4DCUA

Crystal structure of b. subtilis enga in complex with gdp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
432
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 134
structure length 400
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA01
3EG5A 2QE7D 1T91A 1UKZA 5CB8A 2QY9A 1PVOA 1NN5A 1E9DA 1Y3AA 4D2IA 1E2GA 3MAAC 5FI0B 1QWIA 1Q44A 1SKQA 3LVRE 4EPWA 1GZSA 4RD2A 5EQTA 1WXQA 1YR9A 5AJYA 5EZ6B 3Q85A 3LW7A 4ZDKA 2QP3A 1OXUA 2YOHA 4Z8YA 1TADA 3H2YA 4ZI3A 1B0UA 3R7WA 2Q3HA 5D3QA 2Z4RA 1E2QA 2GBLA 2GXSA 4US1R 5CM9C 1W4CA 3WNBA 2DWPA 1G9XA 5G53C 4EFLA 2GESA 2ZRGA 4AKHA 4RD6A 5FL7A 2IYQA 2IF2A 5H68A 1A2BA 4HLDA 4JI4C 2GETA 3M1IA 3MG9A 1CXZA 3QXHA 4TMKA 3ZIAA 1RW4A 5L3SA 1G3UA 2RGAA 3A1WA 1EGAA 4B3FX 4DLTA 2ZI4A 3VAAA 3BS4A 3ZQJA 4YDHB 1AIPA 1KO7A 3LRPA 2FX3A 3I3SR 4HZIA 4JSTA 4RD0A 4LHVA 1M74A 2JLUA 4IKEA 2QRNA 3ZQ6A 5AWFC 2WPDD 3U7EB 2ZJ2A 1XD2A 4Z8XA 1X1SA 1E0KA 5C1BA 1I4DD 1NLYA 5C18A 5LMUC 3I61A 2IYLD 4JS0A 4CGZA 1NG9A 1E2MA 3EARA 5JJKA 2GCOA 1PUIA 4BFXA 3VKHA 1CR1A 4CRWB 4L9WA 5LB2A 1E69A 3SI7A 4BZPA 1ZBDA 3EC1A 4Q02A 4QC2A 1N5KA 3LXXA 2AD1A 4PAMA 1U0LA 5FTLA 4ZCLA 2WSSD 2FZLA 3IHLA 4B71A 1OXSC 2ZYWX 4V03A 1OIVA 1R8QA 4D6PA 1G6OA 3SFVA 4DR2C 2IUSA 2ZE6A 3NH6A 2Q3MA 1HE8B 2CVFA 4Q4AB 3P20A 2PT7A 4PHFA 4WIAA 5FFMA 3VR3A 1JOSA 4DCNA 2ZSDA 4LC1A 4BFZA 1JJVA 2F3TA 1AJEA 2GA8A 4D4MA 4GMXA 3RSLA 4DB4A 4TTPA 2H17A 4D25A 1SGWA 4RY2A 1AQUA 1XXHA 3AP2A 4LYAA 2N1BA 4KFRA 3THWA 3TAUA 3X1ZA 2ORIA 1OE0A 1OFUX 4WXRA 5BYKA 3A1SA 3AVVA 2RHDA 4JI6C 2FWRA 4NP6A 4AYTA 4HZUB 3P27A 2DYJA 2W6IA 4RFSB 1VG9B 3LWNA 1WA5A 3OF5A 3U3OA 3HU2A 4YMTA 1F2TB 2IF0A 4F38A 3VMFA 4F4JA 1IN8A 5DHAA 2MSEB 2CBZA 3A4NA 4G5OA 4MA4A 4URVR 1G3IA 5FOVA 3CF0A 3KQNA 1XEXA 4B2PA 1KSFX 2OBMA 4HDCA 821PA 3VNVA 3ADCA 4S2EA 3R7WB 5KTYA 5EP2A 1IXRC 1SXJC 2QMEA 3GEIA 5UKDA 4E22A 4TMZA 2REOA 3BIFA 4OK6A 4MH4A 4Q18A 2P3SA 3KXLA 5A5GA 4DCUA 4XSHA 3THWB 2OESA 4KLZA 5JI3E 3PJRA 1NVXQ 3WYFA 1OH6A 1W2GA 2IUTA 2JGNA 4M1SA 1HE1C 3A1TA 1Z0KA 1HT1E 4B6EA 2HHHC 4LZZA 4V02A 2JLZA 1BO6A 2AKAB 2O0KA 4FW9A 2ZI6A 1D5CA 4C4PA 1OJLA 1RE0A 1ZB9A 2ZRFA 2PT5A 1FL9A 3IQWA 4A8JB 1E2PA 1MT0A 2QG6A 2ZRNA 4X8HA 3UMRA 2JLXA 4CEIA 5JHGB 5FH9A 1AM4D 4RZ2A 4HUQA 3KFVA 4BLPA 1BIFA 2QSYA 3B13B 3W6PA 2C95A 2PL3A 3DOEA 1DPFA 1ZC3A 1HA3A 5AJXA 4MH0R 1VHLA 4JZKA 1QBKC 1RRGA 1GKYA 4Q4JA 2C9CA 3WNCA 4DLYA 4DSTA 2QBYA 5FPKA 1M7BA 3CX6A 4G5QA 2B6HA 4MYTA 4Q7JB 5K8LA 2R9VA 1CKEA 5CIQA 2GJAA 4Q4HA 4UXIA 4BLRA 3VNUA 2ZRCA 4L9SA 2JLSA 4LF4C 3ZS8A 1YHNA 4TLBA 2ONJA 4HAZA 2Q21A 2PCLA 2E87A 3R8CA 2DR3A 3OEEA 2PJRA 4QGGA 1Z07A 3PUWA 1DS6A 3U44B 5LD2B 2V7QA 5M04A 3QXSA 3GQBA 2BJOA 1OH8A 3FKQA 1C1YA 1WBBA 4DR4C 3QKSB 3SZRA 5F2EA 4V0ME 3I4LA 5FTJA 3RS7A 3CO5A 1D9ZA 1DOAA 2E5LC 1XD8A 4OI4A 5JRZA 1OIWA 2ASEA 5FUWA 3LQRA 4PSKA 3N2IA 2WTUA 4TT3D 4KYIB 3UWKA 2PMKA 3D31A 1CJMA 3BH7A 1L7VC 3KQUA 2XZOA 3FE2A 1XEWX 3QF4B 1GVNB 2A2ZA 3SFZA 2E1RA 1P3JA 4A2PA 4ASUA 4FN5A 2ZRPA 4B3BA 4URWR 3UMFA 4PPFA 2J59A 3KKPA 1MO5A 3EA5A 1G5RA 1X8JA 5BXQC 4TLAA 1ETUA 1JXMA 2MMGA 5D3MA 1E9BA 1TQDA 4PANA 4QHSA 3TKLA 2J9RA 4YMVA 2D7CA 3DKPA 2DPXA 3OESA 3EZ9A 1ZINA 3QEOA 5EE0A 3DL0A 4BFYA 2IWHA 1KAOA 2GJ9A 3TSWA 3R9IA 4PXAA 3NVAA 2B7BA 2NZ8A 2CY1A 3CJEA 1M2OB 2CEAA 2OV2A 1KI8A 4XH9B 3D3QA 2X2EA 2XXAA 4CYMA 2WWWA 5IT9D 2UZIR 3G5UA 3MRSA 2LKDA 4UNRA 1II0A 1AK2A 2OCAA 4RVCA 4JKYA 3AP3A 1ZW6A 5TDHA 1W0KA 1UEJA 4P31A 4EAQA 4NKRA 5DGXA 1N34C 3E70C 4I4LA 3K1JA 4JKIA 1SVSA 1ZD8A 1OFTA 1KSGA 2ZTSA 3PUZA 1IN4A 2WPDA 4GT1A 3NTUA 2QROA 3QI2A 2GBLC 1XBTA 1MABA 3LBNA 4BUJA 2JDIA 4MITA 2ZR9A 3C7KA 5JWHA 4CIDA 4B2IA 4BE7B 1NSFA 4MQBA 2XTNA 4NU0A 4RKEA 2JA1A 4OYHA 3B82A 2CL7X 2WSMA 1G3RA 2G1KA 2H92A 1NLZA 3HPRA 1CF4A 2JLWA 4BECA 1V43A 1OYWA 4HB0A 2H18A 4TN1A 3W8RA 1W44A 3QQ5A 4XWAA 1AKYA 1Z3IX 3IUYA 4P3YA 3T15A 1W36B 4GKJC 3WNDA 1VIAA 1C9KA 3QPVA 5FTKA 2J0VA 1VYVA 1MR3F 4XD7D 2QL8A 2R8RA 4Q03A 2NO9A 4LUCA 1NNEA 1KSJA 1CULC 4HLUC 1OPXA 2H8KA 4DT1A 1Z22A 1DO0A 2WWXA 1TX4B 1QHHB 1WMSA 2F6RA 2OE2A 1EWQA 4FINA 1M1YE 3ZZUA 1OXVA 3THXA 1KMHA 4B75A 1KI6B 4LHYA 4QBIA 1KO8A 1OIXA 2XNDD 1E9AA 1N25A 2ATWA 4ZDJA 2R6FA 1FP6A 1XRJA 1H8HA 3TGPA 2VHCA 2MSCB 1TF5A 1NN0A 4HAXA 1XMJA 4KSCA 5CYOA 3NC1C 1Q1ZA 3GFOA 3W34A 1RRPA 1GITA 1LB1B 3FB4A 2H57A 2EU8A 1HNWC 1D2MA 2CHVA 3WHLA 3KB1A 3WRXC 3A6PC 2Q3FA 1QRAA 5JI2E 4IDQA 4CF7A 1UFQA 2C5LA 2GCNA 3K9LA 4IHQA 2V55B 3TNFA 3CRVA 2FNAA 4LJAA 4EPXA 4LWZA 4QGHA 3I1FA 1QDEA 2ZETA 5J4YA 1ONBA 4NCKA 3IO5A 1HQCA 2HCBA 1R10A 4PPQA 1N2CE 4IFBA 4TQAA 4FMDF 2AD5A 3ZVRA 5LMNC 1I4LD 1KDTA 1SVIA 3RANA 4PO9A 4GOJA 4L15A 1TQ6A 2P65A 4W5JA 4D4KA 1DAFA 1EX7A 3U3KA 2J7KA 2AN9A 2IYSA 1WDTA 3AUXA 2WIAA 4HDQB 4EPTA 4TYQA 2F1RA 5EXXA 3WMFA 2ANCA 4XVRA 2J0UA 1XX6A 2TMKA 1R8SA 2JAQA 4LJ7A 2QPAA 4LF9C 4POAA 2KB0A 2P0EA 5B30A 1WBDA 2Z43A 4M53A 4KU4A 3T1QA 1NL3A 5CK5A 4L16A 4BWYA 1OXTA 1G16A 4PZZA 4LRWA 1TU4A 2BM0A 4G3XA 4W7SA 2DBYA 2AHOA 4GP6A 2A5YB 1HNXC 3J81k 1S9DA 3EIEA 2REXB 2ZUDA 4PPGA 2V4ZA 2GXUA 2CK3A 1NJFA 1T5IA 2W0MA 