4DCUA

Crystal structure of b. subtilis enga in complex with gdp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
432
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
molecule keywords GTP-BINDING PROTEIN ENGA
total genus 134
structure length 400
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA01
2HCBA 1FNMA 1ZNZA 3TW4A 2ZIAA 3GJ3A 4B2PA 4DXAA 4BFTA 5LB2A 2VHJA 3UATA 1DAKA 5HPYB 1G7RA 4DDVA 4CVNA 5GVRA 4C4PA 4D80A 4TL7A 3KQHA 1A1VA 1TEXA 2FF7A 4S35A 3TAUA 3P1JA 1KK0A 3LO5A 4M9QA 2O0KA 4OI2A 1ETUA 1Z2AA 4C0AC 2BMJA 1N2FA 1MR3F 3RVBA 4OHVA 3QKRA 1L7VC 4TMTA 1BMFA 2ZE8A 4JVLA 3LX5A 2EQBA 2JAQA 4C0QC 3GLGA 4NXMC 3JAMD 4XSHA 3IIKA 3NTUA 4A4DA 3TLXA 5K8LA 5TARA 2O0HA 3AF3A 3IO5A 1Q44A 3C8UA 2Q0HA 2ZRJA 2XB2A 2NQ2C 5F3WB 1RE0A 3LA6A 4B44A 3GLHE 3SEAA 1N5IA 2F43B 5TB5A 3AM1A 4OQLA 1M6NA 2FJUA 3LQQA 3WYFA 1Q1BA 5L3SA 3TH5A 3WMFA 2DY1A 2FSGA 1N34C 3BFXA 3REFA 3FKSD 1Q3TA 1XD8A 1TF5A 1PZNA 4M53A 1Q12A 3R7WA 2EWWA 2UUAC 1F48A 5DLQC 3QF4B 1W49A 4CEJB 4JL5A 4M4SA 4D81A 2NZ8A 4ARZA 2H92A 4JVSB 4MRSA 3TBKA 4QHSA 4NU0A 4I81A 3U60B 1GKIA 1SZPA 2ERXA 3DPUA 4FD2A 1L2TA 1GZSA 2IK8A 1UBGA 4ZCIA 1J70A 5HKKD 5EQTA 5B64A 2KWIA 4XWKA 3GJ7A 4KVGA 1VIAA 1HT2E 1KJYA 2QAGA 2GVZC 5FL7A 3QXJA 2XTNA 1KKMA 5DN6D 1KI8A 2R62A 3HP1A 4UJ3A 2XXAB 4AI6A 1UKZA 4FMDB 3SNHA 4QKQA 2EFGA 4JI0C 4S2EA 2O8EA 2HXSA 2JLXA 3GJ6A 2ZANA 1RYFA 3EARA 1OXXK 4TLDA 3ZVMA 1KSHA 4ITRC 4JLPA 4TWZA 1XP8A 4H9GA 3T15A 4ARZB 2QPOA 4TTPA 3AVYA 1YU9A 3P20A 3RS5A 5IDVA 1RVDA 4BECA 3PUVA 4MUBA 2X19A 4WXRA 5FOWA 1DO2A 3UWOA 3KQUA 2J0QA 4B47A 1ZIOA 4KCGA 1N6PA 4TMZA 4W5WA 4CDGA 1Z63A 1SXJD 1P2VA 4GMXA 2RGCA 1NMYA 2IYLD 2ZJBA 3ETLA 4QGGA 3ZGXA 1TAGA 4V0MA 1E2PA 3C16C 4JYCA 5JEEA 4HAUA 1D9XA 3K9HA 2X2FA 2HF8A 1G8GA 1VYUA 5SZIA 3VR2A 2V6JA 1F3OA 3RRMA 2NO9A 4BGDA 5F9FA 1P2TA 3Q7QA 1MO6A 4HEJA 1FZQA 5FBRB 3LBHA 5FBWB 5CDFE 2REOA 5DNYB 3AVPA 1W47A 2IXGA 2ZUBA 3NBZC 3L43A 1E2QA 3TK1A 3KUDA 2ONKA 3C4JA 1XZQA 1JQLB 1G41A 4HUQA 4M9ZA 2R6CA 1EESA 4KFTA 2Q9BA 3EPHA 2WWFA 2D7CA 1QZXA 3W3AA 4I1VA 4EQ6A 2ZE6A 4G1UC 3W6OA 3VU9A 4Q1BA 1YZQA 1E0JA 3U44B 5JCZA 2ZSAA 2KE5A 4IOLA 4BE7B 1KK1A 4NCJA 1GRQA 3H0KA 5J47A 5HTKA 1U0HC 2OESA 1HH4A 4DZZA 2ZSEA 3IEUA 2RHDA 3RAPR 3GFTA 1NIJA 4MYTA 2AR7A 2EW1A 1OXTA 2QTHA 2GJSA 4PZZA 2UU9C 1WP9A 4JLNA 3CR7A 4BZQA 1KI9A 3EC1A 2F4VC 3CNLA 2DWOA 2RGDA 5L3QB 4KFSA 3Q8XB 3AGPA 1GOTA 2PLFA 4B2LA 2H18A 2RGNA 2XZLA 1Q57A 2JJ8A 1UBFA 4KODA 1JXOA 2XNDD 3OTOC 1VECA 2YNMA 3PUXA 3I72A 4ZIRA 1A2BA 2YOFA 3TQFA 4LRWA 1E3MA 3CX6A 1IBMC 4P4UA 4Q4JB 3MUFA 4D26A 3KKQA 1U9IA 3HWSA 4ZPXA 4A9AA 3S1AA 5CYOA 2DPXA 2F1RA 4CYMA 2ZRBA 4TMVA 4BWYA 2OBLA 1YHNA 3AVWA 2O8DB 2QGZA 3WBJA 4MITA 3I07A 1N0UA 2D2EA 2W2VA 1GL9B 3Q85A 5C18A 1EFTA 2QMOA 5UKDA 3NIBA 4Q4AB 1QWIA 1DAFA 5JI3E 1A7JA 1QG4A 2ZR9A 4B2IA 1OLOA 2JLSA 3EWSA 4KITB 1P62B 1T3HA 4AWXA 3B5JA 1DOAA 5E3HA 4Z1MA 4P3YA 4QM6A 1SVIA 3KZ1E 4NBSA 1E2EA 1R7RA 2I1QA 3HYTA 5FOXA 3A4MA 4F4JA 3DM9B 3CM0A 2R6GA 3PIRA 5EZ6B 5BXQC 1XTKA 1UJ2A 3K0CC 4XJXA 3I61A 2O8EB 3U7EB 1RJ9B 2ZYUX 3ZS9A 1MV5A 1LVGA 2Q9AA 1E79D 3LXXA 4L15A 4Q1AA 1NKSA 1W0KD 3AVOA 5JS7A 1ESMA 4NHOA 1E9BA 1FNNA 4DV4C 3LVRE 4A36A 4YXWD 1K0RA 2C04A 4IW3B 2RGGA 1GKYA 4PZYA 4M1WA 3WYGA 1YE8A 2Z43A 2IEYA 2G1KA 4WA7A 1AS3A 3J81k 3I8SA 3THWB 4XVUA 5JSZA 1KMHB 2KZFA 1AGPA 5JBQA 1TL7C 5LD2C 3W5JA 1W44A 2ZI9A 2P3SA 4KO8A 4LSGA 5JECA 5JS8A 1KI6A 3UK6A 4DR5C 1OB5A 2QAJA 2V54A 4K81B 3BORA 1S1CA 2C95A 1BOFA 2FSHA 5DN6A 4C0LA 1AJEA 4UXIA 4ZV4A 2FEMA 1N6RA 3AB3A 5L3RA 1XMSA 4D6PA 1ZU4A 1KTVA 1W7AA 4I99A 1P61B 5CYPA 1W4RA 2E87A 3BH0A 1G3RA 3NDBB 1K6MA 3OAAA 4CZ2A 1X1SA 1PVOA 1P73A 1G4UR 2BM1A 2P5SA 2BCGY 2RB4A 5EZ5A 1EG7A 2FOLA 5E7MA 3VQTA 4C9BA 2CVFA 2ZSDA 4DB2A 4QFMA 5J4HA 2QZ4A 4K0KC 2IHBA 1ML8A 5EE1A 4TTQA 2CCKA 1E9CA 3R9WA 5FFMA 2ZS8A 4PHFA 121PA 4NYIQ 5LB4A 1KAGA 3CNNA 5TMPA 1U9IC 4JLOA 1Q20A 4A0HA 1LS6A 1VTKA 4DUGA 3PITA 2FGJA 2PT7A 3EW9A 3RS3A 2X77A 4A2QA 3OIYA 4DUGD 1E9EA 2Z6VA 3SBEA 4B76A 2QMHA 3TJZA 3KQKA 4TLEA 1XTJA 4MRNA 4PPNA 5KO2A 4H1VA 5BN5A 1FUKA 3K0SA 1OXSC 1G8YA 3RWOA 3MGCA 4JVMA 3AVXA 1CTQA 1W2GA 4NCNA 1J90A 2A9KA 1DAIA 2G1JA 3LD9A 4PFSA 4DR2C 3EZ6A 2GCOA 3TR0A 1UKVY 2RGAA 1AK2A 2JCSA 5SZHB 4HB2A 1J5EC 1IBRA 4X64C 2BBTA 4CGZA 3DKVA 4FMDF 4HAWA 4LJ6A 2GJKA 5A4JA 3C7KA 4BFWA 2AD5A 2FE4A 3FTQA 2CJWA 3OEHD 1QRAA 2QMEA 4RD6A 3LWNA 1OFTA 3PVSA 2UUCC 2A5DA 4KV9A 4BFYA 5KNBA 1G5TA 3KJGA 4MH0R 3D3QA 3U7GA 5KDOA 1D5CA 4MKIA 3RS4A 1A82A 2FSFA 3TIFA 4LJ8A 3G0HA 2CK3D 4Q7KA 1GG2A 4LK2A 3RSOA 1LV7A 2VLIA 3PENA 4LV6A 2B8WA 2GCNA 4B71A 2YZ2A 2H8KA 2I4IA 5GJBA 3CRMA 4Q7LA 4QL3A 4DCVA 2B92A 3CRRA 2RCNA 4PC2A 2GA8A 2ORVA 1UEJA 3ZYCA 2DFNA 1II0A 3KJIA 4JI8C 3G5UA 4FMCF 3AF1A 4IHQA 4QGAA 1JAHA 2SHKA 1GL6A 1FP6A 5EXTA 2BMEA 2ANCA 3ND8A 3BIFA 1VG1A 3BOSA 3F5FA 1E2NA 1VHTA 4Q19A 1S3GA 1XEFA 2JLQA 5FLXD 2CVHA 5JSZB 1OW3B 1UDXA 4PO9A 1UPTA 5KPDA 1IY2A 3WMEA 1AN0A 3EA5A 3UANA 4OHXA 3L0SA 2W6JA 4Q1DA 2EFDB 5GADl 1NY5A 4JLVA 3R9XA 4AG6A 3RDPA 4EPTA 3UPUA 1J8MF 2FPLA 1J2JA 2BKUA 