4DCUA

Crystal structure of b. subtilis enga in complex with gdp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
432
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 134
structure length 400
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA01
2ASBA 2YOHA 3L8ZA 4ZPXA 2BJWA 1VYUA 2CCJA 2Z43A 2V1XA 3D8BA 4JSYA 4EDHA 5CIWA 3ONWA 2GZAA 3X1WA 3AGPA 4TL6A 1E0SA 2WWXA 2ZM5A 3RRZA 4TLEA 3GLFE 3W8NA 3TSWA 1KI8A 4KSCA 2CLCX 4GBMA 4ZKEA 2CE7A 1KI1A 4HDOB 4Z1MA 3W90A 1R7RA 1UBCA 2OPLB 4AYXA 2A5YB 2J87A 2RGEA 2YHSA 4Q9LA 1FX0A 3NBXX 4JI8C 1KZ7B 2F7SA 4L16A 1G19A 4U00A 2O0JA 1GL7A 3IIJA 5C1BA 3VHLB 1K5GA 2IXEA 2ZRIA 4H1VA 1TU3A 2VP2A 3GFTA 3LO5A 4B48A 1UKYA 1EGAA 4HLUA 4X8HA 3RDPA 3EASA 4DR2C 2F3TA 4PX9A 3NBZC 5JS7A 5IRCD 1NY6A 2HEIA 4DV6C 2GNOA 1E2QA 3ADCA 1PUIA 3Q5DA 3NVAA 4CEHB 3L8YA 4KCGA 3QSYA 2XGJA 1MKYA 5LB2A 4DBLC 1QZXA 4P33A 4GP7A 1T91A 1U81A 4Q9HA 4Q03A 3THXA 2GEDA 1KAGA 2GILA 2OESA 3AF6A 2XB4A 2CLSA 5AJYA 3BJIC 1ZNYA 2BCGY 4GKKC 2W6JD 4G5QA 4L15A 2V55B 4YMSA 2VH5R 4Y0AA 4JI7C 3CBQA 4ACBA 3ZZ0A 3EC2A 2WWHA 4RCYA 1NG1A 2F43B 2FZ4A 3B2EA 2XR1A 4O2LA 5EZ6B 4B35A 1CRPA 3CPHA 4UNNA 5EE3A 1MO4A 3T1YC 5BW8A 4MGKR 2WPDA 1FTSA 3EARA 3DPUA 1NLZA 1RRGA 2QNRA 4RFSA 1MRSA 2GEVA 821PA 4LBWA 2OT3B 3RVBA 3C41J 2VHCA 2D2FA 1W5TA 4M9QA 3X2SA 1E4VA 1NSFA 1RRFA 4EFMA 3AF5A 3SBEA 2V7QA 1TEXA 4BEJA 1FW6A 3IQXA 1CLUA 3THWA 2QL6A 3B1WA 1NRJB 2GRJA 2VRWA 5J4KA 4K46A 4PZYA 4DV1C 5LB4A 3TSZA 1MV5A 1D5CA 4P4UA 1ZW6A 1N6OA 1QHNA 3A37A 4I99A 4MUBA 1XMJA 3IBGA 4EIWA 3IIMA 1Q0UA 4V0LA 4QHYA 5CK5A 2FEOA 4IKEA 4JL5A 2OLJA 4A8JA 3B7GA 2FN4A 4NCJA 1YZGA 4JLAA 3U6KA 1OH5A 2GAAA 4Q00A 3RS4A 3H0KA 4NL4H 3FVQA 1G7RA 2JJ2D 3G82C 1WCV1 4PSAA 5E95A 4ASUD 1Q12A 3M1IA 2HUPA 4HAZA 1TTTA 2I4IA 3R9WA 2RGCA 1Z22A 4V03A 2PZFA 4LYAA 3AGQA 1U94A 4P0TA 3O8CA 4K0KC 1U9IA 4FMDF 2HCBA 2ZRCA 3CRVA 1LFDB 2ZYTX 2REXB 5EE0A 5EP2A 3VR2A 1N5KA 5GADl 3CNLA 1DAEA 1J8YF 1RIFA 2QY9A 3M4YA 3C14C 3B1YA 1J7KA 1G3QA 2BM1A 3QI2A 5FR1A 4DUYC 1UJ2A 1JEEA 3CR8A 5CYPA 5AJVB 2VBCA 2PZEA 4NCKA 2ERYA 4JJZA 1DOAA 3NDPA 5FUWA 1Z28A 3TIFA 2VLIA 4LHYA 2J0QA 1S8FA 2GVDC 3K09A 4BLQA 3W6PA 2XJ4A 3BIFA 2WICA 3B9QA 5GJWC 3OIWA 4JVMA 1JAHA 3LY5A 3WBKA 5KHOC 2AKYA 1TADA 2ZITA 3B1ZA 5K8UA 1ZM4A 1ZNWA 2PT7G 5DE3A 4DV7C 3OAAA 3RS3A 3QEJA 1E69A 2QAJA 1T5IA 3IQWA 2JLZA 2ZR7A 1KK3A 2PMKA 4HZUB 2UU9C 1XEFA 3AVQA 1SVKA 1WBDA 2ZANA 4NOZA 5JMTA 2WJIA 3AB3A 2W2XA 5CITA 1YR7A 4TYPA 2NOAA 2P2LA 1SXJD 2ZRLA 4DWJA 4DLVA 1AS2A 2FSHA 1VHTA 1WH9A 1VIAA 2MMGA 2QT0A 3PQCA 5KYKA 4AQYC 3IPYA 1IJFA 1D9ZA 1RYFA 2CNWD 3TVDA 3VX3A 3THYB 1Q21A 2EYQA 3FDIA 2WVJA 1Z6GA 4HB3A 4NYJR 2RMKA 1JJ7A 5FI0B 1KHTA 3I61A 4CDGA 2ZRAA 4OK5A 1RVDA 2V3CC 2KBEA 1G4AE 3BORA 3QBVA 2A2ZA 1WA5A 1JEDA 1L8QA 4US1R 2QRNA 4QBFA 5P21A 4RCZA 1CBUA 1E2KA 4Q5IA 1G21E 3T1TA 4D4MA 4B33A 1OHHA 4IOLA 1TF5A 2CMKA 2ZRMA 3SHWA 3CZPA 1IBLC 3L0OA 2H1LA 3ZYCA 3Q85A 1EFHA 3CH4B 2KJQA 1KKMA 2AFIE 1OJLA 3CH5A 2VO1A 3VFDA 3FOZA 2OO7A 1USPB 4LOAA 4B73A 1E99A 2OZEA 3DHWC 2WSMA 3LLMA 3I1FA 2XX3A 4DVGA 2ZS9A 3FHOA 3QF4A 4RKEA 4ABYA 4B44A 3KUCA 2YWHA 1JNYA 1G6HA 4XIGS 4FD2A 2QBYB 2XXAB 4LV8B 2L0XA 3SNHA 4IRUB 2OFWA 2A5DA 2ZI9A 5AWFC 2BMFA 5F98A 1F3OA 4XTCS 1P62B 5F2EA 1HQYE 1LTQA 1JJVA 2OBLA 3WMEA 2W2TA 5LMNC 2GTPA 1IBKC 1IAQA 4I81A 3GJ3A 3UWOA 1AS3A 3H2YA 2NTYC 3I4LA 3KFXA 3O47A 3P20A 2BOVA 2CDNA 3BBPA 5CYOA 2BHRA 2FEMA 2YOGA 2GVZC 2O0KA 2KZFA 1HE1C 4Z8XA 2QI9C 2QTHA 1Z06A 4HEJA 4HB2A 4D80A 1ZNZA 1NY5A 3VHXA 2GCOA 2FJUA 4Q1DA 1NJFA 3B1VA 3TQFA 1P9WA 1ZU5A 3BFVA 4OQNA 3UKDA 1ONBA 3ZD6A 1O3YA 3GLHA 2ZJ2A 5AK0A 4TSFD 2QPTA 1TF7A 3U3OA 3HJNA 1PV4A 1FFHA 3REFA 4R98A 2FGJA 4W5WA 1TNDA 1XDBA 4BZXA 3KXIA 3BB1A 5FLXD 4KAXA 2D7VA 5GJCA 4RZXA 4QNRA 3MCAA 4IJMA 4V0KA 1NKTA 1SHZA 1PZNA 3IUYA 4TLCA 1KI6A 4DCUA 1OKKA 2RGGA 1KMHB 5EXTA 1KSFX 3UANA 1I4LD 2ERXA 3AF3A 1OIXA 3FPAA 3LBHA 4HLQB 4HAVA 4RD4A 3BE4A 3NEYA 2BMEA 3HU2A 5KNCA 4ZI3A 2FV8A 4C7OB 4DV0C 2ZS8A 4BFSA 4F4CA 1ZJ6A 4ESHA 4BSZA 3MMPA 2OE2A 2PLRA 4LHVA 4PXAA 2YVUA 3T61A 1FP6A 4GL2A 2QQEA 5G40A 2R8RA 2CL7X 1XMIA 5FI1B 3WXMA 5HZHA 4G5OA 2BC9A 4D26A 1HURA 4OQXA 5HPYB 1J70A 5ANRB 2ZRKA 4FWTA 4LYHA 1G7SA 4A92A 1WE2A 1D6JA 2IYZA 2ZRDA 4TZ0A 2HYDA 3WBJA 3PIRA 2OPLA 1AKEA 1NIPA 3M6AA 2BBTA 1OXTA 3DVLA 1JBKA 3ZH9B 4OHVA 4LY6A 4DV2C 4LJAA 2QAGB 1NI3A 3KQLA 2D62A 2EFEB 2YYZA 5BN5A 1KO8A 1XXHB 2VQSA 1JR6A 3GD7A 2XITA 3GLHE 3TUZC 1CEEA 3VAAA 1N6IA 3HWSA 3O8DA 4JI2C 2ZRHA 1OIWA 1KJWA 5TY0A 4XH9B 4J0QA 1S3SA 2IBMA 3AVUA 4C3ZA 4JIMA 4EQ6B 3NXSA 4CEHA 3U3MA 1JPNA 3U44B 1XPRA 5FH9A 2UUCC 1LY1A 3G5UA 2JJ8A 2ZM6C 4DV3C 4FMDB 3RAPR 1P4SA 4PAQA 4NMMA 2DYJA 1YZQA 2P0EA 5FOTA 1XU4A 4A2WA 5JEDA 3GEHA 1MR3F 1CS4C 1S4QA 3LXRA 3SU8A 3LX5A 1W0KD 1X6VA 1Q22A 2AX4A 1GZSA 3QF7A 2RGAA 3Q5EA 4HAXA 4LUCA 4US0R 4DUGD 2REOA 1WP9A 2BIFA 2IYQA 3T1VA 2F43A 3ZIAA 4DLRA 3FB4A 3U7EB 3AKCA 4GZLA 3A1SA 3R20A 1X8JA 1KI4A 5J4LA 3A4NA 2IX3A 1VCMA 2V8OA 3QE0A 1V43A 2GK6A 1YQTA 2J41A 5LD2C 4B3DA 1N6NA 1VCIA 4QFMA 4CF7A 1ZUIA 5FPTA 2CCGA 1QHYA 