4DCUA

Crystal structure of b. subtilis enga in complex with gdp
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
432
structure length
400
Chain Sequence
KPVVAIVGRPNVGKSTIFNRIAGERISRIYSSAEWLNYDFNLIDTGGPFLAQIRQQAEIAMDEADVIIFMVNGREGVTAADEEVAKILYRTKKPVVLAVNKLYDFYSLGFGEPYPISGTHGLGLGDLLDAVAEHFKNIPETKYNEEVIQFCLIGRPNVGKSSLVNAMLGEERVIVSNDAVDTSFTYNQQEFVIVDTAGMRKKGKVYETTEKYSVLRALKAIDRSEVVAVVLDGEEGIIEQDKRIAGYAHEAGKAVVIVVNKWDAVDKDESTMKEFEENIRDHFQFLDYAPILFMSALTKKRIHTLMPAIIKASENHSLRVQTNVLNDVIMDAVAMNPTPTHNGSRLKIYYATQVSVKPPSFVVFVNDPELMHFSYERFLENRIRDAFGFEGTPIKIFARA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-BINDING PROTEIN ENGA
publication title Potassium Acts as a GTPase-Activating Element on Each Nucleotide-Binding Domain of the Essential Bacillus subtilis EngA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Hydrolase
total genus 134
structure length 400
sequence length 432
ec nomenclature
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF14714 KH_dom-like KH-domain-like of EngA bacterial GTPase enzymes, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 4dcuA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dcuA01
5EXSA 3HU2A 5JEEA 4KU4A 1TUEA 2XR1A 2VRWA 1KI8A 4JI7C 1JQJC 1U99A 3MAAC 1Z83A 3CR7A 2BJWA 2H16A 1YZQA 1G21E 3AF1A 4UNNA 2DB3A 3NIBA 4PZZA 2CXCA 5J40A 4TYNA 2AD5A 3CZPA 4RCYA 1QHHA 2D7VA 1W4BA 1XD9A 2CL7X 2V4ZA 1GSIA 3EWSA 1XEWY 4JLBA 3R9WA 1NMXA 1M6NA 1W48A 1W47A 3SU8A 4LF6C 2CLCX 3TUZC 1BIFA 3FGNA 2GZHA 4PC1A 1FNMA 5JS7A 1GFIA 2A3RA 4EKDA 2UXDC 2WWWA 2ZANA 1PA4A 4G5QA 4PPQA 5LDDC 5AJWA 1AN0A 1ESMA 1NVUQ 4ZIRB 1G9XA 1L4UA 1VCIA 4P4UA 2Q3HA 3RS2A 5FPYA 1BMFD 4BFTA 4B35A 3EZFA 3AVYA 1G7RA 2J0VA 2Q3FA 4MKHA 3K0AB 2BVNA 3VR5A 2YOFA 5AJZA 3BH6A 5AJYA 4Q5IA 4BFSA 2DFTA 3AVTA 4N0EA 3ND8A 4TQAA 4BASA 3KZ1E 5GADl 3GMTA 3NKVA 2ZI3A 5G40A 2VHUA 3QY0A 3Q9LA 2QTVB 5HE9A 1FNNA 5DI9A 2J87A 4QNRA 4DCNA 1Z22A 3LH5A 1TF2A 1C9KA 2IYTA 3F3YA 1J2JA 2H5EA 4LJ6A 4MRRA 4Q4AA 3AUYA 1N6OA 2ZUDA 1U98A 3GLIB 1Z0AA 4U00A 2G0TA 2NO9A 1G3RA 3WNDA 4Q1BA 1XTIA 4IDQA 1KK2A 1KI6A 1QRAA 1U90A 4B3BA 4QBFA 4LBYA 4V0OA 1R0ZA 1T5IA 3BOSA 4NKRA 2NO0A 2OCPA 2VO1A 4OI4A 3ASZA 4D0LB 4B3TC 1ZUIA 1E0JA 4Q03A 1QG4A 3DL0A 1C4OA 4GP7A 2GVZC 2VPPA 1U8ZA 4DDUA 2SHKA 3MFYA 1ZIOA 4TL7A 4Z51A 1V5WA 3LUSA 4BZXA 1QHGA 2QL8A 3LXXA 2Q9BA 3QKRA 4M8NE 3H1TA 4HATA 2PEYA 4UNPA 5AUPB 1R5BA 4RKEA 5IDVA 4JVMA 2JLSA 5D3QA 4KLNA 5AJXA 1COWA 2O0HA 3IIJA 3VQTA 1Q3TA 3D31A 5DIFA 2FG5A 2QRNA 2J0UB 3VTKA 3RRMA 5CB6A 1E32A 4MITA 2ZI9A 2ZU6A 1OPXA 1S3SA 3L2OB 5H68A 4DUYC 3DPUA 1E94E 3CWZA 1RRPA 1IXRC 1SULA 2BKEA 2BKUA 3AQ4A 3CM0A 1S2MA 4Y0VA 1OJLA 1P9WA 3OE7A 1Z0KA 4DR4C 4Q4JB 2KI5A 2A2ZA 1UKKA 3UXMA 4L9WA 3FKSD 1OKKA 1A4RA 1N6HA 3R7WA 1CBUA 2FMXA 2OBLA 1E2NA 1USPA 4DR3C 1XJ0A 3VR6A 1XMQC 1IN6A 1Q1EA 2WAXA 3KXKA 3ICEA 2IYUA 2FSHA 2A78A 2VP6A 4TLAA 4OI1A 1Z06A 3RS5A 2O5VA 3NBYC 5CDFE 3D7MA 2ZROA 2Z43A 3ONWA 2FF7A 3U4QA 3NDPA 1J7KA 1N5JA 1VCMA 3T06B 1D9XA 1H8ED 4AC9A 1WBDA 2Z6VA 3SHFA 3MCAA 1RYHA 3PEUA 5J5CA 2JLUA 1DVRA 4BFWA 3SI7A 2OBNA 2IXGA 1Q22A 1ZINA 4DUZC 3LQQA 2ORIA 5FL7A 3ZZUA 3EERA 1KSFX 1Q1ZA 3LRPA 1J90A 2E8EA 2PCJA 4YC7A 5HR5A 1HYQA 4DB2A 4POAA 2EQBA 3CNOA 2GEVA 1LNZA 2I1QA 1KO7A 2X2EA 1XJQA 3A36A 2ZYWX 3FTQA 1DPFA 4A0GA 4JJZA 3B6EA 2NO7A 3BWDD 1T3SA 2ZITA 5EUMA 3ZVLA 2C03A 4AYXA 4B3RC 1TL7C 1GG2A 1OHHA 1VYUA 2YWGA 1NL3A 1FW6A 2KZFA 2E87A 3OIWA 3Q85A 1P3JA 2JJ1A 4XH9B 5AJVB 5KNDA 1JR3A 1XX6A 1PZNA 3BJIC 2J7PD 2DPXA 2E1RA 1F60A 4DT1B 3M0EA 3K0CC 4Q01A 1N32C 1XEWX 3TAHA 4DV0C 3H86A 1AK2A 4PAMA 5KDLA 1IN4A 4ZIRA 1KNQA 4F93B 4JLMA 3U7FB 3N70A 4L16A 4B3MC 1TEXA 3X1XA 4MUBA 2XJ4A 3RNLA 2JLXA 3AV0B 1TUIA 2DWQA 3QF7A 4DR2C 1YQTA 1SQ5A 3K0AA 3K70D 2GJAA 3C16C 1JOSA 1Z08A 1Q44A 1KDRA 1OE0A 2XNDA 3P20A 4HAUA 5CIQA 4CZ2A 4EQ6B 4ZKDA 4Q66C 4UXHA 1OH7A 1PJRA 1FX0B 4TTRA 4F4JA 3CBQA 2W2VA 3CH4B 1P9RA 3CX7A 4MTNA 1OXSC 1RZ3A 3CW2A 1NKTA 4Y0AA 4WOPA 4RZ2A 3IHLA 1N6IA 1R0YA 2CHVA 2QPOA 3EASA 4M1TA 4A82A 2WJJA 2AHOA 1JAHA 2IC5A 2MSCB 5CLQA 5FPTA 4WVFA 3CRRA 3GLIA 3LBHA 1U0HC 3CNNA 5BN5A 3UATA 1HNXC 1NBMD 4L15A 1CRPA 5BYKA 1I94C 3KXIA 1F3OA 4I1UA 4LYAA 1CS4C 5DHFA 5LB2A 4ASUD 2P6RA 1FZQA 1RFLA 1RKBA 1YR6A 5K8UA 4YXWD 4CRWB 1Y3AA 1W2GA 1GVNB 2W58A 1GNRA 1U9IC 4PO9A 1JXMA 3QXJA 4UJ3A 3RYTC 3TUIC 3ZD6A 1CR4A 1KDOA 1X3SA 2QZ4A 1JR3E 2IYLD 3PG5A 4QM7A 1G7TA 4JZKA 3G5UA 1S9DA 5SZIA 3VR4A 2VSOA 3ZS9A 2IYZA 1OIVA 3WXMA 2RH5A 2YZ2A 3KKMA 3PEVA 2YC2C 2J0UA 3ZVNA 2F1IA 2V7QD 5D3MB 4EPRA 3CPHA 1CULC 1A2KC 1U0LA 2EW1A 2OFWA 2YOHA 3TAUA 5J47A 5KOYA 2ONJA 3H84A 2DWOA 4ACBA 1XNRC 2X1VA 1OF1A 2C9YA 1DE0A 1XMVA 2OV2A 3DKVA 3PIRA 4XIGS 2R44A 1SVKA 1ZNYA 1Q21A 4UJ5A 5JJLA 4Q4JA 3WYGA 1HE1C 2MMGA 2ZSAA 1HURA 4JV5C 5GJVC 3SQXA 2RGEA 1EXMA 1UDWA 2V54A 1QHXA 3K9LA 3OE7D 4KODA 2EWVA 4X8LA 5IK2D 1XB2A 5J4LA 4BE7B 5A4JA 4IDOA 1OKKD 2V6JA 1E9DA 4TL8A 3T5DA 3EPHA 3OEEA 3GLIE 1OH8A 2HT6A 2XITA 4LJ5A 3WYFA 2BBSA 1ZM4A 4YMTA 1XD8A 2D3WA 3KUDA 3ZLJA 3NC1C 4DV7C 4M1MA 5F9HA 2YWHA 1JEDA 2GWHA 2OESA 2QAJA 2FWRA 4O3MA 1EESA 2PEZA 1P2UA 4QGHA 1WXQA 4Q1AA 1YRBA 1RW4A 2PLFA 3D8BA 3K9HA 1IBRA 4G3XA 