 5I1HL 3V9FA 2OBGA 2V2TA 1KF9B 1NBZA 3FT2B 3FONA 3LRSB 3B6SB 4XNZB 1YMHA 2NY2B 5CD3A 4NKIH 3INUL 2VXVH 5CWSA 1DQLL 3BVNA 1IC5H 3X12B 2LVEA 2RJMA 3IU4L 4RNRA 5I74C 3P11L 3MRHA 4G6FD 3EO9H 1DQJA 2B1HH 4JRXD 4PLKC 1F4WL 1FV1B 3PJSB 1R6VA 1JHLL 2E7HA 3FB6A 1D5ZB 3QR2A 3LZFL 2C1PA 4PJHA 4BH7A 2JK5B 5HHNA 3PUCA 3NIFF 1XF2B 2OZ4H 2VMFA 4H0IA 4YQXL 4UV7H 2UUDH 3S35X 2ZOLB 1D6EA 2OXHA 3RZCB 2E27H 3VFPA 3KXFB 4D9RD 3PL6B 1S9VA 5ANME 3F12A 3NFPB 5IF0B 2JB6B 4GBXA 4TVPE 2G75B 1ZSDB 2P5ED 1K6QH 4PGDB 1FAKT 1BFVL 4P2OD 5IB3B 1A6VH 4ETQA 2CLVB 4GAJL 4LIQH 1NLBL 4YH6A 1OP9A 3RZWA 4XT1C 1HYSC 1KLFA 1SVCP 2WBKA 1HSBB 1NCWH 1RZIB 1DBBL 1S9VB 2OQJA 4J8RA 3WFCL 3LQMA 4N8CL 3W11D 3ABZA 1CVRA 4PRNA 2YR3A 1BVLB 2JK5A 5HHNB 4HS6B 1MLCB 1IM9A 5EUKB 5AUMA 3FB6B 6FABL 3VRIA 3BQUA 2P5EE 4DN4H 3MUJA 1ONQB 1UB6B 4PB0L 5GS1C 3WFZA 1CQYA 5D5MB 5LAXA 1JK8B 1FYTA 5CEXB 1FN4B 1IQDA 5D7JC 5F1IB 3VXRE 2YXMA 4PBWD 4XVSL 2Q20A 4OQ1A 1DUYA 2A6JB 2WUBL 5HI4D 1CICD 3LKRB 4NQVA 1OP5K 4P9ML 3MV9B 1A47A 5J06A 2PO6A 1T7WA 2X1WL 1IKNA 4YC2B 3NCEB 2YPLD 1LHZA 3RUGB 3WL9B 2R4RL 5DC0A 2R8SH 1U41A 3MCLH 4X4XA 4U1GB 2X4RA 2F53B 3C6LA 3S5LG 1IC5L 1CR9L 2D7QA 4HCRL 1S78C 4L5FL 4KZEL 2R2HB 2HH0H 3MNZA 4L1DA 4PUBH 3VXMB 4L3CA 2B1HL 2ARJA 2LQRA 5I17A 5FGBC 5MI0C 3DXAA 1TTFA 3QPXH 5C0BA 4WI3A 4P3DA 4QYOB 5CJXC 5DS8A 4XTRC 2BNUB 5C0BE 3VFGH 5BJTB 4QWWC 2ZCHH 3TCXA 4OUOA 5HGHA 3RKDC 1LGVA 4ISVA 4V1DB 2Q76A 5J3HC 3SO3C 5KSBF 2B1AL 1GGBL 4MJID 1T7ZA 3PABA 4S2SA 5C0IA 1QRNB 1OTTC 4J4PC 2Q8BH 5CIPA 5J57B 3FO0H 1U93B 4HQQL 1AGCB 3KJ4C 1MJ8L 1PYWB 3PDOA 3HUJB 2FX7H 3QQ9D 5TE4L 3GNMH 1JF5A 5BRZB 4OD1H 1D9KD 5C0DB 3NN8B 3TEUA 4ZO7A 5GZOD 4JDVA 4PJCB 4LVOC 3RZCC 2NR6C 4NZDA 5I19L 2FB4L 3E8UL 4P3WA 