4WBSA 3K0FB 4W9MC 4LHZA 3GLGB 3QXSA 5GVRA 1K5DA 1WQ1R 2WM9B 1TPZA 1G3UA 3CX8A 4BLOA 1U9IC 1PVOA 2D74A 4LI0A 1H8EA 1M74A 3HPQA 3FHTA 1E1RD 1C1YA 4PO9A 5DSZA 5FTJA 4D6PA 1JXOA 5FR2A 5KNBA 2G6BA 4MKFA 3QOFA 4FN5A 4YDHB 721PA 2DBYA 1W4AA 3AP3A 4MQBA 4DV5C 1OB2A 4JI1C 4NP6A 3TBKA 3U3RA 1WB9A 3KX2A 1SXJB 1ZP6A 1W47A 4XVQA 2D4HA 4IOJA 5CIQA 3TNFA 1YHNA 2IXGA 4F4JA 3SI7A 1W5SA 2CXXA 2G88A 4MRRA 3WP1B 2OAQ1 4U7DA 3GJ8A 1OLOA 4KU4A 2XJ9A 3ICEA 1T5LA 2PEZA 1Z0KA 1LF0A 1HTWA 2QPOA 1ZM2A 3A4MA 4LX0A 4R7ZA 4ZDIA 3FKSA 4MKIA 1GKYA 2IWHA 1XTJA 4ZDJA 3AVTA 1T3LA 2E1RA 4QJ4A 3K9GA 2OBMA 1KNXA 2XSZA 3ZVMA 1C4OA 4QGAA 4FCWA 1QWIA 1G8YA 5B30A 2ATVA 2VEDA 4LBYA 3E1SA 5TARA 1IXZA 5K8IA 4QM7A 1OH8A 5GVSA 4UNPA 2NG1A 5J47A 4KFTA 2V9PA 1NMYA 3QVVA 4A0GA 4XWKA 4IVQA 3OEED 2WZQA 3WHLA 2O8BB 1XTRA 4LHWA 3NDBB 1T6NA 4B3GA 3U2QA 4D0LB 8OHMA 3ND9A 2QL8A 4PZZA 1OH6A 4C0QC 3PEYA 3KJIA 2QPAA 2DFNA 4LJ9A 1P75A 4PC7A 3C8UA 1E2HA 4LJ8A 1YRBA 1M2OB 2PBRA 5EQTA 4B32A 1GTVA 3AVWA 5AUNB 1TUIA 4MH4A 2G3YA 4KV9A 1A2BA 1Z0FA 2MSEB 2XNDA 4A9AA 1KJZA 1P2UA 4HZUA 1N25A 1TQ2A 3NG1A 5JEEA 1P61B 2QE7A 3L0IB 1EG7A 3VR4A 3BB4A 1YZKA 4JL8A 2AFHE 4HAWA 3SFZA 2HLDD 1FUUA 4DV4C 5L3QB 1DAKA 1I4DD 5FOUA 2J7PA 1ETUA 3NWJA 5AJWA 3T35A 4A36A 1KYIA 2GZDA 1G20E 4GNKA 4QHSA 2QSYA 4Q1EA 2VIIA 2NGRA 2WIBA 3OEHA 2WKQA 5BXQC 3THYA 2ODWA 2V1UA 1GWNA 1ZRHA 4A2PA 1L4YA 2I1VB 4E03A 1JR3D 3HYRA 1F2TB 2WJVA 4ZCIA 1F5NA 3VX4A 2JLYA 2GBLC 2QMUA 1S1CA 5KSPA 4M0LA 2F3RA 4AKEA 4NCHA 2AK3A 3T1OA 2VQEC 4NYMQ 2NIPA 2Z5FA 3VU9B 1HUQA 3CB4A 3EZ2A 4TQUS 3PENA 3NHAA 1E9EA 1ML8A 2AWNA 2D06A 3A58B 3FMFA 4GMXA 5B57C 4N1AA 4ON9A 1HEIA 2P5TB 4DLYA 2E7GA 1HA3A 2ZAOA 4B2LA 1KZGB 4WXRA 4PC2A 5FL7D 2ZR0A 4JLVA 5KSOA 1USPA 4LFAC 1VG0B 2J0UB 2QGZA 2HJVA 3KKOA 4C0JA 3WYFA 4KLNA 4HATA 3IHWA 4N3NA 1J99A 1SVIA 1ZD8A 5IDVA 2J46A 3LRPA 1ZM3A 2Q3MA 5CJPA 2QBYA 4DCNA 2XXAA 5KSYA 5EP4A 3EPJA 3OFNA 2Z0MA 2C95A 3NTUA 3QKSB 5DHAA 4TMXA 3IILA 1KJYA 1MO5A 3GQBA 1QRAA 4P32A 1E32A 5AR1A 4AURA 3R7WB 1G41A 1U0LA 4LJ5A 1KMQA 2B21A 4JVNA 5JJKA 4YQFA 3U7HB 2C9YA 5E7MA 2XAUA 2GEUA 3V9PA 3CNOA 2V6IA 1NBMD 1I94C 2R44A 3TLXA 1ZCAA 2FG5A 3AP1A 3MSXA 2QMOA 5IHPA 2BWJA 4XWAA 4F7WA 1G64A 2WAXA 2YWGA 2ZAMA 1SZPA 1XB2A 4BWYA 4Q02A 3NBYC 1W7AA 3TJZA 1Q3TA 4DLUA 4YXWA 2KBFA 1XFAA 4NCIA 5JI3E 4JV5C 1OFTA 2J7KA 2OSBA 1Z47A 5J4HA 3CLVA 2ZE8A 4KHZA 3VR5A 1N5LA 4M9SA 2EU8A 3UATA 1II9A 4A82A 4PO1A 4D25A 4DR6C 3ND8A 5IWAC 1KMHA 1MH1A 1D2MA 4B3FX 1Z29A 3KZ1E 3LLUA 4G1UC 4TLBA 3ZGXA 2OM2A 4DT1A 4TYNA 2R9VA 4M4SA 3QG5A 2GF9A 4MDFA 3B1XA 1WDTA 4FIDA 5FOXA 1NJGA 5C46F 1Z8FA 5HCIA 4C7OA 3CO5A 1WMSA 4BFYA 2EFHB 2KWIA 4KI0A 2ZI6A 1G8GA 2PZGA 4KVGA 1E98A 4AY2A 2HF9A 2X77A 3MRSA 1NNEA 5FUYA 3NH9A 2FOLA 4TLDA 3CM0A 3C7KA 1P2TA 4ZV4A 1Q20A 2Z6VA 3C5CA 3CIOA 4OQLA 1OFUX 2PL3A 1W4BA 1RC8A 3U60B 1PLLA 3JVUA 1EK0A 2K5UA 2QM8A 4HYYA 1C9KA 2YV5A 2R6CA 1AA9A 1LF5A 4EJSB 3RYTC 1Z6YA 2X2EA 1ESMA 3EAQA 4GSYA 1G291 2QAGA 4U5XA 1XEXB 1Z6XA 4UNQA 3THOA 1DAMA 3QXXA 1XXHA 1R8QA 3JZAA 2Z4SA 1J8MF 2DFLA 2Q9AA 2QMEA 4UJ5A 3AF0A 2X19A 4WXPA 5LPNA 2F1RA 1G1MA 2EFGA 3NC1C 3EZ7A 3PV0A 4DLTA 2JLVA 4S35A 3I62A 5FBQB 1OXXK 2CHQA 3AKDA 5HKKA 4EQ6A 3B78A 1AQUA 2LKCA 3HU3A 3QQ5A 1QVRA 3U44A 4B47A 2O8DB 4B34A 1RKBA 2JAQA 5A2QD 2YWFA 3CF2A 3N5CA 2RB4A 4ARZB 4WVFA 2ECKA 5B58C 4BFXA 4I4LA 3EA5A 4DCTA 4PPQA 2QRZA 3D7MA 4MGZR 5H70A 1VYTA 2P6UA 3X1DA 4EFNA 1BMFD 5G53C 1CJTC 4IOMA 3K9LA 4TYYA 3C5HA 1OW3B 3AF2A 4DEXA 4DJTA 4DR4C 4I1OA 4KFUA 2DFTA 5JWRA 3ZDQA 2D3WA 3W5IA 4HDQB 5D3QA 3FGNA 2FFBA 2GXUA 3GLIB 4MYUA 1YZLA 2AD5A 4ZCMA 4Q9JA 2IYUA 1W46A 3H1TA 2CHGA 4JKYA 5CLQA 1ZMXA 2JJ1D 2JCSA 2DY1A 3PG5A 4P4TA 4U02A 1UAAA 5L3VA 3HP1A 4PQRA 3K0FA 4YDSA 4Q1BA 3GLGA 2B7CA 2C2HA 1NVVQ 5TB5A 1CIPA 4NCNA 5KTYA 2JLQA 1I4TD 1SVWA 1XCMA 4LF7C 1NIJA 4X66C 2AD1A 4WA7A 5G3YA 5JI2E 1COWA 2IYXA 3VR1A 4AYTA 1UDXA 4B3CA 1DG3A 4AKGA 4OHZA 2FE4A 4LBZA 2A78A 2IYVA 3KUDA 3VKWA 2ZU6A 4TL9A 5DHFA 4DDUA 3GJ0A 1NSTA 5FOSA 2A7QA 1G16A 4M9XA 2PCJA 1E0KA 3PEVA 2GESA 4LHXA 4JT4A 1XXHE 3AVYA 5FBLB 4TMVA 1Z2CA 1ZBDA 2BKUA 2WWGA 1HT2E 1XTKA 2DWPA 2RH5A 4FMBB 1R5OA 2CNWA 1XPUA 3TAUA 2X2FA 4JS0A 4HUTA 2YCBA 1W0JA 2FFAA 4W5HA 5KU1A 3WP0A 2VP6A 4M53A 4M22A 1MABB 5C4GB 3SYNA 1VG1A 2XOKA 3BH6A 4DRZA 1SULA 1T4GA 4AIIA 1KO1A 1XCPA 4B3MC 1DAGA 1AS0A 1RYHA 4TMKA 1XTIA 1GAJA 2QP9X 2QP3A 1U8ZA 4G5GA 1N5IA 1KI3A 1W4RA 4X65C 1IQPA 2G1KA 4KODA 2OEPA 3B9PA 3LVRE 3TAHA 1D2NA 1MRNA 4LGMA 1IN5A 1XMSA 2ZRPA 2W83A 4EPWA 1XCGB 4ERNA 4Q01A 2ANBA 3UMFA 2F6RA 3KKNA 2O8BA 3AEZA 5FBRB 2HF8A 4LFCC 2J45A 1N2FA 1KIMA 4PPFA 1BOFA 3A1TA 3HR7A 4A2QA 1G8HA 4PC6A 3UIEA 2QGNA 1MOZA 2FPLA 1II0A 2DCUA 1AKYA 2GXSA 3GLGE 4RY2A 4Z1MD 4QBGB 2B8TA 4CRWB 2OCAA 2IL1A 2N1BA 2ZI7A 3JZMA 4KBFA 1XRJA 1OFHA 1NMXA 1GITA 3BD9A 2GJAA 4D0NA 3EIQA 5HCNA 3P4XA 3RSOA 5L3QA 2ZUDA 1UEJA 2P65A 2JDID 5EE1A 2F1IA 1W36C 3CNNA 2R6AA 2A5GA 3BH0A 4JLMA 1UBEA 4MA4A 2A3RA 1E9DA 1R2QA 1GFIA 4JYCA 1T8UA 1VYVA 2IYSA 4KXFB 4JLOA 1OXSC 1HNZC 4JI5C 2IYWA 3U5ZB 2C04A 3EPHA 1DE0A 