4HI0E 4PPGA 5FOSA 2C78A 4F4CA 2PT7A 4AKHA 4K0KC 2XOKD 3BORA 5JZVA 1X1SA 1E4VA 3RWMB 1M2OB 1NIPA 1E2PA 4HAVA 1LB1B 5KDDA 1G8HA 3NHBA 3JVUA 3ZS8A 1FTSA 1ODFA 4LHWA 3KKQA 4E22A 3QBTA 3QSYA 4DV4C 3IGFA 4G1UC 2WSSA 3SR0A 2ZRKA 4GNKA 1WF3A 2DYJA 1G41A 3FVQA 3NWJA 3A4NA 4RD0A 3UANA 1IBMC 2W2TA 4C0QC 4URWR 4A6PA 1E1RD 1W4AA 4C0JA 3QG5A 2QSZA 1GKUB 4GP6A 4ZV4A 1E98A 1GOTA 1UBGA 2RHMA 4LHZA 4DT1A 2BJOA 1DO0A 2IYRA 1T3LA 4CGZA 3T34A 1AGRA 1XTRA 3RRNA 2P5SA 1SVWA 2BDTA 3I62A 4E03A 2GCOB 4LJ9A 2ZU0C 1KZ7B 2PBRA 3LVRE 2BM0A 3DM5A 1YRAA 1I4LD 3ZQJA 4JI3C 1KKLA 2WKRA 3U7HB 1JB1A 2LWIA 4EQ6A 3RANA 2IA5A 1E9EA 1BS1A 1GNQA 1FX0A 1P62B 3AGQA 621PA 3AF4A 3BXZA 4BEJA 2C9CA 3SN6A 3PR1A 4EFLA 1AKYA 2XNDD 3GJ3A 1G1MA 1G17A 4JVLA 1AQUA 2OT3B 1XCMA 4NBSA 4DIDA 1XMIA 1RYFA 3CRW1 4JYBA 3EC1A 4NHOA 4L4UA 3TK1A 2J1LA 4BZPA 3IO3A 3LXRA 3NXSA 5JECA 1TNDA 5C4GB 2F1JA 4CEJB 1Z0FA 1A5TA 1PLLA 3HYTA 3LO5A 1N2CE 4Z1MA 4BLSA 1GUAA 2NPIA 4YLGA 2IS1A 4ZPXA 3U61B 3EPLA 4PANA 1XNJA 2RGNC 4BWYA 1L2FA 1F48A 4HLUA 4QJ5A 3KQKA 1HUQA 1S9HA 3GJ7A 1HNWC 3B78A 1WDTA 5H1YA 1W1WA 1DAEA 2ZYUX 1E2MA 3F0TA 3F5FA 1UEJA 3KUCA 4LC1A 4PHGA 4KI0A 5JWRA 1M7GA 2R6AA 4NYMR 2OPLB 4HYYA 3VR2A 4LJ7A 3U60B 1GP2A 3BB3A 4B44A 4BEBA 4JKYA 2WWGA 1GITA 2F1HA 1Z6YA 4EPTA 3FDIA 3ADDA 4KFUA 2WZQA 1W36D 2RGCA 1KK1A 5GJCA 1X6VA 2WAYA 3TR0A 4F91B 5D3MA 3AVVA 4A8JC 4MYUA 4TL9A 1G8YA 2FDCA 2AWOA 4V0NA 1JAIA 3UKDA 2IL1A 4NZYA 4TYWA 3EIQA 5L3SB 4DDWA 2OCAA 2CLSA 4DBLC 1KMQA 3R8CA 3U7EB 4NL4H 4GOXA 1NLFA 5DE3A 2QMOA 2W6JD 2CLDX 1HT1E 3ND9A 3A58B 3BC1A 1SXJC 3K0FA 2VP2A 3AKEA 3QF4B 3THOA 2FFHA 2RGGA 2R6DA 5HZKA 3BGWA 1TU3A 2GZDA 4QHSA 1KO4A 2GEUA 4G0NA 4DKXA 1VHLA 1IM2A 4JMPA 1ZW6A 1G18A 4QL3A 3EWAA 4QKQA 2D74A 4G5SA 4US2R 1RVDA 1EWRA 5KO2A 1AS2A 1ESNA 4EAQA 2ANBA 4OHYA 1DAGA 1U8YA 2FSGA 4PSVA 2GAOA 3U3MA 4N3NA 1ZC3A 4MA4A 3SJAA 2VEDA 5L3RA 4ESHA 4GT1A 2LKCA 1K6MA 5FBRB 4HUTA 4PZLA 3GP8A 4K8OA 3HP1A 3VX4A 3CLVA 3LD9A 3LX8A 4BLRA 5L3VA 3K0SA 4B73A 1KTVA 1F2TB 5C46F 3R9IA 4B2LA 1G6OA 3GJ8A 1VIYA 1W0KD 4DLSA 3KB2A 1YZUA 2HHHC 4V0MA 5EE1A 3REFA 5L8VA 4PFSA 1UBFA 3SYLA 4CW7A 1NIJA 5LD2B 4AD8A 3ECCA 4XVUA 2ZSEA 1FUUA 1QVAA 3VKHA 1BMFA 1KO5A 1PUIA 1D2NA 1E0KA 1CJVC 1XMSA 2G83A 3T1QA 3K70B 1JQLB 1QHSA 2W6ID 1OLOA 3DKPA 2C96A 3EZ6A 4GI7A 3TH5A 3VAAA 4A2WA 1KI7A 4JT4A 1KSGA 2IYSA 1K5GA 5KHOC 1SVIA 2HYIC 2DR3A 1N2FA 1CLUA 1W0JD 2HCJB 4IRUB 2QE7D 3CF0A 2D7DA 2GCOA 5FBQB 4D26A 2HUPA 3CR8A 3TLXA 1FFHA 4GZLA 3CONA 2C04A 2NQ2C 2VP0A 2ZRAA 3DVLA 2ZM6C 2QM7A 1AS0A 2NMVA 2WWIA 4G5GA 2C8VA 4MUAA 2WWFA 3CX8A 5JFGA 4Q4LA 3EX7C 1RJ9B 1TF5A 1YHNA 2WBLC 4XWAA 3U3JA 1UKYA 1EX6A 4FMCF 3RHFA 3TGPA 3EZ7A 2O8BB 4W7SA 2G3YA 2WICA 3B1VA 1EWQA 1KAOA 2IXEA 2QT1A 1DADA 3V4RA 1CEEA 2IYWA 3UMRA 3MSXA 1E2KA 3W90A 4FMDF 4Q7JB 4E07A 2BEJA 2AKAB 1J5EC 1TADA 1UM8A 1ZC4A 4AIIA 2ZRFA 4UQOA 3OIUA 4CEJA 2ZJ5A 3WMFA 4D4KA 1NVVR 4GPTA 2XB2A 5IRCD 1TQ2A 2LCFA 4XTCS 1ZNWA 4O2LA 2X19A 3FHOA 4NCIA 2NTYC 5TDHA 4JI1C 4EPVA 3PVSA 2XNSA 3KKNA 3N2EA 1X8KA 1ZCAA 3QXHA 4V0ME 4PSKA 4ABYA 4RSGA 3BB1A 1SZPA 4DIEA 1VHTA 4FMCB 1OFUX 2OAP1 2PH1A 4OJQA 2VP4A 2ZAOA 4WIAA 4ZCLA 4D4JA 5E7MA 4XD7D 2OPLA 3LBNA 4FCTA 3T61A 1E9RA 4FMDB 3NHAA 4GZMA 4NMMA 2XSZD 4OHWA 4US1R 5FOTA 1OYWA 2O8CB 3TQFA 4CVNA 4M1SA 4M1OA 5FI0B 3FKSA 2B7BA 2ZVPX 1UKEA 2FU5C 4TTPA 4QHTA 2FPLA 1N5KA 1VMAA 1OXVA 3ZIAA 5HTKA 2PT5A 3KB1A 2XZPA 2YWEA 3MWLA 1JEEA 3LW8A 4JI4C 2O52A 2WJGA 2BEKA 4GMDA 4OI0A 2JIZD 4DV3C 1RRFA 2HXSA 4D25A 4BSZA 4OQXA 3EPKA 1M7BA 2ZJAA 1KO8A 5L3SA 1RRGA 4V0LA 3EC2A 1GWNA 1VYTA 5TY0A 2CVHA 3BRWD 1L7VC 4NYIR 2WJYA 3WHKA 3IBGA 4HZIA 2GBLC 2QRZA 2ZJ2A 5KUTA 1X1RA 2QPTA 1XF9A 4B71A 4JL5A 1X8JA 5LB4A 3B5JA 4QC2A 3QF4A 3GLHB 1NJFA 2ZI5A 1F6BA 5KSPA 3TKLA 4LFAC 4B6FA 1B0UA 1SGWA 3HR8A 4QFMA 2JATA 3IIMA 3WMEA 2JLWA 2KJQA 4YDHB 5J4VA 4GOJA 4BRWA 5LMNC 2A9KA 3L0PA 1SVSA 1OW3B 1NVWQ 1G20E 1YR9A 4DB4A 3J81D 2WV9A 4JLOA 3NG1A 1ONBA 2EVWX 5G41A 3GJ0A 3V00A 5CJPA 4M1KA 1Z2AA 3OAAD 2ZVQX 5DYGA 1OSNA 5J4YA 1E2FA 2G6BA 3DMDA 1F2TA 1NYEA 3U2QA 4PC7A 4EFNA 5JHGB 2J7PA 3GEEA 2NZJA 4QGAA 1P60A 1NY5A 3C5HA 2WIAA 4DLWA 3SEAA 3FMIA 1E79D 2QBYA 4LYHA 4NP6A 1WH9A 3OF5A 3KQHA 4Q9JA 3SDZA 2VHJA 1YVDA 5JWOA 2C2HA 2NO1A 3LW7A 3B82A 3N2IA 4A1FA 2NGRA 4UNSA 5IWAC 2RKOA 1M1YE 1S96A 4BFVA 3NDBB 3CIOA 1NG9A 4QG7A 4S35A 1Z07A 2HF8A 2VHCA 5AWFC 1N34C 5BXQC 1G4AE 3IBYA 5ELXA 1NMZA 1BYUA 4JLAA 4D81A 1G3UA 2KE5A 1UF9A 4CEHB 1GAJA 2E7GA 1HH2P 4M53A 2O8DB 3UIEA 1T0HB 2ZI7A 1R8SA 4IW3B 4B3SC 5E7IA 5KPJA 2F4VC 1SVMA 1GL6A 4RD6A 5FR2A 1RPZA 5EE5B 5B58C 4HLDA 1RE0A 1RJ9A 1NBMA 4IDHA 2O8BA 2H7VA 5J4HA 4P0TA 4LK2A 4LF7C 3I92A 5EE3A 5HZHA 1E6CA 2QY9A 1N6PA 4JJKA 1A7JA 3TVTA 2ONKA 4HLCA 5FI1B 221PA 3DMNA 4ASUA 1JPJA 2OFOA 2VA8A 3AF2A 2DYKA 2QPAA 2EFHB 3X1YA 5LPNA 4YXWA 3EZ9A 4L8GA 2XX3A 5KDOA 1WP9A 2ODEA 1E2IA 2F1RA 1XPRA 1XRJA 1LS1A 1U81A 2AXPA 2ORWA 2R6GA 4DXAA 2J0SA 4KFSA 4YMWA 4IXNA 3BAFA 1AM4D 4AI6A 1H8HD 4DRZA 3CO5A 1W36B 3LWNA 4A2PA 2D06A 1X8LA 2B8WA 3E5HA 4LX0A 2FPMA 3LVQE 3MWKA 4M0LA 4BECA 4BGDA 3KFVA 2V7QA 4Q9LA 4KCGA 4AYTA 3H4MA 1E2QA 3AUXA 3K09C 2GRJA 2BC9A 1Z29A 3I72A 5AR1A 4Q1FA 4IJMA 4Z8XA 