4UNVA 5DRNB 3O6KH 1KYOK 4Z95L 2FHFA 4DZBA 3IYLW 2Y07H 4BZ2L 3WNOA 2BSSA 4M6MH 3KDMB 4HIXL 3DV4A 2A74B 4KKCD 5JHDD 3O4OC 4MZ2A 5ITBH 4RAHA 2ADJB 2DJ4A 4PJ9B 5D7LB 1I9JH 3VG0L 4JFEB 5KS9E 3MLSL 3HA0A 4LEOB 5IFAL 3V6OA 3EO0B 4RWYL 4D94A 3WMSA 4JO4H 1Y6NR 3WLBA 1D5XA 5MEOB 3TVMD 3L3IB 4MJ5B 2K7PA 5DMIH 5ICXA 3JV4B 4U1HB 1KB5H 1UEMA 2VITA 3QO0A 3H9SE 1FE8H 2MFNA 5IV2B 3B9AA 5TQ2H 3T4AB 3VFTB 2XZQL 4Y2DA 5DEGA 3MMEA 1KJMA 1U8MB 4X80H 5GGVL 5J6GA 1U58A 1MCFA 3P73B 1CD8A 2W0FA 3GJEB 3SDDC 5I1JL 4QTIL 5HHOD 4KUZH 4IOSD 5GS0D 5FA3A 5AAMA 1BBJA 1REIA 2YA1A 5T3XH 3QIWD 5KSAA 1HKFA 1T2QL 3OL2A 1MI5E 2YPKA 3RAJH 3LRSA 3QHTC 4OLWL 5GZND 4H1LB 3VFGL 3SKJH 2CXKA 4D0CB 1C5BL 1FL3B 3QDME 3GJFK 2RHEA 2NXYD 4V2CB 3MYJA 3HNSH 4K3DH 1KN2L 1BD2B 2MHAA 3LEYL 4MAYB 2P48B 4Y16A 1HXMA 3W2DH 3TBSB 1C16A 3CMOH 1AXSB 3OR7A 4K7FA 4M7KH 5DURB 2R56H 4PJGE 1VADA 1G0XA 3T0EE 2YD3A 1LO0L 1BGXH 2O61B 2QSCH 4GRWH 1Z5LB 3PP4L 1H5BA 1NDMB 1RZJH 5D1QA 5FV1L 2B0SL 1N6UA 5DVOA 3WFBL 3M8OL 3V6BR 3QCTH 1F00I 2EYTA 5JXEA 5EB9A 2H32B 4YDLB 5L2KA 3MUY1 4NM8H 3ILPB 3QDJB 1FL6A 1PLGL 4QHNA 4HJGB 1KYOJ 1RUQH 3GHBL 5I19H 3BAEL 5EU4A 1GVIA 4BH8A 5DZLA 2P45B 3CZJA 4PLKD 5EFIB 5E2VL 5GGUA 1FYTD 4GQ9L 2NY3D 2VISA 4K8RL 1XFPA 4LLDA 4P2RE 1L0YA 1EVTC 1J7VR 1R5VA 3BW9B 1NGYA 4X8JA 4G43A 2PXYD 4GBXC 4YO0A 3UDWA 1NAMA 5E8OB 5GRXG 3QDJA 4HGKC 3ZYIA 3LKSA 1AQDA 1U2CA 2AJ3B 5ILTL 4X4YB 3D87B 7FABH 1DEDA 2G60L 3P30L 4F7EB 5KTEL 1KB5L 3RUGE 5DRXA 2DQTH 4L4JA 1NC4A 1QTYT 2GKIA 2IC2A 4N5UA 1AKJD 2OZ4A 5F9AC 3SY0A 5MENB 3TO4B 1JWUB 3TT3L 5IVXE 1EEQA 3BKCH 1JFQL 1HQ4B 2VQTA 2BJMH 1IQDB 2YPLE 4UAOC 2A6DB 2BP3A 3QIBA 1H3XA 5GSVB 4TN9A 1HYSD 3DO7A 4UTAH 2F19L 4PRPB 1JGUL 4GXUM 3VRIB 3DSFL 2GEEA 5HI3C 