4DD8A

Adam-8 metalloproteinase domain with bound batimastat
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
205
structure length
201
Chain Sequence
RETRYVELYVVVDNAEFQMLGSEAAVRHRVLEVVNHVDKLYQKLNFRVVLVGLEIWNSQDRFHVSPDPSVTLENLLTWQARRHLHDNVQLITGVDFTGTTVGFARVSAMCSHSSGAVNQDHSKNPVGVACTMAHEMGHNLGMDHDENVQGCRCQERFEAGRCIMAGSIGSSFPRMFSDCSQAYLESFLERPQSVCLANAPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Disintegrin and metalloproteinase domain-containing protein
publication title Structure of human ADAM-8 catalytic domain complexed with batimastat.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 67
structure length 201
sequence length 205
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.-:
pdb deposition date 2012-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01421 Reprolysin Reprolysin (M12B) family zinc metalloprotease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 4dd8A00
1ZP5A 2USNA 1AF0A 3B2ZA 3E8RA 3USNA 3KECA 1YCMA 2O36A 3LQ0A 5I12A 3KRYA 1R55A 966CA 4EFSA 1PWWA 1D8MA 2RJPA 2JT5A 3Q2HA 2FV5A 1FLSA 1R1JA 2K9CA 2EROA 4G0DA 1MNCA 1IAGA 1EAKA 1O0QA 1JIZA 1ZXCA 3LILA 3HDAP 4ZR5A 3N2UA 4DPEA 2K2GA 1Y0VA 1OM7A 5D7WA 1IABA 4GQLA 3KEKA 2WOAA 3DWBA 3LQBA 2XS3A 1XFXA 3LJTA 2OXZA 1XFZA 3RTSA 1BQQM 3LJGA 5BPAA 1ATLA 4DV8A 1YOUA 1JK3A 1JAPA 2D1NA 1BUDA 1D7XA 1QJIA 1G4KA 4L63A 3GBOA 3TVCA 1C3IA 4WKEA 3OHOA 1MMQA 1SLNA 1JANA 4H84A 1GE7A 1CGFA 2OXWA 1CGEA 2WO8A 3DL1A 3DPEA 4GWNA 1BSWA 3LMCA 1QIBA 3G42A 4R3VA 4H30A 1EB6A 2YB9A 3U1RA 1MMPA 3LE9A 2FV9A 4G9LA 1K7QA 2POJA 4FVLA 4L19A 5I43A 3B92A 1CAQA 2RJQA 2OY4A 1GXDA 1RMZA 3AIGA 2E3XA 1R54A 1EUBA 4JP4A 1OS2A 1YP1A 2Y6CA 4H82A 4IUWA 4XCTA 2OW2A 1ZTQA 1ROSA 4XBHA 3CKIA 1OM6A 2YIGA 3Q2GA 4PKTA 1BUVM 4HX3A 1QIAA 3F17A 2X3BA 3ZXHA 5H8XA 3N2VA 3EDGA 1XFWA 3DNGA 3WV3A 5BOYA 2PJTA 4CTHA 1IAEA 1GO8P 4GUYA 1HV5A 1AKLA 1DTHA 2OZRA 4DF9A 4GR8A 3P24A 1OO9A 3F16A 1HY7A 2Y6DA 1PWVA 1KBCA 1KAPP 3DSLA 2AYKA 4DD8A 1UMTA 2MLRA 2CKIA 4I03A 2JIHA 1QICA 1FBLA 1RM8A 1K7IA 1B3DA 3AYKA 2X7MA 1SU3A 5LABA 1IAAA 1SLMA 4WKIA 4GR0A 2J0TA 2JNPA 3LIRA 1OMJA 1XFVA 3HB2P 3L0VA 4H49A 4GF1A 1HTDA 1R1HA 1XUDA 4AYKA 1XUCA 4PKQA 5I2ZA 3TSKA 1JIWP 3AYUA 4JPAA 3WV2A 1XFUA 4XM8A 3KHIA 1A86A 5CZMA 4PKUA 2W14A 2N8RA 2OW0A 2W15A 3K7NA 4JIJA 3LKAA 2I47A 1G12A 1BZSA 1I76A 1BKCI 1ZVXA 4AUOA 2OW9A 4H76A 1I73A 1CIZA 3LGPA 3ELMA 3KMCA 4JA1A 4WK7A 1BIWA 3F15A 1KUGA 4PKRA 3TT4A 4GR3A 1JAOA 4GWMA 3HBVP 5BOTA 2W13A 3V96B 3EDZA 1ASTA 4ON1A 2D1OA 1R1IA 1G49A 5D3CA 2J83A 4A3WA 1CXVA 5L7FA 4Q1LA 2DW0A 1D5JA 1JAQA 1FM1A 3VTGA 1USNA 2JSDA 4XM6A 2V4BA 1IADA 3HDBA 2HU6A 3WV1A 2OY2A 3KWVC 2XS4A 3I7GA 1B8YA 2A8HA 3ZUKA 1GKDA 4AIGA 2MZHA 1A85A 1HFCA 1JJ9A 3EDIA 3LUNA 2ERQA 2X3AA 3LEAA 1SMPA 1CQRA 2ERPA 1CK7A 2L0RA 3NX7A 1YQYA 5CXAA 1C8TA 1DMTA 3DPFA 3O2XA 4WZVA 