3CIOA 3B2EA 4HZUA 3ZJYA 4TSFA 4EDHA 4Q9HA 2OBNA 3AP2A 1N0VC 3TKLA 2JEOA 1G21E 2XTZA 3U7HB 1J99A 4CEIA 1QHHB 4RD0A 4DV3C 1YRAA 3QE0A 4DV5C 4KU4A 4XH9B 3HR8A 4WOPA 2PEYA 4JL8A 1DAMA 1IXSB 5EJEA 3I92A 4EPWA 2C96A 2GTPA 4PC6A 1JI0A 1XXHA 1SHZA 2J87A 3QKRB 3QY0A 3NEJA 3PJRA 3O8RA 1MO3A 2IWRA 2NO1A 2ZR7A 3SYLA 3T61A 4F93B 4DLRA 2W6JD 1Q0UA 1WQ1R 4BZXA 4DSUA 5AK0A 4Q4LA 3OIWA 1N36C 2YC4C 3AF0A 2DYJA 1Z6AA 2VHQA 4EPVA 2REBA 1IAQA 3L0PA 3T34A 2IWHA 2Z83A 3QXSA 5AJZA 4FW9A 4KHZA 2XZOA 5TVKA 4DB4A 4B6FA 1XF9A 1W4AA 1WMSA 4AY2A 4R9UC 2A5GA 1P6XA 5DO9A 4C0HA 4X62C 4Q9IA 4TYYA 4XD7D 5C4GB 1US8A 2ZYTX 1XRJA 1NLFA 1XCGB 5D3MA 1USPA 3QSYA 4URUR 5IK2D 4P4TA 1KKGA 4F38A 4B43A 3TNFA 2WZQA 2C99A 1ONBA 4I1UA 4DR1C 3R9IA 4DSTA 3KKOA 3P26A 5DI9A 1XNQC 3SI7A 3H1TA 1QHGA 2VP2A 4MRVA 4RFSB 2H5EA 3O8DA 4FCTA 5G3ZA 4A2WA 1ZU5A 4DLUA 3BFKA 1E0KA 2XSZA 4YMUA 4UJ5A 4LV8B 3D8BA 1NI3A 2A78A 3IQXA 3PEUA 3AKYA 4LWZA 4E09A 2OAP1 3BB1A 1ZB8A 1TQDA 2BWJA 3BK7A 3L2OB 1E2LA 3U3JA 4A0RA 4URVR 2XNSA 5FTNA 5CIWA 1ODFA 4YMVA 3PEWA 5AUNB 4MH4A 3X1WA 1K5DA 2W00A 4KHPC 2V8OA 1TQ4A 3BH7A 1E9FA 1F5NA 4QBHA 2FFBA 2VP5A 4EPRA 4AYXA 2QORA 1Y63A 2BM0A 4MGIR 3ZZ0A 3VKGA 5DI3A 4MTNA 2EYUA 3PQCA 2V1XA 2RH5A 4LBZA 8OHMA 2WTUA 2YJTD 4A6PA 4Q7JB 2NZJA 2WAYA 4D25A 1ZJ6A 3MD0A 3BAFA 4F7WA 1DPFA 3GFOA 1E79A 5E7JA 2PZEA 4ABYA 3UMRA 1R0ZA 3GJ4A 1NVVR 2X1VA 1E9DA 4PHTA 3EIEA 1WB9A 1CKEA 4AIIA 1NP6A 1T6NA 4LDJA 3NHAA 5FOSA 4JI5C 4CW7A 1F2UA 3AGQA 3THYB 1LB1B 4JBWA 5CIQA 2WWYA 4IKEA 3GEEA 1Z22A 2EWVA 1EFCA 1D2EA 2F9LA 3VKWA 2WMOB 1KDOA 4HZIA 1YJ5A 2HLDA 4MDFA 1JEEA 1XNRC 1B23P 1AKEA 3BRWD 5HZKA 1VG8A 3SZRA 3W34A 1EK0A 4LJ4A 2QBYA 1XBTA 4YHHC 2ZJ2A 4DR6C 5L3VA 4TZ6A 2JGNA 4IVQA 4Y0AA 4QNRA 1XTSA 4K8OA 2XOKD 4JI3C 5LMNC 4LJAA 5HE9A 1EFHA 2ZQ5A 4HYYA 4O0MA 1IJFA 1DG3A 1XEWX 1AS2A 1WXQA 2R6DA 2VIIA 2ONFA 2OHFA 4DSOA 1RFLA 4IVPA 1AZSC 3TR5A 3LV8A 1TQ2A 1US8B 3U7FB 4Q9LA 5FUVA 1MRSA 2ZYWX 2EFEB 3UMFA 4NKRA 1G7CA 4CEJA 1X3SA 3RC8A 3RLFA 4ASUD 1AIPA 2GZAA 4W5JA 1E2IA 4OI1A 4ZKEA 1XTIA 4ZCLA 3A4NA 3K09C 4WIAA 2QGNA 4B48A 2PCLA 2QN6A 3AVUA 2G88A 3Q5EA 2CLSA 4OKSA 2DBYA 3KXLA 4GMDA 4U7DA 1G3QA 3OAAD 2Q3HA 2GJ9A 2WV9A 4C2UA 2IUUA 4BUJA 1OYYA 1QHYA 2ECKA 1W48A 1C4OA 2BEJA 2OAQ1 1D9ZA 4MUAA 2YWGA 5EXXA 5FTKA 1U81A 2W2TA 1CJUC 5JI2E 1JXMA 2IT1A 1R8SA 2UKDA 2F1HA 2IYQA 4TLBA 4HLQB 1JR6A 2J46A 1I4TD 4O25A 2QL6A 4IFEA 4RCZA 3CW2A 4NOZA 4M2LA 3O47A 1YZUA 1VKJA 2VTKA 2ZSBA 3K8YA 1S0UA 2ZROA 4BLTA 4NMMA 5EP4A 2FFAA 721PA 4MGZR 3RRYA 1KHTA 2E9SA 1IN5A 5M04A 4DUZC 1ZW6A 5E4FA 1W2HA 1YQTA 3LQRA 4ZDIA 1P9RA 1NY6A 1UBCA 4RZ3A 521PA 3U3OA 1A5TA 2F3RA 5IHPA 2ZI4A 2B21A 4FMCB 5FUYA 2KBEA 2OFOA 4A2PA 1QG2A 1U98A 3PG5A 3N2EA 2G6BA 1WA5A 3RS2A 4LPSA 1E94E 4IXNA 4G5QA 4B75A 2QTFA 4ZCMA 3TQCA 1Z6GA 2G77B 2XNDA 3TUZC 1CBUA 1ZIPA 4EUNA 2VRWA 4JKYA 3V9PA 5JLJA 3THWA 3C15C 4UNRA 2JDID 1MOZA 5DGXA 5C46F 1KDPA 5JWOA 3KQLA 4CEHA 1ESNA 3I73A 2D74A 4IDOA 4B35A 4DR3C 2PT7G 1H8ED 1NJGA 2QTVB 4KJZA 4UNPA 4B3DA 3AEZA 2QP4A 3IPXA 1Z0IA 5KSZA 3QPUA 4HB3A 1LY1A 4HZUB 2CL6X 1IY0A 4HATA 1KJZA 2AFHE 1XD2B 3RRZA 1I4LD 3KFXA 1JR3A 4BFSA 3DL0A 1R10A 5B57C 2JASA 2CCGA 4OQFA 3MRSA 4RJLA 4PSKA 4CRWB 4ACBA 3W90A 2YWHA 4RD2A 1KDTA 3ZD6A 1KI4A 2OG2A 1W0JA 3RS7A 1Z83A 4GP6A 1G6HA 2YWEA 1Q21A 4US0R 1DAGA 4OHWA 4LFCC 3R7WB 3IKJA 4RY2A 1SHKA 3B82A 1DTSA 3CX8A 1OH7A 1WF3A 2F1JA 1T3LA 4AYWA 3LNCA 5DH9A 3WHLA 4HUTA 2A30A 1S3SA 2PN2A 2ODWA 2V55B 4JLAA 3FB4A 2IYXA 3KB2A 3LDAA 4NYJQ 4C2TA 2CLCX 5GVSA 2WWWA 1LTQA 3B6EA 3FOZA 2GCPA 3QEOA 4DDUA 3BC1A 1Z0JA 2J7PA 1U90A 2EVWX 4LJYA 4MA4A 3THOA 4US2R 4EFNA 1WH9A 2I1VB 3JVVA 4F92B 2OT3B 5LD2B 3Q3JB 1E0AA 1BYUA 2EFCB 1VLAA 1XB2A 5LPNA 1Z0KA 1KSJA 2XTMA 1GP2A 1MRNA 3HJNA 2WKQA 1I2DA 1IOZA 4EJSA 3J81D 4QHTA 3V00A 4JI4C 1FJGC 4Q1EA 4TL9A 2IYRA 2UXDC 4GKJC 3FFAA 2OXCA 3L8YA 5JRJA 4JI7C 3EZ2A 2XEXA 2F6RA 4GZMA 4GL2A 1XTRA 3E1SA 3NG1A 2AK3A 1P3JA 2PX0A 4W9MC 1CR1A 1N6NA 4MQBA 5JEDA 4OK3A 2YVUA 4BRUA 4P33A 4IEIA 3LRPA 3HDTA 3IIJA 3QENA 1CRQA 3ZQJA 2F7SA 1BIFA 3A36A 4NONA 1KKLA 4JS0A 4O2LA 3W6PA 2ORWA 1Z08A 2BMFA 1OIVA 4F4IA 1ELOA 3ZVLA 1S9HA 3ZZUA 1N6KA 1ZP6A 4LV5B 2ZRAA 3CRVA 4AKGA 1H8HA 4EJSC 5FBVB 2IF0A 1ZUNB 2VL7A 2IS6A 1L8QA 3OEHA 3TW8B 2VP9A 2D2FA 3W9YA 1LF5A 4HDCA 4RZXA 3GLFE 1XZPA 2D7VA 3SJZA 2C2HA 5F9HA 4DEYA 1VCMA 3MJHA 1E99A 3JZMA 4DCTA 5DHFA 4OHYA 2ZITA 4NYMQ 5DYIA 1G16A 4RD4A 4O3MA 3A4LA 1MO5A 3QNUA 3ADBA 2WJYA 1QVRA 1HT1E 4Z54A 4KI0A 2A5JA 1XMVA 5GJCA 4LF6C 1NVWQ 1XEXA 3TSWA 4GRAA 2O0JA 4WVFA 3ZD7A 5AJWA 3SBDA 1QBKC 1LQLA 6Q21A 4NYMR 1K5GA 1W36D 4FXPA 1JALA 2VSOA 4G5GA 1HEIA 4EPXA 4P4SB 2FMXA 2GESA 4AKEA 1P60A 4IDHA 3SR0A 3FMOB 2WSSA 1T0JB 4JSYA 5LBIA 1F6BA 3L0OA 3QQ5A 3EPKA 4L9SA 1SXJC 3THXB 5B58C 1COWA 2JMPA 2GDJA 1ZNYA 2JJ1A 2JLRA 1U0LA 3GLFA 2CL7X 2Z0MA 5EUQB 3SN6A 1EX7A 3K0CA 4RCYA 2ATVA 2QAGB 2OFXA 4LFBC 1GWNA 1Z28A 1ZMXA 3VX3A 4Y0VA 5CB8A 2D4HA 2G3YA 4TT3A 2IYYA 2V7QA 2C03A 1FMLA 4DDTA 1PA4A 5L3SB 4XWOA 2C9YA 2PT5A 1NBMD 1YVDA 5BWMA 3TSZA 1L4YA 1DAEA 4PC1A 2HT1A 2ANBA 3GCGA 