3FRUB 1A6TB 4LSTH 3ZLQC 1FLRH 5LJYH 1IAOB 2EZ0C 1ZA3B 5JIPA 1Z0NA 5SWSE 3C5ZA 5A43C 3HKFA 3BIKA 4OCRH 4HIHA 4NUJB 4M7KL 4IOIB 2DQEL 2V2WB 1IGCH 5DQJB 2BHYA 3LY6A 4LGRB 3ZT5A 4UV4H 3KLHC 2FHCA 1DQMH 4YHPA 2VXUH 4R0LA 5DQ9B 1PVHA 4FRWA 3S35H 4MNGA 5EO9A 3KPNB 5DUBA 3ZE0F 4I0KA 2FO4A 5E1AA 4H8WL 2EE2A 1CD0A 2EDDA 2ED7A 4HXBH 1UH2A 5CJXA 3FTGA 4JPWL 4F15B 3QEUB 5CD3B 3V5HB 1IEAA 1UM4H 4HH9B 4RMQA 5JXAH 4PJCF 2P8LA 4ZTPL 5L88H 5E4EB 1LD9A 5DFVC 5E9DD 4OGYH 4FTVB 2R2BA 4DUXA 3KPMA 3JBG7 4LPYA 5B22A 3A67H 4ZAKB 4U1NB 2V17L 1W72A 1I3RA 2J8UA 1MFBH 5EG6C 3KPRA 3UYRH 4U6YB 3MGTB 1T20B 2W0KA 5T1DH 1NGWA 4EJ1C 1HOCB 4V2BA 4ZODA 2OJZH 1RY7B 3I6GB 3K81A 5CEYB 2YRLA 5H35A 1Q72H 5L9DL 3ETBF 4NC1E 5FECB 3CFJB 4IDJH 3FO9A 4P5MA 1K9TA 3T1WA 3UBXI 2FYYA 1MCEA 2XKSA 4KKCC 1N26A 2NY6D 3RGVD 1HDMB 1ORSA 4NYLB 1MWAB 1Q0YL 1JGUH 1DSFL 4R9HA 4DGYH 2VR4A 3FFCA 4ZS7H 5CJ5A 3HPLA 2IANA 4WTZG 3GSNH 3KS0J 1TQCB 2NY6B 5F6HI 4P4KD 4BZYA 1EMTH 4NWTL 3MRCA 5EORH 1C08B 1DLFH 4EI6B 1FIGH 4ZNEE 2XWJA 2RR3A 1FSKB 3KPLA 5KN5A 3MJ9L 1UA6H 4PRPE 1KNOB 2W0LA 2JCCF 1RIVH 2JTDA 4X99B 1NMBL 4M5YH 4AL8L 3NA9H 1T21A 1SEBB 5C09E 3QJHB 2YEZA 2DQCL 3GSUA 3ZTNH 5BO1L 1FZOB 4FZEL 1LVEA 2XZZA 3SO3B 2MOVA 1A6ZB 2O5YH 2X44D 2VLJD 2WQ8A 5IUSA 3BP6B 1FGVH 1C5CL 2J5LB 3AS0A 1A02N 1UJTA 4OCMC 3OMZA 1XZ0A 1AGFB 4JPWH 3IJYB 1ZOXA 1OSPL 1J5OH 1MRDL 2H41A 3L3OA 5B8CC 3F7PC 1T1WB 2HFFA 1CE6A 5FFLA 5JXAL 2WK2A 3BUYB 3TJHD 1F97A 2JB5H 2P7TB 1NLDL 1DR9A 1PFCA 1R3LB 1R5IB 1CFQB 3UAJC 3IU3A 4LAQH 5I8OH 1JZ2A 1BM3L 1MOEA 5FO9B 2R0ZL 2QHRH 4KI5D 4Q74A 4YHIA 3RGVB 2ERJB 2EDXA 4HDIA 3UTZB 3IGAA 1R3IH 1KN4L 1UYWH 2VERN 1HI6B 4R2GC 1HHHA 2EYRA 3HZYA 5KSAC 3WNPA 4LFHG 1ZT4A 2GY7B 4ZUVB 4MNGE 4FTVE 5F8QC 3O4LE 