1CR0A 1YE8A 4E5UA 4Q9IA 4W5JA 2O8CA 3DM9B 4HAWA 4M1YA 4H9GA 2RGAA 1M74A 3CRQA 4MKGA 2A5FA 1I2MA 1T8TA 1XFAA 4JI0C 1D2EA 2FFQA 1VG9B 1ZBDA 1JECA 2A7QA 1DO2A 5SZJA 2FFBA 5IK2A 3GQBA 1QHYA 2BBWA 3TQCA 1MKYA 5LMUC 3B1YA 4NH0A 2FSFA 3RLFA 2RCNA 5HCNA 4CEIB 3ZIAD 5GVRA 1NMYA 1VYVA 2VSFA 1NBME 1P2VA 3FE2A 1II0A 3E2IA 1QG2A 3QG1A 4HDCA 2AR7A 1S8FA 2CCKA 4MYTA 2WKPA 4YONB 4KVGA 1OFIA 2GTPA 3SE0A 3GLHA 1KY2A 2D4HA 5CM8B 4OK3A 4LC0A 2XOKA 4FINA 1G5RA 4C0AC 2PL3A 2ZI6A 4R2HA 2AD1A 4TLDA 3P4YA 4ZDJA 2GCPA 1BOFA 1D9ZA 3WNCA 3AF0A 1M8PA 5FOWA 4O0MA 2QQ0A 3EXAA 2A30A 2UKDA 5JJKA 3EIEA 1E2LA 3TRFA 4B76A 1KKGA 3AVWA 3SFZA 1DAHA 1E1RA 5JHHB 1ZB8A 2D7CA 2HEIA 2VF7A 4R9UC 4LI0A 4S2EA 3R9XA 1SKQA 1R0XA 4N0DA 1P4SA 3N5CA 2ZTSA 2YKGA 4C7OB 3Q72A 5F9FA 1T5LA 4NYIQ 2E8FA 5SZHB 4JSTA 3G0HA 1BH2A 1JPNA 3W5IA 1N5LA 1KMHB 1GKYA 1ZD9A 2FV8A 4KFRA 1NSTA 1ZAKA 2GDJA 2YWFA 4X62C 1HV8A 3CB4A 4MRPA 4OL0A 5FPHA 3IPYA 2NPFA 2CCJA 2X2FA 4QBIA 4NONA 5H70A 2CHQA 2XEXA 3RABA 1GTVA 4OQLA 3IEVA 4EJSB 3TW4A 1FMJA 5F3WB 1PVOA 4HSEA 3K9NA 1O3YA 3W5JA 4B2IA 4I1OA 2NO6A 2IEZA 4DSOA 1CXZA 2FNAA 5TVKA 2OILA 2JGNA 4F92B 3FFBA 2F3RA 4ZI2A 3W3AA 5JCZA 4LJYA 2JASA 4CEHA 2HV8A 4XSGA 1R5OA 1YZGA 3NTUA 4IFBA 4LV5B 4Q48A 3HWSA 2ZE7A 1FQKA 4AKEA 3I8XA 4MRVA 3ZQ6A 1Q57A 2O8DA 1HEIA 1WQ1R 3Q5EA 5FBWB 2IYQA 3JAMD 5SZKB 4JT2A 4OJKA 3GLFA 4TSFD 4MRNA 5L3QB 1A1VA 3X1DA 1NF3A 1IHUA 2BMDA 4GKJC 3A37A 4WXPA 2GILA 1MRSA 3QPUA 1NN3A 4OI2A 3KQNA 3VKGA 1HE8B 2ZAMA 2C98A 5JI2E 3L8ZA 2Z4RA 2QGZA 3IIKA 1S3GA 2WJIA 4NXNC 4KAXA 1FOEB 2CMKA 4JLNA 2PZGA 3QVUA 3E1SA 4IEEA 2VTKA 4OHXA 4LOAA 3RSLA 4A0HA 5H8WA 1MO3A 2RGDA 2E5LC 2OUKA 4C0LA 2ZS9A 2QAGB 1KK3A 1P9NA 4TMZA 3T35A 2C77A 1DS6A 2GAAA 2CL6X 3I3SR 2R9VA 4XJXA 5FTMA 4BLQA 4ZO4A 4OHVA 3NH9A 3FKQA 1UAAA 2H8KA 5CIWA 4TQUS 3REGA 1MO5A 4OK5A 1ZP6A 2VP5A 2XJ9A 2ZSDA 3V9PA 4RCZA 1W7AA 3IQWA 4IOJA 4B33A 1XXHA 1P75A 3A4MA 5EXTA 4QM6A 1G6HA 2UUAC 3SHWA 2FE4A 4F4IA 1CR1A 4D82A 4MKFA 3ZVRA 3KTAB 2ZR7A 1Y63A 3EW9A 3KXLA 3LLUA 1VG8A 4OK6A 2H17A 4ZDWA 4EPYA 4B32A 2JJ2D 2VIIA 1E69A 2N46A 2ZRMA 2W6JA 3B8HA 2BV3A 4FCWA 2QTFA 3Q3JB 2MSDB 4QGFA 1DG1G 3RDPA 1E9CA 3FMFA 2ATVA 3DHWC 3DZ8A 3W6OA 4CEIA 2HXYA 2F7SA 2AWNA 3K0FB 2VYFA 4F38A 4US0R 3U6KA 5GJBA 3MD0A 2IS2A 1MH1A 1LF5A 5JSZB 4TTQA 1U0JA 5BQ5A 4MQBA 2DFKB 1KNXA 2EYQA 2X8AA 2ZREA 5M04A 3Q5DA 4PHHA 2ERXA 1NJGA 4DCTA 2IBMA 2XGJA 3KJHA 3OEHD 1NNEA 3NH6A 5E95A 1RC8A 3M6AA 4RFSB 1G64A 2ZYTX 1P2TA 2KBFA 2O0JA 4DWJA 3BERA 3B85A 3RC8A 1DAKA 1AZTA 1W0KA 1Z3IX 2I4IA 2CY1A 1LV7A 4M21A 1XZQA 3AVXA 2DFNA 4DR5C 4KVAA 1XP8A 4URVR 2R6FA 1K8RA 2QI9C 3AGPA 4ON9A 2JEOA 3SBEA 5JJIA 5G3YA 1G291 4QBHA 4HEJA 3B7GA 3VKWA 3ICQB 3DZDA 2VSXA 2W6IA 3CNLA 1KJZA 5CJ2A 2Q9CA 4HB4A 3G82C 2IUSA 3ZD7A 3NC0C 4IDPA 2FX3A 2VLIA 1OH6A 3GPLA 4C7OA 5DLQC 3PITA 1XPOA 1W0JA 4DEYA 4KJZA 2QE7A 4D0GA 4XWKA 3ADKA 3L43A 4LV6A 4TMWA 4BUJA 4PC6A 1KMHA 1YZTA 2Q9AA 3A6PC 3WP1B 1G4UR 1FP7A 2F9MA 4DEXA 4LF5C 1SVOA 2WMOB 5EP2A 2GA8A 5DSZA 2R6CA 4G5OA 4EJSA 2HLDA 2ATWA 3PUYA 2ZUCA 2C9OA 3CJEA 2ZRDA 1J70A 2P0EA 5AUOB 2OFXA 2AK2A 3MWJA 2ASEA 1OIXA 5FOVA 4C0HA 5B57C 2JLYA 3P4XA 1UBCA 2ZETA 4URYR 3X1WA 3R20A 4NOZA 2JCSA 3QKSB 4URZR 2FGKA 1G8GA 3NEJA 4NDZA 4Q4HB 4IKEA 3GLGB 1Z5ZA 2QGNA 3A1TA 4PAQA 3RWOA 1G5TA 1P61B 3QJYA 4KHPC 4DUGA 5FPKA 1ETUA 1Z8FA 2R62A 3SOPA 1GILA 3W3ZB 5TB5A 1AIPA 1GKIA 1HQCA 2EWWA 4TYQA 3UMFA 1YZLA 1YZKA 5L3QA 1DAFA 3CH5A 5HPYB 2H1LA 4M2LA 2IUUA 2PT7G 5CK4A 1US8B 3TMKA 2Z83A 2ZJ8A 4UNQA 2CHGA 3AP1A 1KDTA 1DEKA 3GJXC 5FL3A 2ZEJA 1N36C 2WIBA 2IS4A 3W6NA 4D4MA 1NRJB 4YMVA 1UKVY 4XD7A 2QAGA 4KBGA 4MGIR 1XTSA 4GKKC 1F2UB 2XSZA 2ZS8A 5FTKA 3GCGA 1OXTA 3ZGXA 1MRNA 2QROA 3U3OA 3BFKA 2F55A 4U7DA 4QRHA 1AA9A 1DOAA 2BM1A 5JMTA 4FN5A 2QSYA 4PC2A 3QNUA 3H2YA 1PLKA 3QOFA 3SQWA 2AN9A 4LPKA 1VECA 3EA0A 4B3CA 2JIZA 3NEYA 3TSOA 2B92A 2GXUA 2OO7A 4DLZA 3WY9A 2RGBA 5A0FA 5DI3B 1JXOA 3AVUA 1U94A 2ODWA 1P6XA 3JZAA 3KTAA 1IJEA 1T6NA 2CK3A 2JDIA 1HT2E 2QQEA 4BPBA 2JLVA 1E96A 3O8CA 2GJ9A 1WMSA 3OFND 4NCHA 4YMUA 1DBSA 3FOZA 4LHYA 2VL7A 1T91A 3ETLA 3L82B 2BIFA 3ZZTA 1JI0A 3THXB 1J8MF 4LFBC 3THWB 1EX7A 3F8TA 2ZM5A 1MOZA 2FSIA 2GBLA 1XCPA 2EFCB 5A2QD 1ZRHA 2GK7A 5HCIA 2PZFA 4Q1CA 5JSZA 1ZM3A 1N5IA 3LBIA 1HR0C 1W44A 2ZJYA 2UXBC 3VNUA 1R6BX 1F5NA 3AVOA 5FUYA 4A2QA 4O25A 1I4DD 3TSZA 4HAZA 1SXJD 4R7ZA 4H1VA 521PA 2IXFA 4UNRA 5FTLA 3LLMA 4DV1C 1TAGA 3B9QA 4LYJA 1KI4A 3OAAA 3CF6R 4IDNA 1IQPA 3V4FA 3SZRA 4HLQB 4RD4A 4RFSA 4C4PA 1IBLC 1KYIA 4KBFA 4NYJR 2ZRBA 2ZRLA 3BH7A 3P26A 4MGYR 2CNWD 4A92A 4HB2A 4PQFA 3QVVA 5FTNA 3K8YA 1E79A 1DELA 1CJKC 5FUVA 3DO6A 4GOKA 2ZRJA 2ZRPA 4K81B 1G3MA 1R5NA 2I1VB 2IEYA 3IEUA 5KPDA 1AQYA 3OIYA 3OIVA 5FOXA 3O8BA 4CF7A 4MKIA 3CRMA 1CJUC 2GVDC 2PX3A 2WOOA 1KJWA 2IUTA 4WZAE 3UK6A 2QBYB 2RGXA 4IEIA 4LBVA 3WRYC 2OAQ1 2FEMA 3QXXA 2V1XA 2H92A 1OT3A 2XXAB 2GETA 1EG7A 3QEJA 3TW8B 1OB5A 2OEPA 4LJ4A 3IO5A 3UWOA 1ANKA 1XEFA 1GM5A 4Q7MB 4ZKEA 5UKDA 3QKUA 1LY1A 3LNCA 5EQTA 4ZCIA 3ZH9B 4PR0A 1CU1A 3PUXA 721PA 2WJHA 5C18A 1MO6A 3K53A 4HDOB 2WTUA 2B6HA 2UZIR 1S0UA 3TUJC 4JKIA 4IVQA 4NPHA 1X86B 3LX5A 1YKSA 5DHAA 5GVSA 1FPMA 3L0IB 2XAUA 2VQSA 3QEOA 2TMKA 