4DE9A

Lytr-cps2a-psr family protein ywtf (tagt) with bound octaprenyl pyrophosphate lipid
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
272
structure length
240
Chain Sequence
HVSLARGEQSVKRIKEFDPGKDSFSVLLLGIDQARSDANVLVTFNRKEKTAKMLSIPRDAYVNIPGHGYDKFTHAHAYGGVDLTVKTVEEMLDIPVDYVVESNFTAFEDVVNELNGVKVTVKSDKVIQQIKKDTKGKVVLQKGTHTLDGEEALAYVRTRLLRGQRQMEVLSAIIDKSKSLKMNLSLKDAIGLFPFITSLKSVESIQLTGYDYEPAGVYYFKLNQQKLQEVKKELQNDLGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Attachment of Capsular Polysaccharide to the Cell Wall in Streptococcus pneumoniae.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Membrane protein
molecule keywords Putative transcriptional regulator ywtF
total genus 77
structure length 240
sequence length 272
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03816 LytR_cpsA_psr Cell envelope-related transcriptional attenuator domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.150 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4de9A02
1.10.260.190 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) 434 Repressor (Amino-terminal Domain) 4de9A01
4DE9A 2XXQA 3PE5A 3NXHA 3NROA 3QFIA 2XXPA 4OBMA 3OKZA 3TFLA 3TEPA 3MEJA 4DE8A 3OWQA 3TELA
chains in the Genus database with same CATH superfamily
3UWPA 3QWGA 2XXAA 2AXZA 3FYMA 2WIUB 1Y9QA 3LFPA 4YBAA 1WH8A 2BNOA 2CROA 2PXDA 2WUSR 1PRVA 3VK0A 3CLCA 1X57A 3PE5A 2CSFA 3NROA 2AW6A 4Q2JA 3OKZA 2B5AA 4PU4C 4EKGA 2ODRD 1AU7A 2GZUA 2PUGA 1GT0C 1U2ZA 4X4FA 1QZXA 1UXDA 3GN5A 1NW3A 3SCHA 3CROL 2JVLA 2ICTA 3VWSA 1VPWA 3OWQA 1JFTA 4EKIA 3OMTA 4OBMA 2FFHA 4EZIA 3A9XA 4YG7B 1XWRA 1ZZ9A 2IU7A 3ZKCA 1UXCA 4OB4A 1ZVVA 2OR1L 4X4IA 1PERL 2LYLA 5DRTA 3M9LA 3O9XA 3GBFA 1PRAA 2PXEA 3FYAA 1QB2A 3JXBC 2MEZA 4X4DA 2PXQA 4HRAA 3KXAA 3OP9A 3GZDA 1UTXA 1NEQA 2EF8A 3GUUA 2PXUA 3QF3A 5K98B 2BNNA 1WH6A 1ZZ6A 2KEJA 2PUEA 2IUOA 2PE5A 2L49A 2HSGA 4EK9A 2EWTA 3NXHA 5GAHi 4YG1A 1ADRA 1ZZ7A 2LYKA 4Z5DA 1X2LA 3ZPXA 1ZUGA 1WIZA 3UFDA 2KEIA 5JUWA 1YSEA 4X4EA 4I6RA 2O38A 4IA8A 3QQ6A 2KEKA 3KL4A 2VEOA 4I6TA 2HFZA 3SCFA 4Z5CA 5DSXA 