5L9DH 5C0GB 1OARL 4KRNA 1ZXQA 2OM5A 4X6DF 5EPMB 5K9OA 4FP8H 3MJ8B 5DK2B 2ZOLA 3MRQB 4KK9C 5DRZA 4OF5A 2ZUQC 3L3HB 4G8FA 4W4OA 1UQSB 1NFIA 3VFUB 2QSTA 4KTEH 3VGFA 1NBVH 1RMFL 1RZKH 3T8XB 5I1KH 4C58B 3UTTA 2UZIL 3ARGC 1Q0YH 1S7RA 4ONGH 5SX5H 1S7VA 4X9FA 1CFSB 4XNMB 3W0WD 5ERWA 3E1F1 4G6FB 4GQPH 5C0RH 2XQBL 4UUJB 5GS2D 4Z7WF 1HHJB 4M6OH 2XTLA 3QI9A 4GOSA 3V4UL 4NWTH 3CGTA 1JWUA 2F8OA 3IETB 2ENYA 1FIGL 3IS1X 4HDIB 4GKZB 2DB8A 2ZUWA 1FZOA 2W65A 4FQJL 3RI5K 1U8NB 4EUPG 1N64H 1INEH 3C09B 3L7EB 1RIVL 3IU3B 2XKNB 4TUKL 3DMMD 1SY6H 3MBED 3DUSA 2P8MB 3GI9H 4U1SA 3HMWH 1YNTA 3MV8E 3TNNB 2PTVA 1KLUA 3DETC 4O5LL 1C5CH 3HC0B 4JPIB 3SDXB 2ZUXA 3IDGB 3AFLA 3BP6A 2HT2D 1NBYA 4GXVH 1YEIL 5EUOB 3G08B 4HMEA 1HXYA 4KU1A 5I1LA 4OF0A 4PRID 1KB5B 4KDTC 3UMTA 3WKNA 3FZUD 3ZKQD 1BM3H 1P7KB 3QEGH 4O9HL 1I8MA 4R4NC 1BX2B 1DEEB 4JRXB 2EC9T 2X4SA 1KN4H 3QHFL 4TUJB 1U3HD 2X89D 2D4FA 2DM7A 3FN0H 3ARFD 4HH8A 4HPYL 1AXSA 2VQ1B 4LCWD 3DBXA 2FX9H 3V0AC 3P9WB 1Q0XL 3PL6D 5BVPL 4KKBD 4L29B 2ZJSL 4MWFA 4QRQA 4IDLA 2ZPKL 2HWZH 4G6ML 2F54D 2FYYB 1MCCA 1QFPA 3D85A 3D48R 4NJAH 1QUNA 4JJ5B 5KSAB 1EV2E 43CAB 3MRMB 3QDJE 5JOEA 1A7OH 1JGEB 5F96L 4KMTH 1KT2B 2A1WH 1EO7A 1RVFL 2VKWA 3P77A 4GFTB 1QFOA 5L8LB 5TGBB 2AXFB 1LDPH 4JY6A 3L5WA 4HKXA 3LEVL 1EFXA 1PKQB 4OGXH 4JB9H 5D6DC 1I7RB 4KK6D 2DLFL 4MD4A 4RMRA 3RWHA 1INDL 2D2OA 3BH8B 2IH1B 1S9KC 1OOAA 4TUKH 1ZS8A 4KK9D 3ZTJH 3GMQA 4CADA 5ID0B 4Q9RL 1E27B 1Q8MA 2H3NA 5DYOA 4JLRA 1CFNB 1U95A 2PXYB 5HHPB 4H26A 1Y0LA 4NO0A 1EZVY 4ZNCD 2ZG1A 5EZIL 5IQ9B 4PJIB 3MV8A 3QEQD 1FBIL 3OAUH 3IFLL 4NQDE 3O3AB 4NNXA 3P2TA 3FFDA 5HGBA 3ME0A 4HWEL 5DGQA 2EECA 3PGFL 3QQ4B 4G5ZH 4ODXB 1YQVH 4XCCH 4DOHB 4LBEA 5I1HH 4KJYA 4Z6AT 2V7NB 4RAVB 5F8RC 2LU3A 