2HLDD 4WZ6A 2C5LA 1K5DA 1TMKA 3QKSA 4PXAA 5EZ6B 3GKUA 4Q4HA 3GLGA 2ASBA 3O8DA 1N33C 1KK0A 4E09A 1KHTA 1RIFA 1CJMA 5B64A 1U8AA 4DDTA 1T4GA 3RS0A 3ZJYA 2OCBA 3THYB 2CEAA 1VTKA 1KI2A 2HCBA 2ORVA 2PJRA 2BHRA 1SHKA 1ZMXA 1XMOC 1E0AA 4LCBA 2Q3MA 4AQYC 4DUGD 1H8HA 4DR7C 2J46A 3AVQA 4WA7A 1CF4A 1KOFA 1US8A 2OXCA 5KNBA 2FA9A 2Q6TA 4RFVA 2JLZA 3Q7PA 1VCNA 4BFYA 1N0VC 4MYCA 2YV5A 2FZLA 4G01B 3X2SA 4LUCA 1BKDR 3PJRA 4LY6A 1F2UA 3NVAA 2F43A 1Z6GA 2UUBC 4LJAA 2GXQA 3AKDA 4LF9C 3K09A 4HZUA 5HKKA 4DLYA 1E9BA 5GJWC 2AFHE 3C5CA 3LAWA 1ZNXA 1E2HA 4MGKR 4TT3A 4LWZA 4HLUC 3HU1A 4M9XA 3LY5A 4RD2A 5C2JB 3AVPA 4FMBB 1Q0UA 5DI3A 4C0KA 1QHNA 2KSQA 1ZVQA 1IJFA 2IT1A 1HTWA 3C8UA 4RD3A 5CYPA 2VHQA 4OQFA 4KITB 2Y8EA 1G7CA 1GRRA 1CR2A 3KKOA 4DV5C 1R7RA 3VMFA 2UXCC 4XVRA 2JDID 2CK3D 2GZAA 2QG6A 1Z2CA 1LS6A 4ITRC 3THXA 2VP9A 2A5YB 3THWA 4JBYA 3DOEA 5IT9D 4QNMA 2W2XA 1J8YF 1G5PA 3BBPA 2WJVA 5CB8A 4M9ZA 4C30A 3QQ5A 1EFTA 2XZLA 3P27A 3PENA 2PZEA 4LJ8A 3U3RA 3BS4A 1NN5A 1IY2A 1DTSA 4NYMQ 4V0KA 5E7JA 5EJEA 2O8FB 3RAPR 1ZNZA 4YHHC 1N0WA 1ZM7A 2REBA 5KNCA 3CKLA 3A8TA 4YMSA 1OIWA 2DCUA 2ZE8A 4LYFA 2JAQA 3KJIA 3MWYW 5DGXA 5JCPA 2ZPTX 1JJVA 3U6BA 2MMCA 1IN7A 4DR1C 2YYZA 1TTTA 1KKMA 1EGAA 2D2EA 1HNZC 5E3HA 2QU8A 4P4TA 2Z5FA 2K5UA 5FFMA 3VX3A 5JS8A 5KSOA 4QJ3A 2QTHA 1K0RA 3AEZA 2WM9B 4I99A 5IF9A 5DNYB 1NP6A 4YY3C 3WRXC 3AF3A 4UKDA 2J41A 2GHIA 2IF0A 5KU1A 4FWTA 1EFCA 4QGGA 1E1QD 4KYUA 4L5BA 4Q00A 5IHPA 2XXAA 3AKYA 2XZOA 3K0CA 5BYJA 4A0FA 1E3MA 4IHQA 4YDSA 1UFQA 3BB4A 1AZSC 3W9YA 2ZE5A 4OKSA 1RRCA 4M1WA 4W9MC 4OBEA 4TMTA 2P2LA 1GIAA 2YOGA 3WMGA 3K9GA 4DSUA 1XU4A 4EIWA 4OX9C 1E0SA 3QXCA 2IS6A 4P33A 4TSFA 2UZ3A 4NYJQ 5FBLB 1DAMA 1KDPA 1R4AA 1Z0DA 4JLKA 4ERNA 1GNPA 1R10A 1N6RA 3GLFB 1Z47A 1TPZA 4RJLA 1TQDA 1XNQC 3TR5A 5AUQA 1Q1QA 4KSBA 1S4QA 3A1UA 1XDBA 1E4YA 3NBXX 5EUQB 3THYA 2EU8A 4IOLA 5IT5A 4DDVA 3B2EA 2DWPA 1E9AA 4Q7KA 2O0KA 1BO6A 5A5GA 1KAGA 2RHDA 4B43A 1NN0A 1IAQA 4PZYA 1WRBA 1S1MA 5LBIA 1NKSA 2V55B 1NI3A 4MYHA 4PPFA 2HJVA 3FYHA 4X8MA 1UEIA 1GRQA 1FMLA 4D80A 2EFGA 1LFDB 5CDFA 3PFIA 2V6IA 1UADA 4KFTA 1U9IA 3GFOA 4B6EA 2ZRIA 5BW8A 4RKFA 4RY2A 1Z0IA 2KWIA 3L8YA 5KYKA 2W83A 4PPNA 1P73A 1JALA 2XTMA 4XX2A 3T1VA 3ADBA 1AJEA 1W4RA 1PUJA 1XXHB 2B7CA 1FJGC 2QP4A 2H18A 2J7KA 2V8OA 5FR1A 2JJ2A 4JBXA 5EXXA 4PO1A 4RVCA 1L2TA 2E9SA 4IOKA 2V9PA 4A8JB 2OCYC 1NSFA 2ZR0A 3C15C 1XEXB 1VG0B 3B13B 2OM2A 3A1WA 4LPSA 5HKKD 1E2DA 2VQFC 1PLJA 1W4CA 5AK0A 3QPVA 2ODBA 3FHTA 1UDXA 2QL6A 1GDDA 4TT3D 5G53C 1ZM2A 2WMNB 4LF4C 1GZSA 2YHSA 4TLCA 4ESVA 1IY1A 1FP6A 1QHIA 3CUEF 5DN6D 4GBMA 4HDQB 4DLVA 1FTNA 5CITA 5JI3E 4HUQB 2ZSBA 2WVJA 4EUNA 5BN3A 4WZBE 2WWYA 5F98A 5TARA 5DH9A 2WSMA 3RS7A 4DSNA 2IW3A 1NVVQ 3RC3A 2AKYA 1SXJB 1JBKA 1VDZA 3BFVA 1Z6TA 1XMJA 3OEHA 4P4SA 4D0NA 5KSYA 3PUVA 1VG1A 4EDHA 2J59A 3CPJB 1G3IA 1Q12A 2R2AA 3I1FA 3VR1A 4J0QA 4TQ9A 5HE8A 1C1YA 2GK6A 3GFTA 4B3DA 3RRYA 4B2PA 1HQYE 4TWZA 2HDNB 2OG2A 4KXFB 4LHXA 3SJCA 4BLTA 2O8FA 3EAQA 2W00A 4BFUA 5C4MA 1XTJA 2WOJA 4LDJA 5CYOA 3J80D 2Q0HA 4LGMA 2WPDD 1G16A 3UWKA 2Q21A 2PX0A 4Q19A 4FD2A 2GCNA 2DFLA 2G77B 3B1XA 2N1BA 1UJ2A 3W8NA 2GJ8A 5DYIA 1OV4A 4TLEA 4A6XA 3W34A 3VHLB 2JLQA 3ZVMA 1G19A 5EP4A 3RVBA 4JI2C 1FQJA 4AWXA 1SKYB 1D8TA 4Q9HA 1NVXQ 5JWHA 4BLPA 3I5XA 4DCUA 1IOZA 1EFRD 2F6RA 3Q7QA 4RZ3A 2IX3A 2EGTA 4AYWA 5DISB 1IN8A 1ZU4A 4Q21A 3AF5A 3FB4A 4D6PA 4FIDA 1NN1A 4JLVA 4P32A 4AK9A 2HJGA 4X64C 2AFIE 4XWOA 4GL2A 2GJSA 1R2QA 2GXAA 2BMEA 3C14C 2G1KA 3QE0A 3VFDA 2ZI4A 5K8IA 3J81k 5E4FA 2NG1A 2FJUA 2RB4A 3JZMA 4C2UA 1M7HA 4OHZA 8OHMA 3VU9B 4JSYA 5LD2C 3UPUA 2DHRA 4X66C 3A4LA 4URXR 4AY2A 4C0SA 4QXAA 2V1UA 4XTRA 2EFDB 1AGPA 3ZYCA 3GLHE 3B60A 1G7SA 5K8LA 3K70C 1QF9A 1WA5A 3HU3A 4R2IA 2CCGA 1H65A 4M4SA 4ARZB 2YNMA 1KY3A 1P7CA 4MH0R 2J9RA 2X77A 2RAPA 1ZUNB 2FH5B 1HA3A 2CE7A 4IOMA 3SS8A 3U3KA 3CPEA 4JVNA 4A0RA 3SC3A 1EFHA 4M9QA 4UXIA 5K8TA 4AURA 1WE2A 5CLLA 3FPAA 2CDNA 4B3GA 1Q3HA 3PCRB 1VCOA 1D2MA 4O2RA 3IUYA 3P32A 1KSHA 1JR6A 4C3ZA 1BYIA 4IVRA 2IYVA 2GF0A 4IVPA 4DHEA 4OQMA 1OH5A 5TMPA 2PJZA 2RGNA 2J0QA 4WAUA 1XTQA 3TIFA 1ZUHA 4KSCA 1XBTA 1GL7A 4DVGA 3UG7A 2AX4A 2FZ4A 4JLPA 4DCVA 1T3HA 3BH0A 4TL6A 1ZM9A 3KJGA 4TMXA 3S1AB 4CDGA 3Q8XB 121PA 2ONFA 2QM8A 1T0JB 4LF8C 5FH9A 2B8TA 2BCJQ 1LVGA 1MABB 3PEWA 2AL7A 4CIDA 4CT4B 4MDEA 3OFNA 4GFDA 2PLRA 2XB4A 4ZDKA 1Q20A 3W8RA 4A8JA 4C0BA 3EPJA 1XEXA 4M22A 1E9FA 4RD1A 1MO4A 5AUNB 1CKEA 2UU9C 4QJ4A 3EA5A 2ZJZA 1YZNA 4TZ6A 4X8OA 2REXB 1Z0JA 3QKTA 3GD7A 4II7A 1EK0A 3X1ZA 1NLZA 1KIMA 3HPRA 5BWMA 4PQYA 2E8CA 2IK8A 4HUQA 421PA 3RS4A 4D4LA 2CJWB 2IYXA 3HJNA 3GLFE 4LBZA 3IILA 1MT0A 1COWD 1SXJA 4FXPA 1ZIPA 4JLDA 4JLJA 3B1ZA 3QENA 4PC3A 1L4YA 4TYPA 3QBVA 4JI6C 4U02A 1XZPA 4B3XA 3U7GA 3CZQA 3AP2A 4PHTA 2CNWA 1T9HA 2F3TA 3MJRA 3GJ5A 5EE0A 3VHXA 3AM1A 3U44B 1E2JA 1DAIA 3QXSA 2A5JA 1UBEA 3BK7A 2QUZA 4ACAA 3WBKA 4PAOA 1P72A 1B23P 3U5ZB 3IHWA 2P67A 1Z28A 3ADCA 1EFUA 2BWJA 1P2SA 1KI9A 4F7WA 4PX9A 2IHYA 3KKPA 1E99A 4N1AA 3BIFA 2AK3A 1VPLA 5F2EA 1OFHA 4EFMA 4NCNA 4DJTA 2MSEB 1Z6AA 1DG3A 3FFAA 1XXHE 1Z6XA 2O8EB 1J99A 3MG9A 4C9BA 3RS3A 2ZJOA 1OYYA 4LV8B 3TNFA 2XTZA 1ZB9A 3OTOC 3P1JA 1NG1A 3FHCB 2JLRA 2JJ8A 