2X1VA 4CYMA 1F2TA 2HXYA 2WKRA 4YC7A 2P6NA 2RGXA 3B5JA 3SE0A 2OAP1 4TSFA 1ZAKA 2BBOA 5IT5A 3HDTA 2DWOA 3MWLA 2EFCB 2REBA 2Q3HA 2W00A 1OSNA 3Q9LA 1XF9A 3RS5A 3VU9A 3W3ZB 1XD2B 2XTMA 3QXCA 3ZVNA 4I1VA 2IUUA 2GETA 1ZIPA 1U0JA 4DCSA 4AC9A 2IS1A 1EFTA 1G5TA 3VNUA 3ZS8A 4B74A 1OXVA 2GWHA 4ILEA 1RJ9A 2C77A 3R8CA 1M7BA 1FZQA 2J0UA 1TQ4A 2ZVQX 1GRNA 2JGNA 2EQBA 5KDLA 4A6PA 3EG5A 3P1JA 4G01B 4EAQA 4B76A 3FFAA 2QU8A 1YR6A 4GRAA 3EPLA 2CK3A 3ADBA 4Q4HB 3ZVLA 1ZD9A 2V7QD 4EFLA 4KYUA 3KQKA 4TZ6A 5HE9A 1KI2A 2ONKA 4OX9C 2AL7A 2PMDA 4NYIQ 3NBFA 3LDAA 3QKRB 2YOFA 1Z83A 3R7WA 4PHTA 1F2UB 3I5XA 3WNCA 4XSGA 4K81B 5JCPA 4B3SC 3IEVA 5ELXA 1N0UA 4PSVA 4PPNA 3OTOC 1OIVA 3QKTA 1T3HA 3S1AB 5A4JA 2EGTA 3ADKA 4LDJA 4LRWA 5GJVC 4GKJC 3VQTA 4DKXA 3AUXA 5GJBA 5JHHB 3K8YA 1SHKA 2C78A 1PLKA 1ZC4A 4IHQA 4XD7A 2NO7A 1G8FA 4BLTA 1UM8A 4MKHA 4DSOA 4HLDA 4Q1AA 3J80D 1E0AA 2DFKB 221PA 2QQ0A 2O8EA 4JI4C 3EA0A 2D2EA 4PQYA 4LCBA 5IK2D 2F9LA 3IO3A 4TN1A 4TQAA 2YZ2A 1N33C 1X86B 1CRQA 2IYYA 3EW9A 3FMPB 2OFOA 1E2LA 2YNMA 3I92A 5IT9D 3T06B 5JWOA 1Z2AA 4QG7A 4RD2A 2P5SA 3IEUA 2GAOA 4KJZA 2R6FA 4OHYA 4OI4A 3OE7A 1WF3A 1GL6A 3VR6A 2XB2A 1DAFA 1DO0A 3AKYA 4BZQA 1W0KA 3BGWA 4JI3C 5EXPA 5SZHB 2PJZA 2QENA 4KFRA 4BLRA 3TRFA 4AKHA 1YZTA 4DUGA 1AM4D 4L9SA 3JVVA 3UXMA 4R71A 1YR8A 4LZZA 3OAAD 4NONA 4RZUA 2ONFA 4LC0A 1KK1A 5EXSA 4ESVA 2ZROA 2BEKA 4FXPA 3KQHA 1KK2A 4DLSA 3GLFB 1NMZA 2NPFA 1VECA 2MSCB 4UXJA 2J9RA 4V0OA 3OESA 1MT0A 4TT3A 3CWZA 4TYQA 3SHFA 2ODBA 1UADA 2O5VA 3QPWA 4HLUC 1P9RA 2Q9CA 3N2EA 3AVOA 3U7GA 1CJMA 3BERA 2IUSA 4OJQA 3TW8B 4N0DA 1Q1ZA 1KKGA 3AV0B 3SS8A 2UXBC 1VCOA 3W6OA 4FW9A 1HH2P 4JVLA 4ACAA 2ZSFA 1DARA 4PPGA 4CT5A 4LJ4A 4V0NA 5FPYA 1Q1BA 1P6XA 2FWRA 1AQYA 1DEKA 2O8DA 2O52A 1BIFA 2RGNA 1YJ5A 2BCJQ 1EX6A 3KXKA 5DN6A 4F38A 4RD1A 1E1QA 5FPKA 3CPEA 3DKVA 2PN2A 2PLFA 4Q4JB 2PT7A 3CRQA 2ZXUA 1M34E 4YMWA 4LPSA 3U6BA 3CPJB 3QXJA 2IA5A 3EIEA 4TTPA 1KSJA 2Z83A 4JBWA 1N0WA 1UF9A 1DAIA 2FSIA 1KKLA 4G5SA 1TMKA 621PA 1XMQC 2EVWX 1CJUC 1BO6A 1OV4A 4QRHA 3GLIA 1R0ZA 3TR5A 2P3SA 3DZDA 4KSBA 2JIZA 2IW3A 4PC3A 1E9SA 3OEEA 4D82A 4UNRA 6Q21A 3CF6R 3L82B 2HCJB 1FOEB 3B82A 4KBGA 4E22A 1CTQA 4QBHA 2ZIAA 3KJGA 1SVMA 4Q66C 3QVUA 3T5DA 4M2LA 3LQQA 4ITRC 4BFWA 1DPFA 2FGKA 1FQJA 1OT3A 3JAMD 4IDHA 3CRW1 4N0EA 4LFBC 4UKDA 3B13B 4TMWA 4A8JC 3IDQA 4HAUA 4Q18A 4GP6A 2OXCA 3CWQA 5JECA 4C0KA 2JLSA 2PT5A 4NYMR 5KSZA 3ZS9A 3KQNA 2UUBC 4G3XA 3UG7A 3A4LA 2IYTA 2Q6TA 1W48A 2HLDA 2XTZA 3CX7A 3ECCA 2YINC 1SVLA 4UQOA 4FWIB 4XSHA 3K70B 1IBMC 3LXXA 3W3AA 4JYBA 3U3JA 4TTRA 1BYIA 4B3RC 2GCPA 2VPPA 3TKLA 4BFVA 4ZIRB 4IDQA 2J0SA 3DMNA 2FFHA 4OI1A 4WZ6A 1R10A 2ZJ5A 3A36A 1Z5ZA 4CT4B 3RANA 1MABA 2H92A 3GJXC 1E6CA 1NYEA 4URXR 1K6MA 3PUVA 2CL6X 4DEYA 4JYAC 2H57A 2HT6A 4CW7A 2FX3A 5HR5A 4PQFA 2QA5A 4YMUA 1SQ5A 3ASYA 3K09C 3W8RA 5FUVA 1FMJA 5BR8C 1TEVA 2GZHA 1W1WA 2ZRFA 3DZ8A 3RS7A 1R0YA 2LWIA 1GRRA 5CDFA 2IS2A 3GLIE 5FL7A 3AVXA 3OHMA 3KTAB 3MJRA 2WJYA 4ZCLA 2VSOA 1G3MA 3CKLA 2DB3A 2OBNA 1US8B 4RFSB 5DI9A 3V4FA 5AUPB 4F91B 2EW1A 1CULC 2ZRNA 4LBVA 1AGPA 2Q0HA 3H84A 4YY3C 1IXRC 3L2OB 3DKPA 4NHOA 4OKSA 1OFIA 1L4UA 2IWRA 2ORVA 3MWYW 1L2FA 1X8LA 3EPKA 1N2CE 1GNPA 3CF0A 4IW3B 4PFSA 4BASA 1ZC3A 4XJXA 1KY3A 3BH7A 2OFXA 1E79A 2KE5A 2UZIR 1G9XA 3I07A 2VA8A 4BE7B 4RD3A 4Q19A 4Q7KA 2A30A 2FNAA 4C0HA 4A1FA 5BWMA 1E2JA 3QG1A 4XVRA 2FDCA 1X1SA 1ZB9A 4GT1A 4Q1FA 1QHXA 1TAGA 1XTSA 4S2EA 3T5GA 5DISB 4QJ3A 1E96A 3NIBA 4UXHA 3BOSA 3SQWA 1UFQA 2C9OA 2VF7A 4G5RA 1ZUNB 2ZREA 4MKGA 2CCKA 4BZPA 3SJCA 4F4IA 3SJAA 5JSZB 2BV3A 5BYKA 5L3SB 3PJRA 5JZVA 2ATWA 2Q21A 2GJ8A 3AUYA 4Q7MB 4LJ7A 4IOKA 4PR0A 1XMVA 1J90A 2MMCA 1E4YA 3WRXC 4BRUA 2O8FB 3RABA 3QXHA 1SVSA 2B8WA 3NC0C 1ZM7A 4NH0A 1XNQC 2C96A 4C0AC 2JLXA 3P26A 1F6BA 5CB8A 1U8AA 5CDFE 3T34A 4G0NA 5FBVB 4DSNA 2CLDX 3AF1A 2DR3A 4MGYR 2OHFA 4Q4AB 2XTNA 3T12A 1NF3A 5EUQB 1E2IA 3BAFA 3TUIC 1CXZA 1P73A 4Q4HA 4A6XA 4D81A 4DIEA 3KKPA 2AWOA 4FI3C 1SKQA 4LYFA 2CE2X 5HE8A 3QKRA 3GPLA 1H8ED 5F3WB 4BECA 4FINA 4NKRA 1F2UA 3HU1A 2XZPA 4IXNA 2IHBA 5EXXA 1GKUB 2AXPA 5FPHA 3PUWA 1JQLB 5TVKA 3ZZUA 1D8TA 4L4UA 2J0VA 3SQXA 2H7VA 1XMOC 3I8SA 1XJ0A 4D4KA 1KSHA 4AG6A 4LPKA 1P2VA 3WY9A 2QP4A 1NKSA 2W6IA 2R6DA 1XTQA 2BBWA 1M7GA 1QHGA 4DDTA 1Z63A 3UG6A 2ORIA 1JB1A 3LNCA 5IF9A 2LKDA 1KGDA 1G18A 3BFXA 1ZUHA 3ZQ6A 4MRPA 3VNVA 4E07A 1VIYA 4CEJB 2WKPA 4RFVA 3U4QB 2WJGA 1UKVY 4QKQA 3FKSD 3NH6A 1CP2A 2RGBA 5CB6A 2IEZA 3K0CA 4YLGA 1DG1G 3KQUA 4EPTA 4MYHA 4ZDWA 5EUMA 2XSZD 1KO7A 5C4MA 1ZVQA 3WMGA 1OE0A 1QF9A 2QORA 1FUKA 4OHWA 4MRNA 2G9NA 5FBWB 3BWDD 3GMTA 3VKGA 2NO0A 3L0PA 1NVVR 1EFUA 521PA 2QROA 1ZU4A 1YKSA 2W58A 1XD8A 4BQSA 1VLAA 1TX4B 1N6PA 3AH8A 1KDTA 2QTFA 1IHUA 1RPZA 3DEFA 1TQ6A 4LF5C 2ZU0C 1JAIA 3DDCA 4IDNA 5J4YA 2O8CB 4NXMC 2ZI4A 3GJ4A 5CJ2A 2ZJZA 2ZYWX 1UEIA 1T8TA 3FMOB 3N2IA 4JSTA 2QEQA 3OIUA 4AD8A 4B3XA 2WV9A 1N32C 1HQCA 2NZJA 2XNDD 3EZ9A 1DBSA 3O8BA 4C2UA 1Z6AA 5JJLA 2H17A 2QE7D 1GVNB 2VP9A 4PTLA 1S9HA 5AJZA 2WSSD 3SR0A 3V4RA 4Z54A 1M8PA 3GLFA 2W6JA 1S2MA 4JLBA 2RGNC 1G5PA 1IY2A 4HZIA 