3LUMA 4PKWA 1Z3JA 4PKVA 1PWUA 1SRPA 3L0TA 1I1IP 2W12A 2W0DA 3F1AA 2E2DA 1OM8A 4JQGA 1Q3AA 3EWJA 3HYGA 1C7KA 1UMSA 1JH1A 2MZEA 1ND1A 1MMRA 4I35A 3LJZA 5D1TA 2JT6A 1UTTA 2O3EA 3I7IA 1HOVA 1HFSA 1ZXVA 5I0LA 1O0TA 4PKSA 3HY9A 3LK8A 5JMYA 3LIKA 4WF6A 1XURA 2DW1A 5I4OA 1KUFA 1J7NA 2MLSA 4IJOA 1H71P 4H2EA 3UVCA 3OHLA 2OW1A 2CLTA 1Y8JA 1QJJA 5I3MA 1G05A 1L6JA 2OXUA 2KRJA 1JKYA 4L6TA 4AXQA 1UEAA 1UTZA 3BA0A 5CUHA 3F18A 1KUKA 4A7BA 1BKCA 2SRTA 4J4MA 4H3XA 3G5CA 5L79A 1ZS0A 3EHXA 830CA 3EHYA 1IACA 4FU4A 1QUAA 3F19A 4H1QA 4FXYP 3HY7A 2MZIA 2X3CA 3TS4A 1G9KA 3ZVSA 3B8ZA 3KMEA 456CA 4FXQA 1KUIA 1SATA 1KUHA 1BKCE 1PWQA 1PWPA 1WNIA 2TCLA 3K7LA 1Y93A 2OI0A 3SHIA 3O64A 1GO7P 2DDYA 4ILWD 1BM6A 2DW2A 1BQOA 5D1UA 5D1SA 5D2BA 3VI1A 3P1VA 4HMAA 2DDFA 4QKZA 1CGLA 1XFYA 1GE5A 3RTTA 5B5OA 1GKCA 2QPJA 1OS9A 4IN9A 2AIGP 1AYKA 5B5PA 1D8FA 2OVZA 3MA2A 2OVXA 2Z2DA 3KEJA 1K7GA 3EDHA 4XM7A 1GE6A 1MMBA 1S4BP 2WO9A 3HBUP
chains in the Genus database with same CATH superfamily
1ZP5A 2USNA 1AF0A 3B2ZA 3E8RA 3USNA 3KECA 1YCMA 2O36A 3LQ0A 5I12A 3KRYA 1R55A 966CA 4EFSA 1PWWA 1D8MA 2RJPA 2JT5A 3Q2HA 2FV5A 1FLSA 1R1JA 2K9CA 2EROA 4G0DA 1MNCA 1IAGA 1EAKA 1O0QA 1JIZA 1ZXCA 3LILA 3HDAP 4ZR5A 3N2UA 4DPEA 2K2GA 1Y0VA 1OM7A 5D7WA 1IABA 4GQLA 3KEKA 2WOAA 3DWBA 3LQBA 2XS3A 1XFXA 3LJTA 2OXZA 1XFZA 3RTSA 1BQQM 3LJGA 5BPAA 1ATLA 4DV8A 1YOUA 1JK3A 1JAPA 2D1NA 1BUDA 1D7XA 1QJIA 1G4KA 4L63A 3GBOA 3TVCA 1C3IA 4WKEA 3OHOA 1MMQA 1SLNA 1JANA 4H84A 1GE7A 1CGFA 2OXWA 1CGEA 2WO8A 3DL1A 3DPEA 4GWNA 1BSWA 3LMCA 1QIBA 3G42A 4R3VA 4H30A 1EB6A 2YB9A 3U1RA 1MMPA 3LE9A 2FV9A 4G9LA 1K7QA 2POJA 4FVLA 4L19A 5I43A 3B92A 1CAQA 2RJQA 2OY4A 1GXDA 1RMZA 3AIGA 2E3XA 1R54A 1EUBA 4JP4A 1OS2A 1YP1A 2Y6CA 4H82A 4IUWA 4XCTA 2OW2A 1ZTQA 1ROSA 4XBHA 3CKIA 1OM6A 2YIGA 3Q2GA 4PKTA 1BUVM 4HX3A 1XM5A 1QIAA 3F17A 2X3BA 3ZXHA 5H8XA 3N2VA 3EDGA 1XFWA 3DNGA 3WV3A 5BOYA 2PJTA 4CTHA 1IAEA 1GO8P 4GUYA 1HV5A 1AKLA 1DTHA 2OZRA 4DF9A 4GR8A 3P24A 1OO9A 3F16A 1HY7A 2Y6DA 1PWVA 1KBCA 1KAPP 3DSLA 2AYKA 4DD8A 1UMTA 2MLRA 2CKIA 4I03A 2JIHA 1QICA 1FBLA 1RM8A 1K7IA 1B3DA 3AYKA 2X7MA 1SU3A 5LABA 1IAAA 1SLMA 4WKIA 4GR0A 2J0TA 2JNPA 3LIRA 1OMJA 1XFVA 3HB2P 3L0VA 4H49A 4GF1A 1HTDA 1R1HA 1XUDA 4AYKA 1XUCA 3DTEA 4PKQA 5I2ZA 3TSKA 1JIWP 3AYUA 4JPAA 3WV2A 1XFUA 4XM8A 3KHIA 1A86A 5CZMA 4PKUA 2W14A 2N8RA 2OW0A 2W15A 3K7NA 4JIJA 3LKAA 2I47A 1G12A 1BZSA 1I76A 3DTIA 1BKCI 1ZVXA 4AUOA 2OW9A 4H76A 1I73A 1CIZA 3LGPA 3ELMA 3KMCA 4JA1A 4WK7A 1BIWA 3F15A 1KUGA 4PKRA 3TT4A 4GR3A 1JAOA 4GWMA 3HBVP 5BOTA 2W13A 3V96B 3EDZA 1ASTA 4ON1A 2D1OA 1R1IA 1G49A 5D3CA 2J83A 4A3WA 1CXVA 5L7FA 4Q1LA 2DW0A 1D5JA 1JAQA 1FM1A 3VTGA 1USNA 2JSDA 4XM6A 2V4BA 1IADA 3HDBA 2HU6A 3WV1A 2OY2A 3DTKA 3KWVC 2XS4A 3I7GA 1B8YA 2YUFA 2A8HA 3ZUKA 1GKDA 4AIGA 2MZHA 1A85A 1HFCA 1JJ9A 3EDIA 3LUNA 2ERQA 2X3AA 3LEAA 1SMPA 