1IBKC 4W5WA 4R71A 2GJKA 2P65A 4Q7LA 3T1HC 1T8UA 5FPSA 5FBVB 2KB0A 3T1TA 1CRQA 1NY6A 3T1YC 1N0UA 2QNRA 3L0OA 3LV8A 2ZJBA 4TMVA 1XD2B 5EP1A 3DOFA 3SYNA 4JI8C 1N25A 1XCGB 2CBZA 3R8FA 1ZD1A 5FL7D 3VR3A 5FTJA 2KBEA 4BQSA 3CF2A 3E70C 4JL8A 2GXSA 2P3SA 5TV2A 1II8B 2FN4A 5B30A 4TYYA 2REOA 4JI5C 1SXJE 3C7KA 4KYIB 3VU9A 4QHYA 3EIHA 4BFZA 2YVUA 4XSHA 1IXSB 1KJYA 2CE2X 4LRWA 5CM9C 4DLRA 4P3YA 4V03A 1CTQA 4Q9KA 1OHHD 1Q1BA 1W49A 1TQ6A 2VHTA 4JIMA 5EZ5A 3KFXA 2D2FA 4ARZA 2ZQ5A 4ILEA 1W2HA 2JJ1D 2QMEA 4UXJA 1E2GA 1JR3D 1TF7A 2J3EA 2OSBA 2ZIAA 2QT0A 1S1CA 3RSOA 3O8RA 3B1WA 4HAYA 1GL9B 1FUKA 4GRAA 4OQNA 4Q18A 4AG6A 1LQLA 4AKIA 2YC4C 5C1BA 4OYHA 3TJZA 1G3QA 4RZXA 1CP2A 2AXNA 2YINC 4DLTA 1CIPA 1VIAA 2QEQA 5KTYA 2G88A 2W0SA 3A1SA 2QORA 3AH8A 4M9SA 4NCJA 3KQUA 2BBTA 4A4DA 1IONA 3KL4A 2ZXUA 2FFAA 3TE6A 1P5ZB 1A82A 3I32A 4A9AA 3T5GA 821PA 3MGCA 2F43B 3T1OA 3UMSA 3EARA 2QMUA 2ZRHA 4DV6C 1R8QA 4LSGA 4YQFA 2WWHA 1I2DA 4HZUB 1SKYE 2G1JA 1LTQA 2R8RA 2GNOA 3EZ2A 3K0EA 1II9A 3KQLA 1NLYA 2BOVA 2VBCA 3GFPA 4TN1A 3S1AA 1MR3F 1XWIA 3VNVA 1PV4A 5BN4A 1O87A 1OFTA 4I1VA 1MABA 3PQCA 3O47A 1Z63A 2XTNA 3BD9A 2L0XA 4WBSA 4XOIA 2PCLA 1XPUA 4MRSA 1W36C 2H57A 1QBKC 3CRVA 2ERYA 2ZUBA 3I07A 2VQEC 5FUXA 3LA6A 3MMPA 4JBWA 4R98A 1G8PA 2VF8A 4GMXA 4Z8YA 4NE2A 3TSWA 1D6JA 2ECKA 4PQRA 1SHZA 1A2BA 3GJ6A 5JLJA 4NU0A 4IXMA 1AKEA 4JYAC 3I73A 4MH4A 4X65C 5EXPA 1AS3A 3SJZA 2GF9A 2HT1A 4URUR 2CJWA 5KSZA 4P31A 2UUCC 2GKSA 3CX6A 2B21A 3QUSA 4BRUA 3QPWA 4EPXA 4TMKA 1GRNA 3HDTA 1TQ4A 2P5TB 1N6LA 1KI3A 2R65A 4EPWA 2LKDA 5JBQA 1ZD8A 3W6PA 1CJTC 4A15A 3FMPB 1YU9A 4C2TA 2QMHA 5FUWA 3L0SA 3TBKA 4Q47A 2G9NA 2A5GA 3U44A 1N3BA 2WKQA 2ZS7A 4JYCA 2OLKA 1KO1A 1QZXA 2EYUA 3I8SA 3HR7A 1HY3A 1L8QA 1QVRA 2QP3A 3WP0A 3C4JA 3NBFA 1JNYA 1ELOA 3BFXA 2ZRGA 2BMFA 3MUFA 4I1SA 3KJEA 3PV0A 2PMDA 4PSAA 4MGZR 4NTZA 4JL6A 4Q1EA 3HYRA 1KSJA 4Z54A 2WWXA 2W0MA 3WBJA 4DLXA 3PUWA 4HB0A 1E1QA 5JRJA 3OEED 2O8EA 3AF6A 1W46A 2ZE6A 1ZJ6A 4PTLA 2ZRCA 5P21A 3PUZA 3DDCA 3WYAA 3D3QA 2A5DA 4G5RA 3C41J 4DR6C 3EG5A 2ATXA 2C99A 3AKCA 1XTKA 2J45A 4PHFA 4ZDIA 3IPXA 3WHLA 1YR7A 4CYMA 5ANRB 4ZI3A 1QHHB 1R0WA 1YR8A 2ZRNA 3MJHA 1G8FA 1XD2A 4DCSA 2OE2A 4LFCC 2QA5A 4CT5A 3OZXA 2YJTD 2JMPA 5BR8C 1TEVA 4QOSA 2Z0MA 3RRZA 5FOUA 4MDFA 3A1VA 3HPQA 4FWIB 3SFVA 1UKZA 4B75A 1D5CA 1SVLA 1II8A 3K1JA 4TLBA 3SBDA 1WB9A 4L9SA 1TX4B 2NIPA 4ZCMA 3IKJA 4K46A 4JS0A 1IY0A 3I61A 4LBWA 1I4TD 2WSSD 4AG5A 2IWRA 5B2ZA 3CWQA 3M1IA 5TXGA 4FCVA 2C95A 1OXXK 1KI1A 3M4YA 3GEHA 4EJSC 2FPKA 1LF0A 3OHMA 4Q02A 4Q1DA 4GSYA 2QP9X 3WNBA 2BBOA 4H1UA 2ODNA 3MLEA 2JA1A 4DLUA 3OESA 4DSTA 4B47A 3D6TB 2QN6A 4LHVA 2UVQA 4NCKA 4B48A 1WCV1 2OLJA 2BJVA 1W5SA 2NZ8A 3T15A 4Q4AB 4NXMC 2WHXA 4KHZA 4KLZA 5CK5A 3NBZC 6Q21A 1HH4A 4I81A 1WBBA 1JJ7A 1N6KA 3GJ4A 2N42A 4B3FX 1OB2A 1IXZA 3KDSE 1KI6B 4XVQA 4WXRA 2P6NA 4LZZA 2ANCA 5EE9A 5J4KA 1W5TA 4B34A 3PXGA 1ML8A 3SYKA 3DEFA 5FLXD 2OZEA 3ZDQA 3KX2A 2CXXA 5JRZA 2G0NA 1IN5A 3QIAA 2QAGC 2ZR9A 2YCBA 4X8HA 2GEDA 5DN6A 4DV2C 4FI3C 3QKRB 5JEDA 4Z1MD 3IQXA 4JVSB 2CL0X 3AP3A 2DBYA 2VH5R 4U5XA 1VKJA 3H0KA 2J5XA 2EFEB 3AB3A 2PMKA 4KV9A 1TU4A 1YJ5A 1LW7A 1ZYUA 2IF2A 4WW0A 2FGJA 4FW9A 2BMJA 4I4LA 3GLGE 2NOAA 2PN2A 4IFEA 1M34E 2GESA 3BE4A 4P4SB 1U2RA 3SJBA 4BFXA 3UG6A 3SNHA 2DY1A 3LFUA 3JVVA 1E2EA 4V02A 3TVDA 4HB3A 1KGDA 3R7WB 2HYDA 3IDQA 1E9SA 4KO8A 2IWHA 2P6UA 1V43A 2ZYVX 4B74A 1OXUA 4GDFA 4HAXA 1USPB 2Z4SA 5G3ZA 4QBGB 3MRSA 3PEYA 3T12A 2WPDA 3ZZ0A 2V3CC 4BLOA 2FEOA 2FOLA 2IHBA 3I5YA 4AKGA 1ZU5A 1H8EA 3FWYA 4PO8A 5EP3A 3GEIA 1QDEA 3FMOB 3LQRA 1UPTA 4BZQA 2QENA 2D62A 3U4QB 3QI2A 2RMKA 1MV5A 2ZSFA 3LDAA 4W5HA 1VLAA 4DC9A 2HF9A 4RZUA 2F9LA 1XJCA 5DO9A 4TZ0A 2OXRA 1N6NA 2IYYA 1DARA 3B9PA 1EFRA 2OHFA 2I3BA 2BCGY 1ZCBA 1FL9A 2CVFA 3ASYA 4D2IA 1QWIA 3I4LA 4A36A 1KZGB 4DZZA 2OBMA
chains in the Genus database with same CATH superfamily
5T8TA 1NVEA 4BNWA 2IIBA 1U99A 1JQJC 2W2QA 3MAAC 2X7HA 4Z7OB 3OWHA 2PMBA 4MMYB 1G21E 1GYPA 2D4AA 1H93A 2WG0A 4CIWA 4XQGA 4PXYA 5LLTA 4P81A 5FCDA 5KYXB 3PDWA 4KQWA 4ATNA 3QJ5A 1Z26A 3NASA 5JV5A 1GVHA 5IG2A 5AOVA 4C6RA 2CL7X 2V4ZA 1E63A 2DWCA 1EFVA 1GSIA 1KA9H 3X3HA 1W47A 1H6DA 2B6NA 3TFWA 1RXUA 4B7ZA 3K6SB 2Q4BA 3MK31 1A5BB 4D3FA 3KSAC 2BKXA 4ZVQA 4MWEA 1WZCA 3E8MA 1BIFA 5DFAA 1I36A 4PINA 3VC7A 1E7WA 2GLTA 2HO5A 2VYNA 3EAFA 4IIXA 4MAFA 3L1KA 4RVUA 5H7XA 1K7XB 1NVKA 3SR4A 4EKDA 4CM3A 2HCFA 1G6Q1 3WKEA 4G5QA 3IAXA 4HDKB 2IOYA 1XO1A 1AN0A 1MQ9A 1NVUQ 2ENWA 4ZIRB 4KHPB 1L4UA 1VCIA 4P4UA 2Q3HA 1D7AA 3T3HA 1J1UA 3O3OB 1J07A 1NASA 4BB9A 3C43A 3OCJA 1G7RA 1ORDA 4WK0B 1YFJA 5AK4A 5EUCA 2I03A 2BVNA 1NJ8A 1ODCA 3BH6A 4BFSA 1Z15A 1QFXA 2DFTA 4Q5IA 3HY3A 5ARBA 1F0PA 3ND8A 1QRUA 4BASA 3AVTA 1AOXA 1UM9B 3NKVA 3ER9A 3B8EA 5FWYB 1NOIA 3QY0A 2RHOA 3JTEA 4MR8B 3VPSA 3DAYA 3J7AC 1U0SY 2VCHA 4BMCA 1NX9A 1JIJA 3LZ6A 4Q3NA 1TF2A 1C9KA 3P0HA 1CUDA 3GEGA 1YA4A 4QXQA 4GKKB 1ZGCA 3GLIB 1U98A 1VJDA 5JNWA 4UEJA 3U4IA 4U00A 5B5SA 1PV2A 3K1AA 4HNGA 4LCJA 4L75A 4C2AA 2Q3BA 3ESDA 3JALB 4L51A 2C1ZA 2IH5A 2JEZA 1I33A 3KAPA 4XGNA 5EJIA 4B3BA 1QU3A 3JU3A 4LBYA 1HQKA 4YUAA 1JDPA 1O9GA 1PNRA 1HDZA 1T5IA 5TT0A 3RVKA 4OJNA 1Z37A 3DE3X 4HRAA 1GEGA 