1TF2A 1YZTA 4DKXA 1FOEB 1CS4C 1DADA 3UIEA 1V5WA 4B34A 3NEJA 2NPIA 1S1MA 4LOAA 1H8ED 1TPZA 1EFTA 2RGNA 2QT1A 2VF8A 4G5GA 3RRMA 3KXKA 3VU9B 3G0HA 4OK5A 3EZFA 3L0OA 4BLSA 2ZM6C 1GM5A 2XOKA 2W2VA 3CH4B 1WP9A 4GNKA 2RKOA 2XSZA 2JLVA 2GWHA 5HE8A 2YC2C 1EFRA 2BMFA 2VEDA 3EWAA 1Z6YA 3E5HA 2FU5C 1RRFA 1UAAA 2WJVA 1XPRA 1SKYB 3Q7PA 4MRVA 3K70C 2ATVA 1I2MA 2VP5A 5CB6A 1E2NA 5ANRB 1BYIA 2A78A 3B78A 1YVDA 3F5FA 4RD4A 4YMWA 2ZROA 4X65C 3U4QA 4DUGA 2HXSA 2RCNA 4F4IA 3HU1A 4OHWA 5E7IA 4ABYA 3GLGA 1GRRA 1OHHA 4NYIR 3CZQA 4WAUA 1P60A 1ZD9A 2GF9A 3GP8A 4BGDA 1EXMA 3W8NA 1VIYA 1P2SA 3OIYA 3CM0A 1Z0DA 4JI2C 2FEMA 3GLHA 3JAMD 3LW8A 3I62A 3IDQA 2QL6A 4B43A 1P9RA 3AKDA 4F92B 4EPYA 3CR7A 1NY6A 1KAGA 1LF5A 2ZREA 1WRBA 2FH5B 5FPSA 2C2HA 3CPHA 3WMGA 4LK2A 1U0HC 1G8GA 1VCIA 2PZGA 4LV5B 4I99A 3REGA 3BE4A 1R5OA 4JBWA 4U7DA 1KKMA 1GFIA 1KK1A 2WMOB 3UXMA 4JBYA 2O8FA 5HCNA 2O8DA 1FJGC 1KY2A 2BDTA 4O2LA 3TUIC 1BS1A 4KCGA 4NHOA 5KSOA 2F1IA 1BMFD 2QTVB 2JMPA 2ONFA 1FNMA 4NXNC 3O8RA 3QIAA 4TLEA 3I5XA 2HXYA 4BLOA 1DBSA 2NO6A 2ZS8A 4DLWA 1RRCA 3AF5A 3AV0B 1CJUC 1FX0A 2JCSA 5F9FA 2XSZD 3BERA 4FCTA 3SHFA 2CJWB 1Z29A 4WBSA 1DTSA 1F2TA 5CIWA 2ZI9A 1Z0FA 2BWJA 3BWDD 1OFIA 3CPJB 3FVQA 3AVYA 4IRUB 2BCJQ 1M7HA 1IBRA 1N6IA 2FSGA 2IYVA 2FDCA 5FBRB 3RHFA 4II7A 1HNZC 1ESMA 1MH1A 5ELXA 2O8FB 1G291 1T5LA 2O5VA 1E2EA 2C77A 2QNRA 4B48A 3QXJA 2K5UA 4LF6C 1LFDB 1VG1A 3TVDA 3HR8A 4H1VA 3TIFA 4PQRA 2GHIA 1XDBA 3VFDA 4QNMA 3T5DA 1NMZA 2ZITA 4TYWA 3LH5A 5C46F 5JS8A 2OFWA 5KPDA 1NKTA 4M2LA 4K8OA 3AEZA 2ZI3A 1E2JA 1FMLA 3OE7D 4JI0C 1DAHA 1O3YA 2VQSA 4Q9HA 3SYLA 4DJTA 3GKUA 1IBMC 3LBIA 1DAIA 3UK6A 4URZR 2QTHA 1NN3A 2OSBA 3AF4A 1RZ3A 1EESA 4AKGA 4K0KC 5J4HA 1WE2A 2JEOA 1IXSB 1NRJB 2HF8A 3AF3A 4OJKA 4LY6A 4UNSA 3ZGXA 3GEHA 5IK2A 3WP0A 3OIVA 4K46A 4CT5A 2F7SA 1QZXA 3WBKA 2ODWA 1RJ9B 4LJ5A 2HT1A 2VTKA 4LHXA 3W5JA 4X64C 3BB3A 1CR4A 2CCJA 3EZ7A 2G0TA 4JLBA 3K0EA 3NBYC 2QQ0A 3THYA 4M1WA 4MDEA 5KSZA 1KY3A 4DCVA 2A3RA 3IBYA 3NDPA 5J4KA 2KWIA 4Q1BA 2GJKA 1XCMA 4C0QC 3P1JA 2YNMA 3PEVA 4LJYA 2FPMA 3OEHA 4HEJA 2OBNA 4DR7C 4Q1EA 1JR3A 3KL4A 1G18A 3UPUA 1JPJA 1JR3D 1HY3A 2IYZA 4AC9A 1TEXA 1E0SA 5CLLA 4HAVA 2QM7A 2ZVQX 5KO2A 1VTKA 2A5DA 1XTSA 3CWQA 4D82A 3GLIB 4P0TA 2DFNA 2L0XA 3NHAA 2FF7A 4YONB 4TMVA 4Z1MA 5J4VA 1GP2A 5FR2A 5FBWB 4LF7C 1CJKC 4CW7A 2GILA 5K8TA 3CRMA 4QOSA 2WOJA 3THOA 2DCUA 2LCFA 2WWIA 2R6CA 5AJVB 2PLRA 1J99A 2R65A 3VR1A 4FMBB 1F5NA 2VLIA 3LX8A 1DEKA 3UATA 4JI5C 2NO0A 4OHZA 3THYB 1IN7A 2CVHA 3SOPA 1UBFA 4QM7A 2UU9C 2G88A 3H0KA 3ZYCA 1W1WA 3GFPA 3K53A 4DB2A 1Z6TA 2WWFA 1SXJA 2IBMA 3WYGA 2IYYA 1GKIA 2H16A 5B57C 1CLUA 1DAEA 1L4UA 1P62B 5L3QA 4RZXA 2FFQA 5KPJA 4O3MA 1Q12A 1G7RA 2FA9A 3N70A 5JRJA 2OAQ1 5FPTA 2BKUA 3AM1A 3ND9A 4DSUA 4NH0A 1GL9B 1UBGA 1W49A 3A1VA 1GKUB 1S9HA 5DI3B 1NIPA 4BFTA 1R0ZA 1UF9A 1YZKA 3B8HA 2ZAOA 3K0AA 1TU3A 3DM9B 5EZ5A 5KYKA 1ZVQA 3SE0A 2UXCC 1E6CA 4PPNA 5JBQA 2GZAA 4F91B 2X1VA 2XEXA 4LSGA 3NDBB 4V0MA 3S1AA 1NG1A 1HEIA 2KZFA 4KAXA 4KVGA 4GSYA 4XVQA 5BQ5A 4US2R 4IXNA 2BMJA 1ZP6A 1SHZA 1F6BA 1KOFA 4A8JC 4UKDA 1A1VA 1YR6A 4A4DA 1I2DA 4M9SA 1G5PA 4PZLA 2IL1A 2RAPA 4HAWA 5LPNA 3ZZTA 3KTAA 1E32A 1YU9A 1E9FA 2QAGA 6Q21A 4TT3A 3HJNA 2HJGA 3T1YC 4JYBA 1GL7A 3DZDA 1D2EA 2RHMA 1P72A 1BOFA 1LS6A 3CBQA 4PAOA 1SVMA 4JV5C 1UBCA 2O8DB 4NXMC 5HKKA 5A2QD 5D3MB 4R71A 1QG2A 4EQ6B 1MABB 4I1SA 2CCKA 3GJ5A 3KQLA 1OB5A 3U44A 2Z5FA 4DV5C 5E7MA 2EVWX 2JIZD 4ILEA 1XJ0A 1Z2AA 3MUFA 3CX7A 3QF4A 4MUAA 1TEVA 4ON9A 3EPLA 4MKGA 1IJEA 5FOWA 1Z06A 1ZMXA 1S3GA 3I8SA 4ERNA 5TB5A 2WHXA 3AVOA 4LC0A 2GCPA 1PJRA 1XD2B 1ZRHA 2GAAA 4KSBA 2W00A 1JEDA 4B3RC 1ZNZA 4HZUA 2NPFA 2FMXA 3MD0A 3AKEA 3FYHA 2CE7A 4OX9C 3BAFA 3QE0A 4QG7A 2QGNA 5EE5B 1Q22A 4A0GA 5L8VA 4TSFA 3TQCA 5IHPA 3FMFA 1CR2A 2NQ2C 1Z2CA 1XWIA 4TL7A 4RZUA 4QM6A 2KBEA 3BB4A 4NYJQ 1TL7C 5JHHB 3D6TB 4LBYA 4HATA 2QA5A 4BFWA 5JFGA 1W4AA 2NTYC 1W0KD 1A7JA 3CX8A 3IO3A 4G5RA 1GG2A 2DHRA 2HF9A 4A1FA 3R8FA 2F55A 2ZE8A 1M8PA 4MGZR 4QBFA 1UKKA 4P4UA 2OFXA 4P4SB 1XTRA 3KDSE 5JSZA 3O8CA 4TLDA 3KKOA 3L43A 2OZEA 4ARZB 2SHKA 1U98A 3AF1A 4NYIQ 1E0AA 1IM2A 5IWAC 1IJFA 2LKCA 1E2IA 2ORVA 3AGPA 3BGWA 3CF6R 4JLKA 2A9KA 4GOXA 2WJHA 4DIDA 4AYXA 1N33C 1PUJA 1A82A 3LNCA 2BBSA 3AGQA 3FWYA 2O8CA 2C96A 1PLJA 2FJUA 3GLFE 1OH7A 2G9NA 3GJ4A 4TYYA 2XGJA 2B8TA 4BLQA 3W3AA 4LJ8A 2P5SA 4DV4C 2X2FA 2ZRAA 1NJGA 2EWWA 3SDZA 2HEIA 2OM2A 3QY0A 1US8A 3CB4A 4Q7LA 4H9GA 4OBEA 4HB2A 1OB2A 1OFHA 3FKSA 1FZQA 2PEZA 3EW9A 4FWIB 4OHYA 1J70A 2BC9A 1YZNA 4LBWA 4ARZA 4TYPA 3CW2A 1N2FA 1E9SA 5JJIA 5B58C 2V1UA 1IY0A 4DEXA 2WBLC 2ZJYA 3W6OA 4E09A 4JLMA 3T06B 2R6GA 3KB2A 2J1LA 4LV8B 4BZQA 3O8DA 4PO8A 2V6JA 2AKYA 1YQTA 1J8MF 1AS3A 2ZXUA 4D0NA 4OQLA 2RMKA 2PX0A 4TQ9A 1P7CA 3SEAA 4DSOA 1S96A 4DBLC 4CEIB 5EE1A 3DO6A 4A9AA 1AS0A 1OH5A 2Z4SA 4BEBA 1YZQA 2OEPA 3ICQB 1MO6A 2YHSA 5DYGA 4BRWA 1NVVR 1P75A 4XJXA 3T61A 2QU8A 1H8EA 4M1MA 1K0RA 5IRCD 3V4FA 2EGTA 1K8RA 3EPJA 2ANBA 3NWJA 5AK0A 2QN6A 4C0KA 4EIWA 3CRQA 2JJ2D 4M0LA 1QVRA 4LFBC 1CRPA 1KIMA 3CNLA 2VP2A 4LF8C 3IKJA 2G3YA 1U8AA 