3IIMA 3VFDA 1WE2A 3QF4A 4GSYA 2G0NA 3K0FA 2F1IA 3B9QA 3X1YA 1RRGA 2NIPA 3EXAA 2G0TA 1A4RA 3SU8A 3OEED 3VMFA 3PEYA 3FHOA 2UVQA 1W36C 3FHCB 3MAAC 3TVTA 4TYWA 4DC9A 1Z6YA 3ZIAD 5JWRA 1KOFA 4U02A 1FTNA 2B6HA 3GP8A 2E1RA 2B7BA 1G5PA 1GVNB 4YMSA 1P7CA 4DLYA 4MGKR 1JEDA 3IEVA 2F43A 3WNCA 1UAAA 4M0LA 3OFND 3U4QA 4NTZA 2YCBA 1AKYA 4GT1A 1P2SA 2V4ZA 1HY3A 3WHKA 3EIQA 1TQ6A 4X8LA 5KSOA 2ATWA 1SULA 4I4LA 1VDZA 2QMUA 3CLVA 1EWQA 2OPLB 1QDEA 4K46A 5A0FA 1AZTA 4ASUA 3D31A 2L0XA 3W6NA 3EG5A 5D3QA 3Q7PA 1R4AA 3ND9A 2P0EA 4V03A 3OEEA 4OQNA 4NL4H 2H1LA 2VP6A 2JJ2D 1OHHD 1W4CA 1ZM3A 2LKCA 2PMDA 3CZQA 3IPYA 4TQUS 2P6NA 3CUEF 1OH5A 1Z29A 2VHUA 3RHFA 3SHWA 1UDWA 2OZEA 3ONWA 3K9LA 4BQSA 3C14C 2JLWA 2NPFA 2V3CC 4CF7A 1G8FA 4UNSA 3MWYW 2AD1A 2ZVPX 3AUYA 3QVUA 4HB0A 2QA5A 4Z51A 2ZRGA 4DR4C 3OF5A 1SVKA 2P6UA 1G19A 2N1BA 4BLSA 4AKHA 3WRXC 4M21A 4DT1A 2WJJA 5D3MB 2PCJA 4IRUB 4GNKA 2FFQA 3SHFA 1SVMA 4QG7A 3AV0B 3FKQA 1E2MA 3QF7A 5CJ2A 4B3SC 1G8HA 4B3RC 1IBLC 2QP9X 4RKEA 2FN4A 5BN4A 3FVQA 2JJ2A 3NH6A 4XX2A 4UXJA 5B30A 3PUYA 2C9OA 1R0XA 3FFBA 1IN4A 1P9NA 2DYKA 1OH8A 1IBKC 2WKRA 1S2MA 2ZEJA 3GLIB 4PPGA 2WPDD 1AS0A 1TTTA 1NVXQ 4XIGS 5DHAA 1OT3A 4M1TA 1OFHA 3CWQA 4O2RA 4UQOA 5H8WA 4MYHA 1W5TA 4LHWA 4OK6A 3I62A 2ZRLA 2DWPA 2FEOA 4PSAA 3VR3A 5AJXA 1TUIA 3ECCA 1KO4A 3NH9A 4TZ0A 4YDSA 1MKYA 4Q66C 1G64A 3TE6A 3MFYA 1XEWY 2J9RA 3CPHA 4LFAC 3T1HC 3OE7A 3GJ8A 2DWQA 3VKHA 1AM4D 5FUWA 1WDTA 4D0LB 4GPTA 2HT6A 2QEQA 1XWIA 4ZDJA 2RAPA 3LFUA 4KFUA 1D6JA 2ZRIA 4TLAA 5EE3A 3IHLA 2HYDA 3TUIC 2NTYC 3F3YA 4Q48A 4AD8A 2FV8A 1FPMA 3FMPB 1KY3A 1RYHA 2QRZA 3PCRB 3TAHA 4ESHA 1OJLA 2ZUCA 4JJZA 2JLUA 1ZNWA 3C5CA 1KI1A 3IHWA 4YC7A 1KAOA 2F55A 1FX0A 1HQYE 4JL6A 2QAGC 2BHRA 2JIZD 3DOEA 3QKTA 4IOJA 3K0AA 1K8RA 2ZAMA 1CIPA 2V9PA 2WHXA 4UKDA 1WBDA 2PX3A 1SKYB 1L4UA 4DV6C 3NBYC 2CBZA 3G82C 2O8FA 1RRFA 2GK6A 2XR1A 1Z0AA 1X86B 3TMKA 5BN3A 4PC7A 5KUTA 3GLIA 1NSFA 2MSEB 4W7SA 5CB6A 2IEZA 4A0FA 5KPJA 4YXWA 2RKOA 5IF9A 4IOMA 3W5IA 1OKKD 3A1WA 2LWIA 4HSEA 2Q3MA 3U5ZB 2GJ8A 2B7CA 4OX9C 3VR1A 2VHTA 4PHGA 1AGRA 2P67A 4PTLA 5TDHA 4AKIA 4DV0C 2IX3A 4JYAC 1M1YE 4HAZA 4Q21A 4R2HA 1OFIA 1ZINA 5HE8A 3I8XA 5IRCD 2F3TA 1NN1A 3PFIA 3AKEA 3WY9A 3QPWA 1X1RA 4KSBA 4AC9A 2YHSA 3H2YA 3N70A 4B74A 4JYBA 4LYFA 5A2QD 4G01B 1II9A 2RMKA 4XTCS 4IXMA 2IXFA 2ZUDA 2IYVA 2WM9B 1KYIA 2UZIR 3DZDA 3I32A 4N3NA 1IN7A 4NYIR 4QBIA 3B1ZA 4BEBA 1CU1A 1KI3A 1GRRA 2D7DA 3QG1A 2O8BB 2VSXA 1SQ5A 1SXJE 1HYQA 1T0HB 2OO7A 5FTLA 4D4LA 1HE1C 2BJWA 2CNWD 1QHNA 1UBEA 3DZ8A 3T1TA 3JVUA 4DLZA 4ZDWA 2ASBA 2R6FA 1NN5A 2HJVA 3E2IA 4HAXA 1HNXC 5TY0A 3VR4A 3HPRA 2MMCA 2QPTA 4A8JA 1RW4A 2ZE7A 3RSLA 1M74A 3B85A 2QT1A 1BO6A 2NO7A 3AKDA 3SS8A 5BW8A 2D3WA 3H4MA 2QT0A 4QBGB 4CT4B 1E32A 4R71A 1OH6A 4LF4C 3MWKA 2ZXUA 4Q4HA 1ZAKA 2ZRHA 1P72A 1UADA 3AKCA 4NP6A 5JJLA 4B3CA 1R2QA 3CJEA 1CJTC 4M9XA 3LVQE 1LS1A 4HAYA 5EP3A 2FZLA 2IYTA 4H1UA 1Z6XA 1TNDA 1ZVQA 1T5LA 1L2FA 1E1QD 2AFIE 2OBMA 3WNBA 4GDFA 2PBRA 2IUSA 1QHIA 2R44A 2VQFC 2WWHA 4AK9A 3TGPA 2IYUA 2XITA 4LYJA 4L9WA 3ADCA 4JI6C 4Q00A 1UEIA 3KQNA 4FMBB 4YQFA 2AHOA 3U44A 5KSPA 2ZU6A 3R8FA 4G5SA 4B3XA 3LXRA 2QROA 3WNDA 4WBSA 1U8AA 4LF8C 1PUJA 1XDBA 2ORIA 1HTWA 4R98A 1G3IA 3GJ5A 1JECA 1XXHB 5AWFC 5A5GA 5HKKA 1XPRA 1OF1A 4LHXA 4KXFB 3U3RA 4TL8A 4JKIA 3KTAB 5J40A 3UG7A 5P21A 5CK5A 3BWDD 1N32C 4XTRA 1NLYA 1U0JA 1J7KA 2HV8A 4LCBA 5DIFA 3V4RA 5J4YA 1T9HA 1KZ7B 1MABB 3EX7C 2IXEA 1E98A 3KXIA 4LYHA 1E6CA 3QOFA 4GKKC 2RGXA 2O8CA 2QI9C 3BGWA 2YINC 3TVDA 3ZLJA 2BDTA 4E22A 4ILEA 1SVLA 2GZHA 1RRPA 3K70D 4Q03A 2W6IA 3W8NA 1ZCAA 1SXJA 3EZ9A 1R0WA 1IQPA 2HLDD 5FOTA 3KL4A 1M7BA 2FX3A 2ZYVX 1U99A 2GNOA 4B3MC 1OKKA 1QF9A 1F2UB 3CH4B 2JDIA 3EC2A 1P5ZB 2AKYA 2GAAA 2C77A 4LJ9A 5EXSA 5TV2A 3IBGA 4B73A 2UXBC 3THXA 4CEHB 4BZPA 3RYTC 4EIWA 1Z47A 4JMPA 1S8FA 5GJVC 3LLMA 1CRPA 2WWIA 3OFNA 4DCNA 3FGNA 2GEDA 2YC2C 3QKSB 4BFVA 2FPMA 3FE2A 4LC0A 1OPXA 3ASZA 3EAQA 2GHIA 4YDHB 1G291 2JLZA 1U8YA 2VHCA 2VP4A 3LH5A 3OIUA 1VCIA 1SVOA 3KB1A 5EE5B 1T4GA 3LX8A 3R8CA 1TF2A 1YR9A 4AYTA 1PLKA 3CH5A 3BH6A 4DV1C 2ZJOA 1NVVQ 3KKPA 1G7TA 1G7SA 4QBFA 2WOOA 4X8OA 1ZC3A 4Z8XA 4WZ6A 2PZFA 5KU1A 4PQRA 1Z8FA 1CS4C 3DVLA 3CF0A 4URZR 3OHMA 3I5XA 3PEVA 2F9MA 2IS4A 1SVSA 4II7A 2GCOB 3DMNA 4GOXA 4JVNA 1S96A 1ZM2A 2ATXA 1E4YA 1KO5A 2AKAB 4TN1A 1NN0A 1FFHA 1G1MA 2VEDA 3I1FA 1HUQA 3LBNA 1Z07A 3GLHB 4CIDA 1DE0A 4G5RA 4DCSA 4WW0A 3AF2A 3X1ZA 4BLQA 2EFHB 2GVDC 3M6AA 2BKEA 3SJBA 1ZD8A 4BPBA 1P75A 2FPKA 1GNPA 1IHUA 1W1WA 4XWAA 5FL3A 3T5DA 2OCYC 3SDZA 3B7GA 1YZNA 4OJKA 1FUUA 5J4LA 4NPHA 3ZVRA 3MWLA 1EFRD 1U94A 1EGAA 1RIFA 1H8HD 4JBXA 3U6KA 3NWJA 4PQFA 3VU9B 3CONA 1Z2CA 3A1TA 3NC1C 3PUZA 2OSBA 1ZUIA 4A15A 3NKVA 4JIMA 3FMIA 2QNRA 4HUQB 4LY6A 3EIHA 4C0SA 1EXMA 4X65C 2VQEC 1GDDA 3W8RA 2GXQA 2ZJ8A 3DO6A 1SKQA 2ZVQX 4GP7A 1HNZC 1HR0C 1BS1A 2QU8A 1M34E 5EXPA 4PPQA 1BKDR 3LW7A 2OCPA 3OZXA 1CR2A 4V0LA 4BLRA 3VNVA 4QC2A 2NGRA 3CRQA 3P4YA 1QVAA 2VYFA 4M1YA 2V1UA 4DIDA 2IUTA 2PZGA 3QXXA 1M7HA 1E2DA 2FWRA 2Y8EA 2VH5R 3A8TA 3PXGA 5DI3B 3QBVA 4BSZA 2V6IA 5BYJA 4BFUA 