1CQRA 2ERPA 1CK7A 2L0RA 3NX7A 1YQYA 5CXAA 1C8TA 1DMTA 3DPFA 3O2XA 4WZVA 3LUMA 4PKWA 1Z3JA 4PKVA 1PWUA 1SRPA 3L0TA 1I1IP 2W12A 2W0DA 3F1AA 2E2DA 1OM8A 4JQGA 1Q3AA 3EWJA 3HYGA 1C7KA 1UMSA 1JH1A 2MZEA 1ND1A 1MMRA 4I35A 3LJZA 5D1TA 1XAXA 2JT6A 1UTTA 2O3EA 3I7IA 1HOVA 1HFSA 1ZXVA 5I0LA 1O0TA 4PKSA 3HY9A 3LK8A 5JMYA 3LIKA 4WF6A 1XURA 2DW1A 5I4OA 1KUFA 1J7NA 2MLSA 1OZ9A 4IJOA 1H71P 4H2EA 3UVCA 3OHLA 2OW1A 2CLTA 1Y8JA 1QJJA 5I3MA 1G05A 1L6JA 2OXUA 2KRJA 1JKYA 4L6TA 4AXQA 1UEAA 1UTZA 3BA0A 5CUHA 1TVIA 3F18A 1KUKA 4A7BA 1BKCA 2SRTA 4J4MA 4H3XA 3G5CA 5L79A 1ZS0A 3EHXA 830CA 3EHYA 1IACA 4FU4A 1QUAA 3F19A 4H1QA 4FXYP 3HY7A 2MZIA 2X3CA 3TS4A 1G9KA 3ZVSA 3B8ZA 3KMEA 456CA 4FXQA 1KUIA 1SATA 1KUHA 1BKCE 1PWQA 1PWPA 1WNIA 2TCLA 3K7LA 1Y93A 2OI0A 3SHIA 3O64A 4L7AA 1GO7P 2DDYA 4ILWD 1BM6A 2DW2A 1BQOA 5D1UA 5D1SA 5D2BA 3VI1A 3P1VA 4HMAA 2DDFA 4QKZA 1CGLA 1XFYA 1GE5A 3RTTA 5B5OA 1GKCA 2QPJA 1OS9A 4IN9A 2AIGP 1AYKA 5B5PA 1D8FA 2OVZA 3MA2A 2OVXA 2Z2DA 3KEJA 1K7GA 3EDHA 4XM7A 1GE6A 1MMBA 1S4BP 2WO9A 3HBUP
chains in the Genus database with same CATH topology
1ZP5A 2USNA 1AF0A 3B2ZA 3E8RA 3USNA 3KECA 1YCMA 2O36A 3LQ0A 5I12A 3KRYA 1R55A 966CA 4EFSA 1PWWA 1D8MA 2RJPA 2JT5A 3Q2HA 2FV5A 1FLSA 1R1JA 2K9CA 2EROA 4G0DA 1MNCA 1IAGA 1EAKA 1O0QA 1JIZA 1ZXCA 3LILA 3HDAP 4ZR5A 3N2UA 4DPEA 2K2GA 1Y0VA 1OM7A 5D7WA 1IABA 4GQLA 3KEKA 2WOAA 3DWBA 3LQBA 2XS3A 1XFXA 3LJTA 2OXZA 1XFZA 3RTSA 1BQQM 3LJGA 5BPAA 1ATLA 4DV8A 1YOUA 1JK3A 1JAPA 2D1NA 1BUDA 1D7XA 1QJIA 1G4KA 4L63A 3GBOA 3TVCA 1C3IA 4WKEA 3OHOA 1MMQA 1SLNA 1JANA 4H84A 1GE7A 1CGFA 2OXWA 1CGEA 2WO8A 3DL1A 3DPEA 4GWNA 1BSWA 3LMCA 1QIBA 3G42A 4R3VA 4H30A 1EB6A 2YB9A 3U1RA 1MMPA 3LE9A 2FV9A 4G9LA 1K7QA 2POJA 4FVLA 4L19A 5I43A 3B92A 1CAQA 2RJQA 2OY4A 1GXDA 1RMZA 3AIGA 2E3XA 1R54A 1EUBA 4JP4A 1OS2A 1YP1A 2Y6CA 4H82A 4IUWA 4XCTA 2OW2A 1ZTQA 1ROSA 4XBHA 3CKIA 1OM6A 2YIGA 3Q2GA 4PKTA 1BUVM 4HX3A 1QIAA 3F17A 2X3BA 3ZXHA 5H8XA 3N2VA 3EDGA 1XFWA 3DNGA 3WV3A 5BOYA 2PJTA 4CTHA 1IAEA 1GO8P 4GUYA 1HV5A 1AKLA 1DTHA 2OZRA 4DF9A 4GR8A 3P24A 1OO9A 3F16A 1HY7A 2Y6DA 1PWVA 1KBCA 1KAPP 3DSLA 2AYKA 4DD8A 1UMTA 2MLRA 2CKIA 4I03A 2JIHA 1QICA 1FBLA 1RM8A 1K7IA 1B3DA 3AYKA 2X7MA 1SU3A 5LABA 1IAAA 1SLMA 4WKIA 4GR0A 2J0TA 2JNPA 3LIRA 1OMJA 1XFVA 3HB2P 3L0VA 4H49A 4GF1A 1HTDA 1R1HA 1XUDA 4AYKA 1XUCA 3DTEA 4PKQA 5I2ZA 3TSKA 1JIWP 3AYUA 4JPAA 3WV2A 1XFUA 4XM8A 3KHIA 1A86A 5CZMA 4PKUA 2W14A 2N8RA 2OW0A 2W15A 3K7NA 4JIJA 3LKAA 2I47A 1G12A 1BZSA 1I76A 3DTIA 1BKCI 1ZVXA 4AUOA 2OW9A 4H76A 1I73A 1CIZA 3LGPA 3ELMA 3KMCA 4JA1A 4WK7A 1BIWA 3F15A 1KUGA 4PKRA 3TT4A 4GR3A 1JAOA 4GWMA 3HBVP 5BOTA 2W13A 3V96B 3EDZA 1ASTA 4ON1A 2D1OA 1R1IA 1G49A 5D3CA 2J83A 4A3WA 1CXVA 5L7FA 4Q1LA 2DW0A 1D5JA 1JAQA 1FM1A 3VTGA 1USNA 2JSDA 4XM6A 2V4BA 1IADA 3HDBA 2HU6A 3WV1A 2OY2A 3DTKA 3KWVC 2XS4A 3I7GA 1B8YA 