1K5GA 1DAMA 3SYNA 3QOFA 5FTNA 3IIMA 3GLHE 3NKVA 2A5GA 1IOZA 1W5SA 4P4TA 1EG7A 1G3MA 4Q1CA 4DLSA 2J0QA 3BXZA 1ZB8A 3OEHD 2KSQA 5CYPA 1E1QA 3VR2A 2VP0A 2FFAA 5KUTA 4JT2A 4YC7A 4B47A 4D4LA 2DFKB 3CZPA 1ZM4A 4TL6A 2D62A 3RAPR 4F7WA 2Z0MA 1AN0A 4UXJA 1QHYA 2BJWA 1J8YF 3A4MA 3EZ6A 1YKSA 5DIFA 4GDFA 4IFEA 4Z1MD 2GK7A 1VCOA 1NYEA 4B2LA 5KNBA 4JLPA 4YHHC 4TQUS 1P73A 5KDLA 5HZHA 3AVUA 4Q7KA 4IDPA 1C4OA 2OILA 3QKRA 4MDFA 1G8FA 5DISB 4B3CA 2NZJA 2JASA 4ZKDA 4LI0A 2AXNA 2P6UA 1QHGA 2XNDA 5FOXA 2O8EA 3BRWD 3L8YA 2YJTD 5TXGA 3OIUA 2QGZA 3AKYA 1H8HD 2QMUA 4M1YA 4O2RA 1J90A 4Q66C 2XZLA 2C8VA 2F3RA 4XTRA 4LGMA 4AIIA 1W36C 4QXAA 3DOFA 3T1OA 2IW3A 1G4AE 4JL5A 3CNOA 4YXWD 1CEEA 4QKQA 1VG8A 1CJVC 3GFTA 3TK1A 2ZUCA 5DN6D 3TR0A 3RDPA 1XEWY 4A82A 1MRSA 2VSXA 4LFAC 3ETLA 3Q3JB 3O8BA 1ANKA 4TZ0A 1FTNA 1XEXB 3RS2A 1YJ5A 3A8TA 3CF2A 1QF9A 2PH1A 1JAHA 2VHQA 5KHOC 4BFSA 3AF0A 2V1XA 1OXXK 4ZIRB 1SZPA 1KK2A 1GDDA 1D9XA 5BN5A 1YE8A 1AA9A 2WV9A 4KODA 1MV5A 4LCBA 3IEVA 2AX4A 1KI6A 1P9WA 1ZUNB 3ONWA 5L3RA 2VQFC 1IHUA 1F2UB 1T3HA 1JQLB 1OKKA 3SJBA 1FP7A 2EYUA 1O87A 4KV9A 4UNQA 4FCWA 4LF5C 1KK0A 3QKRB 2B7CA 3ADDA 1GUAA 1U8ZA 2OXRA 4N3NA 2WJYA 2PN2A 1AKEA 1E2FA 3MWJA 1WB9A 3GLGE 5AJWA 1ZNXA 1N0UA 1HUQA 4LX0A 3RS4A 1W2HA 3Q5DA 4TL8A 1VCNA 1YZGA 3B9PA 3CRRA 2IS2A 1XMVA 1XTIA 3RRNA 4HUTA 1RVDA 2JJ8A 3B1WA 1E96A 3CKLA 3I73A 3EPKA 4F93B 1UM8A 3DMDA 3UWOA 2FPLA 3T1VA 2CK3D 4NPHA 4LYHA 2EW1A 4O0MA 1KO4A 1Q3TA 1SVLA 2IYWA 2EFGA 5F9HA 2YOGA 3T1HC 2BOVA 2J46A 3EC2A 4PC2A 2WKRA 2ZRMA 3GCGA 5JWOA 5DN6A 1A4RA 2HJVA 2QSZA 5E95A 2QI9C 4ZDIA 2ODEA 1N0WA 3RVBA 2CXXA 5JSZB 1CRQA 1R7RA 2P2LA 2XOKD 3K0AB 1DO2A 1U8YA 4I1VA 3AVWA 3HR7A 1VYTA 1AS2A 4QHYA 4DHEA 2YINC 2ZU6A 3IPXA 2AR7A 3L0SA 1QHSA 1ZM2A 1DAKA 1UDXA 4YQFA 4Q01A 2J5XA 3MGCA 1HH2P 5L3QB 2WAXA 4BZXA 4IEEA 1BH2A 3PR1A 1HYQA 2OLJA 4L5BA 5KDDA 4DLVA 3GEEA 5H1YA 2ZSAA 2RGXA 3KKNA 1RIFA 4XSGA 2MMCA 2O0JA 3TQFA 3FHOA 3P32A 1KMQA 4PSVA 1N32C 2A7QA 2J0SA 4JJZA 5AJZA 1FMJA 1GNRA 2J7PA 4NYMQ 2QUZA 4GBMA 5FBQB 1HURA 3DM5A 2HYIC 4GP7A 3SBDA 4A0FA 1VECA 1M34E 1ZCBA 3FMPB 3KKMA 5SZJA 4AD8A 3DMNA 1M7GA 1FUKA 3B1VA 4I81A 3T34A 1IN5A 3VR6A 4M1OA 2PX3A 1ZIPA 4JSYA 2FSIA 1UKVY 2A5JA 4QL3A 5TVKA 4C0AC 1BYUA 3IPYA 1USPB 3GJXC 1G41A 1N3BA 5FBLB 1XMIA 4UNNA 4M9QA 1YZLA 3OHMA 1DE0A 4KO8A 1R5NA 3B1YA 4URYR 4C2UA 1G6HA 1LY1A 2H5EA 1F2UA 1Z63A 5FPYA 3PEUA 3E2IA 4DLZA 1W0JA 1KKLA 3B5JA 1UPTA 2YWEA 2W2TA 2FFBA 4LJ9A 3MJHA 2C04A 4TMWA 4GRAA 4JMPA 3TE6A 1JALA 2ZUBA 4KXFB 1SXJD 5HZKA 5JCPA 2WOOA 4DZZA 2UUCC 1OV4A 4U02A 4XWOA 2ZSFA 3NEYA 4ESHA 3PUYA 4LJ4A 3AQ4A 1SHKA 5JEDA 1XMOC 2OFOA 4JVMA 2VL7A 4PO1A 4TMTA 2GZHA 3PITA 1IBLC 2DFLA 3GJ8A 3DVLA 1KJZA 2G0NA 3EWSA 5DI9A 3TRFA 3ZS9A 2ZR0A 4AURA 1N6LA 3VQTA 5IF9A 1GNPA 4DCTA 2V9PA 3A58B 3L2OB 4B3XA 3MWYW 4DR1C 2VRWA 2ZJ8A 1ZM7A 3AP1A 2ZJ5A 3LAWA 2AL7A 4ITRC 4V0OA 1KNQA 4DV2C 4C0BA 5GVSA 3QJYA 3K0CA 4V0KA 4C9BA 1N0VC 3BOSA 2J7PD 4NYJR 4EPRA 2OBLA 2XR1A 2ODBA 3L0IB 5E7JA 3JVUA 4K81B 1US8B 2VP9A 3SBEA 1KKGA 1IONA 1ESNA 1ZNWA 4BLTA 2BEKA 1TQ2A 1JBKA 2BV3A 3NBXX 2IT1A 3TVTA 4N0DA 3N2EA 4QGFA 4XIGS 5AR1A 1U0JA 1X6VA 2NIPA 4CDGA 4Q9JA 1MRNA 1ZD1A 3AKCA 1BKDR 3EIHA 3IIKA 1QHXA 4RJLA 3TR5A 1QHHA 3J80D 1EX6A 1GNQA 2XITA 2BMEA 4MGIR 4OL0A 2IS6A 1Y63A 3K09A 2CNWA 4M8NE 5B64A 4NBSA 4OQFA 4MYUA 3UKDA 1S8FA 2IEYA 4W5WA 1RFLA 2QBYB 1F48A 2R6DA 2YC4C 4HB3A 4X62C 4EJSA 3C14C 4MGKR 5GJCA 1P5ZB 1Q3HA 2F4VC 1XMQC 2GJ8A 3H86A 3RWOA 3VKGA 2BKEA 5FTMA 1MKYA 3ZVLA 3NG1A 1MO4A 1QVAA 2IYTA 1KDRA 2G83A 4HUQB 1XNJA 4B32A 1TQ4A 3U7HB 4EKDA 4IDNA 2ONKA 5HPYB 2YWGA 4B76A 1W48A 1II9A 4BQSA 1E9CA 2H7VA 3A37A 3BFKA 2IK8A 2WMNB 4NZYA 4M22A 4MGYR 4A15A 3PIRA 2UKDA 4IVRA 4Q1DA 3UG6A 3AVXA 4C7OB 1YRBA 2I1QA 5FOTA 4NTZA 3FFBA 4M4SA 4PC1A 5J4LA 2WAYA 3KJHA 2GNOA 2IYRA 5CM8B 1KI2A 3LLMA 5LDDC 4M9XA 4JBXA 4LBVA 5F98A 1XCGB 3T1TA 1XXHE 4JLJA 3X1YA 1KI4A 1DG3A 3R9WA 2REBA 3VR4A 2ATXA 3QKSA 2BEJA 4JL8A 2IX3A 3TH5A 3TSOA 2ZRHA 3MWKA 1T8UA 1XNQC 1OYYA 2WICA 3H4MA 4DV7C 4C0HA 1T9HA 1HQYE 4YMUA 5JWRA 221PA 4MRNA 2ZQ5A 1RPZA 2RGDA 3RC3A 2AK2A 4C7OA 2PZFA 4AK9A 4MKIA 4KJZA 2VP6A 2YV5A 1FTSA 3RS0A 1SVKA 4PX9A 4TZ6A 4TYNA 4EPVA 4Q00A 3QBTA 3SJAA 1P4SA 4M9ZA 3TSZA 4R2IA 4Q19A 4DDUA 2VA8A 1G5TA 4HSEA 2AWNA 3W3ZB 4M1KA 2IS1A 1E3MA 1VYUA 2ECKA 4DUZC 3FPAA 3KTAB 1G20E 4I1OA 1U9IC 5A4JA 1LS1A 3P4XA 2IUUA 2HT6A 2IYUA 2PLFA 3B2EA 5FLXD 2V3CC 3HPQA 2RB4A 3RSOA 1L8QA 3LD9A 4MYHA 4NMMA 4WZAE 3GJ3A 3SNHA 2IXEA 2FSHA 2Z83A 5CITA 2EFEB 2XZPA 4HLQB 5TY0A 2E8CA 1T8TA 3NXSA 3MWLA 4Q21A 5CLQA 5HCIA 3W5IA 3ZIAD 3CNNA 1E94E 3NH9A 2W0SA 1FQJA 1KDOA 1G64A 2UUBC 3G82C 3M0EA 1TF7A 1Z28A 4P4SA 2WIBA 1SXJE 2D3WA 4V0NA 1E1RD 2E9SA 5EUMA 2RH5A 2JJ1A 5JJLA 3EXAA 3RRZA 3MSXA 3AVPA 3U6KA 2FZ4A 1XU4A 2OCPA 4Q1FA 4EUNA 1R6BX 4DDTA 2WWGA 1NIJA 2AK3A 1UJ2A 4KLNA 2ZYTX 1ODFA 2EFDB 2VQEC 1TAGA 3C16C 3ZVNA 3VX4A 1GRNA 3E1SA 1S3SA 2IYXA 4DCSA 2YZ2A 3BFVA 2QENA 1G7TA 1T3SA 3LLUA 1CBUA 1Z0AA 2DFTA 3DZ8A 4PC3A 3VU9A 3QENA 2WSSA 4RFVA 4Y0VA 4B44A 121PA 2UXBC 3A1UA 4XOIA 