4WOPA 2J7PD 3NEJA 3WMFA 1GP2A 3ADDA 2IHYA 2ZI3A 1H8HD 1KOFA 1NLYA 2ZRBA 4RVCA 2GHIA 3SJBA 3OEHD 3X1ZA 4YMVA 5KPDA 1RRCA 2ZJ8A 2ODEA 4JI6C 1QG2A 2YC4C 2GDJA 1UKKA 4B6FA 2PJRA 3TE6A 1U99A 4KHPC 4Q9IA 2ZQ5A 1HNXC 4US2R 4RZ3A 2RKOA 1R5BA 3LBIA 4JLJA 4BFZA 2EWVA 3RS2A 3ZLJA 3F0TA 1GNRA 1KTVA 1PUJA 2KB0A 5H8WA 1P7CA 4WZBE 1PJRA 3K70D 5KO2A 4URZR 2GKSA 3LW8A 3FTQA 4JLPA 4CIDA 5DIFA 2SHKA 1XWIA 5AUOB 2WOJA 1P5ZB 2OCBA 2ZVPX 2IXFA 5DI3B 3L43A 2WTUA 3Q3JB 3DOFA 1M7HA 2ANCA 1U8YA 2BBSA 1EFRD 2ZUCA 4I1SA 1W36D 2CHVA 4YONB 4C0SA 4M9ZA 2BDTA 5JRZA 5LMUC 4URUR 2A5FA 4E5UA 2G0NA 3NHBA 1E94E 3K0AB 2ZE5A 1XZQA 2F55A 3TH5A 4ZKDA 1S3GA 2XZLA 2OUKA 1Q57A 1Y3AA 3EIHA 2JJ2A 4ASUA 4DB4A 3IBYA 2N46A 4C30A 2KSQA 2ONJA 4DB2A 4Q1CA 1EWRA 4DLWA 5E7JA 1YZUA 2CVFA 1JI0A 5TXGA 3MGCA 2BM0A 1NG9A 1WBBA 3SJZA 3ZZTA 3LWNA 4GPTA 3VKHA 3K53A 4KYIB 1QHIA 2WHXA 2JEOA 4TWZA 1JQJC 3G0HA 1KK0A 1VTKA 1SGWA 2Q3FA 3WNDA 1CR0A 3BB3A 1OPXA 3RC8A 1DTSA 2UZ3A 4NBSA 2LCFA 2WJJA 3LUSA 1A1VA 2CVHA 4BLPA 3K9NA 1NVWQ 3B85A 1LS6A 3M0EA 1DELA 2AKAB 4OJKA 1YRAA 1CJKC 1X8KA 3P27A 1Z08A 4LJYA 4A4DA 3QKUA 4CVNA 2B92A 1HYQA 1LVGA 5TV2A 4OI0A 2O0HA 3WYGA 5CK4A 1J5EC 4IVPA 1E2MA 5KOYA 3RRNA 3RRYA 4B3TC 3EXAA 2JDIA 2QSZA 2YWEA 4JLDA 5TDHA 3RC3A 1G3IA 1GRQA 5G3ZA 2W2VA 4M1KA 3CZQA 4FMCF 1YU9A 3K0SA 2ZS7A 4YXWD 1K0RA 5J40A 2DHRA 5CM8B 4CGZA 2E8FA 2GJSA 4M1OA 2W0MA 3VTKA 4ZIRA 3MLEA 1IONA 5K8TA 1NN1A 3CR7A 2AN9A 3MWJA 4DSUA 2CY1A 5EE5B 2ZI5A 3LA6A 1N5JA 3FWYA 4JT2A 2RGDA 3BFKA 1XNJA 3H86A 4O2RA 4DLXA 1SXJA 5JBQA 3W5JA 4NYIR 5L8VA 4OBEA 3EX7C 1YR9A 1ZCBA 1KDRA 2ZE7A 3UMSA 2PEYA 2OXRA 3FKQA 4GOXA 2PX3A 2ODNA 2G77B 2VHJA 3OZXA 3ZD7A 4HSEA 1OYYA 4OK6A 3TK1A 1AN0A 3R9IA 2FF7A 4PHHA 4LF4C 3GEEA 1KI7A 2G0TA 3KTAA 3NKVA 4QGGA 4OK3A 1US8A 2VHTA 1TF2A 1W2HA 1W44A 4TL7A 1KNQA 5BN3A 4TYWA 3QPVA 3W6NA 1GM5A 3QBTA 4D2IA 3E70C 3SBDA 3SOPA 1UBFA 3EWSA 1A4RA 2HV8A 5AUQA 1AJEA 1FNMA 3SC3A 2GA8A 4NU0A 2VTKA 2VL7A 2IF0A 1VMAA 1Z0AA 4Z8YA 4QGFA 4LV5B 3T1HC 2ZSBA 4RZ2A 4DUZC 2GXAA 1XZPA 4BFTA 3MD0A 3OF5A 2UXDC 1CR2A 2BJVA 1NP6A 3ICQB 1KDOA 1R8SA 2E8EA 3LD9A 5KDDA 5J5CA 2DYKA 2GCNA 4MYCA 3UMRA 2R2AA 3A8TA 1RW4A 4JLKA 3IO5A 5HKKD 3CW2A 4LF9C 1B0UA 3R8FA 5JJIA 2ZETA 2G83A 2RHMA 1P9NA 4DSTA 3ZJYA 2ZJOA 1D9XA 1LS1A 2IC5A 4LV6A 5CM9C 1N6KA 5H68A 3T15A 3Q72A 5JSZA 3QEOA 4DR5C 1SXJE 5IK2A 5L3SA 2R6GA 1TU4A 3IIKA 4BGDA 4P4SB 1B23P 1R5NA 2HYIC 2O8FA 2QZ4A 1CKEA 1Q1QA 1ZIOA 2QMHA 2VHUA 2X8AA 3BK7A 4TQ9A 2NPIA 3SZRA 1VKJA 1ZYUA 4WAUA 4YMTA 4POAA 3T1QA 4NPHA 1E2GA 4KO8A 5DYIA 2P6RA 3BXZA 1ZINA 4L5BA 4Q4AA 5KNDA 3MFYA 1G4UR 4D0GA 2BVNA 4W5JA 2JA1A 5JCZA 3I3SR 2WMNB 5BYJA 1GNQA 3N70A 1KSGA 4JI0C 1YVDA 3Q7QA 2ZJAA 1COWD 4HAYA 4QC2A 3K0CC 1I2MA 3J81D 2ZYVX 4OHXA 5D3MB 4QJ5A 4PZLA 3UK6A 4F93B 5KUTA 3A6PC 3MJHA 2NMVA 3FHCB 3GJ5A 1Z6TA 3AM1A 4B75A 2WPDD 1N6RA 4O25A 2OLKA 4RD0A 4OQFA 4LF6C 2BKEA 2ZR9A 3H4MA 3RWMB 2YJTD 4IFBA 1BYUA 3E5HA 1NVUQ 2WWIA 3GP8A 3FE2A 1HH4A 2E8CA 4GOKA 3HR8A 3ASZA 3QJYA 5SZIA 2E5LC 3CONA 4MDEA 1AZTA 1MO6A 3AF4A 3QKSA 4JJKA 4V02A 2R62A 3PVSA 3X1YA 2ZRGA 1KI9A 1YE8A 1Z07A 5K8LA 1BKDR 1U2RA 2NO1A 1HY3A 1SVOA 3IKJA 2QN6A 5FOWA 5BQ5A 1W0JD 2JLRA 1P2SA 3BS4A 5JLJA 4CEJA 421PA 2Z4RA 1LNZA 4R9UC 3U4QA 1M6NA 2FSFA 2FSGA 2XEXA 4X8MA 5J4VA 2XOKD 4B71A 4BFUA 1JPJA 4RKFA 2QM7A 1CR1A 5FTMA 1F48A 3GFOA 3QENA 2H16A 1DVRA 3ZQJA 4JLNA 1U98A 2QG6A 4Q47A 4IEEA 1M1YE 4Y0VA 1IJEA 2IUTA 5CLLA 1KO5A 1W36B 5B64A 2BEJA 2V4ZA 3D31A 5EP1A 1II8B 1Q3HA 1SKYB 5E3HA 4JBYA 1G6OA 1GG2A 2QUZA 4FCTA 1G7CA 2RHDA 2O8CA 1R0XA 1CF4A 4C2TA 2FPMA 4M1TA 2UXCC 2GBLA 2IEYA 2UKDA 1HNWC 2VSXA 4GI7A 1FQKA 1FL9A 1QHHB 4OL0A 1LW7A 3MUFA 1D2EA 2GJKA 2IT1A 3PUXA 3QNUA 4DR3C 1F60A 3MAAC 1N6LA 3QY0A 4QXAA 4DZZA 3BC1A 1E2FA 2VP5A 2ZSAA 1W4CA 5JWHA 1PLJA 3KDSE 2QAGC 1QG4A 3RWOA 4LK2A 4A0RA 1UKEA 1IM2A 1GDDA 1ZD1A 4MGIR 4WIAA 4EPRA 3ZVRA 1E2PA 1FMLA 3GFPA 4MRSA 3I8XA 2C98A 4KITB 2Y8EA 5KDOA 1EXMA 1S9DA 1XEWY 3O8RA 3U7FB 2BJOA 1JECA 4DDVA 1AIPA 3Q8XB 1G8PA 3A1WA 4MRVA 2IS6A 4NXNC 4GFDA 1LV7A 4TLAA 1E9AA 4DR1C 3D3QA 1HR0C 2CJWB 4FMCB 4Q9KA 4MUAA 3SEAA 3J81k 3AP2A 5E4FA 4CEIB 1JOSA 1KAOA 1UDWA 1WXQA 4R2IA 1P72A 3EERA 5DI3A 3WYAA 4EJSA 1J2JA 1IBRA 1E1RA 1U90A 2PX0A 4URWR 4URVR 3SFVA 2JLWA 1Z0IA 4XWOA 5FTNA 1XEXA 2YKGA 1E9RA 3HYTA 1G3RA 1NVXQ 3P4YA 1E2EA 4GZMA 4II7A 121PA 2IYLD 4DLZA 3F5FA 1IY1A 1EX7A 3K0AA 2JASA 5HTKA 5C18A 5DYGA 1CR4A 2V6JA 3PXGA 4DT1B 3CRMA 3K9HA 2FPKA 2CK3D 4M8NE 2A5JA 1ZM9A 4BUJA 4HUQB 3LAWA 4A0HA 3K70C 2I3BA 5F9FA 2H18A 4BLSA 5BN4A 3I5YA 1OHHD 4ARZA 4KLZA 4O0MA 4D4LA 1V5WA 4A0FA 5FTKA 2OV2A 2C9CA 1KY2A 3U3KA 4PC1A 4KVAA 1Q1EA 5G41A 1NN3A 4NYJQ 4RJLA 1DAHA 3X1XA 1R6BX 1E9BA 1I2DA 3D6TB 5EJEA 3LH5A 4L8GA 1YZNA 4F92B 1SXJC 3PITA 4B3BA 2N42A 3AVVA 4BRWA 4XD7D 2WBLC 1XEWX 5B2ZA 4EPYA 3FMIA 5H1YA 2C03A 4AYWA 5DO9A 3KXLA 1VCNA 3AQ4A 5TMPA 1Z0DA 3LW7A 2ZPTX 3Q7PA 4UNSA 2VSFA 4JL6A 4DR7C 3OIYA 3PR1A 4HI0E 4E09A 1DADA 2CEAA 5HZKA 3CX6A 1G7TA 2P67A 4NTZA 1VG8A 2KI5A 3LBNA 4AI6A 2FMXA 4MTNA 3LQRA 4ZO4A 2ZRJA 1FX0B 2VQFC 