2YUFA 2A8HA 3ZUKA 1GKDA 4AIGA 2MZHA 1A85A 1HFCA 1JJ9A 3EDIA 3LUNA 2ERQA 2X3AA 3LEAA 1SMPA 1CQRA 2ERPA 1CK7A 2L0RA 3NX7A 1YQYA 5CXAA 1C8TA 1DMTA 3DPFA 3O2XA 4WZVA 3LUMA 4PKWA 1Z3JA 4PKVA 1PWUA 1SRPA 3L0TA 1I1IP 2W12A 2W0DA 3F1AA 2E2DA 1OM8A 4JQGA 1Q3AA 3EWJA 3HYGA 1C7KA 1UMSA 1JH1A 2MZEA 1ND1A 1MMRA 4I35A 3LJZA 5D1TA 2JT6A 1UTTA 2O3EA 3I7IA 1HOVA 1HFSA 1ZXVA 5I0LA 1O0TA 4PKSA 3HY9A 3LK8A 5JMYA 3LIKA 4WF6A 1XURA 2DW1A 5I4OA 1KUFA 1J7NA 2MLSA 4IJOA 1H71P 4H2EA 3UVCA 3OHLA 2OW1A 2CLTA 1Y8JA 1QJJA 5I3MA 1G05A 1L6JA 2OXUA 2KRJA 1JKYA 4L6TA 4AXQA 1UEAA 1UTZA 3BA0A 5CUHA 3F18A 1KUKA 4A7BA 1BKCA 2SRTA 4J4MA 4H3XA 3G5CA 5L79A 1ZS0A 3EHXA 830CA 3EHYA 1IACA 4FU4A 1QUAA 3F19A 4H1QA 4FXYP 3HY7A 2MZIA 2X3CA 3TS4A 1G9KA 3ZVSA 3B8ZA 3KMEA 456CA 4FXQA 1KUIA 1SATA 1KUHA 1BKCE 1PWQA 1PWPA 1WNIA 2TCLA 3K7LA 1Y93A 2OI0A 3SHIA 3O64A 4L7AA 1GO7P 2DDYA 4ILWD 1BM6A 2DW2A 1BQOA 5D1UA 5D1SA 5D2BA 3VI1A 3P1VA 4HMAA 2DDFA 4QKZA 1CGLA 1XFYA 1GE5A 3RTTA 5B5OA 1GKCA 2QPJA 1OS9A 4IN9A 2AIGP 1AYKA 5B5PA 1D8FA 2OVZA 3MA2A 2OVXA 2Z2DA 3KEJA 1K7GA 3EDHA 4XM7A 1GE6A 1MMBA 1S4BP 2WO9A 3HBUP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP5 A;  2USN A;  1AF0 A;  3B2Z A;  3E8R A;  3USN A;  3KEC A;  1YCM A;  2O36 A;  3LQ0 A;  5I12 A;  3KRY A;  1R55 A;  966C A;  4EFS A;  1PWW A;  1D8M A;  2RJP A;  2JT5 A;  3Q2H A;  2FV5 A;  1FLS A;  1R1J A;  2K9C A;  2ERO A;  4G0D A;  1MNC A;  1IAG A;  1EAK A;  1O0Q A;  1JIZ A;  1ZXC A;  3LIL A;  3HDA P;  4ZR5 A;  3N2U A;  4DPE A;  2K2G A;  1Y0V A;  1OM7 A;  5D7W A;  1IAB A;  4GQL A;  3KEK A;  2WOA A;  3DWB A;  3LQB A;  2XS3 A;  1XFX A;  3LJT A;  2OXZ A;  1XFZ A;  3RTS A;  1BQQ M;  3LJG A;  5BPA A;  1ATL A;  4DV8 A;  1YOU A;  1JK3 A;  1JAP A;  2D1N A;  1BUD A;  1D7X A;  1QJI A;  1G4K A;  4L63 A;  3GBO A;  3TVC A;  1C3I A;  4WKE A;  3OHO A;  1MMQ A;  1SLN A;  1JAN A;  4H84 A;  1GE7 A;  1CGF A;  2OXW A;  1CGE A;  2WO8 A;  3DL1 A;  3DPE A;  4GWN A;  1BSW A;  3LMC A;  1QIB A;  3G42 A;  4R3V A;  4H30 A;  1EB6 A;  2YB9 A;  3U1R A;  1MMP A;  3LE9 A;  2FV9 A;  4G9L A;  1K7Q A;  2POJ A;  4FVL A;  4L19 A;  5I43 A;  3B92 A;  1CAQ A;  2RJQ A;  2OY4 A;  1GXD A;  1RMZ A;  3AIG A;  2E3X A;  1R54 A;  1EUB A;  4JP4 A;  1OS2 A;  1YP1 A;  2Y6C A;  4H82 A;  4IUW A;  4XCT A;  2OW2 A;  1ZTQ A;  1ROS A;  4XBH A;  3CKI A;  1OM6 A;  2YIG A;  3Q2G A;  4PKT A;  1BUV M;  4HX3 A;  1QIA A;  3F17 A;  2X3B A;  3ZXH A;  5H8X A;  3N2V A;  3EDG A;  1XFW A;  3DNG A;  3WV3 A;  5BOY A;  2PJT A;  4CTH A;  1IAE A;  1GO8 P;  4GUY A;  1HV5 A;  1AKL A;  1DTH A;  2OZR A;  4DF9 A;  4GR8 A;  3P24 A;  1OO9 A;  3F16 A;  1HY7 A;  2Y6D A;  1PWV A;  1KBC A;  1KAP P;  3DSL A;  2AYK A;  4DD8 A;  1UMT A;  2MLR A;  2CKI A;  4I03 A;  2JIH A;  1QIC A;  1FBL A;  1RM8 A;  1K7I A;  1B3D A;  3AYK A;  2X7M A;  1SU3 A;  5LAB