3X1WA 3EA0A 521PA 1ELOA 1FUUA 3IIJA 4X8OA 4C0JA 1XZPA 2R6AA 5TARA 1N6RA 1Z08A 2HDNB 3FDIA 1TUIA 1KJWA 2R62A 4B3SC 3SU8A 2QRZA 3ZH9B 2X77A 3JZMA 1OKKD 2H1LA 4IVPA 5EE3A 1NLFA 5C4GB 1JECA 3RNLA 3TJZA 1KI1A 3CLVA 4P33A 5IK2D 3RABA 4A2QA 2D7DA 2FSFA 2X19A 2IS4A 5DYIA 3VX3A 2UUAC 3PEYA 4LYJA 4Q48A 4EJSB 2W83A 3PXGA 4PR0A 3BC1A 1DELA 1Q1QA 4EJSC 4C3ZA 4ZI2A 2R44A 3DHWC 2QAJA 4OK3A 2O8EB 2FEOA 4NCNA 4Q47A 1Q21A 1VLAA 3I8XA 1X8LA 2AFIE 2Q0HA 4NYMR 1S4QA 1KZ7B 5KOYA 3CUEF 1VMAA 2QZ4A 5CJPA 1NBME 2PT7G 1P2UA 1NN1A 1ZAKA 4MYCA 3PENA 4Q9LA 2J3EA 2EWVA 2GRJA 2OLKA 4LHZA 2ZJAA 3W90A 2QQEA 2XTMA 3GMTA 2CLDX 1JNYA 5DSZA 1P9NA 1P6XA 1ZM9A 3Q8XB 3W6NA 4KHPC 3GJ6A 1XNRC 4LPSA 4WZ6A 2BBOA 2GEDA 1VCMA 2WZQA 2ZANA 1XF9A 2WKPA 4Z51A 1L2FA 3Q9LA 4JIMA 1D8TA 4IOLA 4H1UA 4FIDA 1UADA 1PZNA 3LQQA 1GL6A 1JEEA 1W46A 2A5FA 2EQBA 3OAAA 3QPUA 4HB4A 4DV6C 5EE9A 4Q4AA 3V4RA 1AGPA 2BCGY 3GLHB 1LV7A 2IXGA 3KZ1E 1Z47A 5K8IA 3WXMA 3HWSA 2E7GA 1VKJA 1ZUIA 3LA6A 4D0GA 3FHTA 4MRSA 5BN4A 1K6MA 3MLEA 2ZVPX 5CDFE 3QSYA 1VPLA 3BD9A 3TAHA 3WP1B 4OI0A 2CNWD 2CJWA 3D7MA 5JLJA 5JCZA 3KQHA 3M6AA 1GILA 1XP8A 1FW6A 5CDFA 1KZGB 3X2SA 4DLRA 2ZAMA 2QT0A 1E2DA 4HAUA 2NG1A 4KBFA 4IDOA 3AF6A 4D80A 4CEJB 4QRHA 2FPKA 3WY9A 4PZYA 1U81A 3ZLJA 4U00A 2VPPA 3OFNA 4M21A 4CEHA 2OXCA 4UXHA 3SC3A 3D8BA 1IBKC 3FMIA 5G3YA 1WF3A 1J2JA 3TW8B 4AI6A 3CH5A 5L3VA 3KUDA 1KSHA 5HR5A 4EDHA 1ZCAA 3K8YA 5K8UA 3CONA 4IJMA 2QEQA 1AZSC 1N6KA 5L3SB 1LTQA 4KYUA 4TTQA 4WZBE 2ZPTX 4FMCB 1KI7A 1SQ5A 4ZPXA 3EAQA 2QTFA 4L8GA 3U3JA 2PMDA 2W58A 1ZYUA 4BRUA 1XJCA 2V6IA 3U61B 4JLOA 3QXCA 2CLCX 4IVQA 5G3ZA 2XXAB 1P2VA 4LDJA 4XTCS 721PA 4PTLA 2GXAA 4Q4JB 1G3QA 2VBCA 4UNPA 3ZZ0A 4E5UA 5JMTA 2ZJOA 1EWRA 1R0WA 2OPLA 1N6HA 2JDID 3GLIA 4B3GA 1UKYA 3VKWA 1SKYE 1NBMA 5DE3A 1XZQA 3KKQA 1W7AA 1NBMD 2PZEA 1TUEA 3C8UA 3PFIA 2D7VA 2NO7A 2DYKA 4US0R 4JI3C 1EFRD 1RYFA 1XCPA 4AG5A 4B74A 1R4AA 2C03A 3K09C 5P21A 3L8ZA 3NC0C 4G0NA 2JIZA 3A36A 1UEIA 4BASA 1G7CA 1Z8FA 2UZ3A 4GL2A 1CP2A 2V7QD 3SR0A 1VDZA 4Q4HB 1NMXA 2FGKA 4X8LA 4UJ5A 2GEUA 4HAYA 1Q0UA 2NOAA 3B6EA 2D2EA 3FKSD 1G21E 4FI3C 4C0SA 1NSTA 2X8AA 5EP1A 5JEEA 5JECA 4AYWA 3TUJC 1IN6A 3U4QB 2BIFA 4FXPA 1XB2A 4ZIRA 3GD7A 1Q1BA 2D74A 2ERYA 3V00A 4YY3C 3AVTA 3K9GA 2F43A 3K0FB 4BFUA 2WWYA 2ZR7A 3QVUA 5FPHA 2XNSA 1GOTA 2YWHA 5GADl 3CPEA 2ZE7A 4AQYC 5KNCA 2ZSEA 1OSNA 4URXR 2B21A 3AVQA 3IQXA 1D6JA 2CE2X 4N1AA 1N6NA 2XX3A 3TW4A 1LQLA 2VIIA 2XJ9A 4Q9KA 4M1TA 5AUNB 5GJWC 3SN6A 3B60A 3GJ7A 3LXRA 1IQPA 4OKSA 4UJ3A 1WCV1 2JLRA 4D81A 3FGNA 1QHIA 1U90A 2VYFA 2WVJA 4KHZA 3ZD7A 4B3TC 2CCGA 3EPHA 3KJEA 1EFHA 1NP6A 4JI7C 3LFUA 2GF0A 1N5LA 2FE4A 4QHTA 1GWNA 2VH5R 2RGCA 3ADBA 4JT4A 2F43B 3K0FA 4HLCA 3DPUA 3K70B 1H65A 2PBRA 4TTRA 4G01B 4R2HA 1I94C 2Q9BA 3P4YA 4IOKA 2E8FA 3U3MA 4QFMA 1T6NA 1E0JA 4PQYA 4TL9A 3K9HA 2KJQA 3TBKA 1SVOA 1IY1A 3FMOB 3FOZA 2P5TB 4MTNA 3C41J 2RGGA 1VHTA 2ZIAA 3M4YA 1XXHB 2CL6X 3MFYA 4LPKA 3SS8A 2DY1A 1E1RA 4QJ3A 3O47A 3SHWA 2NGRA 4Q7MB 2GJSA 2Q9CA 3QF7A 5IDVA 3VHLB 2BBTA 2ZYUX 5JS7A 3V9PA 1EK0A 3QEJA 2IXFA 2ZRKA 4OHVA 4XD7A 2W6JD 1E9RA 4DV1C 4DR5C 4GKKC 4KFUA 2W6JA 1U9IA 1KO5A 3WMEA 3H84A 5AUPB 3PV0A 4R7ZA 4YLGA 2GXQA 2GVDC 1G8PA 2OO7A 1Z83A 2AXPA 1JI0A 2YVUA 4I1UA 1JB1A 3A4LA 4ZKEA 1N5JA 1JJ7A 1KHTA 1SVWA 1P61B 1Z0JA 4NL4H 1NF3A 1GTVA 4C0LA 4RD3A 3MJRA 1NI3A 2XB2A 4CT4B 2QPTA 3L82B 5DNYB 3B1XA 2A30A 4YDSA 4JVLA 4B73A 1GAJA 3HYTA 5CK4A 1XPUA 4JLVA 1GIAA 2YYZA 4XWKA 3EIQA 3IILA 1XEFA 2D2FA 1Z6XA 1R0YA 2UVQA 2ZRBA 3C5HA 3NHBA 5FI1B 3BK7A 4YXWA 4DEYA 4DWJA 3SQWA 2F9MA 4JLDA 3R9XA 5E3HA 1TTTA 5TV2A 4Q4LA 5FUXA 5GJVC 1T4GA 1ZIOA 4JLNA 3CR8A 4JLAA 3GLFB 3GPLA 2C9OA 1EFCA 5EXSA 2ZI5A 2F9LA 4OI1A 1PV4A 3J81D 4Y0AA 3WRYC 2JLYA 2OPLB 1ZUHA 4ZCIA 2C78A 3ND8A 2HYDA 1U99A 2RGNC 3PG5A 1RJ9A 1KMHB 4ACBA 3UG7A 1JR3E 2MSDB 4RZ3A 2D06A 2W6ID 4GFDA 2IWRA 2C9YA 3GJ0A 1G17A 3PEWA 4RCZA 3EERA 3EZ2A 4C30A 1L4YA 3U7GA 1N6PA 1AQYA 3LX5A 1JXOA 2NO1A 4DT1B 4OQMA 3DDCA 4A6XA 2VHUA 3PUXA 4NCJA 4DR3C 1R0XA 1DAGA 1JQJC 3H1TA 2RGBA 4OQXA 5DO9A 2CDNA 1RKBA 3PVSA 1I4TD 3KFXA 5SZHB 2ORWA 3K9NA 1SULA 3LY5A 5KDOA 3OFND 1FPMA 2VF7A 4LHWA 3SJZA 1UBEA 2KI5A 3B85A 3KJGA 1XJQA 2GDJA 3PUVA 5HKKD 4WW0A 1KYIA 4NONA 3QBVA 4TMXA 3U5ZB 1CJTC 1KI3A 3Q72A 1KI9A 1W47A 1HV8A 3ICEA 4AY2A 1IY2A 2IA5A 4IOJA 2YWFA 1A5TA 1TMKA 2D4HA 3IGFA 5BW8A 5JZVA 2ZRDA 3K70D 1TNDA 4C2TA 3SQXA 2YCBA 4IXMA 4DSNA 2O8BA 1AZTA 3AH8A 1NY5A 2VSOA 5EUQB 4NCIA 1G1MA 2Y8EA 2XJ4A 4PQFA 1II8B 3C4JA 1G8HA 3F0TA 3KXIA 5HTKA 3P26A 5DI3A 4UQOA 1KDPA 3HP1A 5KU1A 5TMPA 2IHBA 4HYYA 5FUVA 4KI0A 4MRRA 2ASBA 3CIOA 3L0PA 4FCVA 3K0CC 4JJKA 4ZCMA 1YRAA 4FMCF 4MUBA 2FN4A 3BB1A 2BBWA 4JI1C 4QJ5A 2B8WA 4EFNA 4KFSA 1E2KA 4WXPA 3EASA 4R98A 1J5EC 1RC8A 4OHXA 4Q1AA 2GTPA 1LVGA 4BSZA 2I4IA 3IBGA 3FTQA 3T12A 2NMVA 1FNNA 2QPOA 2YKGA 1P2TA 4KFTA 4AG6A 2JJ1D 3FHCB 4MKFA 1Z5ZA 2LWIA 2HUPA 1ZNYA 4A0HA 5BWMA 1GRQA 4A6PA 2DWQA 1OHHD 2JATA 3AF2A 1N6OA 1NVWQ 4TLCA 4B3DA 2P6NA 4FWTA 5H8WA 1U2RA 3S1AB 1XFAA 2OT3B 2J0UB 3C5CA 4DUYC 2F1HA 3BFXA 2OUKA 3B9QA 4RD1A 