4TTQA 2ZSDA 3TVTA 4EUNA 1RFLA 5FL3A 2AHOA 1CJVC 1FP7A 3B8HA 1QHSA 1S96A 3L0SA 3OE7D 4Q4LA 5FPSA 1OYWA 1NLFA 2VF8A 2MSDB 2V54A 5LBIA 3WNBA 1PA4A 2PH1A 3PFIA 1TQDA 4JVSB 1Z0JA 4Q7LA 3GJ7A 1GL9B 1ELOA 2OCYC 3SDZA 1EESA 1S1MA 1GOTA 3B60A 2IF2A 3LVQE 5EZ5A 1JR3A 1JXMA 3KB1A 1HE8B 1X1RA 2G1JA 3PCRB 3KFVA 1OKKD 1OB5A 4XX2A 4XTRA 4X8OA 2ZUBA 3THXB 3VMFA 4OQMA 2VYFA 4GDFA 1IOZA 3QPUA 3K1JA 2QTVB 4PAMA 1KO4A 2OG2A 1LQLA 4TT3D 5FTLA 5FFMA 2J5XA 1XBTA 2GK7A 2IK8A 3TW4A 1G5RA 1OH7A 1U0HC 4Z51A 1AGRA 4AWXA 3AVPA 1QVAA 4LWZA 4P31A 3TSOA 4C0LA 1BH2A 1NN5A 1HT1E 2VP4A 1GUAA 5A5GA 2WWWA 4LJ6A 5DNYB 5EP3A 1L2TA 4JBXA 1FJGC 3TUJC 2OILA 1IY0A 3PEWA 3DL0A 3EC1A 5JS8A 4WW0A 4TL8A 5L3RA 3THWB 4X64C 4V0MA 4DIDA 1BS1A 2ATXA 2GJ9A 1VDZA 3RHFA 5DN6D 3GJ6A 4QHTA 1E1QD 4Q48A 3GKUA 3R9XA 4QGHA 2DPXA 3DO6A 1XNRC 1ODFA 3F8TA 1N3BA 2ZE6A 2A9KA 3BRWD 2D7DA 4I1UA 1DS6A 1IN8A 2AR7A 5KPJA 4A8JB 4MYTA 2BMDA 1NBMA 4P4SA 4QNMA 1VG9B 4IFEA 5SZKB 1N36C 3CRRA 4AG5A 5LD2B 1IN4A 3EWAA 2F1JA 2RAPA 1Y63A 1L7VC 2PCLA 3U61B 1LB1B 2WJHA 2WWYA 4URYR 2EFDB 2GF0A 3W9YA 4DHEA 2OCPA 1JR3E 4PSKA 2JIZD 2FFQA 1A2KC 2ZEJA 3UWKA 5JFGA 1VPLA 3E2IA 2VP0A 1H65A 1N34C 1E9CA 3IGFA 3KKMA 3I72A 1XD2A 2WIAA 1ZNXA 5JRJA 3LX8A 1UKZA 2FU5C 3ZIAD 2WOOA 4UJ3A 2Q9BA 5D3MA 3KB2A 4FCVA 1QBKC 3PUZA 5SZJA 1IN7A 2WWFA 5F9HA 4H1UA 5LDDC 2GXQA 3TMKA 1EWQA 5C2JB 4YHHC 2C8VA 2WSSA 2ZTSA 2ZYUX 2DWQA 1P60A 4Q7JB 4C0BA 2H8KA 3AKEA 2ZJYA 1W2GA 1QDEA 2EWWA 4K8OA 4M1SA 2J59A 2YC2C 4NE2A 4OI2A 1Z3IX 3LV8A 2UVQA 3KL4A 2TMKA 1H8HA 4H9GA 4PANA 2JLUA 1XJQA 4QBIA 4RD6A 4O3MA 4EPXA 5DGXA 3PEUA 2ZJBA 3EZFA 3RLFA 2IS4A 1E0JA 3HPRA 4DXAA 4M1WA 4V0ME 2HHHC 4EKDA 3I32A 3C4JA 1AK2A 3UPUA 1GKIA 4LF8C 4ZI2A 4TMTA 1IXSB 3S1AA 1OXUA 2UUAC 3DMDA 1XP8A 4X62C 1T9HA 1IN6A 2FA9A 1GSIA 1WRBA 4MH0R 1ESNA 1TL7C 2J3EA 1R0WA 4M21A 4JKIA 3F3YA 4QL3A 1FTNA 3GEIA 4HB0A 1NBME 1UPTA 3ETLA 3DM9B 1P3JA 4PHFA 3KJHA 3W34A 1EFRA 4TMZA 3SYKA 1S0UA 4QM6A 1KDPA 1II8A 3CUEF 3C16C 5DH9A 4D4JA 3B6EA 1RJ9B 3IPXA 3MG9A 4A15A 3REGA 3LFUA 4KFSA 3SYLA 1FPMA 5M04A 4DCVA 1OF1A 2NO6A 3P32A 2RCNA 3FYHA 4DC9A 4EPVA 2F9MA 1XD9A 2F1HA 2E9SA 2QT1A 4C9BA 3RSLA 4ZDKA 4W7SA 4WZAE 3KJEA 2JMPA 4IVRA 3WHKA 4CZ2A 3FFBA 1QHHA 3VR3A 2AK2A 4NZYA 3PUYA 1E2NA 3WRYC 1XX6A 4HLCA 3RNLA 4AKIA 2NQ2C 1DO2A 2HDNB 4EJSC 1E79D 1X3SA 2NZ8A 1BMFA 1CU1A 3EZ6A 1E9FA 4XOIA 2CXCA 2D7CA 2IYRA 4B6EA 4RSGA 2F4VC 4DDWA 2AXNA 4C4PA 1E2DA 1FNNA 1JALA 1GIAA 5JHGB 3DOEA 1O87A 3QF4B 3V00A 4PHGA 1E3MA 5EE9A 3GCGA 2VHQA 4GMDA 1TUEA 1NL3A 2HXSA 4IDPA 1GILA 1XJCA 2B7BA 3A1UA 5E7IA 1ANKA 2JJ1A 4LC1A 1RE0A 2ASEA 2H5EA 4JMPA 2CJWA 4IXMA 2C5LA 1RZ3A 2HT1A 5AJXA 4B43A 5FUXA 3TQCA 1ZB8A 4CEIA 3OIVA 1R4AA 2WAYA 2BMJA 4HB4A 1A5TA 5A0FA 4R2HA 2O8EB 3MWKA 2R65A 2CL0X 1A82A 3CJEA 4BPBA 2JATA 1W49A 2J1LA 1A7JA 4L9WA 4M1MA 1N6HA 4OYHA 4UXIA 1AZSC 2C99A 3QUSA 2XNSA 1T0JB 2ORWA 1XPOA 4LYJA 2GCOB 4LSGA 4M1YA 3RRMA 1HV8A 2HJGA 4JZKA 4BEBA 4P3YA 3GLHB 2I1QA 3K0EA 1SKYE 3C15C 4B2PA 3I73A 1Q44A 4B2IA 5DLQC 1K8RA 4IEIA 4GOJA 2NO9A 4HUQA 3A1VA 3KKQA 1VHLA 4HDCA 4X8LA 1UBGA 1T0HB 4Q21A 2XZOA 5FOVA 1N0VC 2EYUA 2CBZA 3IHLA 4Q4JA 1MO3A 3TGPA 1NN0A 2W0SA 4PO8A 4PAOA 4NDZA 1G17A 4IDOA 1KI6B 3RS0A 1RRPA 2WMOB 3DM5A 1T3SA 2ZSEA 3TR0A 1EFCA 4QOSA 5UKDA 4XVUA 2FZLA 4MITA 2W6ID 3QIAA 2B6HA 2E87A 2FH5B 3OFND 3SN6A 4AK9A
chains in the Genus database with same CATH superfamily
2IXBA 4JK3A 3ELYA 3M6VA 3W3AH 3R3YA 4KWIA 1EP1B 1VYUA 4X5OA 4BV2A 5C80A 4JV5B 3OE4A 1V4VA 3UJ9A 4YUZA 3KUXA 4KNYA 2OBFA 4KWEA 4RIHA 3D8BA 1E4EA 4EDHA 3E5NA 4NXMB 5D84A 4DXDA 2O6LA 1KS2A 3R7LA 2BT4A 1KZ6A 1CVIA 3GVXA 1XCOA 3O3CA 2JAHA 3RSGA 1VP9A 3TSWA 4BC1A 3HEBA 2ATCA 1JPVA 2CLCX 3OWHA 2HIGA 4HDOB 1X14A 4HDAA 4Z1MA 1F8UA 1R7RA 2O7NA 4JYPA 3HFSA 2OPLB 2HREA 1JIKA 2A5YB 4A03A 3LOPA 4H7KA 2YHSA 4Q9LA 1S8OA 3USES 1Z62A 4OREX 1KZ7B 1FCJA 2C42A 2F7SA 3EG9A 3BHJA 4JMLA 2O0LA 3W78A 1G19A 1CZHA 1OXBB 3G2LA 3MUEA 4U00A 4BV3A 5KOYA 4Y7CA 1REQA 3IIJA 1QGUB 4P38A 4DANA 1CX9B 3DVSX 4HWSA 3VHLB 3I9V6 2OMKA 3LSYA 4G1FA 3SC2B 1EGAA 4JOCA 3VPAA 2PHZA 5DDIP 3SPXA 4FZJA 3RVRA 4DR2C 3KO8A 3NBZC 3GPDG 3DT9A 5CDGA 1A96A 1HNXB 5FAXA 3P0IA 4OP3A 2VJLA 1NY6A 3OP1A 1YBMA 4I6JA 1Q1AA 3AJDA 4OJTA 3NVAA 1MX1A 4CEHB 1A5ZA 1B41A 4M36A 2YFYA 2XGJA 2R68A 1MKYA 1AC5A 2HIMA 4YLYA 5LB2A 5AK5A 3W1VA 2JCXA 4BL5A 5I9NA 4P33A 5CB4A 1T91A 2EX1A 2GEDA 1KAGA 2GILA 3H8SA 4HDNA 4KXNA 1H2RS 2OESA 1O7JA 1PDWA 3F6YA 4MO9A 3DE0X 5LBTA 3S5JA 2BCGY 4GKKC 1DDIA 2QTVA 2XODA 3PTZA 4IDGA 2XVAA 3QE2A 1AY0A 3D1LA 1Q0ZA 3H5IA 2OV8A 5LZ9A 5CVUA 3IXMA 1J25A 1GTJ1 4B8YA 1IH8A 4NY1A 1ONSA 4BNWA 5BW8A 2WPDA 2DULA 4RK7A 4D9FA 1XZBA 1JFTA 3DPUA 4E88A 1NLZA 1GSOA 2QNRA 2ZIZA 1QZ3A 1CFZA 1X15A 3IESA 4HVAA 2GEVA 5IDWA 2ISQA 4J0DA 4OH7A 4Y6SA 5IBPA 1S3IA 4D9BA 2YBDA 1RC0A 1W5TA 2DPLA 4LNAA 8MHTA 1RRFA 3RUFA 4EJ0A 1VRCA 3IAAA 4P5PA 1I24A 2R47A 2RKBA 3B52X 5B1EA 5F12A 1N5RA 1CLUA 3H5OA 3RVDA 3THWA 1T5SA 1QE0A 2P1RA 4O5AA 1Z4KA 2GRJA 4UBOA 2V97A 4AZTA 1DIRA 2CHEA 1Z2EA 4K46A 4M38A 1QQ7A 1W4LA 3DHEA 1D5CA 