A;  1IAA A;  1SLM A;  4WKI A;  4GR0 A;  2J0T A;  2JNP A;  3LIR A;  1OMJ A;  1XFV A;  3HB2 P;  3L0V A;  4H49 A;  4GF1 A;  1HTD A;  1R1H A;  1XUD A;  4AYK A;  1XUC A;  4PKQ A;  5I2Z A;  3TSK A;  1JIW P;  3AYU A;  4JPA A;  3WV2 A;  1XFU A;  4XM8 A;  3KHI A;  1A86 A;  5CZM A;  4PKU A;  2W14 A;  2N8R A;  2OW0 A;  2W15 A;  3K7N A;  4JIJ A;  3LKA A;  2I47 A;  1G12 A;  1BZS A;  1I76 A;  1BKC I;  1ZVX A;  4AUO A;  2OW9 A;  4H76 A;  1I73 A;  1CIZ A;  3LGP A;  3ELM A;  3KMC A;  4JA1 A;  4WK7 A;  1BIW A;  3F15 A;  1KUG A;  4PKR A;  3TT4 A;  4GR3 A;  1JAO A;  4GWM A;  3HBV P;  5BOT A;  2W13 A;  3V96 B;  3EDZ A;  1AST A;  4ON1 A;  2D1O A;  1R1I A;  1G49 A;  5D3C A;  2J83 A;  4A3W A;  1CXV A;  5L7F A;  4Q1L A;  2DW0 A;  1D5J A;  1JAQ A;  1FM1 A;  3VTG A;  1USN A;  2JSD A;  4XM6 A;  2V4B A;  1IAD A;  3HDB A;  2HU6 A;  3WV1 A;  2OY2 A;  3KWV C;  2XS4 A;  3I7G A;  1B8Y A;  2A8H A;  3ZUK A;  1GKD A;  4AIG A;  2MZH A;  1A85 A;  1HFC A;  1JJ9 A;  3EDI A;  3LUN A;  2ERQ A;  2X3A A;  3LEA A;  1SMP A;  1CQR A;  2ERP A;  1CK7 A;  2L0R A;  3NX7 A;  1YQY A;  5CXA A;  1C8T A;  1DMT A;  3DPF A;  3O2X A;  4WZV A;  3LUM A;  4PKW A;  1Z3J A;  4PKV A;  1PWU A;  1SRP A;  3L0T A;  1I1I P;  2W12 A;  2W0D A;  3F1A A;  2E2D A;  1OM8 A;  4JQG A;  1Q3A A;  3EWJ A;  3HYG A;  1C7K A;  1UMS A;  1JH1 A;  2MZE A;  1ND1 A;  1MMR A;  4I35 A;  3LJZ A;  5D1T A;  2JT6 A;  1UTT A;  2O3E A;  3I7I A;  1HOV A;  1HFS A;  1ZXV A;  5I0L A;  1O0T A;  4PKS A;  3HY9 A;  3LK8 A;  5JMY A;  3LIK A;  4WF6 A;  1XUR A;  2DW1 A;  5I4O A;  1KUF A;  1J7N A;  2MLS A;  4IJO A;  1H71 P;  4H2E A;  3UVC A;  3OHL A;  2OW1 A;  2CLT A;  1Y8J A;  1QJJ A;  5I3M A;  1G05 A;  1L6J A;  2OXU A;  2KRJ A;  1JKY A;  4L6T A;  4AXQ A;  1UEA A;  1UTZ A;  3BA0 A;  5CUH A;  3F18 A;  1KUK A;  4A7B A;  1BKC A;  2SRT A;  4J4M A;  4H3X A;  3G5C A;  5L79 A;  1ZS0 A;  3EHX A;  830C A;  3EHY A;  1IAC A;  4FU4 A;  1QUA A;  3F19 A;  4H1Q A;  4FXY P;  3HY7 A;  2MZI A;  2X3C A;  3TS4 A;  1G9K A;  3ZVS A;  3B8Z A;  3KME A;  456C A;  4FXQ A;  1KUI A;  1SAT A;  1KUH A;  1BKC E;  1PWQ A;  1PWP A;  1WNI A;  2TCL A;  3K7L A;  1Y93 A;  2OI0 A;  3SHI A;  3O64 A;  1GO7 P;  2DDY A;  4ILW D;  1BM6 A;  2DW2 A;  1BQO A;  5D1U A;  5D1S A;  5D2B A;  3VI1 A;  3P1V A;  4HMA A;  2DDF A;  4QKZ A;  1CGL A;  1XFY A;  1GE5 A;  3RTT A;  5B5O A;  1GKC A;  2QPJ A;  1OS9 A;  4IN9 A;  2AIG P;  1AYK A;  5B5P A;  1D8F A;  2OVZ A;  3MA2 A;  2OVX A;  2Z2D A;  3KEJ A;  1K7G A;  3EDH A;  4XM7 A;  1GE6 A;  1MMB A;  1S4B P;  2WO9 A;  3HBU P; 
#chains in the Genus database with same CATH topology