4DE8A 1CJGA 5DTQA 1LQCA 3ZHIA 1R69A 1DWKA 1QP7A 3D1NI 1BDHA 2PXKA 3OQNA 3GZCA 4PU8A 3SCGA 4ER3A 1RZRA 3NDBB 1MFQC 1JH9A 2AWIA 3BDNA 5DRYA 4Y42A 1R63A 1QQBA 3LISA 2LCVA 3ME5A 4YARA 2LYQA 3OQMA 3TEPA 3TRBA 3L1PA 1OCTC 3G0TA 2KZ8A 3GZDC 1PNRA 3QYXA 3RZZA 1O4XA 3GN5B 2LLVA 2LYJA 3S8QA 3TFLA 3BD1A 1PRUA 2OFYA 4IVZA 4PU3C 3ZHMA 3NZLA 3DNVB 1OSLA 2IVBA 3U3WA 4JQDA 3QOXA 2XI8A 3IVPA 2XSDC 4X4HA 4WVLA 2GRLA 3R1FA 3HZIB 2M4HA 2L1PA 5GAGi 2PXTA 2PXPA 2D5VA 3CECA 1DULA 4ER7A 4Z59A 4I6UA 4MCTA 4NDWA 1RIOA 2EBYA 4MCXA 4J1WA 4DE9A 2AXVA 4X4BA 3QOWA 1DW9A 1NERA 4GHJA 2PUBA 1QP0A 2AXUA 1ZZBA 2H8RA 1LCDA 2JQEA 3A9ZA 2LLWA 1QQAA 4Z58A 3B7HA 3PXPA 4X4CA 1LCCA 1S7EA 1WETA 2PIJA 2KPJA 1LLIA 3H5TA 2XIUA 3BS3A 4JCYA 1LMB3 2XXQA 2FJRA 3F52A 2XCJA 4GQMA 1E3OC 1SQ8A 2LYSA 2J7UA 4EQZA 3SR4A 2PUDA 2LYPA 1RZRD 2PXVA 2BJCA 3MLFA 3F6WA 1L1MA 1Y7YA 3EUSA 2JCGA 1HQ1A 2L8NA 2BNMA 1IC8A 1B0NA 2AUWA 1EFAA 3OQOA 3JXDL 5A7LA 4JCXA 2J7WA 1HF0A 2R1JL 2A6CA 1JFSA 1JWLA 1ZPQA 3KJXA 3G5GA 1QPZA 4F8DA 1QP4A 2IV1A 4IWRA 3LQXA 4ER0A 3DM5A 4I8TA 2O4AA 3TELA 1ZAYA 2LYRA 4ER6A 2PXBA 2ICPA 2MXDA 3FMYA 3JXCL 2HCSA 2HCNA 4PU7A 1CQTA 2XJ3A 4FBIA 3R09A 1ZZCA 1POUA 2LNMA 2HINA 3MEJA 3SX0A 4ER5A 2PXLA 2MQKA 3F51A 3KZ3A 2O49A 4J1XA 5DTMA 2V3CC 1ZS4A 4O8BA 4Z5HA 1RPEL 1BDIA 2PXFA 2IVGA 2XXPA 2PUFA 2PPXA 3QFIA 2YBDA 4X4GA 3G7DA 1ZZ8A 3A9YA 2R63A 2IVQA 5DTRA 2PUAA 4FN3A 4YG4A 2PUCA 5DT2A 1RZSA 2GRMA
chains in the Genus database with same CATH topology
2L1PA 2XXQA 2LLVA 2M4HA 1U2ZA 4EK9A 3GZDA 3NXHA 3UWPA 5DTQA 3TFLA 3GUUA 3R09A 2J7UA 1NW3A 3ME5A 4EQZA 4ER5A 3PE5A 3SR4A 4ER7A 3NROA 3ZPXA 2XXPA 4ER0A 2LNMA 3TEPA 4DE8A 3MEJA 3NZLA 3SX0A 3A9ZA 3G0TA 3QFIA 2J7WA 4Q2JA 3TELA 2LLWA 5DRTA 3GZDC 3M9LA 5JUWA 3GZCA 2YBDA 3OKZA 4ER6A 5DTMA 3VWSA 3A9YA 3QOXA 4EKGA 2VEOA 3OWQA 4DE9A 4ER3A 2HFZA 2MXDA 5DTRA 2ODRD 2HCSA 3QOWA 4HRAA 4OBMA 4WVLA 4EKIA 2HCNA 5DRYA 5DSXA 5DT2A 4EZIA 3A9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DE9 A;  2XXQ A;  3PE5 A;  3NXH A;  3NRO A;  3QFI A;  2XXP A;  4OBM A;  3OKZ A;  3TFL A;  3TEP A;  3MEJ A;  4DE8 A;  3OWQ A;  3TEL A; 