1S2MA 2HLDA 1COWD 2JLQA 2YOFA 4GI7A 4EQ6A 2PEYA 2WJIA 5J47A 3X1DA 1MOZA 3NBZC 4NE2A 3OAAD 2ZI7A 4OJQA 2GZDA 4GZMA 3ZJYA 4CZ2A 3I5YA 2DWOA 1LW7A 1VG0B 1G4UR 4V0LA 2P67A 4DDVA 3K0SA 1XPOA 2ODNA 3RS5A 2O0HA 3NBFA 3RWMB 2WJJA 3LUSA 4PFSA 3B7GA 1S1CA 4B6FA 2F1JA 2EYQA 1DVRA 1HH4A 3ZD6A 2CXCA 3RRYA 8OHMA 5KSYA 2FOLA 4HDOB 1W36D 4G5SA 4A36A 3ZVMA 1W0JD 5G40A 3QG1A 5C4MA 1W4BA 1X8KA 1XTQA 2ZS7A 5BR8C 1UKEA 1ZU5A 2OCYC 2QMOA 2ZYVX 3RYTC 4DUGD 3NIBA 4JVSB 1JPNA 2VSFA 4QNRA 2XAUA 1CIPA 4B3MC 3VR5A 4PSAA 3KUCA 3QUSA 2C99A 3KJIA 1T0JB 4D4JA 1Q20A 1OLOA 3QKUA 4IW3B 4QGAA 4X66C 3U2QA 4E07A 4QBHA 4TSFD 2ZSBA 4Q5IA 5DH9A 3AB3A 1G19A 1PLKA 4KVAA 2IEZA 1QG4A 2ERXA 1E2LA 3CRW1 2ZRJA 4RSGA 1MO3A 3VHXA 4DC9A 2HV8A 2ZRIA 2AFHE 2EFCB 3BBPA 3I92A 2OHFA 2B92A 3BORA 1CTQA 3ZDQA 2EFHB 5DLQC 5J40A 1F60A 3U60B 1KO1A 3QG5A 3U6BA 2G77B 1XD9A 1KNXA 1BMFA 2HLDD 4XVUA 4BPBA 1YR8A 1OW3B 3BJIC 2CHGA 2DB3A 2QP4A 3F8TA 5G41A 3JVVA 1K5DA 4J0QA 4W5HA 3N5CA 4DXAA 4PHHA 3UANA 4DV3C 4A8JA 2KBFA 2JJ2A 1S0UA 5H70A 1E4VA 4EFMA 2VO1A 5LD2C 3RC8A 2E8EA 1NKSA 2CMKA 1G8YA 3QVVA 4PC6A 2W2XA 1HTWA 1NVUQ 2XTZA 5E4FA 2RGEA 1F3OA 4DV0C 1B23P 1Z0IA 2FV8A 1M6NA 4RCYA 5GVRA 1E1QD 1GSIA 1WQ1R 1UDWA 2VHTA 2HCJB 3PCRB 1DG1G 2G1JA 4A2WA 2J41A 4DLXA 1PLLA 1X86B 1LF0A 4XX2A 1LNZA 4LV6A 3SYKA 1ZM3A 3LBHA 5EXPA 4CVNA 1HT2E 4Z54A 3I72A 1FFHA 2Z6VA 4HLUA 4N0EA 4ACAA 5EP3A 1Q57A 2AWOA 4Q9IA 2ZRLA 4WA7A 2I3BA 4KBGA 1N36C 1ZU4A 1RYHA 1N5IA 3DEFA 5LBIA 5BYJA 2CHQA 4LBZA 1T3LA 3W9YA 421PA 4URUR 3RLFA 2FG5A 4D0LB 3QPWA 3JZAA 2QORA 4E03A 5SZIA 4U5XA 5CJ2A 1J7KA 4MKHA 2IHYA 4MRPA 4QBGB 4D26A 3THXB 1E9EA 2BMDA 5B2ZA 5AUOB 4IEIA 4LJ6A 2PJZA 1XMSA 2FGJA 1YR7A 3BH6A 4BEJA 3TLXA 4PHTA 2P6RA 2GEVA 4NDZA 4JI8C 1KJYA 2V8OA 4AWXA 4ESVA 1Z6GA 2ZE5A 3HU3A 3WHKA 3LDAA 4IDHA 3Q5EA 4ZDWA 1D2NA 4YMSA 1U94A 1E4YA 2WJGA 5FBVB 1OF1A 3WYAA 4GOKA 3Q7QA 4B35A 5C2JB 2G6BA 2BM1A 1DARA 3F3YA 4F4CA 4OQNA 1ZJ6A 1KK3A 1Z6AA 3OIWA 2Q9AA 3OZXA 3QKTA 5FOUA 4GPTA 4DVGA 1L2TA 2UXDC 1USPA 2BJVA 4DR6C 2GVZC 3WBJA 2WM9B 1II8A 4GMDA 1E79A 2VP4A 5KSPA 1CR0A 2FFHA 2J45A 3AUYA 3BH0A 4WOPA 5DHFA 4L4UA 2GAOA 3ECCA 1AGRA 2ZEJA 4JVNA 3HDTA 1QHNA 4LYFA 1X3SA 3LV8A 4GZLA 2QM8A 2WKQA 1G7SA 1PA4A 2Q6TA 1E98A 3QNUA 5HE9A 5EJEA 1ML8A 2VHJA 4RFSA 3VTKA 1E99A 4DLUA 2C98A 3U3RA 3U7FB 3REFA 3SJCA 4A0RA 3X1XA 4KITB 2QAGC 5FOSA 1T0HB 4OI2A 3KQKA 1NVVQ 3I07A 3HYRA 2V54A 2ZJZA 2KE5A 1FX0B 3PQCA 4NOZA 3GLFA 2OAP1 3R20A 1W4RA 5BN3A 5LB4A 4S35A 1XTJA 2GK6A 1WH9A 3I32A 4FMDB 4O25A 3ADKA 1IXZA 2QP9X 3C15C 4B33A 2O52A 4W9MC 2CLSA 4HI0E 2BVNA 2OCBA 4ZV4A 4R9UC 2QE7A 4RKFA 2O8BB 1NMYA 2N42A 4WVFA 3QXXA 4JYAC 3TMKA 4AKIA 4A92A 2XB4A 1FQKA 3MMPA 3GLIE 1A2KC 4BFVA 1KGDA 3IEUA 1XTKA 4P32A 4CEJA 2R2AA 1Q1EA 3DKVA 3UMSA 1EFUA 4X8MA 4CEHB 3RS3A 2WWHA 3TUZC 4IOMA 3OTOC 4PAQA 2GCOB 4JL6A 1E2HA 1X1RA 621PA 2N46A 4G1UC 1YZUA 4ZO4A 2IC5A 2QMHA 3CWZA 5F3WB 5FL7D 3MCAA 2PCJA 4JYCA 4DIEA 2GKSA 5EP4A 5FL3A 2ZM5A 3OEED 1E79D 1OT3A 3GLGB 2BHRA 4DDWA 3T5GA 1HR0C 3FFAA 5SZKB 4TWZA 2J87A 2ZJBA 3KX2A 3LO5A 5EXTA 2ZU0C 3ASZA 5A0FA 4QJ4A 5AUQA 5J5CA 3IHWA 3B1ZA 3LVQE 4FD2A 4PC7A 2OG2A 3T35A 5GJBA 1SXJB 2ZS9A 5FUYA 1COWA 4NCHA 4PHGA 5KNDA 4LFCC 1JAIA 3ASYA 5FR1A 1IAQA 3EX7C 1JR6A 2CL0X 1W5TA 1KTVA 1R5BA 4AKEA 1ZC4A 4DRZA 1R2QA 3OE7A 5IT5A 2O8CB 4ASUD 2QAGB 1CU1A 2I1VB
chains in the Genus database with same CATH superfamily
3GGCA 3LCMA 1XJWA 2C4VA 1T91A 4XUCA 10MHA 1EM8B 2FSPA 3LQ4A 1E9DA 2C5GA 5F7ZA 3JWGA 4BQFA 2DHDA 1E2GA 1V4BA 2JVIA 1QWIA 1Q44A 1SKQA 2HMSA 3A1EA 3KKEA 4MUGA 4TLMB 2LZ0A 1GZSA 2VSNA 3O9ZA 4PO3X 5E3IA 5EQTA 4X62B 5AJYA 4ZD6A 5EZ6B 3JQ6A 1JEOA 2PR7A 2CJYA 1LUAA 3OLVA 3LYUA 1NUQA 1OXUA 3W2IA 1XT6A 4B6QA 2NSYA 1MH9A 4Z8YA 3WWZA 2ZBVA 4BWGA 1W0CA 2BFAA 2J4CA 3LY7A 5HIMA 3R7WA 4US2R 2Z4RA 5L6LB 1RT9A 1DJPA 5DXFA 3ABOB 1BQ4A 3M83A 4UTVA 4PNZA 1NA5A 5CM9C 1YDHA 2CF5A 3COVA 3VSCA 1E3TA 2B69A 4AKHA 1A77A 1XRAA 3C97A 3JARA 4I50A 1JIIA 3JWIA 2WKSA 1ZKMA 5H68A 6NULA 2PT6A 1RAEA 1P4EA 1XPJA 2G9VA 2OHJA 3NEPX 1CXZA 4MVJH 1RMYA 5L3SA 1G3UA 1PW5A 1A9QA 2RGAA 3A1WA 1EGAA 2DECA 3IT3A 4G9BA 4B3FX 4DLTA 4BCDA 3BS4A 4ALLA 1KO7A 1P3DA 3IB3A 1ZD2P 4PUHA 3PE6A 3D4LA 4NULA 4RD0A 1MXFA 1NXPA 1M74A 1TZBA 4UUMA 5CVTA 2QRNA 1C0LA 3LRTA 4MZXA 3ZQ6A 3M5WA 3PVCA 4Z0HO 3SM9A 2DSTA 4LXUA 4RIEA 5T4FA 3ZHTA 3U7EB 2PKRA 1I5OA 4CE6A 1X1SA 3L04A 1NLYA 2X5KO 4ES6A 5C18A 3I61A 1FJGB 1CQWA 3VA7A 1RQLA 2H63A 4CGZA 1NG9A 4YRGA 4KQHA 4BFXA 4J6FA 1QB7A 4OOFA 1BXGB 4BBYA 2G9ZA 2FRVA 2BFBA 4A0QA 1ZBDA 3VJLA 4G56A 3VPBA 3ZCPA 4R41A 1AZLA 1T1IA 4QGSA 4DMFA 3OX2A 2ZB4A 5LKRA 1HTTA 4V03A 1OIVA 3NHYA 1P29A 4UVIA 2R3SA 5EZYF 3WYDA 3LO8A 1FDTA 2BFWA 2P4HX 3PXDA 5B3JA 3WLPA 1W29A 2AGVA 4LXQA 1OZGA 4XB1A 3UTDA 3HLTA 4BRZA 3EG9A 3NH6A 3PQ7A 6PFKA 3FH0A 2QTTA 2W2QA 3P20A 1ND6A 5FFMA 4PYNA 1JOSA 2YY7A 3BSWA 4RX1A 4HHEA 1PTJC 1WETA 3TQOA 1KEWA 5FJIA 4BFZA 1JJVA 4J2HA 4ENVA 1GCOA 1R9GA 2GA8A 3QK7A 4NMXB 4P81A 3RIHA 1GN8A 4CM9D 3K9WA 2ID7A 5LZ5A 3F98A 4D79A 4PZPA 3D6AA 4F84A 4KFRA 5AXBA 2I22A 2F8LA 