 1ZP5 A;  2USN A;  1AF0 A;  3B2Z A;  3E8R A;  3USN A;  3KEC A;  1YCM A;  2O36 A;  3LQ0 A;  5I12 A;  3KRY A;  1R55 A;  966C A;  4EFS A;  1PWW A;  1D8M A;  2RJP A;  2JT5 A;  3Q2H A;  2FV5 A;  1FLS A;  1R1J A;  2K9C A;  2ERO A;  4G0D A;  1MNC A;  1IAG A;  1EAK A;  1O0Q A;  1JIZ A;  1ZXC A;  3LIL A;  3HDA P;  4ZR5 A;  3N2U A;  4DPE A;  2K2G A;  1Y0V A;  1OM7 A;  5D7W A;  1IAB A;  4GQL A;  3KEK A;  2WOA A;  3DWB A;  3LQB A;  2XS3 A;  1XFX A;  3LJT A;  2OXZ A;  1XFZ A;  3RTS A;  1BQQ M;  3LJG A;  5BPA A;  1ATL A;  4DV8 A;  1YOU A;  1JK3 A;  1JAP A;  2D1N A;  1BUD A;  1D7X A;  1QJI A;  1G4K A;  4L63 A;  3GBO A;  3TVC A;  1C3I A;  4WKE A;  3OHO A;  1MMQ A;  1SLN A;  1JAN A;  4H84 A;  1GE7 A;  1CGF A;  2OXW A;  1CGE A;  2WO8 A;  3DL1 A;  3DPE A;  4GWN A;  1BSW A;  3LMC A;  1QIB A;  3G42 A;  4R3V A;  4H30 A;  1EB6 A;  2YB9 A;  3U1R A;  1MMP A;  3LE9 A;  2FV9 A;  4G9L A;  1K7Q A;  2POJ A;  4FVL A;  4L19 A;  5I43 A;  3B92 A;  1CAQ A;  2RJQ A;  2OY4 A;  1GXD A;  1RMZ A;  3AIG A;  2E3X A;  1R54 A;  1EUB A;  4JP4 A;  1OS2 A;  1YP1 A;  2Y6C A;  4H82 A;  4IUW A;  4XCT A;  2OW2 A;  1ZTQ A;  1ROS A;  4XBH A;  3CKI A;  1OM6 A;  2YIG A;  3Q2G A;  4PKT A;  1BUV M;  4HX3 A;  1XM5 A;  1QIA A;  3F17 A;  2X3B A;  3ZXH A;  5H8X A;  3N2V A;  3EDG A;  1XFW A;  3DNG A;  3WV3 A;  5BOY A;  2PJT A;  4CTH A;  1IAE A;  1GO8 P;  4GUY A;  1HV5 A;  1AKL A;  1DTH A;  2OZR A;  4DF9 A;  4GR8 A;  3P24 A;  1OO9 A;  3F16 A;  1HY7 A;  2Y6D A;  1PWV A;  1KBC A;  1KAP P;  3DSL A;  2AYK A;  4DD8 A;  1UMT A;  2MLR A;  2CKI A;  4I03 A;  2JIH A;  1QIC A;  1FBL A;  1RM8 A;  1K7I A;  1B3D A;  3AYK A;  2X7M A;  1SU3 A;  5LAB A;  1IAA A;  1SLM A;  4WKI A;  4GR0 A;  2J0T A;  2JNP A;  3LIR A;  1OMJ A;  1XFV A;  3HB2 P;  3L0V A;  4H49 A;  4GF1 A;  1HTD A;  1R1H A;  1XUD A;  4AYK A;  1XUC A;  3DTE A;  4PKQ A;  5I2Z A;  3TSK A;  1JIW P;  3AYU A;  4JPA A;  3WV2 A;  1XFU A;  4XM8 A;  3KHI A;  1A86 A;  5CZM A;  4PKU A;  2W14 A;  2N8R A;  2OW0 A;  2W15 A;  3K7N A;  4JIJ A;  3LKA A;  2I47 A;  1G12 A;  1BZS A;  1I76 A;  3DTI A;  1BKC I;  1ZVX A;  4AUO A;  2OW9 A;  4H76 A;  1I73 A;  1CIZ A;  3LGP A;  3ELM A;  3KMC A;  4JA1 A;  4WK7 A;  1BIW A;  3F15 A;  1KUG A;  4PKR A;  3TT4 A;  4GR3 A;  1JAO A;  4GWM A;  3HBV P;  5BOT A;  2W13 A;  3V96 B;  3EDZ A;  1AST A;  4ON1 A;  2D1O A;  1R1I A;  1G49 A;  5D3C A;  2J83 A;  4A3W A;  1CXV A;  5L7F A;  4Q1L A;  2DW0 A;  1D5J A;  1JAQ A;  1FM1 A;  3VTG A;  1USN A;  2JSD A;  4XM6 A;  2V4B A;  1IAD A;  3HDB A;  2HU6 A;  3WV1 A;  2OY2 A;  3DTK A;  3KWV C;  2XS4 A;  3I7G A;  1B8Y A;  2YUF A;  2A8H A;  3ZUK A;  1GKD A;  4AIG A;  2MZH A;  1A85 A;  1HFC A;  1JJ9 A;  3EDI A;  3LUN A;  2ERQ A;  2X3A A;  3LEA A;  1SMP A;  1CQR A;  2ERP A;  1CK7 A;  2L0R A;  3NX7 A;  1YQY A;  5CXA A;  1C8T A;  1DMT A;  3DPF A;  3O2X A;  4WZV A;  3LUM A;  4PKW A;  1Z3J A;  4PKV A;  1PWU A;  1SRP A;  3L0T A;  1I1I P;  2W12 A;  2W0D A;  3F1A A;  2E2D A;  1OM8 A;  4JQG A;  1Q3A A;  3EWJ A;  3HYG A;  1C7K A;  1UMS