1TO1E 3DZBA 4D0LB 1GUBA 1ZUIA 5K0FA 4Q03A 4IHJB 4UHEA 3PDJA 1EB8A 3W5UA 5IT4A 1IXYA 4GX1A 3P0JA 3TDMA 4FHFA 1ZIOA 2F8SA 4XEHA 4RJTA 3ESZA 1V5WA 2D28C 5IARA 3FHJA 4DGQA 2IU3A 1QX4A 4XDHA 5JQGA 3N6XA 2J3JA 4M8NE 1JHMA 1RWQA 2PEYA 3K30A 2AH5A 2HLPA 5ISMA 4RKEA 4U2EA 3P2EA 5D3QA 2WD8A 2QL5A 5B2EA 1COWA 2I2BA 5EZQA 5JPCA 3VQTA 4HTFB 4E2ZA 1Q3TA 2J0UB 2QYTA 5BQOA 3IUBA 1WZEA 2AZTA 1F8UA 3LRTA 4MITA 2PX6A 3EMKA 4R5MA 5JCOC 1GQSA 1U3WA 3RVRA 3DPUA 3TTXA 1SULA 3CM0A 4P6VF 1E5XA 2IDMA 4N3CA 1BDJA 2D0PB 4H7IA 3HLTA 3OE7A 1FYFA 1Z0KA 4EJMA 3H9EO 2KI5A 4RV4A 3N54B 1HR0B 5ALJA 3JPWA 1BAPA 1NT2A 4ENQA 3IA2A 3R7WA 5DW3A 1CBUA 2I87A 1DJOA 1TCAA 1USPA 3FSRA 1LUAA 1Y7HA 2WTBA 3VR6A 1JNXX 5TJ9A 1Q1EA 2WAXA 3KXKA 3ICEA 1F1BA 1EQUA 2ICAA 3FGOA 4L4XA 2NUAB 4JEMA 1E8MA 1U8EA 1OWMA 4LYDA 2VP6A 5JOQA 1SVUA 2FHPA 4JENA 3RS5A 3QVKA 2PVPA 2WTAA 4QIHA 3FPKA 3DA8A 3OZSA 4HPVA 3HVRA 3NI2A 1TT7A 1E1CB 1A97A 1BD3A 2Z43A 2FF7A 3F4KA 3HJGA 3I53A 4Q05A 1KYYA 1JLMA 4KAFA 3I6YA 3NDPA 4L5YA 2QL7A 4P8RA 5G4KB 1D9XA 1H8ED 2Q4TA 1KORA 3IAM1 4L27A 4KXWA 3RT7A 3LMKA 2Z6VA 3BXFA 2OCDA 4XCQA 2XZDA 3MCAA 4MMZB 4D5GA 3AV3A 1WHSB 4C78A 1DVRA 1GLVA 1B8UA 1NBOA 5FV4A 3GRPA 4HEA1 1RDFA 4FBLA 2E4AA 1ZINA 3LQQA 4JHLA 1R8YA 5E8RA 4GWLA 1RNLA 3JVEA 1Z5GA 1T4BA 2PCJA 1PG3A 1C14A 1HYQA 3CZ9A 1KF0A 2A7XA 2R7KA 4MROA 4YC7A 5FHRA 4CPDA 4K6GA 2RAFA 4U8HA 5IAAA 1Q77A 2PANA 3ABQB 4X7RA 1LNZA 2GMWA 1MZPA 1H42A 4BVFA 3R3WA 1KO7A 2CJYA 1XJQA 2X2EA 5T6MA 3ZQKA 4JVOA 1C3EA 4JJZA 2OYSA 4KE6A 4Q3AA 5EUMA 2PD6A 4QXOA 1TYZA 2C03A 2AEEA 3OX2A 1U0TA 1WHTA 2Y1EA 1B43A 3MA0A 4CMGA 1OHHA 4MVJP 2XRZA 4F6RA 5GGYA 1NL3A 2PZMA 5LP6C 1V0JA 2AGVA 2E87A 2CFRA 2JJ1A 3C3XA 3OIWA 3OTGA 3QW2A 1G9TA 2J3IA 1JR3A 3A31A 2CU6A 3BRQA 3OUTA 4NS4A 5T64A 3ZGLA 2J7PD 1DHTA 1VDMA 1AX9A 5ALQA 3K0CC 1HTTA 1N32C 1XEWX 2YMPA 1CS0A 3GI1A 1KL7A 2G04A 3FUVA 3L6UA 4A0SA 5K6AC 4PAMA 1ZG3A 1Q1GA 5KDLA 3PWKA 3V2HA 3JATB 4URFA 3SC2A 4DA6A 1TEXA 2PK3A 4JM1A 5I8ZA 1JE0A 1SUIA 1BCSA 2XJ4A 5F73A 1GPUA 1M2VB 4KX5A 3OC6A 1KARA 2VRCA 2DOKA 2R5NA 3K0AA 2KLBA 4BN4A 5JZOA 3K70D 5AJUA 2HSDA 2RHHA 3CKMA 3MGKA 3EMDA 3P20A 2FUCA 4NOKA 3VOBA 4BCBA 4PZ9A 2FWAA 4EQ6B 3RAFC 4N8DA 4Y67A 3ZEAA 1T6ZA 5KOJB 1CUAA 1QH9A 2C82A 2P78A 3PGMA 3DPSA 2OYCA 3HC7A 2QTVA 1DWOA 4O4JA 1KPIA 4WOPA 4RZ2A 1Q74A 2H6EA 3ZH2A 1N6IA 1E3JA 2PGJA 2WTNA 3EASA 4RNDB 5GV8A 5BPFA 2IZ1A 2MSCB 3N0XA 3DR3A 1G63A 4IRMA 4C5AA 1CEXA 1I3MA 3DW1X 4WVFA 5CG2A 3CRRA 1W85A 5I9MA 4R01A 4P3OA 4X7BA 2FRXA 4Y9TA 5C3MA 4Z1OA 1N8KA 3RK1A 5BN5A 2IYNA 1HNXC 1ENZA 3QU9A 1PR9A 2PM8A 4L15A 3WLAA 5I7WA 2XCSB 4H4DA 4FJ0A 5BYKA 4ER3A 1I94C 1ZGAA 1JTFA 1P1KA 5TQ0B 4P86A 3CB2A 3VDQA 2DG2A 2AC7A 1CS4C 3HYCA 5T4FA 1RE1A 4S1WA 2PSFA 3NX4A 1G4HA 2IPOA 4XGQA 1VSBA 1BJKA 4O2AA 4PCUA 3RYHB 2XCOA 1J8DA 1ZN9A 4YAUA 1GVNB 1ENOA 2W58A 1GNRA 3RF6A 3HEAA 3SGLA 2DETA 3ZGZA 1JXMA 1Y4SA 2R7LA 2AYXA 2WFAA 4RVSA 4ZARA 4CDNA 3AR4A 2PZAA 3BZWA 4ETMA 2JGFA 2IYLD 1CCWA 3TEJA 2PMCA 3IVRA 2EFYA 2OQIA 5HIKA 2PN1A 5MGNA 3DVAB 3V34A 1Y4DE 1FVOA 4DV5B 3VR4A 4ZZIA 4WZAB 3QMPA 3T9DA 3LJKA 1PQWA 2CMGA 2YC2C 3PEVA 2K6GA 1JIKA 4KXMA 3LBFA 1HDXA 3HYLA 3WB1A 2EW1A 1A2KC 4WEQA 4NVRA 3TB4A 3VC1A 2YOHA 1JYEA 3PI7A 2ONJA 2DWOA 3Q4GA 3FNEA 3L7DA 2XA1A 3CX3A 2X1VA 4RK0A 5HQTA 3PIRA 4XIGS 2WIKA 3NHKA 4YQFA 2QVXX 2R44A 2M1XA 1ZOOA 1SVKA 1ZNYA 3G2LA 3Q1LA 3GLTA 4B17A 2AVDA 2H1CA 1QTRA 1HE1C 5IAJA 3V8EA 2MMGA 4WXEA 1HURA 4XJTA 1DXHA 2XUHA 2AHRA 4MPPA 1W9HA 1RHUA 5ER6A 4D41A 1N2HA 3HCFA 2FWPA 2QN9A 1QHXA 4R05A 3K9LA 3LF2A 4XYGA 3L93A 4YHHB 3DNMA 1X7XA 4F2GA 1XB2A 1GT6A 3V8NA 5FA8A 4PN7A 5IK2D 1S2DA 5C52B 3HBFA 3DLHA 1OKKD 2V6JA 4HC4A 1E1DA 4Y18A 1L0BA 1SUPA 4QOEA 1Z82A 4RIEA 1BVHA 4FEGA 3T5DA 3EPHA 3OEEA 1O57A 2HT6A 1J2EA 1P4JA 4H77A 4BVHA 3L6CA 1CZRA 3V32A 3NWEA 5LYJB 1IU9A 4AUNA 3ZLJA 2G0AA 2WIFA 2UXBB 5CGQB 5A4MS 4DL9A 3NC1C 4M1MA 4H3KB 2NQTA 1U7XA 2FWRA 3NAGA 1EESA 1G42A 2PTGA 4Q1AA 5CA0F 2PLFA 1T9GR 2P9YA 2C78A 1YV9A 2VT6A 1RI4A 1Y5IA 1W87A 2CKDA 3AO0B 3EMVA 3NPMA 4G63A 3GUVA 4ETIA 4C7KA 4F2PA 4H3SA 3FCCA 3EDOA 5AVRA 5JZVA 2V7TA 1GEEA 1NIPA 4LS3A 1L5NA 4HAVA 3OQOA 1JX6A 4IRXA 2VDKB 4IG9A 5A05A 3NHBA 1ZQ9A 4DJ5X 3HGMA 1LX7A 4DWVA 2VVTA 3PWSA 2AEFA 1JHRA 5H3HA 3T9CA 1GTSA 4WWHA 4YK7A 2C3OA 1JSCA 1TJ3A 5JG7A 5I8WA 2LTAA 3IMCA 4KSYA 1TCVA 4GHWA 4JC5A 4EVSA 1CVRA 3CCBA 3ESAA 3FVQA 4EG1A 2DC1A 3JSXA 3OOHA 3RUDA 1W4AA 2ZLBA 2JKVA 3ZCTA 4C0JA 3CKYA 1ESDA 1EZZA 1GY8A 4GP6A 3GA0A 3TZHA 3EQ7A 4LHZA 5KYNA 4NJMA 3ANSA 4OHOA 3TGWA 4CGZA 3T34A 1XTRA 4HQFA 1H3EA 1RC1A 1Z7BA 2V74B 1SVWA 4R2MA 2EX0A 1P9LA 2PX4A 3I62A 1B6SA 1T5HX 1USVA 2GCOB 3IHKA 2CUNA 2PBRA 1L5GB 4PGFA 1YRAA 2GKOA 1K63A 2LR0A 1UT5A 3CZ5A 3ENZA 3ZQJA 1MJ5A 1NF8A 3OLWA 1E7SA 5TT1A 3CJRA 4JX8A 2IA5A 1E9EA 2OENG 3KKKA 4IDBA 1I3KA 5JNTA 5LQUA 4GYKA 3L8FA 1FX0A 621PA 1DWUA 4MDYA 3AF4A 3BXZA 5D6OA 2XDWA 1YRWA 2WM8A 3SN6A 3ZHOA 1AKYA 1EWKA 1KETA 3GJ3A 4I50A 4UARA 4DIDA 1XCMA 2FW7A 1XMIA 1OASA 3CRW1 5ALOA 5I4CA 2Z1NA 1SURA 3DMPA 4AICA 4YWHA 5HIIA 5THQA 1XS3A 2OHVA 5CVCA 1QGYA 2JAUA 1EHCA 1VL8A 1MC8A 3OZUA 4CEJB 4OLFA 1PLLA 3DKRA 4LTNA 1IBSA 1EGQA 1X3LA 2ZXEA 1N2CE 4CKEA 2QX8A 2NPIA 