4LF5C 4B3TC 1S4QA 2GRJA 3B60A 4DR7C 3KFVA 5F2EA 5E95A 3SFVA 4DLSA 1E1QA 1JPNA 1GNRA 1Q1ZA 2DHRA 3MLEA 4TYPA 4B34A 1VYTA 3CO5A 3NVAA 1W36B 1NG1A 4A0GA 2UZ3A 4GI7A 4LHYA 5AR1A 3B1XA 5JJKA 2DFKB 3QXCA 4TLCA 3GJXC 2E8CA 1J8YF 1KY2A 4NCKA 2GBLC 4MYUA 4YMWA 1TU4A 5HZHA 2J0SA 1KI7A 1TF7A 1N5JA 3CB4A 1NIPA 3VX4A 1GITA 1CULC 2LCFA 2VBCA 3GLFB 3U4QB 5EE9A 2ZR0A 1LF0A 3U61B 1IXZA 3A6PC 1IM2A 2QSYA 2TMKA 4M1KA 5H1YA 1NN3A 2GBLA 1NBME 3BXZA 1VIYA 1XMJA 3C5HA 5HCNA 4YLGA 3JZAA 4JI1C 3BERA 4URYR 2FSIA 4V0KA 1W5SA 1Z5ZA 3K9GA 3U6BA 4PAMA 3PR1A 5FI1B 3CX7A 5JHGB 2BBOA 2EGTA 3DM5A 4JZKA 4YONB 2NMVA 5L8VA 2GF0A 5EP1A 2ONJA 1Q3HA 4OL0A 2WICA 2W58A 4BFXA 1YR8A 1FP7A 2WJIA 1HH2P 5BR8C 2WWGA 3ZVNA 2GZDA 4OBEA 4RKFA 1S9DA 2CJWB 1Q1QA 4G0NA 1OFUX 3IQWA 2GEUA 2O8DA 3ASYA 4D82A 4YY3C 4DV7C 1I4DD 1YR7A 421PA 4TYNA 4BLOA 4G5OA 4U00A 3S1AB 1XNJA 5DYGA 1HV8A 2FGKA 2FFHA 1XMIA 4DIEA 2OV2A 1VG9B 3FYHA 5FUXA 5FPSA 3BFVA 1E4VA 1II8B 2ZPTX 3SC3A 3Q72A 2D62A 1R5OA 3OESA 4M9SA 2IC5A 4M1SA 4KBGA 4ZIRB 2KSQA 5FPYA 4BLPA 3EZ7A 2YKGA 1XXHE 3GLGE 4M1MA 1F60A 4GFDA 1X8JA 3CZPA 1NMXA 2QE7A 2X2EA 1E69A 4DT1B 1E0SA 4J0QA 2EYQA 1JB1A 1XFAA 3HU2A 4XOIA 1DS6A 1N6HA 3AQ4A 4LGMA 4PQYA 1MH1A 4D0GA 1N3BA 2QUZA 4TMXA 3T5GA 2QM7A 4B3BA 4LX0A 2AL7A 1DG1G 4NXNC 2HDNB 1N6LA 3R20A 4UNNA 4LBWA 2OCBA 4AQYC 4IEEA 2IS1A 1NMZA 2QM8A 1E2HA 3AVQA 3K53A 4HDOB 4ZDKA 3A1SA 2XJ4A 2WJVA 4PZLA 2DCUA 1NSTA 1GAJA 2Q21A 1KIMA 2WWXA 4EQ6B 2KBFA 4AURA 2OE2A 3K0AB 4LF9C 1PLJA 3BB3A 5IK2A 3J80D 1X8KA 4DKXA 4FCWA 3GLHA 4JLDA 5KYKA 1ZC4A 2FDCA 1YZLA 3WP1B 4RZUA 3SYKA 4NDZA 4N1AA 2ZS7A 4FINA 4PR0A 5FI0B 1IONA 1MT0A 2P65A 4Z1MD 4OJQA 4HDQB 4BASA 5J4KA 1COWD 1G18A 4FCVA 3QUSA 1VYVA 1GTVA 2ZRKA 3AP1A 2IHYA 3X1DA 2JJ1D 4OQXA 1X8LA 4FWIB 2G83A 4QJ4A 4QJ5A 1II8A 1ZB9A 2ZETA 3KKMA 3NDPA 4FIDA 2ZU0C 1CJVC 1Z0DA 2VF8A 2OFWA 3RWMB 1R6BX 4B33A 2AXPA 2Z5FA 4BEJA 2HF9A 5FR1A 2A5FA 2CMKA 4GBMA 2AWNA 1RRCA 1UFQA 2ZJAA 1KNXA 3FKSA 2O8CB 3HU1A 1N25A 2PLRA 5FBQB 1EX6A 3B1WA 2W6ID 3IUYA 4Q18A 3SE0A 3K70B 5KDLA 2DB3A 1ZBDA 2W83A 3QKSA 2BJVA 1XJCA 4Q4AA 3RNLA 1GM5A 2NO0A 4N0EA 2E7GA 4NZYA 1H8EA 4C7OA 3AF5A 3DHWC 2ZI7A 3T1VA 4TTRA 4Q7MB 4DCUA 2FZ4A 1GNQA 4PC3A 4Q1CA 5KHOC 1SGWA 3HU3A 4US1R 4C3ZA 4FI3C 5IT5A 3SJCA 1FMJA 2BOVA 1R0YA 4QRHA 1DEKA 2ZM6C 2WJGA 3CBQA 5CLLA 2G9NA 5EUMA 1KO1A 5EP2A 2J7PD 3CKLA 1XPOA 3TRFA 4RVCA 1Z06A 2AN9A 3D7MA 3DOFA 1B0UA 4A8JC 1MO4A 1T5IA 2BBSA 1OIWA 3CRW1 3T1OA 2Q6TA 1AA9A 3LUSA 2AK2A 2GAOA 3VHXA 1KSFX 1BYIA 3AP3A 3UKDA 1HURA 2FNAA 3KX2A 5ELXA 1XD2A 1TU3A 1N5KA 621PA 3B1YA 3ZDQA 5FPHA 1GSIA 4N0DA 2IS2A 3CF2A 3HR7A 2E5LC 1X6VA 4Q4HB 5CDFA 4OI4A 3ZS8A 5JFGA 5KNCA 5C4MA 4BFZA 3I5YA 2R2AA 3P27A 4QXAA 1NG9A 4PO1A 1DADA 2IYWA 1JPJA 1ZUHA 1OYWA 2XZPA 3K09A 4Z8YA 4PX9A 2XJ9A 1DO0A 5TXGA 4E5UA 2A7QA 3IBYA 1G5RA 4X66C 4X8HA 3MWJA 2O52A 3NEYA 2OCAA 2GK7A 1NL3A 2WMNB 4ZKDA 4OYHA 4WXPA 2GEVA 2J0UA 3CPJB 2CY1A 4QGHA 4DUYC 4TQAA 3ICEA 2VP0A 1M7GA 3FWYA 2QQ0A 3CF6R 3K0EA 3ADDA 2DR3A 1G8PA 2QE7D 4TQ9A 4L4UA 4B32A 3M1IA 4KVAA 4LPKA 5K8IA 3QPVA 5GJWC 1W4BA 1G6OA 3MSXA 1QHHA 2QG6A 1P2UA 1KDRA 1VMAA 1KK2A 3GJ0A 4LF7C 1V43A 2LKDA 1DBSA 4GOJA 4LUCA 4P32A 2HCJB 1NF3A 1TPZA 1TUEA 2J3EA 2XSZD 4WAUA 5DSZA 5KDDA 2ZM5A 3D6TB 4XVQA 4TMKA 4LJ5A 3BE4A 4LI0A 4D4KA 5KTYA 3GLIE 4PHHA 1ANKA 1G3MA 5KSYA 1G9XA 4EJSB 1ZRHA 4QNMA 4OK5A 3P4XA 3EPJA 3AF6A 1T91A 2R9VA 2VO1A 2ZTSA 5JWHA 2WVJA 4RZ2A 1GFIA 5HR5A 4OHZA 1CLUA 2DFLA 4C0JA 2VQSA 4URXR 1WCV1 1TADA 4L16A 1YZKA 4MRRA 4Q5IA 1M8PA 3QKUA 3RC3A 1C1YA 2J41A 3OE7D 1Z0FA 1YZTA 2GWHA 2J0VA 4URWR 3UMSA 2IA5A 4LC1A 5ANRB 2BCJQ 4DEXA 2R65A 3NBFA 4DHEA 2N42A 1G20E 1NYEA 3CNOA 5FOUA 1TEVA 5BYKA 2ZJYA 2FA9A 2C98A 4GZLA 4EFMA 1G17A 2GXSA 1V5WA 5JZVA 2YV5A 1O87A 4TL6A 2ZRPA 5J5CA 3K0FB 2X8AA 2J1LA 2QENA 4IDNA 2K5UA 4IOKA 4LJ7A 4M8NE 3QI2A 1KMHA 3REGA 3T1QA 2HHHC 1I2MA 4M22A 5KNDA 1GL7A 4JT4A 2GJAA 4DSNA 1NLZA 2FU5C 4XSGA 3EERA 4R2IA 3X2SA 4V0OA 3AUXA 1NNEA 4QM7A 3UIEA 4EPYA 3SFZA 3VTKA 2ODNA 2ZREA 3LBIA 3QVVA 4TT3D 5DISB 4P31A 2ZRCA 5JMTA 3NC0C 4MYCA 4NYJR 4R7ZA 2CDNA 2WIBA 4I1OA 4M1OA 1VCNA 4NCIA 2WSMA 5J4VA 1ZM7A 1VPLA 1GUAA 5JJIA 2VA8A 1XEXB 4BRWA 1BH2A 4DV2C 3QIAA 1M2OB 2C5LA 1HQCA 4A82A 1PLLA 1PUIA 2MSDB 2H7VA 3C41J 3DEFA 4QOSA 5AJYA 5DE3A 4HLDA 2J59A 3ZZTA 2BVNA 4EAQA 4IJMA 1GKUB 5AJVB 4ZI3A 2D06A 1E2JA 2JIZA 3BS4A 4LOAA 3LLUA 5EE0A 1JR3D 3SJAA 3HPQA 1RKBA 3KXKA 3GQBA 4G3XA 5FL7D 3SYNA 1JR3E 3T1YC 2QQEA 5G3YA 1FQJA 1FTSA 4KYUA 3VR5A 2PJZA 4DWJA 1RZ3A 2PEZA 4DDWA 5IT9D 4Q4JA 5IWAC 1OHHA 1YKSA 1FW6A 3BD9A 4DLTA 3AVTA 1P9WA 2E8EA 2DFTA 4P0TA 4PSVA 2NG1A 4JLJA 1DVRA 2ZAOA 1KI2A 2KI5A 1KZGB 5JHHB 3AH8A 2YWFA 1ZD9A 1E1RD 3NBXX 1VHLA 1KO7A 5FPTA 3KTAA 1VCOA 1HA3A 4RFSA 4QGFA 4JBYA 3EPLA 1G4AE 2VPPA 4DBLC 4PANA 5JCPA 1OXVA 5E7IA 4QJ3A 3T06B 1O3YA 4A8JB 1IN8A 1R5NA 1GIAA 2ASEA 3A1UA 1Z6TA 3MJRA 4MKFA 4C30A 1W46A 2IYSA 3N2IA 4RD3A 2XB4A 3DMDA 3U3KA 1DELA 5AUOB 4ESVA 4D0NA 4HB4A 2CCJA 1U8ZA 4D4MA 1USPB 1YZGA 2E8FA 2UXCC 2JA1A 3MMPA 2PMKA 1QHSA 1HE8B 4X8MA 1OE0A 2CNWA 4PAQA 