A;  1JH1 A;  2MZE A;  1ND1 A;  1MMR A;  4I35 A;  3LJZ A;  5D1T A;  1XAX A;  2JT6 A;  1UTT A;  2O3E A;  3I7I A;  1HOV A;  1HFS A;  1ZXV A;  5I0L A;  1O0T A;  4PKS A;  3HY9 A;  3LK8 A;  5JMY A;  3LIK A;  4WF6 A;  1XUR A;  2DW1 A;  5I4O A;  1KUF A;  1J7N A;  2MLS A;  1OZ9 A;  4IJO A;  1H71 P;  4H2E A;  3UVC A;  3OHL A;  2OW1 A;  2CLT A;  1Y8J A;  1QJJ A;  5I3M A;  1G05 A;  1L6J A;  2OXU A;  2KRJ A;  1JKY A;  4L6T A;  4AXQ A;  1UEA A;  1UTZ A;  3BA0 A;  5CUH A;  1TVI A;  3F18 A;  1KUK A;  4A7B A;  1BKC A;  2SRT A;  4J4M A;  4H3X A;  3G5C A;  5L79 A;  1ZS0 A;  3EHX A;  830C A;  3EHY A;  1IAC A;  4FU4 A;  1QUA A;  3F19 A;  4H1Q A;  4FXY P;  3HY7 A;  2MZI A;  2X3C A;  3TS4 A;  1G9K A;  3ZVS A;  3B8Z A;  3KME A;  456C A;  4FXQ A;  1KUI A;  1SAT A;  1KUH A;  1BKC E;  1PWQ A;  1PWP A;  1WNI A;  2TCL A;  3K7L A;  1Y93 A;  2OI0 A;  3SHI A;  3O64 A;  4L7A A;  1GO7 P;  2DDY A;  4ILW D;  1BM6 A;  2DW2 A;  1BQO A;  5D1U A;  5D1S A;  5D2B A;  3VI1 A;  3P1V A;  4HMA A;  2DDF A;  4QKZ A;  1CGL A;  1XFY A;  1GE5 A;  3RTT A;  5B5O A;  1GKC A;  2QPJ A;  1OS9 A;  4IN9 A;  2AIG P;  1AYK A;  5B5P A;  1D8F A;  2OVZ A;  3MA2 A;  2OVX A;  2Z2D A;  3KEJ A;  1K7G A;  3EDH A;  4XM7 A;  1GE6 A;  1MMB A;  1S4B P;  2WO9 A;  3HBU P; 
#chains in the Genus database with same CATH homology
 1ZP5 A;  2USN A;  1AF0 A;  3B2Z A;  3E8R A;  3USN A;  3KEC A;  1YCM A;  2O36 A;  3LQ0 A;  5I12 A;  3KRY A;  1R55 A;  966C A;  4EFS A;  1PWW A;  1D8M A;  2RJP A;  2JT5 A;  3Q2H A;  2FV5 A;  1FLS A;  1R1J A;  2K9C A;  2ERO A;  4G0D A;  1MNC A;  1IAG A;  1EAK A;  1O0Q A;  1JIZ A;  1ZXC A;  3LIL A;  3HDA P;  4ZR5 A;  3N2U A;  4DPE A;  2K2G A;  1Y0V A;  1OM7 A;  5D7W A;  1IAB A;  4GQL A;  3KEK A;  2WOA A;  3DWB A;  3LQB A;  2XS3 A;  1XFX A;  3LJT A;  2OXZ A;  1XFZ A;  3RTS A;  1BQQ M;  3LJG A;  5BPA A;  1ATL A;  4DV8 A;  1YOU A;  1JK3 A;  1JAP A;  2D1N A;  1BUD A;  1D7X A;  1QJI A;  1G4K A;  4L63 A;  3GBO A;  3TVC A;  1C3I A;  4WKE A;  3OHO A;  1MMQ A;  1SLN A;  1JAN A;  4H84 A;  1GE7 A;  1CGF A;  2OXW A;  1CGE A;  2WO8 A;  3DL1 A;  3DPE A;  4GWN A;  1BSW A;  3LMC A;  1QIB A;  3G42 A;  4R3V A;  4H30 A;  1EB6 A;  2YB9 A;  3U1R A;  1MMP A;  3LE9 A;  2FV9 A;  4G9L A;  1K7Q A;  2POJ A;  4FVL A;  4L19 A;  5I43 A;  3B92 A;  1CAQ A;  2RJQ A;  2OY4 A;  1GXD A;  1RMZ A;  3AIG A;  2E3X A;  1R54 A;  1EUB A;  4JP4 A;  1OS2 A;  1YP1 A;  2Y6C A;  4H82 A;  4IUW A;  4XCT A;  2OW2 A;  1ZTQ A;  1ROS A;  4XBH A;  3CKI A;  1OM6 A;  2YIG A;  3Q2G A;  4PKT A;  1BUV M;  4HX3 A;  1QIA A;  3F17 A;  2X3B A;  3ZXH A;  5H8X A;  3N2V A;  3EDG A;  1XFW A;  3DNG A;  3WV3 A;  5BOY A;  2PJT A;  4CTH A;  1IAE A;  1GO8 P;  4GUY A;  1HV5 A;  1AKL A;  1DTH A;  2OZR A;  4DF9 A;  4GR8 A;  3P24 A;  1OO9 A;  3F16 A;  1HY7 A;  2Y6D A;  1PWV A;  1KBC A;  