#chains in the Genus database with same CATH topology
 3UWP A;  3QWG A;  2XXA A;  2AXZ A;  3FYM A;  2WIU B;  1Y9Q A;  3LFP A;  4YBA A;  1WH8 A;  2BNO A;  2CRO A;  2PXD A;  2WUS R;  1PRV A;  3VK0 A;  3CLC A;  1X57 A;  3PE5 A;  2CSF A;  3NRO A;  2AW6 A;  4Q2J A;  3OKZ A;  2B5A A;  4PU4 C;  4EKG A;  2ODR D;  1AU7 A;  2GZU A;  2PUG A;  1GT0 C;  1U2Z A;  4X4F A;  1QZX A;  1UXD A;  3GN5 A;  1NW3 A;  3SCH A;  3CRO L;  2JVL A;  2ICT A;  3VWS A;  1VPW A;  3OWQ A;  1JFT A;  4EKI A;  3OMT A;  4OBM A;  2FFH A;  4EZI A;  3A9X A;  4YG7 B;  1XWR A;  1ZZ9 A;  2IU7 A;  3ZKC A;  1UXC A;  4OB4 A;  1ZVV A;  2OR1 L;  4X4I A;  1PER L;  2LYL A;  5DRT A;  3M9L A;  3O9X A;  3GBF A;  1PRA A;  2PXE A;  3FYA A;  1QB2 A;  3JXB C;  2MEZ A;  4X4D A;  2PXQ A;  4HRA A;  3KXA A;  3OP9 A;  3GZD A;  1UTX A;  1NEQ A;  2EF8 A;  3GUU A;  2PXU A;  3QF3 A;  5K98 B;  2BNN A;  1WH6 A;  1ZZ6 A;  2KEJ A;  2PUE A;  2IUO A;  2PE5 A;  2L49 A;  2HSG A;  4EK9 A;  2EWT A;  3NXH A;  5GAH i;  4YG1 A;  1ADR A;  1ZZ7 A;  2LYK A;  4Z5D A;  1X2L A;  3ZPX A;  1ZUG A;  1WIZ A;  3UFD A;  2KEI A;  5JUW A;  1YSE A;  4X4E A;  4I6R A;  2O38 A;  4IA8 A;  3QQ6 A;  2KEK A;  3KL4 A;  2VEO A;  4I6T A;  2HFZ A;  3SCF A;  4Z5C A;  5DSX A;  4DE8 A;  1CJG A;  5DTQ A;  1LQC A;  3ZHI A;  1R69 A;  1DWK A;  1QP7 A;  3D1N I;  1BDH A;  2PXK A;  3OQN A;  3GZC A;  4PU8 A;  3SCG A;  4ER3 A;  1RZR A;  3NDB B;  1MFQ C;  1JH9 A;  2AWI A;  3BDN A;  5DRY A;  4Y42 A;  1R63 A;  1QQB A;  3LIS A;  2LCV A;  3ME5 A;  4YAR A;  2LYQ A;  3OQM A;  3TEP A;  3TRB A;  3L1P A;  1OCT C;  3G0T A;  2KZ8 A;  3GZD C;  1PNR A;  3QYX A;  3RZZ A;  1O4X A;  3GN5 B;  2LLV A;  2LYJ A;  3S8Q A;  3TFL A;  3BD1 A;  1PRU A;  2OFY A;  4IVZ A;  4PU3 C;  3ZHM A;  3NZL A;  3DNV B;  1OSL A;  2IVB A;  3U3W A;  4JQD A;  3QOX A;  2XI8 A;  3IVP A;  2XSD C;  4X4H A;  4WVL A;  2GRL A;  3R1F A;  3HZI B;  2M4H A;  2L1P A;  5GAG i;  2PXT A;  2PXP A;  2D5V A;  3CEC A;  1DUL A;  4ER7 A;  4Z59 A;  4I6U A;  4MCT A;  4NDW A;  1RIO A;  2EBY A;  4MCX A;  4J1W A;  4DE9 A;  2AXV