2OD9A 2TSYB 4LSWA 4G4JA 3QGMA 4O5OA 5JPIA 2GEFA 4HGZA 3V7NA 4YT5A 1A1SA 2UV8A 3VMMA 1P5RA 4J8PA 4MQEB 1HDCA 4WL0A 3ZTYA 1Q0UA 4V0LA 3NTQA 5CK5A 3IAM6 4IKEA 5FADA 5HKLA 4EYOA 3D4NA 3NHPA 4NCJA 1OH5A 2GAAA 4OBBA 1RZRA 3GPCA 4B17A 3H0KA 2HNAA 3WLKX 4H7FA 2IIQA 4BX9A 4NL4H 3KR0A 3C1OA 1GTMA 4RSRA 2JJ2D 4U7HA 4PSAA 5E95A 4ASUD 3E2MA 4Y8VA 1F1BA 1NNI1 3M1IA 2NTEA 2HUPA 4BYMA 2DUJA 2PAAA 3GGCA 2QPLA 3G1UA 3RUPA 2I4IA 3CSDA 3NDJA 1OASA 2RGCA 1IUKA 4JFAA 1PHPA 2SECE 2A59A 4V03A 3J80A 3AGQA 1U94A 4P0TA 4LQLA 1U9IA 3VPGA 4FMDF 3QZUA 4UUOA 5G0SA 1LFDB 3WWZA 1LK7A 5GADl 3CNLA 1O95C 3ACBA 4BVKA 4H4DA 2ZSIA 2YV1A 3M4YA 2AJLI 4CTMA 3C14C 3CGGA 3I04M 1LJUA 2GK4A 1N92A 4RM2A 1G21A 4M89A 2PBFA 5FR1A 5ILGA 1JNXX 7REQA 4PLCA 5SYMA 5AJVB 3ZW9A 2VBCA 4CMJA 2C57A 3VU8A 2HCTA 5DGCA 3RGGA 3JYOA 4PYOA 2AFIA 1Z28A 2YVAA 3OOJA 3UUFA 4DCJA 2EX0A 5JH7A 5I7UA 1NF2A 4JBIA 5AW4A 3ZWMA 3EFOA 2VRCA 4GD3Q 3C6BA 2PX2A 4CKWB 3EYWA 2OG1A 4DABA 3FWNA 3K70D 1ZM4A 3VC7A 1CB7A 2HCFA 2XLCA 3OAAA 4LNHA 1GNLA 5EWJA 4LXHA 2R00A 1LSSA 4CKBA 1T5IA 2HMVA 3ZDAA 2KYRA 2XRFA 1Y1LA 4YP1A 2PMKA 3RC1A 3R0IA 1WBDA 2ZANA 2ZUSA 3OVMA 5EERA 2W2XA 4JJ7A 4OTZA 2IZ5A 2D3TA 2NOAA 4LMPA 1SXJD 1SCDA 1W8IA 5MN5A 4V1CB 4DLVA 2JC3A 1MB0A 5KNLA 3P5SA 2AB0A 4QYMA 2ECFA 5CAEA 1VJCA 4KN8A 1R6AA 2NAPA 4GW3A 2O14A 3VX3A 1XMPA 3H2KA 1JIIA 1NA5A 1RCUA 4MO2A 5LA6B 2BP7A 3E15A 1LPAB 4NYJR 4RLHA 3STVA 4R8SA 1JJ7A 1MHPA 1VCHA 3AL3A 3ISTA 4BCCA 4Z0NA 4OK5A 3B9RA 3TZKA 5CXQA 3QBVA 5HF6A 5DM4A 3FUCA 5TVGA 4E5VA 4LF9B 2AEFA 1PEKE 1JEDA 1L8QA 4US1R 4QBFA 4J94A 1GN8A 1UM9B 5LP6C 3S2EA 1E2KA 1G21E 3P2KA 1IVSA 1IHOA 1OHHA 1QS0B 2YBEA 1TF5A 3QMMA 2CMKA 2N47A 2A33A 1YQQA 2YW9A 3TINA 1IBLC 1NI5A 3K05A 1N0IA 3L0OA 4LVOA 1E6KA 1EFHA 3UBMA 3KSBC 1L7OA 3FA2A 2YJNA 2B1RA 3MQ2A 1X7HA 3CH4B 1RI5A 3D9QX 2JH8A 2AFIE 4LZPA 5F73A 1OJLA 4ZEWA 3CH5A 3DJFA 1ZGBA 2Q99A 2ZQYA 3E3OA 2BMVA 2PKXA 3NEAA 1E99A 3PVZA 3DHWC 1FYEA 5I9TA 3I1FA 1VE3A 3RHSA 3SFTA 1G8MA 1WM1A 3WJ7A 3KYDA 1Z8NA 3WG9A 3KUCA 3UGTA 1JNYA 1G6HA 1L1EA 4FD2A 1BXZA 1OFUA 1EHYA 3GCXA 2CXHA 3NLLA 4LV8B 4YMLA 2XXAB 2L0XA 3ILHA 3KQTA 4YA6A 4CLOB 5JY6A 1A9TA 2RE8A 3RBVA 2VAXA 2ZI9A 5C32A 5AE1A 5A1JA 8ATCA 2WQ6A 2K7FA 1MORA 3N53A 1M2HA 1SCAA 5BSFA 1FP4A 1LTQA 5I9SA 1JJVA 1PJ8A 1N1GA 5ALZA 3IULA 1H9BA 2BLLA 1KVSA 4WK4B 2NVUA 4FX5A 4ALNA 3H2YA 3P20A 3O47A 4GM4A 4BAGA 2HM7A 2UVDA 4URFA 1GUFA 4UULA 3BBPA 1BN6A 3RYFB 4F7DA 2OZPA 2X41A 4X97A 2XVZA 3WK7A 2FEMA 2P7IA 3DV2A 3PSHA 2KZFA 1I4OA 4Z8XA 2QI9C 3CJRA 2F59A 1NLMA 2QLLA 3JTMA 1WV1A 4JA0A 1NXPA 4HB2A 1O96A 5FO1A 3W8FA 2AN3A 4D80A 3VHXA 1P44A 2GCOA 2Y66A 4Q1DA 3B1VA 4B3FX 2PZBA 1CUDA 1O3YA 3GLHA 1K7SN 2ZIGA 2ZJ2A 3SP1A 1J24A 1JV2B 1D8AA 3HJNA 4L4YA 4OGWA 4X6LA 3TZCA 5JZ9A 1PV4A 4OX9B 4R98A 3PQ5A 1BVUA 1ZMBA 3ORQA 2XQGA 5D87A 1NU8A 1S2LA 2FYTA 2GF2A 3WL8A 1P6UA 3MXTA 1UBJS 4JH0A 3WWEA 1OJ7A 4QWWA 2ZW9A 1YKFA 3BB1A 3PRKE 2D7VA 4E4RA 2A92A 2BFPA 4WUTA 5LYJF 4RZXA 1BU8A 4HMQA 1MEEA 4B3SB 3L9XA 4H6WA 4QNRA 3FPBA 5ER9A 4V0KA 2J5BA 4PLZA 1JG7A 4RK1A 4V3CA 1QMGA 1RR6A 1MIHA 3UANA 4AUEA 2ACEA 4E08A 3DZHA 3U49A 1QZUA 2CB9A 3AF3A 1DTEA 1DEHA 1Y42X 3CV3A 1QWOA 4HLQB 2OAEA 1DJOA 3GZTB 3P2MA 5MN4A 1XEAA 4ZAWA 5ICFA 5KNCA 3O1LA 2EGGA 1N2HA 3PGXA 5DBFA 4CWAA 5IKMA 3GLKA 4LFAB 3F47A 4MS3A 2X2OA 1LBSA 2PLRA 3BE5A 4EZIA 1YFJA 3OJFA 1RHKA 4CI9A 4B4OA 2YVUA 1H1DA 4ZALA 2R8RA 2PYIA 3HYCA 4KGVA 1BWSA 4Y6OA 2BC9A 5CFLA 3WGYA 1J70A 3ORYA 1WKVA 1DRJA 2B61A 2WB4A 3OUUA 1WE2A 2EJUA 2ZPAA 3G8AA 1SZDA 1WZNA 1WTAA 2O07A 3JQQA 4JAVC 3WBJA 2HMTA 3EXIB 1LV8A 1FSZA 3KP1A 1H85A 4KBYA 3LF2A 2YUIA 1LQUA 4RIGA 4FNMA 1OXTA 4J1TA 4NR0A 3BWYA 3G0OA 2AYYA 3LC7O 4J75A 2AV6A 3I4CA 1ZGHA 4LY3A 4OHVA 1JN0A 1ZQ9A 3PFBA 3H1GA 3VAZA 3LLVA 4BO8A 2QAGB 4E51A 2FR0A 2VDWA 4FSHA 4KK4A 3ZW8A 5TT0A 5BVGB 2EFEB 5CCXA 5IDQA 1VPEA 1Y98A 3UMYA 2JFBA 1KZ1A 4Y30A 5CX1A 1EFVA 2VQSA 1HYHA 3GUYA 3H18A 1K86A 2V03A 2XITA 3CZMA 3GD7A 3GLHE 3PDHA 1N6IA 1TRHA 3IVXA 4JI2C 1YQ9A 2XDYA 4QLBA 3IQIX 3N5KA 5TY0A 1A4UA 5G2OA 4RV9A 5KQPA 1TYCA 4MWTA 1E60A 3CKYA 4HGRA 3U5TA 3HNRA 2C59A 2WLTA 3OKAA 4QPZA 3RYIB 1JPNA 4I19A 3ZGNA 1V1MB 3DR5A 3IB3A 4NFSA 3U39A 2JJ8A 3HA7A 2PUCA 1HQDA 4DV3C 3T7DA 4PAQA 2NCLA 1PJBA 4UU1A 2OCGA 1YZQA 4NMMA 4CV1A 1VPTA 3T3IA 5JEDA 5JMOA 2VF2A 2BGWA 4WS9A 3MRXA 4QATA 2C29D 3LX5A 2RGAA 1J9GA 5BSWA 4Z3DA 3ZWBA 4EGSA 1Z3CA 3VNQA 4YPOA 2I6QA 1M0WA 4KTVA 2F43A 4C0LA 2JFWA 2YJ4A 3FB4A 3U7EB 5JNLA 1G2QA 4G0OA 4EOGA 1SIBE 4KH1A 3MJ4A 4GZLA 1UPFA 4G0VA 3CBGA 3ZUGA 1X8JA 2W37A 3M4XA 3A4NA 3D6MA 1Z73A 3QE0A 3IEIA 2V6FA 3QUCA 1MTZA 4QZVA 4ARSA 5ARBA 1W5FA 1MPTA 4ZAYA 3B48A 4NE9A 1C3OB 2BGMA 2C3PA 2PRZA 2A94A 3T4EA 1VIDA 2R5FA 4BVEA 3K0FB 3TFWA 3VU0A 1XDGA 3GLGB 4UATA 2BFCB 1OLXA 3DFZA 5EXDA 2XECA 3KHTA 2D74A 4NDNA 3UWSA 4BN5A 1FXSA 2J09A 2IHTA 5DSZA 5FTJA 3UJCA 3A6JA 3DOIA 3E4CA 1WEKA 2J3DA 3H5RA 1GLGA 1RM5A 2HU2A 2AFHA 1CUWA 2BF4A 2O3SA 4M60A 2G6BA 5CFQA 3MINB 4MKFA 2O4CA 4FN5A 4YDHB 1YQDA 4IQGA 2DBYA 2WFMA 1WR8A 3EZNA 1MCZA 1SC1A 2KS6A 4JI1C 4K26A 4ND3A 