4EYKA 4KO4S 3QEBZ 4X93A 4RYLA 2OOKA 5JAMA 1W25A 3AVVA 1QIEA 4CM5A 4BNMA 2FWRA 2HMAA 4AYTA 5LJIA 5T8TA 5CPFA 3KL2A 2UU9B 4QOIA 2O05A 5CCDA 1FNCA 1WA5A 1VZ3A 4ER3A 3HU2A 2HMVA 4YMTA 2IH4A 4DFDA 3RYIA 3UMJA 4EI7A 1JFTA 5DHAA 3BJEA 1KMNA 3U4HA 2G17A 4URVR 1UMDB 5MN4A 4QUHA 5GPBA 3CF0A 2BM8A 1GZ7A 3FYUA 3W5DA 3KQNA 2FSVC 5CBPA 1RYDA 3S5UA 4PUIA 1JHAA 4AUKA 3E27A 3I9V1 1C3OB 3IDOA 4L5IA 4S2EA 1K7FB 4WKNA 1WW3A 3HU5A 4Q7QA 1JDNA 1JQBA 2QMEA 5JZ9A 4TMZA 1TEHA 2REOA 4P5PA 2M6KA 5K0LA 3ENZA 2P3SA 1L7AA 3FYCA 4FKZA 4IICA 4XSHA 3UC9A 2N75A 4UMEA 1IBSA 2WT8A 4KLZA 3VVLA 2NU9A 3TD6A 3WTBA 1IC6A 3EEOA 3L79A 2Z9CA 3L95X 2JGNA 3NT2A 4IGAA 4WLOA 1F7UA 1HT1E 4V02A 3O03A 4LZZA 4YJGB 5HJ5A 1BO6A 2AKAB 4ZVRA 4Y1GA 3P9KA 2H2HA 1ZB9A 2D0OB 3HM9A 1SJ9A 1YOBA 4D1YA 1H2XA 3BREA 1E2PA 4UNIA 4JUBA 4QPDA 2ZRNA 3UMRA 1WXXA 2JLXA 1AM4D 4CI0B 5E1OA 3SSNA 1VL5A 2CVQA 1D03A 1W9MA 3Q3HA 3W6PA 2F62A 4DLLA 1PT9A 2CLFB 3DOEA 3B5EA 5K51A 5A4DA 1GARA 2Y76A 1ZC3A 1WMFA 4AZ3B 1DFHA 4MH0R 4JZKA 3T7SA 1QBKC 1RRGA 4AJOA 3WNCA 3HO1A 3UEOA 1M7BA 3EQ6A 4QD3A 3U5TA 4MYTA 3WS7A 5K8LA 2R9VA 3FPJA 1VL6A 3Q0EA 1T8YA 4KXQA 2JFXA 1SCUA 1TD1A 2ZRCA 2YXBA 2VJNA 4O33A 4X97A 3OF2A 1YHNA 5U1PA 3VISA 3ZS8A 1OBCA 5B6JA 2PCLA 3R8CA 3DLTA 3OEEA 2H1WA 3EEIA 3IMLA 2ECQA 2ST1A 3KVYA 5EKUA 1OLXB 1Z07A 3SQNA 3MTBA 1HPLA 5F35A 3HXPA 1H1LB 1RTKA 4BGVA 1BRTA 1O9TA 3U7QB 1RI2A 2EHDA 2BJOA 3UO8B 5L95A 4KFCA 1I4OA 1OT5A 2OP0A 2XAAA 3HP4A 3ILSA 1EJ2A 2GBCA 1C1YA 3BIOA 3E82A 2AI1A 4RHFA 1N78A 1LX6A 4W5NA 3NU1A 3BWVA 4JI5B 3N3BC 5GOZA 4DNQA 4DR4B 4PIMA 2Z30A 1I3LA 5BMVF 4X7RA 5LQCA 1YGYA 1PT7A 2ASEA 3KUXA 3MC1A 4GWKA 4XA8A 1M6XA 3L41A 3N2IA 1E89A 4KYIB 4HS9A 1OC2A 1V1MB 3SEFA 3T3PB 3D31A 3BH7A 4U0JA 3KQUA 4DMMA 3DE3X 1UXHA 1V3QE 2FF5A 3FE2A 3GRFA 1XEWX 1IIRA 3QVWA 3I28A 5LWQA 1P45A 3CW9A 2WSBA 2XGGA 3BTOA 4RV5A 4CWAA 4GPZA 3MCWA 4M60A 3OZGA 4YAOA 4IIFA 2HF7A 1G5RA 1Y5LA 4HDNA 1IIBA 2FRDC 3AM3A 1RSZA 4RK5A 1U2QA 3DWGA 1VPTA 4D9KA 3RJ9A 1E9BA 4PANA 1I6LA 1SPXA 1H0KA 1QFMA 4H7EA 3EZGA 4L6IA 4YMVA 4DTCA 4ND6A 4JR2A 2BM9A 3WYEA 3DL0A 3KETA 4PZ0A 2FX5A 1HE3A 1FRNA 2YR0A 1VBFA 2VK2A 4RTNA 2Q99A 5HF8A 1P0IA 2WILA 3EVCA 1A9PA 3K70B 3TSYA 5K6TA 4OUDA 1EE1A 1N33B 4GSKA 5A04A 2NZ8A 3E3NA 3CJEA 3WGVA 2CEAA 3AC0A 3D7LA 3FDZA 2CL5A 4FZRA 3OM8A 4A10A 4DAOA 3ENNA 3EVEA 3GXBA 2ZCJA 4RV4A 3TE7A 1I6MA 2O3QA 1DCKA 2AEMA 3AO0B 5IT9D 2ODPA 3B1FA 3GA0A 1QWOA 3HA5A 3G5UA 1FU4A 1O03A 1Z4MA 1RKQA 1H0SA 1CUBA 1AXGA 1Q0RA 2ZOSA 3HRKA 4MMXB 1II0A 2OCAA 3FRIA 4WKOA 5BSEA 4GLOA 4I19A 4R5HA 2O54A 3AP3A 4QUJA 2O2IA 2I78A 5EJGA 4EHIA 4PXSA 3OZTA 4Q4DA 3TTSA 4J0CA 1UEJA 4P31A 2MU1A 3MVEA 4JVOA 4NKRA 3E70C 4EAQA 4FBGA 2ZCUA 3K1JA 1U02A 4JKIA 1ABBA 1BOOA 3SJCA 1PS0A 1HQDA 1OFTA 1WZIA 3JAKA 4PZUA 3VI4B 2ZTSA 4FTFA 5B1HA 1GTZA 1XNGA 2BI4A 2I6UA 2WPDA 3HSSA 4I2NA 3UAGA 4DQXA 5MF6A 4GT1A 1QLHA 1ENOA 3QI2A 4KH1A 1G4HA 2GBLC 3FYUB 1L7PA 2YMLA 3VVCA 4NQRA 4EHHA 3CZ5A 3LBNA 1BROA 1SH7A 2JDIA 5JWHA 3C7KA 4CIDA 4B2IA 5AW1A 4R2JA 5K9ZA 4RTJA 4R1MA 4E2FA 3JWPA 4NU0A 1Q3KA 1J09A 3E0QA 4RKEA 4MVJA 3HFSA 4JX8A 3DEYX 3WLRA 1G3RA 1YC5A 4RQUA 2AKEA 4XARA 3LK6A 2QL5A 3O4JA 4UBNA 3IJ5A 5BSUA 4HB0A 3W8RA 5A9TA 1N5DA 1W44A 1GZ6A 5JT1A 3GVIA 4FFBB 5LYJA 4G8CA 4DLAA 2YWCA 1FU7A 2XMZA 3IPLA 2WUDA 4LQDA 5JNUA 4P3YA 1W36B 3WL3A 5AHWA 4CLRA 2FN9A 1C9KA 3C5EA 1DKMA 5FTKA 1DU4A 1MR3F 1DEOA 3T9FA 3DZCA 1DBIA 4H4EA 1SQ0A 4LUCA 3USES 3C6KA 4HXGA 4NXMB 1RVV1 1ZEMA 1QC5B 5CH3A 4F86A 2N3ZA 3LHKA 4Q3KA 3OCCA 3AB8A 3L4EA 5NULA 3HB5X 5TQ0A 2X9VA 4OH1A 4BFCA 5BNTA 3CQ3A 4UM8B 1XZJA 1NE2A 4YT8A 4B75A 1KXJA 1KI6B 1XLTA 4LHYA 5JC1A 1TUBB 4QBIA 1EE9A 4WL0A 1L5LA 1QP4A 2XNDD 1QO0A 4D9JA 1O95A 2A58A 4ZDJA 1FP6A 1XRJA 1EAMA 1GTG1 1Q77A 3OU2A 2VHCA 5K0CA 4EK9A 3BGSA 4CKCB 3TGPA 1NQVA 1TF5A 1NN0A 4KSCA 1XMJA 2P0YA 5LLTA 1UWKA 2XUAA 3NC1C 3GJQA 5FX2A 3RAFC 1ZXBA 5CDYA 3R7FA 1LB1B 4G0VA 4WCFA 3EFEA 4R8LA 2CHVA 4PY2A 4EYEA 4EF5A 3GDGA 3OLZA 3KB1A 3WV4A 4F85A 2C1ZA 4TSKA 5JI2E 1GCGA 4J7UA 2GVNA 4R8KA 5KMGA 3WMRA 3IPAA 3RFCA 2HGSA 5ER6A 1FP2A 3GIDA 4PUGA 2AG6A 1C2YA 1MFPA 3EUEA 1P2BA 1WD5A 5CPBA 3I1FA 1X13A 3L05A 2AOVA 4P54A 4QRIA 3RC7A 4NCKA 5JPIA 4EHLA 3H1PA 4Z2AA 2BTQB 4NBTA 1J07A 2F8TA 4DKJA 1WL8A 1Y5NA 1YJCA 4IFBA 4N5LA 3WGUA 5LQJA 3J80A 4FW8A 3ZVRA 3B36A 3FJ1A 3H8WA 3KWMA 2OB1A 1UK6A 4ZVNA 2Q45A 3RANA 4PO9A 4GOJA 4L15A 3ICOA 1POXA 4D8WA 2NU7A 3O1IC 4E5PA 2P65A 4KVZA 4J94A 4Z9FA 3MB8A 2J7KA 2IYSA 1WDTA 1QAQA 2WIAA 1QQ5A 3S2GA 3I6BA 5EXXA 3ONEA 2ANCA 4XVRA 3WMFA 1R8JA 1XX6A 1K88A 1DEHA 2BZ1A 2JAQA 3WWYA 5TR9A 2XB9A 3T1HB 2QPAA 5K3SA 3JASB 2VCEA 2P0EA 5B30A 4KR0A 3ZCTA 3MWFA 3WGIA 3NP9A 2RHOA 2PXXA 3GFBA 3SC4A 1NL3A 3GUCA 1PRYA 5CK5A 4ZJPA 1U8CB 4BWYA 1NW4A 4ND8B 1OXTA 2H1VA 2PH3A 3OJ0A 5IT9A 5LUAA 1RJDA 4LRWA 1B0PA 2BM0A 2GRUA 4D8YA 3EGEA 3P0EA 1UBNA 2NNLD 3QVKA 4YAEA 2A5YB 3O8OB 1Z5NA 1H0RA 2GK4A 4AB1A 1KTIA 3J81k 3MYRA 2P0AA 2REXB 3MHPA 3L8GA 1CVIA 1GGKA 3O2NA 3LVBA 2A0XA 4BB9A 1JS1X 3FNFA 1T5IA 1OPRA 1FS4A 2VHEA 5LA6B 5HX7A 4DKXA 1QG6A 1CS4C 3FWHA 