1KAP P;  3DSL A;  2AYK A;  4DD8 A;  1UMT A;  2MLR A;  2CKI A;  4I03 A;  2JIH A;  1QIC A;  1FBL A;  1RM8 A;  1K7I A;  1B3D A;  3AYK A;  2X7M A;  1SU3 A;  5LAB A;  1IAA A;  1SLM A;  4WKI A;  4GR0 A;  2J0T A;  2JNP A;  3LIR A;  1OMJ A;  1XFV A;  3HB2 P;  3L0V A;  4H49 A;  4GF1 A;  1HTD A;  1R1H A;  1XUD A;  4AYK A;  1XUC A;  3DTE A;  4PKQ A;  5I2Z A;  3TSK A;  1JIW P;  3AYU A;  4JPA A;  3WV2 A;  1XFU A;  4XM8 A;  3KHI A;  1A86 A;  5CZM A;  4PKU A;  2W14 A;  2N8R A;  2OW0 A;  2W15 A;  3K7N A;  4JIJ A;  3LKA A;  2I47 A;  1G12 A;  1BZS A;  1I76 A;  3DTI A;  1BKC I;  1ZVX A;  4AUO A;  2OW9 A;  4H76 A;  1I73 A;  1CIZ A;  3LGP A;  3ELM A;  3KMC A;  4JA1 A;  4WK7 A;  1BIW A;  3F15 A;  1KUG A;  4PKR A;  3TT4 A;  4GR3 A;  1JAO A;  4GWM A;  3HBV P;  5BOT A;  2W13 A;  3V96 B;  3EDZ A;  1AST A;  4ON1 A;  2D1O A;  1R1I A;  1G49 A;  5D3C A;  2J83 A;  4A3W A;  1CXV A;  5L7F A;  4Q1L A;  2DW0 A;  1D5J A;  1JAQ A;  1FM1 A;  3VTG A;  1USN A;  2JSD A;  4XM6 A;  2V4B A;  1IAD A;  3HDB A;  2HU6 A;  3WV1 A;  2OY2 A;  3DTK A;  3KWV C;  2XS4 A;  3I7G A;  1B8Y A;  2YUF A;  2A8H A;  3ZUK A;  1GKD A;  4AIG A;  2MZH A;  1A85 A;  1HFC A;  1JJ9 A;  3EDI A;  3LUN A;  2ERQ A;  2X3A A;  3LEA A;  1SMP A;  1CQR A;  2ERP A;  1CK7 A;  2L0R A;  3NX7 A;  1YQY A;  5CXA A;  1C8T A;  1DMT A;  3DPF A;  3O2X A;  4WZV A;  3LUM A;  4PKW A;  1Z3J A;  4PKV A;  1PWU A;  1SRP A;  3L0T A;  1I1I P;  2W12 A;  2W0D A;  3F1A A;  2E2D A;  1OM8 A;  4JQG A;  1Q3A A;  3EWJ A;  3HYG A;  1C7K A;  1UMS A;  1JH1 A;  2MZE A;  1ND1 A;  1MMR A;  4I35 A;  3LJZ A;  5D1T A;  2JT6 A;  1UTT A;  2O3E A;  3I7I A;  1HOV A;  1HFS A;  1ZXV A;  5I0L A;  1O0T A;  4PKS A;  3HY9 A;  3LK8 A;  5JMY A;  3LIK A;  4WF6 A;  1XUR A;  2DW1 A;  5I4O A;  1KUF A;  1J7N A;  2MLS A;  4IJO A;  1H71 P;  4H2E A;  3UVC A;  3OHL A;  2OW1 A;  2CLT A;  1Y8J A;  1QJJ A;  5I3M A;  1G05 A;  1L6J A;  2OXU A;  2KRJ A;  1JKY A;  4L6T A;  4AXQ A;  1UEA A;  1UTZ A;  3BA0 A;  5CUH A;  3F18 A;  1KUK A;  4A7B A;  1BKC A;  2SRT A;  4J4M A;  4H3X A;  3G5C A;  5L79 A;  1ZS0 A;  3EHX A;  830C A;  3EHY A;  1IAC A;  4FU4 A;  1QUA A;  3F19 A;  4H1Q A;  4FXY P;  3HY7 A;  2MZI A;  2X3C A;  3TS4 A;  1G9K A;  3ZVS A;  3B8Z A;  3KME A;  456C A;  4FXQ A;  1KUI A;  1SAT A;  1KUH A;  1BKC E;  1PWQ A;  1PWP A;  1WNI A;  2TCL A;  3K7L A;  1Y93 A;  2OI0 A;  3SHI A;  3O64 A;  4L7A A;  1GO7 P;  2DDY A;  4ILW D;  1BM6 A;  2DW2 A;  1BQO A;  5D1U A;  5D1S A;  5D2B A;  3VI1 A;  3P1V A;  4HMA A;  2DDF A;  4QKZ A;  1CGL A;  1XFY A;  1GE5 A;  3RTT A;  5B5O A;  1GKC A;  2QPJ A;  1OS9 A;  4IN9 A;  2AIG P;  1AYK A;  5B5P A;  1D8F A;  2OVZ A;  3MA2 A;  2OVX A;  2Z2D A;  3KEJ A;  1K7G A;  3EDH A;  4XM7 A;  1GE6 A;  1MMB A;  1S4B P;  2WO9 A;  3HBU P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...