2PKYX 2R6ZA 4NP6A 1G20A 3TBKA 1ORTA 4R8VA 4Z4CA 2RJ3A 3OETA 5AVRA 2ID4A 3D2CA 3IDAA 3QQPA 1GPBA 1LVHA 3K35A 2UZ0A 1C7ZA 2O2SA 1YJQA 3GWZA 4REQA 2YWBA 3H75A 3TNFA 3F97A 2M6KA 2BH2A 1L4KA 1O58A 1NAHA 5ELMA 4BHTA 1W5SA 3DCNA 5FYDA 5JXJA 4D8TA 1C3XA 4KREA 3DZKA 4U7DA 1BDMA 1QZTA 4HPXB 3MA0A 1ORVA 5DK4A 3I5AA 1Z0KA 1VFPA 3ESCA 4BNKA 1O0SA 1YE3A 3CKKA 2CUNA 4TKMA 4ZDJA 1GQQA 1C3VA 2BFNA 1SPXA 1WF6A 3P9YA 5IJ9B 1DIOB 1VKOA 3ZVMA 3OURA 4FUQA 1NASA 1C4OA 3RSQA 2PD4A 4WINA 4D6YA 2XT9A 4CIBA 2ATVA 3O8OA 2Z5VA 4LBYA 4QSHA 4ZVUA 2G36A 1OH8A 1UP7A 3IELA 4GYWA 2VZEA 4I3GA 1Q3KA 4G4IA 1O94D 2NG1A 2R87A 4O4JA 4UREA 2C88A 3BILA 5CVDA 4Z2YA 5ES4B 2EBFX 1COZA 1XAHA 4KFTA 2QV0A 3QTBA 5DM70 2G0AA 4IVQA 2QR2A 1IHYA 4HXEB 4B3GA 3K6JA 1DQPA 1JA1A 2IZZA 3ND9A 3PPVA 5J43A 4O2BA 1INLA 4C0QC 1K3UB 3ZDYB 2DFNA 2HC9A 5M29A 2O8NA 4PGHA 5ALYA 3C8UA 3PX3A 1YRBA 1KPHA 1M2OB 5EQTA 3BIXA 5AUNB 4KV9A 4MH4A 1U6IA 4MZDA 4OKIA 4WQMA 4OUDA 1P2GA 4DQ0A 5BNWA 1UPCA 2I55A 2H29A 4NDNE 1TK3A 3WQSB 3JQAB 1P61B 2G5TA 5LZ4A 1EVLA 4D9CA 3I52A 4EZEA 1JQKA 2AFHE 3STHA 1C1DA 1JLLB 2WDPA 4B9AA 1FSFA 2JFUA 5L3QB 3WR5A 1DAKA 4F21A 2B3TA 1I4DD 3PPYA 2P4QA 3NWJA 4NOKA 2VTBB 2GZDA 3NWPA 1G20E 2W6ZA 3L6UA 4XUGB 3UF0A 4Q1EA 4Q4DA 5FF9A 5AVSA 2PUHA 4M49A 2CLOB 3ED5A 3CZCA 3THYA 4EO7A 2ODWA 4RPKA 2HUNA 1GWNA 1N8TA 3VH4A 2Y1LA 1ZOOA 4MA0A 1ZSNA 5CVJA 2VPWA 2B8NA 1F2TB 2AG0A 3ND6A 1EWVA 2FDRA 2HWKA 3PXBA 5FUQA 1Y8CA 2HEGA 2IEIA 2P68A 1DMRA 2F3RA 4QUAA 3WL4A 2A9RA 4BNJA 5IABA 2UZ4A 4C29A 2W90A 1KEVA 4CMEC 1A5SB 3PICA 4NENA 1MZPA 5F33A 2Z5FA 3D43A 1U7ZA 2MR6A 2DRIA 3F71A 4LY9A 3U3DA 2ZUFA 3EZ2A 1ZD3A 4TQUS 4PG8A 3NHAA 4M99A 2DMRA 5D85A 4RA6B 1ML8A 1TZCA 4DW8A 4DMUB 4U6NA 4MGHA 3U9TA 5KYYB 3GLRA 5B57C 1NSYA 3ODPA 4DLYA 1C7JA 1HA3A 4YASA 3P96A 2OCXA 3V8EA 4JQZA 2AOTA 2YN2A 4LFAC 1VG0B 2P77A 4ZVOA 3RV4A 3KKOA 2GCGA 1N36B 4BNHA 3IHWA 5IDVA 1PQWA 4KQJA 4RXTA 2Q3MA 3RUEA 2Q5FA 1RYMA 5EP4A 4C88A 2Z0MA 2C2ZA 2CGEA 1X94A 3HKEA 4QD3A 3QKSB 1PHRA 2HSJA 1ZRSA 1IZYA 4F9TA 1GGEA 1K0UA 3GQBA 1E32A 1G41A 1U0LA 4PVCA 4TS3A 5T4BA 1JG1A 2B21A 4LJ5A 1UZLA 5IJ0B 5FJJA 3E18A 4YQFA 1X39A 4WFIA 2C9YA 1UC4B 1X2EA 1QUEA 3B3JA 1TM3E 1QH1B 1WXWA 3C5VA 4FYJA 3OQOA 1WTCA 2GEUA 4RK4A 4L50A 1R8YA 3SQNA 4L78A 4AKTA 1JPUA 1U0EA 3ZEIA 1EXWA 5E3JA 2Q46A 1RS0A 3A7DA 2BFFA 4J2HA 2FG7C 3ESDA 4Y1EA 3RM3A 1XZIA 1M76A 2KM1A 3AT1A 3QLEA 4F7WA 1G64A 1DKOA 1EK1A 1YACA 3OZGA 4EW3A 2D5LA 2YWGA 1WZIA 3E81A 1Y6JA 1W85A 4ZAFA 1IQ0A 1UBSB 2WHQA 2CVOA 4XUDA 5U1PA 4ZYLA 1Q14A 3GAZA 3KT0A 4GZ5A 1OA1A 4LHSA 4BWYA 2HK8A 3OCYA 4Q02A 5EJ9A 1I6KA 2WF5A 2XOEA 8ABPA 3B89A 1XFAA 4DRYA 3WL6A 4JV5C 4C76A 1VL0A 5EHZA 1IZ0A 2FWBA 2ZE8A 1WBJB 3VR5A 4R1NA 1LLCA 2FW9A 3K96A 3BE6A 3Q0EA 3SZMA 4QYSA 1QE3A 3T3GA 4TKVA 4LF8B 5A04A 4PO1A 1QANA 2FPXA 3Q87B 4DR6C 4M87A 4H4CA 4D25A 3ND8A 1ZH6A 4I5IA 5IWAC 1MG5A 1KMHA 2E85A 2QY6A 2XPCA 4TLBA 1EIWA 4A8HA 5IDYA 2WJWA 3IUQA 2DFDA 1S2IA 4UVEA 3CA8A 1H3FA 4IIFA 2QRMA 3QG5A 3QP9A 4HGNA 4MDFA 4FIDA 1WHTA 5FOXA 1NJGA 3Q1LA 4KIFA 1NOKA 2XY4A 5JDIA 5LQMA 1G8GA 5LFAA 2HMYB 4KVGA 1CC1S 1E98A 4PLVA 4AY2A 2X77A 1O95D 1X19A 2B4YA 3MRSA 1BJKA 1E5QA 1NNEA 4INOA 1TCVA 3V42A 1ESCA 3DOOA 3RVJA 2MCQA 4ZV4A 1Q20A 2Z6VA 3H5TA 3CIOA 1TIPA 3PZRA 1OFUX 5D8DA 3ZHVA 2AZTA 5LMZA 1VEHA 1SCUB 2W4IA 4XM0A 4B85A 4JCCA 1EK0A 2K5UA 4HK4A 4OXRA 3TG2A 4NEQA 1MUUA 3FBTA 2QRLA 1PYOA 2JI6A 2R6CA 2F3SA 3E03A 4X1KB 2PKQP 2PV0A 3GPIA 1RXVA 2PX5A 3ZGYA 1QRUA 3GRFA 4GSYA 1G291 3FXAA 3WDKA 4U5XA 1XEXB 3CPSA 4WJKB 3I5UA 2V0CA 4MS1A 3R6TA 1DAMA 1UFOA 1YUMA 3QXXA 1XXHA 3JU3A 1ZJZA 2FY8A 3JZAA 2Z4SA 3OQIA 4WRRA 2FSVC 3ILXA 4UJ5A 1KAEA 1FVXA 4GH5A 3UC9A 4G0PA 5ESWA 2D1QA 2FZVA 2J3LA 1MQSA 1YMUA 3S44A 3NC1C 1G1MA 2TMDA 3K2QA 4Q9DA 3TKAA 4ZZ3A 3I62A 4GKBA 1NQUA 1OXXK 1W25A 1WAMA 2PO7A 3K3PA 4FONA 5LQKA 1TA0A 4C04A 3GLVA 1AQUA 3M34A 1AO3A 2FCRA 4BNVA 2BR4A 2W6CX 1UINA 3ES9A 4BNNA 2O8DB 3IUNA 3IEXA 4O6VA 1XMXA 2JAQA 4QOFA 2NTNA 2Z2JA 4Q9NA 3N5CA 3SY8A 1S2DA 1FU8A 4H7HA 4ARZB 2ZTLA 4KR6A 3X1DA 1KOGA 2P6UA 4NSNA 1J1UA 1RQ2A 1ZQ1A 2VHWA 3CNHA 3RUHA 3ZWVA 4AWBA 4I5FA 3VPCA 5EMJA 1JFSA 2P2YA 3K9LA 3W5AA 3JYQA 3D4OA 1OW3B 1VLLA 2IXTA 3LUBA 4JBGA 4ND5A 4DJTA 4GLFA 3LDGA 4DKJA 4CUJA 4DNFA 1C2YA 1E3IA 4NOLA 3QPBA 3BHNA 4G1BA 2EQAA 4BQQA 2VSYA 3E0QA 1XHLA 2C83A 4HDQB 1GKLA 1XTBA 2D59A 3P0FA 4M8LA 4Q1VA 4K9PA 3K4QA 1FC0A 3QE4A 4MYUA 4ZCMA 3E5MA 4GEKA 1W46A 1YFZA 4L73A 1Y4ZA 2CHGA 3EXG2 3TL2A 1BCRB 1A7KA 3A06A 4P4TA 4U02A 4YAIA 1UAAA 4YMIA 1V5IA 5L3VA 5K3OA 4W9NC 4YDSA 2B7CA 4K86A 3OOEA 4TXNA 3A6GA 4ATNA 4CGYA 5LM3A 2EG9A 5KTYA 2JLQA 5KTOA 4WA7A 4CKXA 3Q0TA 2AD1A 1YI8A 2DPMA 3SXPA 4MV1A 4DE5A 5T4EA 4NMXB 3VJKA 4W6QA 4IUBS 2EIHA 1EDOA 4UBMA 4Z7JA 5BR7A 1SD2A 5LWQA 1OT5A 3LKZA 1YMVA 1RP1A 1K2WA 1VB5A 4TL9A 1K6XA 3GFSA 3GOHA 3G2HA 5FOSA 3R0XA 3UMVA 3FJOA 1O5TA 4DC1A 2GBGA 1E0KA 4LHXA 2GESA 5AW8A 1UJMA 4JT4A 4YALA 3H11B 1XXHE 4UOQA 1EH5A 3NANA 5REQB 4MDHA 3S2IA 3BMNB 3ZHTA 1Z2CA 2RBEA 3DLHA 3NO4A 1SJ9A 2G4CA 2WE8A 2WWGA 3URKA 1HT2E 1K4MA 1GG9A 3LYUA 