5KNCH 3ZJTA 3NEJA 1GXSA 2CUNA 1S1MA 4DCPA 5T3YA 4F8YA 4WZBA 1TPZA 3ME5A 1EFTA 2VF8A 3CHYA 3HE3A 4I1IA 4N01A 3G0HA 3OPQA 3BL8A 4E70A 5A3RA 5JZBA 4HQFA 2JW5A 2DEUA 5KYVA 4CQLA 4F5YA 3WLAA 5C8YB 3RGGA 5HIKA 4I5GA 4NJMA 2P6PA 3CH4B 1WP9A 1QORA 1Z4KA 2YY5A 1WB6A 4NJEB 2VAWA 2JLVA 4BKMA 2HX1A 2ATCA 3QWIA 3U7QA 4B8WA 1ODCA 2Q7XA 2UUPA 4CIWA 1R88A 3UXYA 3TXXA 2NAPA 5CJJA 3E5HA 4BV8A 1GPNA 2H2IA 4MRVA 4ZVVA 2W48A 3SE7A 1ZLYA 1I2MA 2VP5A 2BL4A 1KS2A 2JCYA 1ZRMA 1I14A 3AXSA 2GT1A 5K3CA 1IG0A 4YMIA 1DWPA 4JWTA 5T8KA 1BYIA 1IAVA 2A78A 3WGOA 5MDHA 4PFKA 2RCNA 4F4IA 1GNTA 4ABYA 1GRRA 3F90A 4ZZ0A 5FDFA 1JLLB 1EK5A 3I58A 3AHEA 3CZQA 1S7GA 4KXNA 3ZWWA 4UBIA 1ZD9A 3OBIA 3K71B 5TS2A 2DLDA 6ADHA 1C7RA 1Z5WA 4MUJA 4O4JB 1VZ2A 3IBTA 3GLHA 3M4XA 1JE1A 3K35A 3C4QA 3C8HA 4WFIA 5IM4A 4F5ZA 3I62A 3VJRA 5BMVA 4AECA 1YACA 4UPVA 1DCTA 1NY6A 1KAGA 2EDAA 2ZREA 4E3WA 3SO4A 1MORA 5TJHA 2JB9A 4AKTA 3JQFA 1EQ2A 5ALVA 4FJ0A 3DDHA 3EXFA 1T4CA 2VG8A 4I99A 4LV5B 4EO4A 5CFLA 1ZONA 4U7DA 3P0JA 4TS3A 4L4ZA 2JFUA 3URKA 4WK0B 1PBNA 1PZMA 1FJGC 2GKOA 5TQ2B 1X7XA 2BDTA 3QHQA 3R44A 3GRYA 2RC5A 2E6UX 3KXDA 4MUIA 4NHOA 4MLDA 4Z0TA 1BMFD 5FKJA 5KSOA 1S8AA 4KREA 2WQZA 4J49A 2F59A 4MQFA 1FTGA 4K9OA 1M2FA 2H1HA 5EWMA 3W2FA 3F9IA 3IQHX 3B48A 5F7OA 4V2IA 3I5XA 2HXYA 4QYXA 2NO6A 3HO8A 5CB4F 1RRCA 3AV0B 2Z6UA 1FX0A 1QFJA 4DC1A 5LVAA 4BO5A 2XSZD 2R87A 3BERA 4X61A 2P4EA 3RUCA 4E1VA 1BE1A 1DTSA 4MVCA 5LKAA 1GTRA 1WSAA 3IJPA 3KALA 2BY4A 2NTNA 2QN7A 3CLUC 1DJLA 3AVYA 2BCJQ 3ILHA 2ZM6B 1TD9A 2XLCA 2G40A 2FDCA 3L1KA 4ZT4A 3QVXA 2FR1A 1KVUA 3GEMA 2BTQA 4AY3A 4OXIA 1HNZC 1Q0ZA 1BE6A 1Y9AA 3O1LA 3ZY6A 5I3ZA 3GJZA 1P5JA 2O7QA 4LTMA 1CUJA 5DCWA 2F8SA 2WJZB 3IT0A 4A6EA 3PCTA 3WO1A 4C43A 3U3ZA 3OZUA 3HR8A 1BD3A 1RM4A 1P19A 2NV2B 4H1VA 4CU5A 3H2HA 3BFPA 5CYGA 2C4HA 1JKJA 3O1JC 3D6JA 2YFKA 4BNVA 4DG8A 2GEBA 1BQEA 9LDTA 1I5EA 1FUGA 4NV1A 4QNMA 1NMZA 2CMDA 4R1QA 3T5DA 3G8DA 3PRKE 4TYWA 2XRYA 2OFWA 5IC6A 3GXOA 3FSRA 3IAHA 4K8OA 1R5JA 1HF3A 4IHKA 4KXYA 1UDCA 3SDBA 3OE7D 1O3YA 1DAHA 2VQSA 3LHDA 3DMTA 4K9RA 3TQHA 1Q0LA 4O1HA 1L5SA 4IJWA 2IQ5A 3T3EA 4EMTA 3GUHA 4MIOA 4QYIA 1I9GA 2W6CX 4GYYA 3UK6A 1SXPA 3DW1X 2QLTA 3Q7TA 1NN3A 2XEDA 1P4EC 3Q7SA 4BAZA 4NZPA 4DA7A 2ZUWA 4K0KC 3EGXB 3D81A 3SX0A 5J4HA 2I6GA 5K20A 3K15A 1JR4A 4GR5A 1Z68A 1WULS 4WSOA 4BMZA 2XWBF 1EWKA 1PCXA 4UEKA 1DHTA 2V65A 4LY6A 1WSDA 1AQNA 3ENWA 5HNKA 1EX9A 3KE9A 3QUAA 2UVPA 4K46A 4JAVC 4MROA 1WPRA 4BX3A 2Q2NA 2CMHA 4CG3A 4E2YA 1BEUB 1X1TA 2I7XA 3UMYA 4X64C 2B5WA 4PTZA 1KC3A 2I4TA 1L7BA 2CCJA 4RE5A 1NQUA 4JLBA 5JMPA 1Y37A 4CETA 4GBED 3NBYC 4UOZA 4RMGA 3IAFA 3MTIA 4PLTA 1KY3A 3K1ZA 1XA4A 4Z6KA 3KTFA 5IZCC 2X6RA 4ZZ3A 3LQ2A 3MZ0A 4L5JA 5ESDA 5LYYA 1ADJA 2OHOA 1KYXA 3E03A 4FNMA 2KWIA 1N3IA 2GRAA 3HUDA 3QA9A 4Q1BA 4Q9AA 2V3VA 3P1JA 3QNMA 2Q8QA 4FILA 3H9GA 1M6VA 3DEAA 3IP1A 2P9FA 3A27A 4OVKA 1OU0A 5DM4A 3CW8X 5EIBC 1PDOA 2PGAA 2ZIGA 4Q1EA 3S8YA 2MIIA 1IPEA 1H2FA 2N9UA 4XX0A 2GCGA 4AC9A 1A72A 1QK5A 1TEXA 1C3VA 3EXIA 4R84A 4HAVA 1OVGA 1U6JA 4ND4A 5KJCA 3M8KA 1VTKA 2A5DA 1MQ9A 2YHBA 4INOA 5MFPA 1DRWA 2V6FA 2FF7A 1CEXA 1NT4A 4CJXA 5H83A 4XLLA 5LQDA 4C3VA 1YR3A 1OA0A 3AFNA 1WDWB 4P35A 1HRKA 1GP2A 2J3MA 2ONYA 1B3BA 1ISPA 5TE9A 2BGIA 3GZNB 5FBWB 4IJKA 2QNIA 4LF7C 3IUEA 4ZQEA 4EUHA 4ZJUA 2XQJA 3UOAB 4BJ1A 3B6KA 3PE3A 2JHFA 1SKAA 1T24A 4S1TA 4X1KA 2HMWA 2TRSB 1O90A 1S3FA 5AJVB 3SHVA 3WOVA 2UZ4A 3ZJVA 2R65A 2DTEA 2ORED 4FMBB 4DXDA 3KU1A 4OG2A 2VLIA 2JD0A 4PG4A 3UATA 3JALA 3O9VA 2HK8A 3DVSX 3H6GA 3ZE0B 2I71A 3PK0A 4I55B 2VDQB 2CVHA 3D2BA 1FSFA 1WXWA 3GNLA 3C45A 1V35A 2QR3A 4BV2A 2G88A 3OTIA 1CZHA 2IKSA 4L95C 4NENB 2JI9A 1UOOA 4AULA 2WWFA 2XVZA 1XN4A 1Z39A 2IBMA 3GEDA 5CW2A 1GKIA 1YDGA 2H16A 2VNKA 3B5IA 1GQYA 1DAEA 1NM5C 1L4UA 1LDMA 1XP5A 3COSA 2FFQA 4CM8A 2A1TS 4O3MA 1O58A 1Q12A 3N70A 3RFVA 2AFHB 4ICIA 4EJ0A 5JRJA 2O9JA 2G1AA 2WTAA 2X4IA 4IQ8A 3ND9A 1EA7A 1MX9A 1GL9B 5LDGA 4ZC1A 3TTWA 3A1VA 1GKUB 1S9HA 3BULA 1NIPA 3DQZA 1R0ZA 1L7RA 1PYGA 1UF9A 1TLTA 3B8HA 3JSAA 1SBYA 3K0AA 4FYWA 4X63A 3ZIDA 3AETB 4JI1B 3SE0A 1E6CA 3WXBA 4D41A 2VQFB 1FLVA 2QN8A 4PPNA 5FTWA 4CL8A 4D46A 2G63A 1Z5UA 5JH7B 2GF2A 2DHMA 4CMCA 3O8LA 1FEZA 1PL8A 1TMGE 1E6UA 1WTCA 1C3LA 1X15A 3IVMA 4GSYA 4QJIA 4BU0A 5JD3A 1W5BA 4XGKA 1GLNA 2IYNA 2IZ7A 4JYMA 2WYIA 4XVQA 3E8XA 5E6UA 3RKUA 4G1BA 1H3FA 2P3OA 5LCXA 1C4XA 1PDVA 4J90A 3L8HA 4O4HF 3KKLA 4KN6A 4V2UA 5K3FA 2RAPA 4MVXA 1PTKA 2HRCA 4UQLA 3HA3A 1UPCA 3KTAA 4UDYX 1EGMB 3ZZTA 1HT3A 4CKBA 1JJBA 3G49A 1IY9A 3HJNA 4K3UA 3C1AA 3NRJA 3ORRA 4DPLA 4K9QA 3EFHA 2D1FA 3LZDA 1BOFA 1LS6A 3CBQA 3HY3A 3NPDA 5ECWA 1UBCA 4NXMC 1BKYA 1VHWA 1WB4A 1JUDA 3KEGA 5F33A 3V9AA 4ALNA 1AV7A 1QG2A 4B3JA 1MC8A 4Q3NA 5HF5A 5HSGA 4QAJA 4Z3DA 3HM2A 1UXGA 1YJ8A 2CCKA 4XPIB 5BQ3A 2IDMA 2PQ2A 4PYKA 3TNDA 2EVWX 4LQ4A 3SF0A 1Z2AA 3K5PA 4MULA 3MUFA 3CX7A 4MUAA 4QIHA 4U2KA 1EGHA 2ZQZA 3ONDA 4RADA 4Y6PA 1CNFA 3BGDA 4MKGA 2VJYA 4U7FA 5HBRA 3L77A 3RUFA 3EPLA 3ZGOA 1S3GA 5LCIA 4TVBA 4ERNA 1QPZA 5TB5A 3AR9A 2WHXA 4LC0A 4PYJA 3SS9X 3CEAA 5HP4A 3EZNA 1PJRA 