4MNQE 5D7JD 5FKPB 5HYSG 4HFWB 2FEDD 2M26A 1OAQL 4G8IA 4XBEL 1T80A 3EYFA 1WEJL 2WIMA 1SEBA 4HKXB 1EGJA 2FJGA 2XTJB 4KI5E 4X6EB 1NBQA 5E5MA 4M48H 1QG3A 3JVGA 2FX8H 4DJMA 3FN0L 5KVEL 5EBMA 1KNOA 1T5XA 4JFFE 1CFQA 1NCAL 2M1KA 1YEJH 3EFDH 4KH2A 4JFOB 5D1XC 3FT4A 2H32H 4EVNA 3BZ4A 3PQYA 4KV5E 4F7TA 4TNVK 2O5ZL 4Z7WA 2BDNH 4OFVA 2KH2B 4NNPL 2XZAH 3OX8B 3ZL4H 5E2JA 5IJVA 1KXQE 4NQDB 3EJZC 4JRWA 3GBMH 4TULL 1CGWA 5EBGA 3HUJF 4KHXH 1J10A 4XP9H 5I74B 4GW1B 2HA1A 3JSSA 2SEBA 3T77A 3VRLF 1L7IL 1UKTA 4WNQA 1K4DA 1FVCA 1VFOA 3TIDA 5DJAA 2A1WL 5HHOB 1BOGB 1CI5A 3GBLA 1OTSC 1KV3A 4S1DC 3S96A 4YHZL 1JF1A 2CKBA 2GUOA 4D0DB 5IMLB 2P5WA 5E1HB 4KJWC 5AZEL 1M7IA 3TBTA 3MJ9A 3G04A 4R4FH 1S9WA 3DI3B 2HRPL 5DHYA 3QCUL 3PL6C 5IHBA 1MJ7H 1K5NB 2IAMA 1S78D 3HR5B 4PY8I 4H0HB 4L1HA 4LSSH 4G9DA 5DK0A 2NY5H 2QADB 4AEHH 4OF3A 4OD3H 1QEWB 1GOHA 4N9OB 2NXZC 1BVLA 4NQDA 2AQ3A 4XZUA 1MVUB 3IKCB 2X4PB 2HFEA 2VLLB 4UUJA 3R06B 3O0RH 3G6DH 1MCWW 1YNTB 1A7NH 2QADD 4F8TA 4K3JH 2VLKA 5J13B 2EC8A 3IDJA 4KTDL 1NSNL 1Z5LA 1S7UA 1U42A 4KKLC 4P9MH 2AABL 3UAJD 2J5LC 2YPVL 1NAMH 3LIZH 4KQ3H 2OL3H 3SGJA 1IAIM 1BQLH 2JJVA 4C54A 4HFWA 4RDQG 2D03L 2GJJA 3VFSB 5IFHH 2FX8L 3PV7A 4HKJA 5IG7B 1YEDB 3OXSB 3GFUA 4YHKL 3VGHA 3ZKXB 2V7HA 2X4TA 2NR6D 4OLXH 1IGIH 5C6TH 4RBPH 1WFOA 2N1KA 2YA2A 5DVLA 2CIKB 3GJFB 3PDGA 4XVJH 3CSYA 4OZFG 3CSGA 5TPWH 1NCTA 5JMOC 3AS1A 2CO6B 2VLME 3MA7A 5I71C 4J23A 4ELMB 4HWBH 2VDQH 5J6GB 2P7TA 3AU1A 4GRLC 4WUKL 4PP2B 4A6YA 5DQ9A 1F90H 3D85B 4HJ0C 4LLVB 1JMXA 4HG4K 5GRUL 1N0LA 1ZA6B 1LE9B 5LXGL 4N0CC 4P2OA 3L1OL 1CGSL 4HQQH 5C2UB 4O2EB 4HBCL 1JPTH 4L29A 4JN1L 1EUUA 2LAGB 4Z7UB 2V2XA 4R4FL 1KLGB 4NT6B 1BP3B 2QR0A 4IRZH 3U4BL 4F37K 5BRZA 2X1OA 1U8QB 4N68A 2ITDA 3G6AA 