A;  4X4B A;  3QOW A;  1DW9 A;  1NER A;  4GHJ A;  2PUB A;  1QP0 A;  2AXU A;  1ZZB A;  2H8R A;  1LCD A;  2JQE A;  3A9Z A;  2LLW A;  1QQA A;  4Z58 A;  3B7H A;  3PXP A;  4X4C A;  1LCC A;  1S7E A;  1WET A;  2PIJ A;  2KPJ A;  1LLI A;  3H5T A;  2XIU A;  3BS3 A;  4JCY A;  1LMB 3;  2XXQ A;  2FJR A;  3F52 A;  2XCJ A;  4GQM A;  1E3O C;  1SQ8 A;  2LYS A;  2J7U A;  4EQZ A;  3SR4 A;  2PUD A;  2LYP A;  1RZR D;  2PXV A;  2BJC A;  3MLF A;  3F6W A;  1L1M A;  1Y7Y A;  3EUS A;  2JCG A;  1HQ1 A;  2L8N A;  2BNM A;  1IC8 A;  1B0N A;  2AUW A;  1EFA A;  3OQO A;  3JXD L;  5A7L A;  4JCX A;  2J7W A;  1HF0 A;  2R1J L;  2A6C A;  1JFS A;  1JWL A;  1ZPQ A;  3KJX A;  3G5G A;  1QPZ A;  4F8D A;  1QP4 A;  2IV1 A;  4IWR A;  3LQX A;  4ER0 A;  3DM5 A;  4I8T A;  2O4A A;  3TEL A;  1ZAY A;  2LYR A;  4ER6 A;  2PXB A;  2ICP A;  2MXD A;  3FMY A;  3JXC L;  2HCS A;  2HCN A;  4PU7 A;  1CQT A;  2XJ3 A;  4FBI A;  3R09 A;  1ZZC A;  1POU A;  2LNM A;  2HIN A;  3MEJ A;  3SX0 A;  4ER5 A;  2PXL A;  2MQK A;  3F51 A;  3KZ3 A;  2O49 A;  4J1X A;  5DTM A;  2V3C C;  1ZS4 A;  4O8B A;  4Z5H A;  1RPE L;  1BDI A;  2PXF A;  2IVG A;  2XXP A;  2PUF A;  2PPX A;  3QFI A;  2YBD A;  4X4G A;  3G7D A;  1ZZ8 A;  3A9Y A;  2R63 A;  2IVQ A;  5DTR A;  2PUA A;  4FN3 A;  4YG4 A;  2PUC A;  5DT2 A;  1RZS A;  2GRM A; 
#chains in the Genus database with same CATH homology
 2L1P A;  2XXQ A;  2LLV A;  2M4H A;  1U2Z A;  4EK9 A;  3GZD A;  3NXH A;  3UWP A;  5DTQ A;  3TFL A;  3GUU A;  3R09 A;  2J7U A;  1NW3 A;  3ME5 A;  4EQZ A;  4ER5 A;  3PE5 A;  3SR4 A;  4ER7 A;  3NRO A;  3ZPX A;  2XXP A;  4ER0 A;  2LNM A;  3TEP A;  4DE8 A;  3MEJ A;  3NZL A;  3SX0 A;  3A9Z A;  3G0T A;  3QFI A;  2J7W A;  4Q2J A;  3TEL A;  2LLW A;  5DRT A;  3GZD C;  3M9L A;  5JUW A;  3GZC A;  2YBD A;  3OKZ A;  4ER6 A;  5DTM A;  3VWS A;  3A9Y A;  3QOX A;  4EKG A;  2VEO A;  3OWQ A;  4DE9 A;  4ER3 A;  2HFZ A;  2MXD A;  5DTR A;  2ODR D;  2HCS A;  3QOW A;  4HRA A;  4OBM A;  4WVL A;  4EKI A;  2HCN A;  5DRY A;  5DSX A;  5DT2 A;  4EZI A;  3A9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...