3SQXA 4XVRA 4ERNA 3AVVA 1ZNXA 4PAOA 2OPLA 4JLKA 1XMOC 3AF4A 4KFRA 1N0WA 3TUJC 1JJ7A 1XJ0A 3SQWA 4EKDA 4MDEA 1HNWC 2BIFA 3FHTA 2CLDX 1FL9A 3IGFA 4HLUA 3UXMA 2A3RA 1LW7A 2Z4RA 1S1MA 1UKEA 2BEKA 2RHMA 4L5BA 2OUKA 1F2TA 1P4SA 4CT5A 2B8TA 1Z3IX 4EFLA 2MSCB 2ODBA 3VHLB 1R8QA 3KJEA 1DARA 2ZI5A 3DKPA 5FPKA 2GXAA 2QP3A 1D2NA 1U2RA 4Q9JA 4WZBE 4JLMA 5LMUC 1N5LA 2I3BA 4TMWA 1WRBA 1NKTA 1UF9A 4LZZA 1RJ9A 4QHYA 4F91B 1CJMA 3W3ZB 1CXZA 3O8CA 5CJPA 1N6OA 2XGJA 4JJKA 2WSSD 1XCMA 4B3FX 3L8ZA 2P6RA 3ZH9B 2HYIC 1CJKC 2O8BA 3I4LA 1CF4A 4KLZA 5K8TA 2IF2A 1EFRA 3EASA 3KUCA 3E5HA 4MRPA 2W0SA 3IDQA 3VR6A 1ZD1A 5AUQA 2WJHA 1IXRC 2KJQA 3B1VA 3B13B 2CK3A 1NBMA 5H70A 4ON9A 1XTQA 2GILA 3BB4A 1XX6A 2MMGA 2W2XA 4E03A 4NCHA 1KSGA 1ZM9A 3RABA 2WAXA 2ZI3A 1OV4A 3E70C 1EFUA 2OLKA 2GKSA 2CL0X 2RGEA 4UNQA 2YYZA 5CK4A 4CEIB 3VAAA 2EU8A 3PV0A 3ICQB 2QY9A 4DJTA 4JV5C 2UUBC 2ZRDA 2H16A 2ZRNA 1OB2A 2GETA 4NE2A 5H68A 2CXXA 5C1BA 4FWTA 3SOPA 3WXMA 1XD9A 2VSFA 3L82B 2OXRA 4KYIB 1UKKA 1E9RA 1KK3A 4Q9KA 4ZO4A 1G3UA 5K8UA 2PH1A 2V7QD 1C9KA 2BC9A 3EZFA 2IW3A 2NO6A 4Q1FA 3BJIC 3TSOA 4PXAA 4YMTA 1PV4A 2HEIA 2P2LA 1JOSA 1Q22A 4D4JA 1R5BA 3L0IB 3M0EA 3U3MA 4V02A 1NVUQ 4TSFD 1UKYA 1CP2A 2HXYA 1ZYUA 2CE2X 5BQ5A 1FX0B 3WYAA 1EWRA 4KAXA 1NRJB 1T8UA 2JLVA 4GOKA 4OI0A 1NJFA 2P5TB 221PA 3IILA 3GMTA 4KLNA 3ZQ6A 4IVRA 2J45A 1IY1A 2IBMA 1XJQA 2RGNC 3QG5A 4Q02A 4P4SA 2VF7A 4HLUC 1CR4A 1E9SA 2RGBA 4LBYA 3QJYA 1AQUA 4C0KA 3GLGB 5JRZA 1AQYA 1T8TA 3GEHA 2Z4SA 3P32A 5LDDC 4JT2A 5G41A 1F2TB 3H84A 3MG9A 2ZRFA 3A1VA 5FR2A 2PJRA 1N2CE 4OQMA 1VG0B 2ERYA 5AUPB 4LHVA 1LNZA 3VNUA 1A2KC 2A5YB 2QL8A 2QSZA 3I3SR 1JNYA 4C0BA 4TYQA 3LW8A 1CEEA 3QBTA 2J7KA 1N33C 5G53C 4KSCA 1Q1EA 3ADKA 4B6EA 5CITA 1JQJC 4WZAE 4W5HA 4A1FA 1FOEB 3WP0A 5FTMA 4ACAA 2OILA 2J0UB 2CXCA 4D2IA 4Q47A 4DLWA 2QPAA 3M4YA 4XD7A 3T35A 3A58B 1TMKA 2KB0A 3Q5DA 2XX3A 3O8BA 4HLCA 3CR8A 2ZI6A 1RPZA 2QBYB 1JJVA 2CEAA 1CR0A 4JI2C 1YRBA 3CWZA 3K70C 2WOJA 4C7OB 1E2GA 4LYAA 2CHQA 4RFVA 2C9CA 2HUPA 2ZRMA 5CM8B 3KDSE 1KI6B 5C2JB 3B78A 1XU4A 2ZJ5A 2AXNA 4UXHA 3H86A 2XXAA 2IYZA 2C78A 2OM2A 2YOHA 2R8RA 4RD1A 1E9AA 4ZI2A 4KBFA 4LBVA 5F98A 2HJGA 1SXJB 4IDQA 5CLQA 1XPUA 4HI0E 4MKGA 2CHVA 3EWAA 4V0NA 2FG5A 3THYA 1GRNA 3K1JA 2WPDA 2ZE5A 4MKHA 3A37A 1WBBA 4AG5A 1ZM4A 4MGYR 4IDPA 3RRNA 4DLXA 4B3GA 1IJEA 3RS0A 1XMQC 1W0KA 3B8HA 1I94C 5FTJA 2H57A 3OIVA 1RC8A 1MABA 2A2ZA 2JLYA 1IN6A 1W0JD 1JBKA 4V0ME 4DLVA 3B9PA 1LFDB 2WIAA 1YR6A 4NH0A 4DVGA 2NPIA 1E2KA 2O5VA 5FH9A 3WMGA 3FPAA 4HAVA 4PO8A 1SVWA 3GEIA 2OEPA 5B2ZA 3K9NA 1XCPA 3EA0A 3UG6A 1DAHA 2O8FB 2BMDA 4E07A 1PJRA 5G40A 3F8TA 3LAWA 4I1SA 3IO3A 4DRZA 3KKNA 2N46A 1QHXA 2WBLC 4Q01A 3NXSA 4JLBA 4RSGA 4F4CA 1TX4B 5FOVA 5CM9C 1ZCBA 1SKYE 2FH5B 3UWKA 3GFPA 1D8TA 2AWOA 2C8VA 2NOAA 2QRNA 3HYRA 3CPEA 1KGDA 3KJHA 2WKPA 2OLJA 1GILA 3FDIA 3MCAA 1JAIA 2W0MA 2J5XA 3DDCA 3QEJA 2XAUA 821PA 2ZS9A 4JSTA 4IFBA 1KNQA 2GXUA 4U5XA 1N6IA 1D2MA 3GKUA 1KMQA 2ZJZA 2IL1A 3Q9LA 3QXHA 1KJWA 4L8GA 4LHZA 5HCIA 2JATA 2ODEA 2CE7A 3RANA 2R6AA 1FQKA 5SZJA 3BBPA 3N5CA 2XOKA 4POAA 4A6XA 4A92A 4PPFA 3GD7A 5FBLB 5KOYA 2Q9CA 1E1RA 2BJOA 2YOGA 2REXB 3WRYC 3ZIAA 3X1XA 1UM8A 1E2FA 3GPLA 3WBKA 3U2QA 1H65A 2CHGA 3F0TA 2H17A 1Y3AA 2GF9A 1OIXA 1T3SA 2PL3A 3FMFA 1OXUA 5SZKB 1KO8A 2ZSFA 3V4FA 2AX4A 5L3QA 1BMFD 2BBWA 4FN5A 2Q3FA 3LY5A 3NHBA 3T12A 1OSNA 3PUWA 2BV3A 1E96A
chains in the Genus database with same CATH superfamily
2I7XA 3DR3A 1T4CA 3ED1A 1LBHA 1UMBA 1ILWA 1NNSA 4UQPA 3VC7A 1SBZA 2VHJA 5LB2A 1M33A 3KQQA 4OHCA 4DDVA 1G38A 3T9AA 4CVNA 1YI0A 5JSUA 2Q5LA 1N9GB 2FF7A 3DDZX 2G07A 3PI7A 2FWNA 4Y6PA 2PL1A 4C04A 1BS2A 1HXHA 2PWYA 2RBKA 3LO5A 4IDAA 3LDFA 4M9QA 4OI2A 3RQIA 1ETUA 2BSQA 2HBZA 1A7AA 5JROA 2BFCB 2PLNA 2M1XA 1XRQA 2F1OA 1N2FA 1MR3F 2DUNA 1PR9A 3OOEA 4HDNB 4OHVA 1E5LA 4ARCA 5C8ZA 1L7VC 4TMTA 4XWTA 1BMFA 2ZE8A 3DEAA 3PSAA 2EQBA 2PUBA 1BWPA 2B3TA 3G9ZA 2JAQA 3EE6A 3OP4A 5FEUA 5I7OA 2PQ0A 3WRWA 2A5LA 1JTEA 2OD2A 1GQOA 3GLGA 2ZJFA 1TJNA 3HNOA 5KC9A 3JAMD 2JGRA 1QZUA 2ZWMA 2XZDA 3OH8A 5K8LA 1J1IA 2H51A 3TLXA 3CKMA 1YR2A 3PGMA 5I7EA 1CEXA 2GBPA 4F3RA 1GPUA 3C8UA 2A94A 2XB8A 4WY2A 4EG4A 1DXYA 1OC4A 5IX8A 5P8WA 5IC6A 3SEAA 1GZDA 1TK3A 5E6RB 1GQRA 3GR1A 2F43B 2F64A 2PUTA 2XTAA 3CKYA 3O93A 3QSGA 1IBMB 2P2BA 1ZL0A 2FJUA 1P7WA 3U26A 3LQQA 1ORDA 4TRMA 1S89A 4BNUA 3SS7X 1UBUS 1FFEA 3EXG2 5CXSA 1OX4B 2FEKA 2H4WA 3FFWA 3VTZA 1WJGA 4ICIA 4NQRA 2B8NA 2JFUA 1U7DA 1WU7A 4ENVA 1N2HA 1QGZA 1TF5A 2O2EA 4M53A 3RYCA 4YNBA 2EWWA 3GG2A 3B3AA 1UXJA 4CEJB 3N0WA 5LP6C 4C3VA 5K2OA 5LLSA 4D81A 2XE6A 3CNHA 4ARZA 1AKTA 4EW1A 4MRSA 2J9GA 3MT9A 2P69A 1Z4KA 4NU0A 3R7AA 3U4AA 4DAOA 1GKIA 1L5VA 4CODB 3A31A 4FD2A 5DHUA 1W5BA 1GZSA 2XXBA 4YGXB 4C4YA 3LUHA 3O9MA 4CCWA 2JZNA 1KZ6A 1VIAA 4Z3KA 4IBOA 4QYTA 3IOBA 3K2IA 4P3OA 3K16A 3LUJA 1EVJA 4TTVA 2WQZA 3HP1A 2XXAB 4RK0A 1EFVB 1OJ7A 1UKZA 1ZDMA 2WD7A 3M3HA 4CDMA 4CMKA 2D0DA 2HXSA 2NSJA 1CB7A 3PEEA 1EK6A 1OMOA 2FG6C 2Q4BA 3EARA 1K8ZB 2ZG6A 4FQ7A 4KMRA 4LVUA 3BGSA 3DC2A 4NZ9A 1V3VA 5ALYA 3ZD8A 2CXNA 1KSHA 4ITRC 4JLPA 