4LRIC 5D7IA 4HIXH 5C0AA 1FPTL 3MLZL 4ORGA 3HMXH 1JRHL 5FM5M 2EDHA 5TE7H 1U8PB 3MROA 5KVMC 5IVOA 3VGAC 1EBPA 5IVNA 1F3DH 2C3WA 1DBAH 5F89A 1A9EB 1KFAL 2VDNL 2OLDA 3IJYA 3MLSH 5ISZD 5KSVA 3ARDA 3GMPB 3EOTL 3IRPX 4LLWA 5DZNA 3RNKA 3QUKB 4U6VH 5D1ZB 1A7NL 2DLTA 4PJDA 4LLQA 1A21A 4L9LA 3PGDB 5D6DA 2B4CL 4BFIA 3CXHK 1MIEL 4X4MA 1OCWH 3RIFK 5DRWA 5EOQH 2XQYK 2VLJE 5J4MA 3FB5B 1RJZB 2AABH 2NY0C 3VJ6B 4ZUWB 4JPKH 1LO3H 1MHEB 4CAGA 4LSDA 2OL3L 3BH9A 4XNYH 4OTXL 3UEZA 4YDIH 3QUXA 3L3KB 4NO3A 4KK8C 3EDFA 3ZE1E 4WHYH 5I1JH 1JPSH 2DWDB 3CDFA 5SX4H 2K9UA 2A73B 4OLWH 4WWKC 2P4AB 4HLZH 3STLA 2Q3AA 1MCJA 1OHQA 2FBJL 1LNUB 2LE9A 4U1NA 4ZOEA 5GZOC 3NACL 4HW6A 4OSUL 1JE6A 4ONHA 4AMKL 3VWJA 4J3XA 3OZ9L 3IDIA 1LO5A 2WWKO 1ZKAA 3EYUL 2Y36L 1KENL 1TPXC 4RA3A 1OP3K 4JFOA 1XIWB 3B9DA 3IFOA 4QHNB 1YEHH 1G7MB 4UBDC 2MCG1 1AI1L 1F6FB 2HP4A 3O4LA 3DMMB 2DM4A 2D0GA 3OAZH 5GZNC 5J12C 2NXYC 2XICA 1JI2A 2DLHA 4X6EA 5K33A 5I16B 3EHBD 1VENA 5ELIA 1XIWD 3BEWA 1RUQL 4YHNA 1C16B 4GRLB 2V2XB 1A14L 4YPGB 4BA8A 5EU7E 5JOFB 3B9EA 4GMSH 1MJJB 1B0GA 1O5DT 1NANH 1NGPL 1YYLL 5FYLD 2IH3B 1FGNH 3UBXA 1FNSL 4XP1L 1A6PA 3D3VE 3WDIA 2BSTB 2VABA 1R5WB 1I8IB 5D7LA 12E8L 3H9YA 4J3SA 3BYYA 5EU6A 1OGAE 5A2FA 3EOBA 3GSRA 3CLFH 2Q3ZA 4LKCB 4BFGA 2AJYL 3AVEA 3IFPA 4KHTL 3UJIH 1WZMA 5JA9A 3ES6A 1BLNA 4LKXA 1G9NH 5C0GA 3VGAB 4DGVH 5C0FA 5MEOA 1MAKA 5FDWA 4DFIA 2A6DA 1T6WA 3BPCA 4GBXB 4LCIH 3BMVA 4IOIA 3S4SG 2X2YA 4OLVL 1CG9A 3SPVA 1UH3A 1PKQA 4P99A 1DE4B 3BPOC 2ITCA 1F45A 4FFVD 4LSUL 1ZA3A 2DLIA 1JPSL 1NMAL 3BSZL 4OV5A 4BH7B 4LLYA 1A6TA 3TA3C 4P9HH 4LHUA 4EOWL 3L5IA 2VDOL 4OUUA 1U91B 2A9NH 3RJDA 2X1QA 3LS5L 3UPCA 2FBJH 4QRUA 1MF2L 5E8NB 2F5BL 2WMPA 3DV4B 1KPUB 5FGSA 5IMKA 3VFMB 1GXEA 2XA8H 3OZ9H 