5DX1A 3WA6A 3FLAA 3KQSA 5E7QA 1PS0A 2H51A 3D2BA 4RYLA 4XCVA 4ZXFA 3ZY6A 4AJ4A 2VP6A 4M53A 4X7PA 3BMXA 3IERA 3FCEA 2XOKA 2F1OA 4QUBA 4AIIA 1AS0A 1RYHA 4WK0B 1FSGA 4B87A 1KQPA 2XB6A 1U8ZA 1VPVA 3KFLA 4G5GA 3TQSA 3KXWA 1Y6RA 2BTQA 5IYZA 3LVRE 3TAHA 4DDKA 4J0GA 2P4HX 4J7CA 2E4WA 1TMGE 1XMSA 2ZRPA 1ECLA 2HA2A 4H6PA 2H1HA 1HYEA 2OGTA 3FOEC 4Z9BA 1MV8A 1K68A 3O7WA 1DUIA 5CT8A 2TECE 1DKRA 1N2FA 3PPWA 4D43A 4JQYA 3PI7A 3BFJA 3HR7A 4A2QA 2OV3A 4NK5A 2FPLA 4MAMA 3D3WB 4NEHB 4ARBA 4RY2A 2P20A 1HRKA 3ZE1B 5I4CA 4OF4A 5IM4A 2KHZA 3DTYA 2N1BA 2A1TR 5IM5A 1ISRA 3MCUA 3D5TA 4RABA 4KDCA 1NMXA 2I03A 3BWXA 2X6TA 3V1YA 1JDBB 2BEUB 3H5NA 4RDCA 4FZ5A 2R1ZA 3EIQA 2VATA 1OOEA 3QFCA 5HCNA 3RSOA 5A2GA 3WS7A 1U8TA 1WJGA 3S2FA 1UEJA 1UK6A 3G1TA 3NVKI 2WI8A 1MW8X 1CUEA 1WLSA 4GGPA 3T54A 3OE5A 2A5GA 3E48A 3LKDA 4C7VA 3ML1A 3ABIA 1E9DA 4JYCA 3MUOA 3FYSA 1Y7IA 4JLOA 4N01A 4KAAA 4XDHA 3OPNA 5D86A 5H80A 4AZSA 2C04A 1ZS9A 3AYXB 4NCXA 3QPDA 1KFBB 2WKRA 3ORFA 2Y4OA 3LC1O 3E9EA 3H2IA 3B5JA 3JQFC 1AZLA 3DBRB 3EXHA 1H94A 3GK3A 2OAP1 2QNIA 3SE0A 1NONA 4NZPA 3WYBA 3PE4A 2BBOA 4QPPA 1H5NA 4MINA 1K7XB 2ZB2A 4WBXC 2PH3A 2IOFA 3ENVA 3MWLA 5ALGA 5HDQA 1I10A 4D3XA 1XVUA 2Q3HA 2REBA 1OSNA 2JRCA 2W00A 2GD6A 3RS5A 1UKAA 4WZAB 3ZVNA 4I1VA 2BFOA 3UCEA 1E59A 2GETA 5DOVA 1GPH1 3ER8A 4DCSA 2BEWA 3D8HA 1DT5A 4YIHA 1Q7GA 1TOAA 3DBOB 3OZBA 5DHPA 1SOWA 2GWHA 5BSTA 3R0JA 1RJ9A 5NLLA 1GN9A 1M7BA 2GERA 1FZQA 2J0UA 2JI7A 4GPD1 1WVGA 4L8YA 4ZOEA 1HDGO 1CDDA 3WMXA 2EQBA 1C50A 1TT7A 1A8UA 1O03A 3LLSA 4I55B 3P1JA 3D0QA 1GQSA 3PRYA 3V4VB 4B76A 2XHEA 1OWLA 4INJA 4N4AA 1MB9A 3K9QO 3ZVLA 3TOCA 4KYUA 3KQKA 2A8YA 3UNXA 1ZUD1 4PQEA 4TV9A 4OX9C 4K0KB 1B3BA 3D6VA 3NBFA 1JE0A 2Q7XA 1Z6ZA 3SIXA 1Y3FE 3MQFA 5CHEA 3R3HA 3RT1A 3I5XA 3M82A 4Z4QA 2ZYIA 1C7IA 1AKUA 3AERB 2PSEA 1LRKA 1EHCA 1YO6A 2PH5A 2ZTHA 3GDOA 3EGCA 3PXCX 4E1BA 4ZTUB 4B3SC 1ENPA 1BCSA 1YZVA 4MUFA 1N0UA 2IUEA 4PLFA 3TDMA 2ADFA 4RHTA 1T8PA 1HYBA 2HD4A 2EGTA 2A4MA 2CNOA 3ADKA 1RMTA 5GJVC 3AKZA 4DKXA 1E92A 3AUXA 2AQKA 4ZP1A 1R0LA 5LOVA 4PEVA 4TWRA 3AXSA 2V7EA 4ZEVA 3KKLA 2GKOA 3VV3A 1PLKA 5AOCA 2NO7A 16PKA 4BLTA 1UM8A 5B4UA 2GPTA 4MKHA 2WU8A 4HLDA 4FDLA 4D02A 5JAHA 2Q5IA 3HGMA 4RESA 2ZP1A 4WZBB 2DTXA 4UBJA 2QVBA 3OJWA 3OFSA 1V3TA 2R84A 2WG1A 221PA 2UVPB 2NUAA 1RJWA 1CUVA 3ETOA 1V95A 2W48A 3KIPA 3SZGA 2FN3A 2HF2A 5CDSA 4ZVRA 5IK2D 2VJOA 1UC5B 5E6SB 4TQAA 1X86B 1A76A 2IYYA 3LLCA 1RYZA 1E2LA 2BISA 2YNMA 3T06B 1KIAA 2F9FA 3HUEA 1RSZA 2XYVA 3NXKA 3LXUX 1M34A 1MAUA 3IR6A 1BE0A 2JPDA 1BDJA 4YBZA 2E5LB 4IXTA 4DIKA 1WF3A 3VR6A 1DAFA 2GEJA 1LPBB 1W0KA 3BGWA 2YIVX 3PLRA 4O3FA 2PJZA 4KFRA 2MR5A 5EYPA 3TRFA 1PW5A 2O3RA 3O75A 4EUKA 4TROA 1JIQA 1XZLA 2ZBVA 4ITVA 3UXMA 2IV3A 1YMQA 4CCYB 1PT9A 2AW3A 1YR8A 3EDCA 4LZZA 1JLMA 2VPYA 3TR3A 3GDWA 3WLAA 5IKXA 4RZUA 2PV7A 5K0CA 5E6RB 5CMLA 4FLFA 4HADA 1M1XB 3GFBA 2ZROA 5C5CA 2F2TA 4WXHA 5AI6A 5G1NA 2NU8A 4HUJA 4BBAA 2DPGA 1VDMA 2PJDA 2MSCB 1CEYA 4UXJA 4YRBA 2J9RA 5HF5A 4TT3A 4YMGA 3WDMA 4CFZA 3R0ZA 2D28C 3I6BA 4H1WA 1DXHA 2EDAA 1E5DA 1X7ZB 3N2EA 3GD5A 1E3LA 3DL4A 3R5JA 4F12A 3KXDA 2QU7A 2EHJA 4A27A 3FDZB 1A27A 3AJ8A 5TEWA 4HXGA 1HWYA 5LDGA 4OQYA 3UZUA 1DHTA 1QFSA 1VCOA 3ELUA 3KG2A 4JR1A 4KMRA 5LQSA 1HH2P 1R3DA 1XU7A 3UXEA 1IBCA 5EKSA 5ITVA 5HUQA 1Y3IA 4GR4A 4XXHA 4LMBA 3B5IA 4PPGA 4R68A 2AA3A 4V0NA 5FPYA 2QRVB 4N8EA 1FBNA 1L5HB 1P6XA 5BQPA 1TAQA 4ROSA 3D3NA 3V4PB 1ZH2A 1Y34E 3TTTA 4C03A 4EKYA 5DBIA 3D6HA 3OOHA 2AKEA 2UUPA 3G5MA 4MS4B 4RD1A 4AJEA 2IVFA 5CLHA 1E1QA 3LNTA 1UK9A 2PN2A 13PKA 4IQ0A 3EZYA 3QEMA 3NQ41 1J7JA 4C06A 5D6OA 2ZXUA 1M34E 5EMLA 1AGYA 3GRUA 5KKAA 1MXBA 1X7XA 1M2GA 1DKQA 3E8XA 4TTPA 4F86A 5F52A 2QDKA 2BTEA 1ORDA 1KKLA 1V11B 2H0QA 3ECAA 3REOA 5DTMA 4C89A 1C8KA 4YRZA 2Z1NA 2PM8A 4ZI7B 4QRHA 2X3FA 2Y92A 2FZWA 1R0ZA 2OVBA 4IIYA 4KVZA 3TR5A 2P3SA 3ZJ5A 4KSBA 4YCNA 3V1NA 3OEEA 5MF6A 6Q21A 4DLBA 3SXUA 4ENTA 4X1YA 4KBGA 3OZSA 1YUBA 1MP0A 4IFIA 4E1VA 3LX4A 2AI2A 3G5AA 4UW9A 2LDBA 4MV9A 5BRAA 3QVUA 1ULZA 4M2LA 1HM5A 1CRZA 4ITRC 3PS9A 1YDWA 3GUHA 3SMQA 3MTAA 3SQOA 1Q7CA 2GRAA 1QU3A 4IDHA 3KOUA 4LXUA 5CVCA 4N0EA 5E1BA 4UKDA 2PAFA 1AQIA 3O94A 2ID7A 4A8JC 5KSZA 3DV0B 2LGJA 2FFJA 5JECA 4C0KA 3KQNA 2PT5A 3DDNA 5K85A 2VRNA 3ZZ1A 1A9QA 1CF9A 1J56A 3TCNA 3UJAA 2Q6TA 3FJYA 2RI1A 1GZ4A 1HMPA 3UWMA 4DQDA 1SVLA 2JFYA 4LISA 4DV0B 4YGXB 2DQZA 1NW4A 3G68A 1BE6A 5DBGA 1HTTA 2I2WA 2JF0A 2QHXA 3W3AA 3KZVA 4PCAA 1P5JA 2GCPA 4TTRA 3TKLA 3U3JA 4BUCA 4E0BA 5K8VA 1NDHA 1G9SA 4AZVA 1LDBA 3W2HA 4ME6A 2PO5A 4OI1A 4WZ6A 4CT4B 5H5JA 3EYAA 3NJ8A 5EHQA 4WLVA 2FETA 3L6OO 4KQWA 4O1MA 3SX2A 3AI7A 5BV7A 3GJXC 4V24A 4X3PA 1E6CA 3O2NA 2M6RA 5FIUA 5CB4B 2H1IA 2LXNA 4RHFA 1V16A 5G0UA 1Q84A 2HT6A 4K9LA 4EHBA 4S04A 5M2QA 1M83A 1RLTA 2WSIA 3OZUA 4BO4A 4ZA2A 1YNSA 3PNSA 3JWHA 3NRJA 4ZCSA 3TO5A 2OQRA 2GPJA 2VAMA 1TEVA 4HH1A 1GV0A 2GZHA 2ZRFA 4N3AA 3W2IA 3WLHA 4EX6A 2B34A 4YJHB 1B7GO 4DR7B 3S3TA 4XW2A 2OO5C 3RW9A 4U0JA 1DI0A 3NGLA 1WXEA 4NNOA 3KTAB 3MJRA 4G81A 3ANNA 4KC0A 4P35A 5TGDA 3PNQA 3VTFA 3WKCA 4FVTA 5K3SA 2DB3A