4NJEA 3ZTYA 4R51A 4G0WA 1SELA 2NU9B 1GAEO 4ZPXA 3ZEIA 4XB1A 4LYYA 4Q93A 4JJ6A 1F48A 1CPYA 4HLUA 5AJHA 3MILA 3V97A 4EVQA 2VATA 3GJ7A 4PV7A 4TSRA 3I04M 2VQFB 2ZYUX 4GLFA 3KUCA 3L95X 1E2MA 1LSJA 1UEJA 1YJAA 1CQJB 4LI3X 5EXDA 2N3ZA 5TQ2B 3OETA 1M7GA 2R6AA 1JIXA 2AUTA 2OPLB 4HYYA 5HQJA 5AXBA 3ZDXB 1PGJA 2GPSA 4KIJA 4BEBA 3BGDA 2FN7A 2HI0A 2Z5GA 1PO7A 1GITA 1EDEA 1Z6YA 4CQJA 4EPTA 2JIBA 3KPVA 4AU1A 3MCUA 4G09A 4KB5A 1KK1A 2PXXA 3PT9A 4OOEA 2I62A 4UU1A 5GJCA 3TR0A 4CMCA 2VJOA 3PLNA 2PROA 1U28A 4MYUA 4RZSA 3TZCA 1B74A 4ZGBA 1Y8ZA 1ISSA 1GPH1 2QRLA 5CA1F 3LT5A 3M3DA 2AWOA 2WU3A 3UKDA 1FNBA 3L7AA 2IL1A 4A6DA 3QFFA 2QZSA 2JKZA 3PUHA 3R5SA 4X6YA 1RTKA 3NOXA 1J5PA 3Q87B 3LL4A 4OQ4A 1ZH4A 4PYKA 4UHHA 1JDVA 2O8VA 4LN1A 3T1NA 5LNK1 2QRHA 3EVZA 1DOHA 4NL4H 4I5IA 5KCMA 4DC1A 4FQ7A 1P19A 1NLFA 2JRCA 5JDCA 5A1IA 2W6JD 3HH8A 4N7BA 3IUEA 1RAHA 3A58B 3BC1A 3ZW9A 3QF4B 1D09A 4EECA 4PUGA 1UANA 4J7XA 2C7GA 2GCGA 3GZNA 1YZFA 5H81A 4DJAA 1PV1A 1J2TA 2YHUA 4UEOA 1ZUD1 1IM2A 4R8SA 1ZW6A 3VO9A 4QL3A 2A92A 4QKQA 2D74A 4G5SA 3OOSA 5ALVA 2R97A 5CA1B 4H35A 3KPJA 4GOMD 1DAGA 1U8YA 1FJHA 2HBQA 2EIHA 3NJ4A 2GAOA 4HDNB 4N3NA 4MA4A 5DYWA 3S28A 2EKQA 2VEDA 3JWPA 4L22A 5IAEA 1Q95A 1U2QA 1Z0UA 1XZBA 3UH0A 3WB0A 3UGQA 3ITEA 1D6SA 2H51A 2LKCA 5FBRB 4PZLA 4K8OA 3VSEA 3CLVA 3LD9A 4WS9A 3TR3A 1AURA 4TKLA 5L3VA 4BGIA 1F2TB 5C46F 5LQRA 1Y98A 1K1EA 1GA6A 3F8SA 3LZCA 3R9IA 3A1NA 4X64B 3UTCA 4B2LA 1U7PA 2H63A 3C1AA 4JEHA 3AFGA 1FFCA 2CYBA 1B8PA 2X6QA 3LT1A 4PR3A 3DL2A 1MX3A 3QU5A 4BQIA 5G4LA 5CDUA 3D1LA 1OXKB 3DMFA 3KB2A 1P7YA 4INPA 5EE1A 3LAXA 5FLYA 1YZHA 5KJEA 3V2GA 4W1RA 4ANFA 1G8KA 5L8VA 4CW7A 5KJ1A 4AD8A 5C1DA 5IN5A 3WB2A 1MX1A 1H0KA 2Z51A 4CN8A 3ANXA 1L7NA 2ZTLA 3ML1A 3TFQA 4CN9A 3PXBA 5JNLA 3TQHA 4BLVA 1XMSA 1C8LA 1QVWA 4EHKA 4HMQA 2ODTX 3DKPA 4LQDA 4BJ1A 2C96A 1KPGA 2AFHA 3GFVA 2X0EA 5JO0A 5K3OA 2J3MA 2IYSA 5KHOC 2YZNA 3ROEA 2DR3A 2XTAA 4GSLA 1HDCA 1F5SA 4HGYA 1U11A 3UKJA 2X0JA 1O5TA 2FPRA 1OGYA 2AS0A 1XRMA 3ESCA 3HCOA 3SMQA 5REQB 1ZUWA 2H3HA 1STOA 2HUPA 3CR8A 1J42A 3IEPA 4NCAA 4ER5A 2ZBFA 2NQ2C 3OF3A 3K71B 5CAEA 2EQAA 3LL7A 4NZOA 2YJNA 3CUUA 4EYKA 5H9WA 4IZHA 3B3GA 2ZIXA 3CX8A 3GDHA 5KJCA 1QXSA 4Q4LA 2IEBA 1DKNA 1TF5A 4RPIA 4XWAA 3U3JA 1EX6A 2WQ6A 3OQPA 5DK4A 2FCRA 5JXHA 2G3YA 1FJ2A 2WICA 1BCRB 3DL7A 2F1KA 3QPBA 1KAOA 1NULA 1ODJA 2I9KA 3USES 1UPFA 1DADA 1WULS 3BRCA 2IYWA 3I2JA 3V4RA 4JT9A 1WUJS 3EZGA 1KERA 3AUJB 4N76A 2WM3A 4D0RA 4PLVA 2AFVA 4ME6A 1F6WA 1YOVA 1EH5A 1FNDA 2EJCA 3ACBA 3AFIA 1XVIA 1ONSA 2FPIA 1JXAA 3B3QA 4UQOA 5H9VA 4AIIA 3WMFA 5C5CA 2B8JA 1NVVR 1V1RB 4GPTA 3LPLA 4F3CA 1Z62A 4ZYZA 5ECWA 1JS1X 1YL5A 3RCBA 5J9FA 3I28A 3MFQA 4DPLA 4ETNA 2GHQA 2R8EA 2DHCA 4IVNA 4V0ME 1IUKA 1OLUA 1BD4A 1FYDA 1OR8A 1UMBA 2ERCA 2YY5A 3C5WP 3JQGA 3O83A 5TQJA 3D6VA 3DZKA 4RSGA 2Y68A 1DWQA 1KJJA 4R2KA 3M4JA 5ALIA 1CY4A 3WGUA 5BWLA 3P7MA 4PICA 2Q7XA 4E0BA 1OI4A 2PH1A 3BCHA 2VP4A 3PPIA 4KUEA 4CIXA 2ZAOA 2HA5A 5E7MA 3T61A 3OQMA 4INAA 5AVOA 2G8NA 2R79A 5FOTA 3RUHA 2ISCA 2QR5A 3AXSA 4Z9XA 4LXGA 4M1SA 3TQFA 3A6EA 2KS6A 4CVNA 3FKSA 4D9FA 2J9GA 4I5GA 2ZVPX 4TTPA 4PGMA 1WV0A 2FPLA 2WE7A 3EXEA 1OXVA 3BWBA 1DT5A 1QYVA 3PHHA 5HTKA 3ZDBA 1ML3A 2PT5A 4H7JA 2PPLA 4NZZA 2YWEA 3MWLA 2BISA 3LW8A 2O52A 3L49A 1P4RA 2IXDA 3DOOA 1RRFA 3HN6A 4BSZA 3CW9A 5HGXA 1KO8A 2R4QA 1VL5A 3ZWDA 2DHEA 4KACA 3SXUA 4CU5A 4DRXB 1TO6A 1U3GA 2O50A 3DNPA 3DO8A 3HXPA 4QEZA 1XHJA 4ALMA 4BLUA 2IU4A 3IBGA 3F7OA 2I8LA 3KSUA 2QPTA 5ADHA 1JIVA 2AOWA 3KLNA 4ER7A 3P5BA 3M82A 1VPWA 1RPAA 5HXAA 5KVQA 3B5JA 2Q1WA 1PWXA 2MINB 4PXSA 3GLHB 4BEVA 4NZ9A 1T9ZA 1PEKE 4BEWA 3HDGA 5IN4A 2LP4Y 1NJFA 1NYLA 3U4CA 2ZI5A 4FKZA 5G1NA 3LUKA 1NXOA 3FOWA 1PW5A 1E5DA 1HGXA 4HOYA 4TXMA 4G8JA 3IIMA 2ADFA 4ZC8A 3V7FA 3WMEA 4CTMA 5K6RA 2JLWA 1SOWA 3ND7A 3SS7X 4BRWA 5LMNC 2A9KA 3L0PA 4IGKA 1SVSA 4JP3A 1OW3B 1NVWQ 4LJSA 1G20E 1DIRA 1YR9A 1EG2A 4AO6A 2J3QA 4QSHA 2JEYA 1R16A 1IBKB 5J3JA 2F3UA 2N0SA 1K7CA 2BFBB 5I01A 2ZBGA 2AI1A 1ZWLA 1R1DA 5H02A 4L4QA 5KAPA 3CVVA 5AKLA 1WXWA 3OAAD 4H15A 4P4LA 1V16B 1E2FA 3U2QA 2FK7A 3OLCX 2W2OA 1JEJA 1MTZA 1QLJA 3GEEA 4RTPA 4IGAA 5ITZB 5GIOE 3M33A 1DTWB 4MP8A 2BMVA 2B9VA 3IXLA 1E79D 2B8NA 4MRMB 3MJCA 4NAHA 4EW6A 1Q5PA 4NP6A 4IZ6A 5J2TA 2CXUA 4HNAB 4JDUA 4QGSA 4PO3X 1AKVA 3SDZA 3PPXA 5JY6A 4OU5A 3LW7A 2OR3A 3VOAA 1I6KA 1EDOA 1NW6A 3OM0A 3V7YA 3HJRA 4UNSA 3ROGA 1E8DA 3EFOA 3D4LA 5FBKA 1PT5A 1S96A 1TA9A 1GA1A 1Y9EA 2FW0A 4N9WA 4EUEA 3NDBB 4RDHA 2P4SA 4IJUA 1U7HA 1O4VA 3FSGD 4A1OA 4QG7A 1Z07A 2RJOA 2B1GA 4GRIA 3UQYS 1SQ6A 3ZI0A 2FLKA 4MPDA 4XRGA 3N39C 3M9WA 5BXQC 3ABSB 3FJOA 1BYUA 2HA2A 4FC7A 1XGKA 2EIXA 3G2IA 2FG6C 2G6TA 4D81A 3O94A 1NRXA 1UF9A 4CEHB 1GAJA 2EP8A 3FVTA 2E48A 1QCCA 2NYRA 4HZGA 3K2QA 4Y1FA 1UPAA 5JCJA 4M53A 1CV2A 2Q4EA 1T0HB 2XDQA 4BBPA 5KPJA 4S24A 1LA2A 1JDBB 1GL6A 1R9MA 2W6ZA 4RD6A 5FNZA 3E03A 4MYDA 4X9XA 5B58C 4WECA 1NBMA 3O4JA 3PA8A 4BQNA 3FCYA 1XMPA 2FEXA 1K5HA 1C3JA 2EDAA 2PGNA 2Q5EA 3GGDA 4AJKA 3S1SA 2V6MA 4JJKA 1N6PA 1XQWA 1A7JA 1HL3A 2NXCA 3LP5A 4HLCA 2JGRA 1VMEA 4LDPA 3QGMA 4OXKA 5EA2A 1IYZA 5FI1B 1LJLA 1SMKA 2QPAA 3ELBA 1ZVMA 2EFHB 3L7OA 3G9XA 4HYEA 5T67A 3X1YA 2VRNA 3EZ9A 