1XD2B 4KSBA 3C8ZA 4DG9A 5AKZA 3VNBA 4PG5A 1JEDA 5C7LO 3WQBA 3LNOA 1W6UA 1TXGA 3UA4A 1I7LA 2P8SA 3QE0A 4QG7A 4DWOA 2R2GA 1JB9A 1Q22A 1L7DA 2ZXFA 3GH1A 4A0GA 4EJFA 4TSFA 4ZN6A 2X22A 3TTYA 1SVUA 1E3DA 3FWNA 3PDCA 1T3ZA 4DVJA 2NQ2C 3ER6A 1JEQB 3A1NA 3C6ZA 4TL7A 2AN3A 4TRJA 3KYCB 5M3BA 1V7PC 2H4YA 1P0CA 3D6TB 4HATA 4CL2A 5FB3A 2HJWA 4KXXA 5EHNA 4PS1A 1W0KD 4QOGA 5KTMA 3R8FA 1GG2A 2DHRA 2HF9A 3HDYA 3KT0A 2ZE8A 1M1ZA 3ICCA 1M8PA 1U7HA 2Q6OA 4MGZR 2WA1A 4QBFA 2Y1OA 2JJYA 2OFXA 4P4SB 3AOGA 4A8TA 2X0IA 1DCFA 3B9RA 5JSZA 3BGOS 4FFSA 3S2FA 1HTBA 1YGPA 4R9NA 2UVDA 4AO6A 1GA6A 3KYDA 3NJ8A 1A9XA 4ARZB 2QM0A 5BQOA 5H82A 3D7NA 3RTAA 5KYYA 5LP1A 3I3OA 4LX8A 2DHCA 4CDRA 1IM2A 1DMSA 2EG9A 3MINA 4KMRA 1ZK1A 3OY2A 3PFGA 2ORVA 5DOZA 2WFLB 2ZWOA 1H5UA 3W8EA 1B16A 4JZYA 2A9KA 2D0DA 4G0MA 2IHJA 3S70A 3ADBA 1A7KA 3PC6A 3TX2A 3BDVA 4KQCA 1A82A 3QLUC 2O5CA 2JVKA 1JPUA 2O8CA 2C96A 3HEAA 4MQUA 3BIXA 2H6EA 1F7VA 3GLFE 2FJUA 3TXYA 5C3UA 2XGJA 3JRXA 3LF2A 3LPMA 3UUEA 2B30A 1WXHA 3W3AA 4GUAA 5DF1A 2YJGA 1ZL0A 2R8XA 1NJGA 5LU8A 1GQFA 1A98A 4O2BF 4ENQA 3AEQA 1DBWA 2PEZA 2ETVA 3NWOA 3QMMA 1U7ZA 1JLRA 3CLUD 1J70A 2BC9A 4FWIB 1NATA 3E9EA 1EBFA 1RYMA 4D99A 2DQZA 4YJ3B 5B58C 1H22A 4WKGA 4Y6QA 1GUBA 3AY7A 3W6OA 1V1JA 2J3KA 1RMQA 4AVYA 4JLMA 1EVKA 5DGTA 4CM8B 5BR4A 3T06B 3QITA 3DCJA 2R1UA 3KB2A 2YZGA 2GHRA 4XEUA 2XUIA 4MQ4A 3R8XA 2C0CA 1N5RA 3PC2A 4C7KA 5LMNB 4IXTA 4YAJA 1J8MF 1T3GA 4U9IS 4CLEA 4R7GA 1E77A 1V8ZA 3PNSA 3U3XA 1GGHA 2JCXA 2P6OA 4RH3A 5LQAA 3ZE7A 4ZXPA 3JYHA 4DBLC 1M34B 4CEIB 5AKLA 3JWEA 5EE1A 1NJ6A 3OD1A 4WXMA 3E22B 4RMIA 5HUHA 4KRFA 1SC3A 3E2MA 3ICQB 1RRVA 1P75A 4XJXA 1OI3A 2I2BA 5AM5A 1O5TA 3ESDA 2P9GA 3GGPA 3F5DA 2X41A 1CHNA 4JP5A 1EFAA 4YWHA 1TQHA 2PO5A 3EVFA 1MJGA 4UCWA 5JTTA 3EPJA 4FM9A 2ANBA 2EFYA 2BKLA 2QN6A 3HFRA 1X1DA 2GUWA 2PBFA 2FPGA 4KMSA 4XZ3A 3RS8A 5IJ9B 5LL6P 2VP2A 3VH1A 2FMUA 3DC2A 2V4MA 3EYAA 3RR2A 1VB5A 3Q7RA 4EG4A 5JVDA 3SYNA 1G2OA 1K5GA 4DM3A 4HLNA 1V8OA 5F73A 4UZFA 1JNXX 1GSAA 2MYTA 4KK4A 5IEJA 4GO1A 3VYSB 4DLSA 4B7XA 2HTFA 4H4CA 3OEHD 1DDGA 2QU7A 2YJ3A 3CISA 2A35A 3N5KA 1CFZA 4GDMA 4E1AA 4PLYA 1IUOA 3WLLA 5JNVA 1SELA 3NGMA 2EZ9A 2FFAA 4YC7A 5CA0F 2DFKB 3CZPA 1QLWA 4RS3A 2IXBA 3G1WA 4F06A 3HB4X 1BXRA 3OPYI 2Z0MA 1FFXB 1AN0A 4UXJA 2YX1A 1MA3A 1QHYA 1E63A 3EGIA 7ADHA 4ZCRA 2VJQA 4CBVA 1NVDA 4UAUA 4GDFA 4IFEA 4NZOA 1B76A 3NWEA 5CHEA 3HWX1 5KNBA 3BEDA 3AVUA 4RESA 4UVEA 3VOAA 1C7QA 3ZEIA 2HSEA 2OILA 3GVPA 5IAGA 4BB5A 2JASA 3PZRA 3MLAA 2I62A 3U7JA 4CMAA 2HB6A 5FOXA 5G0TA 4MLZA 4A3SA 1SUWA 1CE8B 4OHBA 3OIUA 3RSSA 5IDQA 2QMUA 1REQA 4O2RA 4PG7A 3CF4A 1IJKA 5DNAA 1W36C 2FFJA 5JC8A 3DOFA 5J2UF 2IW3A 4JC4A 3L7LA 2DUJA 5D3KA 1VG8A 5DN6D 3TK1A 4RA9B 5AKJA 1SHUX 3I45A 3M5PA 3TR0A 3WO0A 4AKEA 2Y2VA 3WKDA 2VSXA 5I8ZA 4LFAC 3DDZX 3QVSA 3O8BA 4TZ0A 1AUXA 4IHJA 2Q5CA 1VIMA 4DV1B 3DWEX 1JAHA 2P9YA 2VHQA 5KHOC 2VNJA 2IZZA 4L0MA 2VZEA 3Q8KA 4ZIRB 3DJFA 3PUKA 5C35A 4IF4A 4AN1A 5BN5A 4LF9B 1YE8A 4RVSA 1GT91 4CMEA 1G38A 2PA0A 4R1UA 4WNIA 3Q8LA 4UUQA 5AT1A 3ZU4A 2YFHA 4G67A 2QM3A 1AXEA 4BGEA 5SY6A 3IEVA 2ISSD 4FFRA 4ER0A 4ZZIA 1XZNA 1P9WA 1KRHA 1ZUNB 4FIZA 4ZYXA 2ON6A 3HN6A 3NIDB 4CDMA 3I0ZA 4PWZA 3T38A 1F2UB 1JIKA 1JQLB 1IZYA 1T3HA 3HFJA 5EMJA 1APBA 4H18A 3DEKA 1PV1A 2EYUA 3K8ZA 4KV9A 1RPTA 3BWBA 5BVGA 4UNQA 1PL6A 2AC7A 3M4NA 2H8GA 2XADA 4NEHB 3WL4A 1GG9A 2B7CA 1EG2A 1HDIA 3U16A 1YMUA 2W71A 2ZPAA 4N3NA 4YAGA 5E7QA 2AR0A 4PRYA 3GLGE 2ACEA 2WF8A 2BONA 4YR9A 3EBLA 3PUHA 4BVGA 5J3JA 2V3WA 1XZMA 1QVWA 3OZFA 3GO4A 1W2HA 2IELA 3NVDA 4ZT5A 3ZLBA 3VDRA 2H59A 3CRRA 3QUTA 1T4CB 5CLJA 2VSYA 1XTIA 5LOVA 3RRNA 1CQXA 3P9RA 4HPWA 3CSSA 1E96A 1T35A 2A0WA 2A92A 1XZAA 2WK1A 3I73A 4XQ9A 3EPKA 1UM8A 3T9EA 4OLBA 3FRJA 5HJ2A 4ARVA 2X0JA 2PZJA 4L7VA 4JBNA 5ECDA 1E1CB 4QDXA 1I1OA 3RU9A 3RVQA 4HNTA 2YWDA 4K9SA 2B36A 2IYWA 3AM4A 4UHKA 4E5NA 3FRHA 3GJTA 3T1HC 3EC2A 4RH0A 3K94A 2SCUB 4PYMA 1M73E 4M8LA 3C24A 2QTBA 1A4RA 2YTZA 1KYTA 5IASA 1L1QA 3K9CA 5ERXA 2A84A 3DUWA 5DULA 1QCZA 1AHNA 5JSYA 3RVBA 1XCOA 3MS4A 5DJ5A 5CB4A 4TMFA 1Y4DE 3Q6MA 4MUXA 4GXTA 1BGXT 2J07A 4UPDA 3I6YA 2PUCA 2VH2A 5BSFA 4B17A 2BTOA 2PKYX 3HEMA 1CLEA 4GOND 3AVWA 1C1HA 2C97A 2PZBA 1A4XA 1PEKE 4QOHA 1W88B 3ABQB 1QCCA 1UDXA 3ZGLA 1NZDA 3RJ5A 4EGCB 2AZXA 3MGCA 4W9NC 1E5VA 1HH2P 2OBFA 2RGWA 3I9JA 3WFIA 4MEBA 4BZXA 1U2DA 1BH2A 2GPNA 1CZRA 3LT4A 4QT0A 4P0PB 5JVDB 4MIEA 4BMOB 1PVVA 3KKNA 1YJAA 3WZMA 4TPKA 3HRHA 1EP3B 1KORA 3HCEA 4RHCA 3TQFA 2EP5A 3U80A 1INLA 2AZTA 2RIPA 3IAUA 3PWZA 3UJPA 1D0VA 1GJRA 2RGUA 2AS0A 4RFLA 4BP3A 2O2XA 2LRHA 4ESOA 2XYVA 4PNEA 1JF8A 1FMJA 4FE7A 5ESWA 2I5PO 4QU8A 3BMOB 5FLEX 5IC4A 4A0FA 3GUVA 1ZCBA 1E58A 5D85A 5AI9A 1P81A 4FKBA 3LCCA 5CYFA 3T34A 3E9DA 5I9SA 1NAIA 2CV1A 2HW8A 1IN5A 3R7AA 1WO8A 3CT6A 3EVNA 3AESA 2JC3A 2PX3A 3NBUA 1Q15A 2VCYA 1K1EA 1O6CA 2FSIA 2QXTA 5HRUA 4ZJYA 3OQMA 3ZZNA 2AOTA 1SQGA 4I46A 5DNWA 4B82A 1LQUA 3STWA 2R1VA 1E9VA 4R6WA 3GVHA 4UNNA 4KO8A 5BSMA 2BH1X 1R5NA 4HAOA 4URYR 5IXSA 3EEFA 3FW1A 4NBLA 4CUKA 1LY1A 1DIHA 1AUQA 1Z62A 1Z63A 1ZQ9A 2EZUA