1B6DA 1AGFA 4Z0XB 2DKSA 4OCRL 4JFXA 4UAOB 3V6OE 3F7QA 1A7PH 1SEQH 2OTUA 3JV5A 4ZO8A 2R1WA 5D9SB 5BVJA 4P4KC 3SKNB 4YQXH 3KJ6H 4LNVA 1JGVL 2NY1C 4B0MM 1OAKH 4PJBF 4PPTA 1A7RH 3CK0H 3OXRA 5KVGH 3F5WA 1FFOA 1BVKB 4MNHA 5CBAB 5H35B 5D2LB 2YPLB 3TGXA 1RU9L 3VFOA 4KMQA 2CDEA 4DFHA 4X9HA 5D1QB 4G8GE 1V05A 3X17A 2OCFD 4XRCA 3NGBB 4H88L 3IAGC 4RRPA 4OLZH 5F7MC 4J3UA 3TNMA 1CDGA 4NPYB 3JXAA 1F4HA 1M7DA 5IR1A 5FGRA 2QL1A 3IDGA 1M6OA 4Z7NF 5K9QG 1LD9B 1VEOA 2Q86A 1DBML 1JHKL 5F9OH 5M7QA 2LTQC 1XF4A 5ID1A 2F53A 3C6LB 5I8KL 4CBPA 2XG4A 1S7QB 3UJIL 5IHZB 4M93B 1EO5A 2OJZL 1CLOH 1VHPA 5I8EB 1NEUA 1EHXA 5JIHA 5SWZB 4NQED 3T65A 3T0AA 5IHUL 1FVEB 1GGCL 1S9XB 2CLZB 1XGPB 1AIFB 2NXZB 2XKUA 4KY1L 2CDFA 3STZB 4XNZC 3QJFA 3MGTA 1VGKA 2WNGA 4LLYB 1UZ8B 1WGOA 4HBQA 5BMFL 5I15L 3C60A 5CMAB 5I1IH 4NRXB 4WHTB 3RL2B 2ITCB 1MELA 1PD6A 3MR9A 5A2JH 2Z35B 3ARDC 3FQTA 4N8VA 2EDOA 1EZVX 2A9NL 5KVFL 4H25A 1FH5H 1R3HB 5DJ2A 1LWRA 5INCA 3S34L 4OI8A 4PRIA 4UDUB 5DK2A 3VWKD 3QUYD 4YNYA 1SEQL 5IVXA 5F9JA 3CH1A 5ESQB 4ODHH 2DJUA 3KJ6L 1IEBA 4PRHB 3DURB 3O2DH 4FQXC 1VESA 4F58H 5D1ZC 1N6VA 1CTNA 4EQ3A 1PGRB 4QRPB 5DRNA 5BO1H 3RZCA 4QTHB 4DZ8B 3EOAA 4L8DB 4PJCA 3TYGL 3VXQB 5D93C 2GCYA 4ZS6C 5IF0A 5D7LD 3PV6B 4LEOA 2YD6A 4FQIL 3HI5L 2E3VA 3SCMD 4BQ9A 3ALWA 4ZUSA 4S0SD 2YS4A 4PJBE 4PRDB 2R9HC 2XN9D 3JWOH 5DTFA 3QIWB 4XP6H 2X10A 5DT1H 4ZOCA 3U83A 4LSRH 2AGJL 1VFMA 2DN7A 2CPCA 4LCCA 2X4NB 1FNGA 1P53A 2CKNA 2VLRA 5SWZA 3V4PL 2DQUL 3QFJE 3RWFA 2FZ3B 4LSVL 4NKQB 1JPFB 1FLTX 1I9JL 1TNNA 4HUWB 5D1QC 1NDGA 3UJTH 4WI2A 1HSAA 4RFEA 3UX9B 4XXCC 5EZLA 4NJ9H 4U2YA 1WICA 3ZHKA 3L3JA 5BZWB 2D7TL 3B9KB 1CZ8L 1MFEH 2EDJA 3O2WH 2D9CA 4PGJA 4DAGH 4P5KB 5IMMB 3VWKB 4IJ3B 1XT5A 1VGEH 5CIPH 3CSPA