3NYQA 3UY4A 1ORRA 4AS2A 3D2AA 3HWWA 2AW5A 4KWEA 3RS5A 1KYYA 3KIPA 5E9QA 4BECA 3OUUA 5FOWA 2X19A 4C2AA 1DO2A 2PRSA 2YS6A 5HYVA 1EWYA 4YJHB 2I91A 3M2PA 6GPBA 5MHTA 2I6UA 2NP6A 4MV0A 1ZUNA 4LY9A 4CUZA 2WT4A 3GLVA 3AILA 4QO7A 5A2GA 2LNDA 4GMXA 4XDYA 1D07A 1NI5A 1NMYA 2RGCA 3GGGA 4J07A 2IYLD 2ZJBA 1TD1A 1NAHA 3FPSA 4PLPA 1SZJG 4V0MA 4WLOA 2ZYDA 4WZAA 4ZU1X 1PYGA 1C1HA 1W35A 3T7RA 4JYCA 4WEOA 4N6GA 4ER0A 4G4SP 3X44A 4HAUA 1D9XA 2X15A 3TTWA 2IE8A 2EJCA 5JCJA 2AR0A 4DJEC 1VYUA 1E89A 2V6JA 2ZB2A 3DB1A 4EVQA 5F9FA 1U0BB 1E2BA 3T4PA 1Q2XA 3F98A 2GPYA 3O4GA 1WB6A 3LBHA 1YDWA 5CVCA 3RW9A 4MV7A 1YJQA 4XIJA 1J5XA 3AJ9A 4YCBA 4UHBA 3WSTA 3ZEIA 2Z1MA 1DQNA 2JAHA 3D02A 3GGOA 3GJYA 3MTBA 2ECOA 4YYEA 3ZWKA 5HDQA 2F17A 3SIWA 2UYGA 3UV6A 1L7DA 1NP3A 1PRYA 3V48A 2Z09A 3TTSA 2G5PA 2GPWA 4HUQA 3FDJA 4X61A 5BMVF 3T7KA 5TNXA 4KFTA 4IIHA 3DDUA 3I5UA 4DV1B 1QZXA 1YWGO 2AMLA 2NU8A 1K75A 4EQ6A 2ZE6A 2P40A 4G1UC 3VU9A 3HN7A 1YZQA 3W6OA 3ID6C 3L7IA 3IVGA 1YSCA 5JCZA 2WQ6A 5G4KA 2AFHA 1BGVA 2GEJA 3KHTA 3H17A 3L8DA 5HTKA 4Y6QA 3ZH2A 2FW9A 1HH4A 4QECA 3GQBB 5ALQA 2WLSA 5IJ9B 3OC0A 1YDHA 5ELMA 3BGOS 5GINE 3D1VA 4JC0A 1F7VA 4MYTA 1M0WA 5TE9A 1CIVA 3I9V6 2QTHA 2UVDA 4JFRA 5EQFA 2UU9C 4MQEB 5K4AA 1AKUA 1C4XA 3MAJA 3V8EA 4B3RB 3DR5A 1GCGA 3WLQA 3N2LA 1HZZC 5E8JA 4B4VA 1TO1E 3TFWA 4D8VA 3R5HA 2W6PA 2CYBA 2F4NA 1UBFA 3RYHB 4ZZ0A 1DSSG 2MCQA 1KQPA 1JXOA 1X2BA 2VUUA 2VRCD 3OTOC 2YJZA 4HS4A 5ED0A 2H29A 2W2OA 2YNMA 3L9WA 1S02A 4UM8B 3U48A 2NNWB 3KHSA 1I7QB 2NSHA 5T67A 2YOFA 5CVJA 4RJIA 1E3MA 4BKRA 3T5TA 4D26A 1IBSA 2QR5A 4OXQA 5CYOA 2DPXA 3RJ9A 4FR5A 4H35A 1HWYA 4CBVA 1HTBA 1M3SA 1YVUA 2OBLA 3KXDA 2O8DB 4QXQA 3WK7A 2QYSA 1T43A 2W2VA 4NMXB 2VQEB 2R00C 3NIBA 5ALPA 1DAFA 2IZZA 3KLPX 4FX2A 1G8KA 4YJHA 4ZOLA 3E3AA 4C1BA 4E5VA 4B2IA 4RLQA 1FS5A 2JLSA 3EWSA 5KVVA 1KJQA 1PU1A 1QLWA 1T3HA 3HFGA 2CEKA 2JA2A 1OXKB 1DT5A 3B5JA 3DQZA 3H04A 4DUZB 2OZLA 2GPNA 3ER6A 1DOAA 3PDIA 4DMGA 1A7UA 4G1EB 4P3YA 1SVIA 4NBSA 4YT8A 1R7RA 2CLFB 2I1QA 2HIHA 2XCQA 5ILGA 1Z16A 5EFOA 4ESOA 1U4NA 1X2EA 3Q9UA 1D4OA 1XLWA 3E22A 1B42A 1EFVA 3F8WA 1UJ2A 3I61A 3NIDB 1RAGA 3EMBA 3BWVA 5E2AA 2O8EB 2ZVDA 3FCEA 3NGMA 3GRKA 1E79D 3A3OA 3EXHA 2PMWB 3OUZA 5CYFA 4AY5A 3KSDO 4Q1AA 4CQJA 1NTRA 3N0XA 1W0KD 3AVOA 4AUKA 5CH3A 2D3TA 2PRYA 1MXAA 2W2QA 1JT2A 2AOUA 1HG1A 2C04A 4IW3B 2H0QA 4RV5A 5L7YA 1QCCA 4N12A 3TQRA 4YXWD 3BA6A 2VQ6A 1YE8A 3QP9A 1KBQA 3KD3A 3O0TA 3PKZA 4TVOA 4UMEA 2VI5A 5LQSA 1O95D 3IEPA 3LDHA 4OGGA 4XVUA 4CR8A 5ILOA 3CUVA 1E3DA 5MN6A 4L08A 4R8VA 2VRBA 3V1LA 2ZI9A 4LQLA 1AUPA 1O94D 4X1KA 4B7AA 1MEJA 4MDHA 3M7IA 4AECA 4DR5C 4E0BA 1CP3A 2FP4A 3PFHA 3BORA 2HDOA 5DBOA 4UW9A 4ZAVA 5FWDA 2GN9A 2O7VA 2QL9A 4ZV4A 3IMFA 2H5IA 3V1UA 3I05A 3IUJA 3HLKA 3WYDA 3RUFA 4U2CA 4C4ZA 3F96A 3PGXA 1T2VA 4YV7A 4BGUA 3BH0A 2JIQA 1G3RA 3MUOA 3ZU6A 3SMQA 3OAAA 4HGPA 5CA0A 5ALEA 3FBWA 1DRVA 1PVOA 1GN9A 2BM1A 3LXMA 4XWWA 1L7XA 2UYYA 2G5TA 5MFPA 1P7LA 2BR4A 2O19A 3NWBA 5C7OO 4BL5A 1Y98A 2PS9A 2JHGA 2Q4TA 4L4RA 4X3OA 1DBQA 4HV4A 1M8JA 3MINB 5A2QA 4D3XA 2ZSDA 5IHXA 1W6RA 4FM9A 4DB2A 2OYSA 2QZ4A 5HQ3B 2ZWOA 4FE4A 2J3DA 1G98A 4QUDA 1K4KA 4TTQA 1XCJA 3CW8X 5FFMA 1IDOA 4E1AA 2ATCA 3Q8MA 4PHFA 1UJMA 3IMLA 2FZ5A 4I9FA 1UXOA 4NYIQ 1PVDA 5KYTA 1IZ9A 1U9IC 2C8KA 3E58A 1YAHA 1JYFA 3GRYA 1RRVA 2IDJA 4KPGA 1XZDA 2ONZA 5EIHA 2M6LA 2NCLA 4A0HA 4CMCA 2XMGA 1UJBA 1Z36A 4PLVA 3PITA 2FGJA 2PT7A 1Q1AA 5F4ZA 5HCUA 3RS3A 1AV7A 1J56A 1Q7BA 2FMIA 4IZHA 1BVHA 5DBIA 3O8NA 3GAZA 4MPPA 4A2QA 4CU5A 1KEVA 3VR6H 3NONA 1GU0A 3IE2A 2I3AA 4CHTA 4MO9A 4W5RA 4TLEA 5TX7A 2JD2A 1HZJA 2WIFA 1XTJA 2YY6A 4JXJA 3H5IA 4MP3A 4RY8A 3M70A 4JP8A 1VEHA 1AXEA 3E35A 4KO2S 2PO5A 2V03A 2R7KA 1XNHA 1M5TA 4AZTA 3JD0A 2BLNA 1DT3A 1EUDA 2WZCA 1Z6ZA 5DB4A 3VPGA 4NCNA 1U04A 8ADHA 3L7YA 4GOMD 2J8ZA 4UD2A 5C4IA 2HRBA 4O63O 4DR2C 3ZX4A 1NBHA 4O6VA 3RTDA 1J42A 3OD1A 3LVBA 1FFSA 1PJ2A 3VPDA 3H4VA 4BFLA 1C81A 1ZUWA 3O8OA 4HFNA 3TGWA 4L2ZA 2IPAB 3DKVA 3ZHOA 4F2PA 1ULZA 4Z49A 5A4JA 4BFWA 2AD5A 4DR3B 3B7WA 5IYZB 1CB0A 1CE8A 3LY7A 3OEHD 2PRKA 1ZEJA 2QMEA 5FADA 1CRZA 1OFTA 3GUVA 1O9HA 2AGVA 3V8NA 1L8AA 5C7LO 1Q74A 3A9RA 5TPWA 4Z9FA 3VU0A 1JIVA 5KNBA 4QFDA 3D3QA 4D57A 4CU2A 5EXEA 4DXDA 3U4MA 2GO7A 3RS4A 1QONA 3Q9NA 5KJ6A 3BMQA 4UHFA 4K1LA 4PLGA 5CYGA 5K0BA 4CFSA 4LK2A 1CY7A 4PTYA 1C8KA 2PANA 3PENA 2O50A 1MVLA 3HCCA 2VPQA 4W9NA 3FRIA 3IQDB 1NLUA 1JSLA 2ACEA 4WJZA 4BQOA 2ID4A 4MLZA 4P3KA 1Z9BA 1T2UA 1UKAA 5GJBA 1Z74A 4LQDA 3HV0A 4HGNA 4B6GA 4GAEA 3RU3A 4PWYA 2CXOA 2Q3BA 4DCVA 3CCCA 2X5JO 4PC2A 3WIUA 4MQ6A 4MV8A 1NZDA 2ORVA 1UEJA 3H16A 4M0FA 4Y6SA 4KR0A 3LQKA 5GZ1A 3BL5A 3I83A 4II3A 4ETNA 2Z95A 4N9QA 2IBSA 1JAHA 3RUPA 1EX1A 1PS8A 1FDUA 4K1XA 1A50B 2C5EA 3JVEA 1BH6A 1P5JA 2B83A 2ZM6B 4XQCA 3JX9A 1TQHA 3N76A 4H7PA 4RK1A 2XYRA 2BMEA 4AJ1A 5ADWA 3ND8A 1UMCB 1ZD5A 3BIFA 3CINA 1KVUA 3F5FA 1E2NA 3EMKA 3CJTA 5FA5A 2PSSA 5BRNA 5JSZB 4OB7A 4PO9A 1Y33E 1XIVA 1HZZA 1M0TA 3D6MA 1PEKE 5HIIA 5K51A 1NYRA 1GNSA 4Q1DA 4MI6A 1TVKA 4AG6A 3RDPA 1CDDA 1MQAA 2YVLA 3FHJA 1ZUD1 4DY4A 2V0CA 4HZUA 1Z4MA 