2NVUB 3C85A 2ODEA 1P2FA 1TVKA 1BHQ1 1MJGM 1PFGA 1XAHA 2JBHA 3ZKAA 1LS1A 2HGSA 4CCYA 3KLMX 2VPIA 4KRGA 4N40A 2QTNA 4DXAA 4N8EA 4KVFA 4HV4A 2NU7A 4MVJE 3KU4A 1QKKA 4X94A 2C3PA 4J94A 5AVJA 4IXNA 5BW5A 3BAFA 4AI6A 3CO5A 3SJUA 3LWNA 4A2PA 2D06A 1U9ZA 2B8WA 4M0LA 4TS4A 2FPMA 1RLJA 3OG9A 4BGDA 2VQEB 1BX3A 2CUTA 4RV5A 1XYVA 2AQHA 3FN4A 5FB3A 3AUXA 4AZWA 3D2LA 4M9UA 1WXEA 4MW7A 3RIEA 2Q49A 1FTQA 1TCCA 1J56A 1NM5A 1CR0A 1RWPA 4FK8A 3RAEC 2HHAA 3PDIA 4Q9IA 4W5JA 1E20A 1DEOA 2O8CA 3ADPA 4H9GA 4B83A 1T1JA 8ADHA 5BSRA 4K9LA 3N8HA 4X65B 3TN7A 1O89A 1WD5A 4DAEA 4EEKA 3TZKA 1XFAA 1L7PA 3EC7A 1G5QA 2C1EA 1ZBDA 2XMSA 4KXLA 4QPCA 3IQDB 2XLCA 4RE6A 4ZEOA 3UH1A 4D3XA 1GU1A 1KYZA 2RC5A 1QHYA 1CVIA 3GQBA 1J24A 4ROSA 1U7TA 4YCSA 3RM3A 4BQEA 2IZ0A 4QZVA 3R3HA 4MR7A 1CE8B 4Q16A 3IDSA 2G72A 3K6RA 4EARA 1OC2A 4ENRA 4BVGA 3ZIDA 3ZV3A 2JBWA 2O2GA 5TEVA 2D2VA 5CFLA 1VYVA 4XIJA 3MERA 3ZI4A 1DMRA 5C8YF 5K03A 3DLPX 2AYYA 3OVMA 1KVRA 1SUAA 1YNSA 3V8RA 3LQ1A 3FE2A 1I1OA 1O08A 3E58A 3QY9A 5DM0A 1YB7A 1RPNA 1MORA 4J1NA 4MYTA 1PG5A 3H2TA 1NVMB 1SHUX 2H1RA 2VZ0A 4JODA 2FLWA 3VM6A 3PHCA 3SE0A 1KY2A 3HL0A 4Y2GA 1OX4B 4OK3A 4L6IA 4F4UA 4KQEA 4FINA 4C14A 4ZJUA 1G5RA 3I9V1 4WBNB 4H31A 1W25A 2OC4A 3UT5A 1QU2A 3C3PA 1TW2A 4TLDA 1V60A 2WIGA 2GCPA 2WWTA 1D6NA 1BOFA 1JHVA 1X1DA 2C5SA 3MJSA 1HDRA 5EHIA 4DR6B 1M8PA 2ZJ1A 4OV6B 5C8YB 3I0MA 1P0PA 3JAKA 4O0MA 3HFGA 3BULA 3EXAA 2A30A 4CKBA 5JJKA 3QA9A 4RM2A 1KKGA 1QNFA 5EWJA 4MO9A 3RBVA 1DAHA 2RI0A 3VYWA 2VLBA 3IEXA 3GWGA 2QTCA 5JHHB 1ZB8A 5KNCD 1FFAA 4LI0A 3PXCX 1SKQA 1JEYB 4KIUA 1P4SA 3N5CA 3RREA 4MVWA 1RRMA 4REQB 2NP6A 3Q72A 5COQA 4X0EA 5SZHB 1G5FA 1LK7A 1YGPA 5I9BA 2BGRA 4POOA 2HM7A 1DQPA 1GKYA 1ZD9A 4NARA 3UJ9A 1ZAKA 4I4IA 4M0DA 4XA8A 1GDHA 4B6OA 5CFZA 4KPUB 3E05A 2ZT7A 3I52A 4YECA 2ZZNA 4GSKA 3IPYA 2DE0X 1Y5MA 1EFDN 1RM4A 2X2FA 4KDRA 4DPKA 2XEXA 2IPAB 1GTVA 4OQLA 4EJSB 4FHCA 4XUEA 5DTJA 3UK2A 4GH5A 6ADHA 5F3WB 3KR2A 3KE9A 2B4AA 3K9NA 4GKVA 4YROA 1QCYA 3VH2A 4B2IA 1SQ0A 2IEZA 4QOGA 3TLZA 2X1HA 4RTMA 2ECOA 5EJAA 1QR6A 5HGJA 4KQGA 3W3AA 5CBPB 3CX4A 5INTA 1PX2A 1WB6A 3EGDA 2BEWA 3L0DA 4XSGA 1JMKC 1R5OA 2IPMA 4LV5B 4HYTA 4Q48A 4YRTA 5ER9A 3N2KB 4FDTA 5JYCA 4DJJA 5LBTA 4AZSA 2I4TA 5IKMA 4PNZA 2PKEA 1V37A 3QWFA 4XD2A 3H11B 4PWZA 2WJPA 3C7AA 3GLFA 1G59A 4MB2A 3X1DA 4W9NC 4MUYA 2PUFA 1OPRA 4WXPA 4QSMA 1PEYA 3T9FA 5DOZA 1GZ3A 1RZRD 4FE3A 4P0PB 1E6KA 4E5PA 2Z4RA 1V4VA 3QKIA 3IIKA 4KAXA 1AN9A 2GNPA 4MI9A 1FOEB 3TKYA 2WZBA 3BREA 3O03A 5A5EA 4A0HA 4C0LA 1H85A 2HJRA 2X2PA 2W4MA 1KK3A 2O3UA 3KKLA 3MYRA 3OTWA 1R88A 2C77A 4J6FA 3T35A 3ZGVA 1RXSA 1RWKA 2AUMA 4ZPJA 2MDTA 1NRWA 1LWNA 4B3IA 3GGPA 5BNTA 3FKQA 3P9QA 4YDQA 3FG9A 1JUDA 1I6LA 4NPAA 2H8KA 2IHUA 1R9JA 2ZUSA 1KZHA 3COZA 3SJ7A 3AHCA 4BC9A 1ZP6A 1T8PA 2XJ9A 3PROC 1FYXA 1QFZA 1BE8A 1P6UA 2VJBA 2ZSDA 4RCZA 5ICFA 3UAXA 2FEKA 4QO8A 5IW8A 4CTJA 4B33A 1XXHA 4E13A 1WZIA 3JWJA 1QWOA 3KHKA 1DWPA 3INYA 4IXDA 4BMZA 4F4IA 1CR1A 3AINA 4TV9A 1LBQA 2WQ7A 3KTAB 3DXFA 3EBOA 3KXLA 4BNHA 1VG8A 1QX3A 2NN3C 4KXUA 1MVLA 2M32A 4ZDWA 4B32A 2JJ2D 3NHLA 5KMGB 2ZRMA 4XX0B 3FDXA 3E3NA 3B8HA 3DOJA 3C3KA 3ZHSA 3UJHA 3SZUA 4D8TA 1TTHA 1M54A 4FZ5A 4QGFA 4XGRA 1NP7A 1T9KA 3RDPA 4RPKA 1E9CA 3FMFA 3W6OA 3DZ8A 4CEIA 3IVCA 2JKYA 4J0GA 4AUMA 2IPNA 1ZIYA 5LJIA 4K9RA 3QV2A 6LDHA 3CPSA 1UFKA 1XI2A 1Y8RB 3PUKA 1YGYA 2JBAB 5BSVA 1T4CA 1JT9A 5CT9A 5A5DA 3K94A 1VZ3A 5BQ5A 4Y6QA 1JT2A 1IWPB 3PE6A 4MQBA 4E5YA 2PE5A 1IG3A 2AI3A 5KYWB 4AS2A 2ERXA 5IJ9B 3T8YA 4EYSA 3DVRX 4TXJA 1KQ3A 1PCXA 2IBMA 3VPXA 2PUDA 2D5BA 3H97A 3PNSA 5B6IA 4YRMA 1VKOA 2O54A 5E95A 3BTOA 3Q6NA 1OWPA 3NUGA 3OMXA 1PIWA 4AL4A 2ZSKA 4C7BA 1Y4ZA 2WP8J 4P3NA 1K3UB 3D4IA 3B85A 5CG1A 2O2DA 2Q9UA 2I4IA 3LQFA 1P91A 2CY1A 1LV7A 1AXEA 2GYUA 3ED5A 3AVXA 5IFLA 4KQHA 1YI1A 5B1HA 1ZFNA 3STHA 3EEOA 1KC1A 2DT8A 5EJ9A 2JJYA 1V7QA 1Y5LA 3AERA 3BF8A 2Z8YM 1IQ0A 2BEVA 3I5AA 4HDMA 5JJIA 4JP8A 4NOMA 4ZVLA 1SUSA 4GM1A 1NI4B 1X1CA 4F97A 4MS3A 5KC8A 4QBHA 4I6EA 3ICQB 2I78A 1K8ZB 2ECFA 2V65A 4LF6B 2GWRA 2W6IA 1VLMA 4PG5A 3I3OA 1TZBA 1H2HA 3VU0A 3G82C 3H7IA 1OH6A 4IDPA 3E7XA 2YV1A 1PNVA 3UJNA 4DMLA 4GBED 4RHEA 4J75A 4XWKA 2VDUE 4RIFA 1MC5A 3KSBC 5CHYA 1JPVA 1BXGA 3I05A 4LYEA 2Q9AA 1F0KA 3KU1A 4FDVA 5JANA 3W5BA 1FP7A 3C24A 4G85A 4DEXA 4LF5C 2I7XA 2WMOB 4RKWA 2YYAA 3CBGA 1ULUA 4Y0NA 3CYFA 2W8BB 1UPCA 3KTDA 2ATWA 4DNPA 3WV4A 3ZBTA 2XUAA 1V6SA 3KJFA 1YBAA 4ZVUA 3VR5H 2ZRDA 1FLOA 2P0EA 2OFXA 1QS0B 2ASEA 3SM9A 1PS0A 1AUOA 5DM4A 1NKVA 1UBCA 3DQQA 3T3EA 1XQ1A 2CD9A 4NOZA 4GLOA 2P40A 2YJ5A 4URZR 2FGKA 4L8LA 4R8RA 2FMTA 1IWBB 1M8KA 1YQUA 2ACEA 2Z1MA 3HCDA 4IF4A 4BUCA 1G5TA 1OAKA 4I9NA 1EFLA 4KH1A 2ZCUA 4AJEA 4DIMA 4JSRA 3KUXA 1GILA 4U4AA 3W3ZB 3D4OA 3DBLA 3E8XA 5TB5A 1AIPA 4KAJA 1HQCA 1OXBB 1EU1A 1XJ5A 5ENZA 3W2IA 4KX3A 4DSAA 1RSZA 1KH1A 1FQOA 1DAFA 4P54A 3MAGA 4Y6GB 4M83A 3VTZA 1XYGA 1SEVA 4LMPA 4NDAA 4AJPA 3VHRA 2H2AA 1NJ2A 1COZA 5EPOA 2PYDA 5LJLA 2CHGA 5AI0A 3DYBA 3U7RA 1PFKA 4B3TB 3IQGX 3GJXC 4YP0A 2ZEJA 3SIWA 1N36C 3D7NA 3C6ZA 2VNHA 3CRZA 3EEIA 3FLMA 1T9BA 4D4MA 4ZOQI 5BR4A 4WK4B 3F7NA 3WS7A 3HBMA 1SU6A 2UYGA 2QAGA 2PH3A 3JAWB 1F2UB 1SQFA 3MRTA 3A6GA 1CT9A 4KEAA 1U5CA 2ZS8A