2BISA 2I2AA 2R6HA 3QLEA 4OYRA 2G4LA 4D8YA 1RLMA 4I4CA 5G0WA 3TKLA 1IUPA 3MD9A 1ZK3A 1NWCA 1J99A 4UNIA 1QHHB 1Z34A 2SNIE 2AZMA 3G13A 3T7EA 4LOIA 4WOPA 1BX1A 4GEKA 1C3VA 2BGTA 4F04A 3UFXB 1JW9B 5ES4B 5KWVA 5F5LA 1BW9A 3I92A 2QSJA 2WJ6A 2BMWA 4LRTB 4IG4A 2P90A 4D3FA 2C96A 4EPWA 5EEHA 2J87A 3QKRB 3QY0A 2TYSB 2OM6A 5AVTA 1VKOA 5IXSA 3LSTA 3WGNA 3KEOA 4GL4A 3R5SA 1U2GC 5LP1A 5CMLA 1SXHA 3CF4G 1SG0A 1XTPA 2C9MA 3D6FA 4G85A 1QFSA 2C2XA 4U9IS 4DSUA 2R6R1 5JPIA 3OIWA 3P7MA 2DYJA 2VHQA 3DAYA 3VI3B 2H0RA 3OT4A 3AG5A 1IAQA 3AYZB 2EQAA 2JZCA 3E27A 4BJ3A 3T34A 3HB4X 3IAXA 3VO1A 4NCBA 13PKA 1U7ZA 4FC7A 2VKQA 4WDRA 1SG6A 1W8DA 4FW9A 1OT5A 2HO5A 2JKVA 3DTVA 1ZH6A 2A14A 5IVIA 4R1NA 5TVKA 3ZWBA 2I29A 3UGJA 5ALNA 4GYWA 1P33A 4PZ0A 3MB8A 4QSMA 4AY2A 5KYYA 2J5QA 1FTQA 3OPYB 4RMIA 5H9UA 2X42A 2FZGA 2HBRA 3LOUA 2QTMA 2FMUA 5C4GB 1US8A 4BB0A 3U16A 1V8OA 2A1TR 3DZCA 2X22A 1LLUA 5B1YA 2PRIA 4DTCA 1X7YA 3IV7A 1L7PA 4UFOA 4E5SA 4J7XA 4X71A 3TNFA 1EXWA 4I1UA 4DR1C 4JVOA 4DSTA 3VYUB 3EH1A 1GY8A 4WKCA 4BVGA 1VE7A 5EXDA 3IKTA 1MOQA 3P26A 4L6CA 4J29A 4DJFC 3SI7A 2R25B 3ZWDA 1QK5A 4KUEA 1U3WA 2BI7A 2QY6A 4CG3A 4W5TA 3KSBC 1DIRA 2XBUA 2AE2A 1RP7A 2ODQA 3ESZA 3MJ4A 4A2WA 4DLUA 3BFKA 4M55A 3FROA 4QFBA 3WQSB 3E9DA 3CH7A 4R2KA 3HN2A 4UJ5A 5DHPA 3IQXA 2FFRA 2A78A 1E66A 2A8YA 2ZZMA 4GX0A 5TVGA 2X4IA 1J33A 2W6QA 4TX1A 4DDHA 3V4SA 1DQYA 2UVPB 3JQPA 3SZGA 3ZZ1A 1ZN8A 4K6OA 5SV2A 3U3JA 2XNSA 3F1KA 5CIWA 4URVR 2O7SA 4HS9A 1Y8CA 4GYYA 2HY7A 2I6GA 1K5DA 2W00A 3KAKA 3L49A 3SPXA 1EWTA 1TQ4A 3B6ZA 3TRDA 1F5NA 3MELA 2VP5A 3WB0A 2VJMA 1H2AS 3FZEA 2C9ZA 1X1BA 2M98A 3VR0A 4K6MA 1ZD4A 3HVHA 3SX2A 2GZRA 3FVTA 3VKGA 4MTNA 2PSHA 2PA0A 4RAQA 3PQCA 3C6KA 4LBZA 3WISA 5C5DA 2WTUA 1IM5A 2C3OA 2YJTD 3OZWA 4IL5A 1YB1A 3PC8C 3V1NA 1BAPA 2FX2A 2NZJA 1E3QA 1T8WA 1O94C 2FPSA 2GCGA 1ZJ6A 2HRZA 3PNSA 1RMQA 4QDKA 5JBIA 5JUWA 5KYUA 3TI9A 1LI4A 3VNAA 4RJKA 3GFOA 1E6KA 1ORHA 3IKVA 3KKEA 3AINA 1JGTA 4ABYA 4DV2B 1KPIA 4E3ZA 4PHTA 4BN4A 4WOCA 3ZGLA 2YRXA 2D1YA 5U4QA 1Y7TA 3CPSA 4H2DA 3EVDA 3NHAA 4JI5C 2FWMX 3D2LA 5GONA 1VLQA 3AGQA 2IX9A 5T64A 3ETEA 4G1FA 2O1WA 1LB1B 3PGJA 1HLPA 4DA0A 4EGJA 5EJ9A 1AGXA 5CHYA 2PX2A 2SKCA 1HOXA 2QRVA 3QWHA 1V48A 3VKWA 3SLGA 3TO5A 2WP8J 1E5TA 1X9GA 1VCHA 1WABA 3RJ5A 5IJ0B 1QFYA 2HLDA 3OEWA 1JEEA 2VVTA 4YUAA 5EKSA 1ZY2A 3ODGA 1CUWA 4R2WA 5HZKA 2R1TA 2EJVA 3W34A 1EK0A 3NJ8A 4C5BA 3BKWA 3FTNA 2ZJ2A 4KTTA 2QBYA 4DR6C 4TZ6A 3HWX1 1OXMA 2MINA 1GGJA 3BWYA 4W7IA 3PRHA 1WXHA 4RKWA 4JOQA 4FOTA 2O4CA 3ZDFA 4YN3A 1EFHA 5EFZA 3B9BA 3VOTA 4YP6A 5BT9A 4C0WA 3ZW8A 1MHPA 1DG3A 1P44A 2WNIA 2IW1A 3ZWMA 2WLTA 3TAXA 2R6DA 2ZXEA 2ONFA 1H2EA 4PZAA 4UDYX 3TR5A 5CB0A 1XRLA 4IQ4A 2O9JA 4C7KA 1B6GA 3A6EA 3LCRA 1N1EA 3WKBA 4ZEMA 3U7FB 3O91A 1E1YA 4PNEA 1FSFA 4NKRA 1USIA 2D1QA 1ZK1A 4GX1A 3RLFA 3DCYA 3PQ3A 3RC8A 2FP3A 1AIPA 2PIDA 2D7JA 4P5PA 1YFKA 1SPXA 3ED5A 3A4NA 4GLBA 4WIAA 3R7BA 4RIHA 4ISBA 3TZ6A 2Z3ZA 3VDNB 3JQ8A 2QN6A 1H5NA 1FRQA 3FWZA 5B7QA 2A0UA 2KW5A 4B7XA 3OCXA 1HL7A 2Z30A 3M6MD 3OAAD 4D9BA 2WV9A 1ECGA 3I45A 4W8GA 2IUUA 4C2UA 3H11A 1TI7A 3L8GA 3LPAA 3CJQA 1W48A 4RMGA 4DSAA 1C4OA 3ZGZA 4AU1A 1D9ZA 4Y0NA 1A0OA 4GBGA 5CLGA 4E5KA 2YICA 4GUDA 3T5BA 5JI2E 4I55F 1RXVA 9MHTA 2IYQA 3D2BA 4TLBA 1JR6A 1RNLA 3A05A 2J46A 1I4TD 4F7DA 1I3CA 1MJNA 3DA8A 2C7BA 1L4LA 3JWGA 3KTDA 4RCZA 3CW2A 5JSYA 3V3KA 5ABPA 4M2LA 4MV1A 2CSXA 4GQIA 1TKAA 3W2IA 1TD9A 2A1UA 2PX4A 3G1TA 3KYCB 5AXBA 1R6AA 1Y8AA 4MGZR 4HDRB 1KHTA 1NNI1 2QVLA 1YACA 3QW2A 5E4FA 3WWCA 1T1IA 4DIFA 1VFNA 1BA3A 1X80A 2IV3A 4YJ2F 3WV5A 3AT1A 1B4DA 4XAQA 5BMVB 3GB9A 2C0PA 5SY4A 3NGXA 2NQ8A 4EL0A 1GZ5A 1M72A 4ZXPA 3KO8A 2B21A 2WAOA 3EYAA 4CE6A 4E88A 5CFNA 3CVUA 4Q6BA 3ME5A 1QO7A 3Q8KA 1E1LA 2KBEA 2OFOA 3CVYA 1NNUA 4RM2A 3S70A 1U98A 5AE3A 2KQUA 3FYUC 4LRQA 2G6BA 1FCJA 2ZBUA 3HEAA 4M7RA 4QATA 4TUYF 2H2WA 4XGKA 4B75A 1QK4A 4YP5A 3TE7A 1LGYA 4TMYA 1VLJA 1Z6GA 2AG0A 2GTIA 3KJQA 3B38A 4FSDA 2XNDA 4KR9A 1OYOA 2Z9BA 5ELLA 4EUNA 4B7CA 4JKYA 3V9PA 3VSCA 3C15C 4UNRA 1MOZA 5DGXA 5C46F 5JWOA 1DCKA 1ESNA 2CYAA 4WZZA 3I73A 3IPCA 4IDOA 4NEQA 1CPYA 4AZ3B 2QQ5A 1BZYA 5ICGA 1TM1E 4FE7A 4K9NA 3AU8A 2R8XA 1J9EA 1TPYA 4KJZA 2Z2XA 1GPKA 2B34A 3FSGA 3EEQA 3IPXA 4QRIA 1UANA 1W9HA 2PBLA 5I7AA 3USCS 1PZHA 3FWKA 1TXGA 2NV0A 4BNMA 8MHTA 4HATA 5EIFA 1OASA 3Q5GA 2VDUE 2RC5A 2XW6A 4EGFA 1A5BB 1QH9A 4UOEA 3MJVA 2KX7A 3H5WA 1PWEA 3VJKA 4BFSA 3FTFA 3T9FA 2ERCA 3S5UA 1B0AA 1Y6GA 2CCGA 1GFZA 2Q99A 4HRYA 1H1LA 1AHIA 2A67A 1PDWA 3K6RA 1R8JA 1SKBA 2A84A 4RJLA 5B36A 5KQLA 1UK9A 5KOJA 1EDZA 3W90A 4RD2A 1FLDA 1K3UB 4LWQA 4BLUA 2OG2A 3EVTA 4WNIA 1W0JA 2IEBA 3IPLA 1WX1A 3KTOA 2YWEA 1IY8A 4OHWA 4LFCC 2D5LA 4FGJA 1E3TA 2J3QA 1LZLA 1WZEA 4AJPA 1CRLA 4RMJA 1T3LA 4DMCA 1P4EC 1M66A 3BQ9A 4M83A 4MKZA 2PN2A 3BIWA 4OHKA 4CV3A 3QVWA 4EB8A 1J24A 1V7ZA 1OI2A 1TCBA 2QLNA 4U6NA 3TYXA 5E6RA 1AXRA 4C2TA 5DCWA 1O8BA 5GVSA 1RQNA 5TS3A 2AMFA 4FNGA 4PZ9A 3KKZA 5G02A 1LTQA 3FOZA 2GCPA 3QEOA 4MA0A 2Y0CA 1UZLA 5E0OA 3JTEA 5JYCA 1U90A 2BSAA 2EVWX 1EUQA 4EFNA 4TVSA 3K5PA 5GP1A 1E5VA 2ZSIA 5K0ZA 1VKNA 3JVVA 4GOOD 4UAJA 2B8EA 3SJUA 3HABA 4ER3A 1SBQA 2GZ1A 5LPNA 1KSJA 1YQQA 2XTMA 3PVZA 1YZVA 4FBMA 1DI0A 3SQMA 4BU0A 1VJTA 2WKQA 2E6KA 3RB8A 4D8UA 1I2DA 3ELWA 3EGDA 1H5UA 4O4LA 2J0EA 3R5FA 5A4AA 2X1HA 4JI4C 3JYPA 4MTCA 3SXUA 3INRA 4YPVA 1I1NA 1IMJA 3M5PA 1BXRB 1SIWA 4HGOA 4TL9A 4UEWA 5CHEA 5M29A 3O4FA 4ZEOA 1ECBA 2OQVA 1ZH2A 3TDNA 3FYCA 2OXCA 4E1BA 2I62A 5JRJA 3EZ2A 3ORRA 2GAIA 2WD8A 4MPTA 4Z9XA 1AA6A 4DNPA 1DWQA 3Q15C 1CUXA 2AK3A 1HI9A 2ID7A 4V2IA 3UX3A 1WM1A 2HJRA 4TTSA 4ZO6A 5C31A 5BV1A 4W9MC 1TLTA 2IVZA 2FLKA 2HTEA 3VOAA 5A5FA 5JEDA 3E15A 1XHFA 4BRUA 2Z1NA 1NULA 4FYVA 4S1PA 1OBHA 2C3UA 1ULSA 2XGGA 2JGJA 3CO0S 4YASA 5AYVA 3UMMA 4X65B 8AT1A 1NR1A 4YAWA 3AR9A 2ORWA 5CDYA 4BWFB 4PS1A 1OIVA 4F4IA 3ZWYA 1O0BA 2XUPA 2VK4A 4K5QA 4OJYA 1PX0A 4MUNA 4INPA 1S9HA 4IIUA 1I9GA 1N6KA 1ZP6A 1ZMTA 4TT8A 5BSHA 5KVQA 4AN1A 2AUMA 3MW8A 1MXHA 3OKPA 3ZTTA 2C59A 1H8HA 5BXYA 3LCUA 3QMVA 4YJ2A 4X1KB 2O3JA 2VP9A 1FEZA 3L6EA 4UCXA 2JH3A 4QOFA 5I9LA 5KTSA 1OFGA 3SJZA 16PKA 4O8CA 1VCMA 3EGIA 4JB0A 2AEMA 4WNAA 1TC1A 4DCTA 1X8XA 2XB6A 3CT6A 4NMWA 1G16A 4WN9A 1T3TA 5IN5A 5LWQA 2FMFA 1UMDA 1MO5A 3QNUA 2Y05A 5EWJA 4YP7A 1KL7A 1HNWB 4C6TB 3ZTYA 1B6TA 3LZDA 2A5JA 1N8TA 1XMVA 1ZJ5A 2LPMA 3BJRA 3DBRA 1Q0ZA 3P0JA 3PLRA 4GRAA 3R23A 4RL6A 4EX6A 1QBKC 4YRPA 4J16C 4YRIA 5CUQA 1W36D 5LA6B 3ZW9A 4PYOA 5DLEA 4EPXA 4LZAA 1KERA 4EA7A 3UXHA 1X7WA 2JCYA 4K2AA 1GG9A 1T2FA 1W0CA 4L0QA 1C3OA 1SNYA 4M99A 4XRRA 3W78A 2WSSA 4NZPA 5AKZA 5HKAA 1AKRA 5HMMA 2BGGA 3WJ7A 4KGXA 3TFOA 2WFAA 1OTHA 3TPCA 2GDJA 2I03A 3UK1A 3GLRA 4KDEA 5DKFA 2IHKA 2JJ1A 2JLRA 5AHWA 1TCAA 5ALRA 2CL7X 4RA9A 4S2UA 5IYZF 4KKXB 2J30A 1LC0A 1EX7A 4UEJA 1NBEA 1CQJB 2HCTA 3G3EA 4Q3LA 3ZJTA 2JJYA 2QAGB 4JI0B 1X1QA 3VYRB 4EBFA 4RPKA 1QQBA 4FSXA 1PT9A 3D6UA 1O03A 3G9UA 5CB8A 3AWIA 2V7QA 2C03A 3PQ4A 4JB2A 5DT9A 3ZY2A 1P1HA 1XJWA 3BBLA 1PA4A 2QN1A 4XWOA 2AJCA 4BVLA 5IANA 1DAEA 1CDEA 3QNMA 5JVDF 2HT1A 2GOYA 1U2SA 4K03A 3GCGA 3HZHA 3IIMA 3VU3A 2IEAA 4GEGA 4B4UA 1S2NA 3OPMA 1LNSA 2CVZA 3B9QA 4BNFA 5U9CA 3SU8A 3VMFA 3MWEA 3EODA 1O6BA 3BMOA 1E3JA 1GSAA 3FHCB 3TVTA 3W5UA 4E30A 1YA6A 3F9IA 3RAJA 3ZIAD 3GRCA 1KOFA 2ZJ3A 2R7LA 4J3JA 2E1RA 2B7BA 3D3WB 5FV7A 2GEBA 2Z2KA 3OSZA 4IUYA 4YMSA 5LQAA 1FJHA 1YJBA 2QLFA 2ZJ0A 3QEBZ 5AKEA 3OFVA 3AZQA 1ECFA 3A32A 3N07A 3A11A 3UZ0A 4JBHA 2Q7DA 3RFVA 4W5NA 4WRRA 2IBTA 1HY3A 1J1ZA 1AC5A 2PX8A 1TQ6A 3EXEA 2XDAA 3FOWA 4IH9A 1R50A 3CLVA 2PWPA 1I5RA 3GWGA 2R4UA 2X6QA 1QDEA 1QWSA 4RVDA 3SK0A 4DABA 4F56A 1AZTA 3V4PB 5J43A 1SXGA 3E2PA 2CJPA 3QTBA 3G9TA 3IVCA 1UOPA 1GLVA 3Q7PA 5D3QA 3ZJUA 3UAOA 3OEEA 4OQNA 3O3CA 4RS3A 5K6RA 2VP6A 3IOCA 4YJDA 4I14A 5E9AA 1YR1A 4BV2A 1W4CA 2WYUA 3NX4A 3KM0A 4TQUS 1UJ4A 2O2YA 2P6NA 1OH5A 3PQ2A 1S8NA 1UT8A 1Z0ZA 4O5AA 3MQ2A 4YP0A 3SHWA 4BQSA 1YZ3A 3OI7A 3W05A 3QVKA 4YJKA 1G8FA 2Y71A 4F3KA 2BUBA 3LT2A 2OECA 4OLBA 2ZVPX 1RZRD 3OF5A 4FYKA 1SVKA 2GBFA 4HQFA 2N1BA 1K9VF 4L27A 1XL1A 2ZTVA 4BKPA 5HIAA 3TTTA 3R6WA 3TEFA 3WRXC 3GGDA 4PFQA 4E2XA 1RIIA 1DUVG 2WFLB 3EXFA 3N7AA 2PCJA 3JCZA 4IRUB 5CT5A 2FFQA 3VR3D 2F8SA 4X1YA 2CNOA 3QF7A 4LW8A 5F33A 1H3FA 1XALA 5GGYA 4CF6A 1T8YA 4B3SC 4NZNA 3DFFA 1PQYA 1I80A 1XLVA 3JWHA 4AM8A 1KE1A 2QP9X 3GCWA 1KEZA 3NH6A 3MUEA 1I8TA 2IP4A 2JK1A 1XRSB 2CJFA 2YIMA 3UHJA 4NJMB 1EHCA 2C9OA 1BXRA 1SBYA 1C1XA 4O2BF 1IN4A 2DYKA 3FVRA 4UBKA 3RKRA 4COKA 1UPUA 2WKRA 3WQQA 3F6EX 1X19A 5A3QA 2O2SA 3ASVA 4ROTA 3EBOA 1EXDA 5FULA 4XIGS 3UEOA 3LDGA 4FLEA 2JIPA 4X0EA 2YDYA 1JHQA 3MGGA 4MB6A 1Z4JA 4GH5A 4PLTA 4LZPA 3ZLVA 5H8WA 3TTVA 4YV1A 3HB0A 3E8XA 2HA0A 2J4DA 4BQIA 3NR2A 5CDUA 1NBAA 5FQOA 4D9CA 4G0OA 4ZVNA 1JWLA 1YL6A 1JPUA 3NH9A 1CD5A 5BP7A 5BNWA 1TLLA 4YO7A 3CLSD 3PDUA 1TM7E 1UBMS 3RUAA 3CPHA 1M6YA 4RGQA 2AIRA 3T1HC 3VKHA 4OLJA 5FUWA 1WDTA 4AN4A 4M9CA 1Y5LA 3WOHA 2AOTB 3I5MA 2GQ0A 4OD0A 1XWIA 5JD4A 4ZDJA 3SD7A 2RAPA 3KD2A 1D6JA 5EIAA 3A2NA 5JY1A 4TLAA 4ZJYA 4MR9B 3INGA 4AKTA 2GSDA 1Z5VA 3G2HA 3MTIA 5CJJA 1KS9A 4QXPA 1D7OA 4W82A 1NRIA 2OV8A 3TUIC 1XRAA 3FOEC 1P45A 2HW8A 4LY3A 1XAJA 3GF4A 3B2NA 2QRZA 4ESHA 1I10A 2CSUA 2NXCA 3DW3X 3EFOA 3F5QA 3JD2A 1Z5UA 1OJLA 3R09A 2X0JA 5AI4A 5DCYA 1EEHA 2IH5A 3PIDA 1AF7A 1KI1A 1XLTA 1ONSA 3C5CA 3IHWA 4YC7A 1UMDB 1ZOLA 1A8UA 2DSNA 3CF4A 4J6EA 3MTGA 4MO2A 3RC1A 4E51A 2B0CA 3SDSA 2F55A 2RKBA 2NT3A 3GFBA 1L7BA 2JIZD 1NJSA 2RJ3A 4GOND 3EVNA 2BJHA 3VU8A 2O1EA 1E9VA 1DXHA 3TFQA 1CIPA 3KSAC 2F8LA 2WHXA 2Z8YM 3WL7A 4PG5A 1QR2A 1AZLA 1OAOA 1SHJA 1U02A 2PX3A 3LBFA 3NJ4A 3D8UA 4IINA 5HKLA 1GTG1 1ENPA 2CBZA 3HRKA 4BX8A 1JZQA 4C0XA 2FUG6 2GK6A 3MLBA 1Z7EA 3E05A 3BJEA 1Z0AA 1X86B 5BN3A 6REQA 1U5CA 2MSEB 4KYVA 1U3VA 2IEZA 2NNLD 1UXGA 2ZZKA 5DNEA 5JPCA 3UB3A 3T5AA 3U1TA 4UMDA 1EAMA 5IF9A 4UOZA 2X5KO 1TZCA 4JROA 2GJ8A 5LU8A 4QU5A 4RCVA 3DLIA 3S8MA 4EO4A 2MR5A 4CMEC 3K6SB 4IG9A 4FLMA 2VHTA 4D42A 1WULS 3U62A 3V8RA 4BMPB 3FDXA 1JHMA 1UBSB 1I2AA 2BUAA 4HDMB 4PTLA 1FJ2A 5AKJA 1J39A 5TDHA 5B6IA 1QYVA 5J3JA 2QN3A 4D9EA 3QMPA 3R3VA 4V38A 4YJ3A 4HAZA 1L0BA 3WKCA 4RTQA 2PUGA 2CKDA 2Q2OA 4GXNA 4AF8A 3PFIA 3L8EA 2IKQA 3HY4A 4KSBA