4DF0A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus
rcsb
molecule keywords Orotidine 5'-phosphate decarboxylase
molecule tags Lyase
source organism Thermoproteus neutrophilus
total genus 65
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df0A00
4HNUA 3LRMA 3EB2A 4O1CA 2ZZ5A 5K3VA 2RDUA 3EXSA 2Z6JA 3CIXA 2CLEA 4CCCA 5KITA 4PTNA 4TX9A 3LLDA 4JGDA 1H1YA 2VFIA 3TV8A 5HUOA 3W1TA 1VYRA 4OU1A 2CU0A 1DJNA 2C19A 1IXQA 1OX4A 3LCXA 3A22A 3W70A 1HFBA 3H53A 3W2UA 5MHBA 1Q6QA 1SW7A 2YPIA 4GUGA 4JS3A 4RZ5A 5CSSA 1TPB1 3TSBA 3PSWA 2ATSA 1H51A 4IUOA 1ICSA 2I9EA 4ZQNA 3G0UA 5C5YA 2FQIA 2XN0A 4ZQPA 3LCLA 2BZNA 2NXGA 3P81A 3NGJA 1AK5A 4K39A 3TA6A 3NO5A 4Z1DA 3LX9A 1LCOA 3THQA 3C2VA 3LHZA 3UPBA 4M6QA 3MI6A 1RQEA 1GG0A 4JIPA 2YX0A 4G1KA 5CZJA 4QAIA 2VEPA 2O7QA 3NL6A 3N14A 3B03A 1VCGA 1TPVA 5FEXA 5EYWA 3DHDA 4NNCA 1KTBA 3MBFA 1TPC1 1PCKA 3DZ1A 4IMDA 2EHHA 1ZCOA 5D04C 3B04A 3W22A 1B3OA 1UBSA 3DKJA 1OK4A 2VENA 3G1SA 3MYOA 3LB0A 4NJHA 2ZBTA 2WNNA 4O0KA 5HUPA 2TSYA 3QEZA 3PF3A 1CX9A 1ZNNA 2C18A 1PL9A 3NQ6A 4LOCA 2WSRA 5G2HA 3GAKA 4D2JA 1H60A 3G18A 5EA9A 5FEPA 3W1XA 3W71A 2YR1A 3P60A 1W31A 2XN2A 4RV8A 2V5BA 4HIBA 1OK6A 1RD5A 3UWWA 3VNDA 3WJXA 1NF0A 3HG5A 3B06A 3EWXA 5L6UA 4Z0SA 3G0SA 4RXGA 1OABA 3A5FA 1YXCA 3H55A 3W6YA 5K4ZA 3G24A 5KMYA 1FCQA 1KA9F 1QNVA 3R89A 3IIXA 1SO4A 1ZAJA 4ZQCA 1EB3A 1WDWA 1FWNA 2BX7A 1IXPA 1QOPA 3LCWA 4JTKA 1ALDA 4YL2A 4DF2A 1LRNA 2NXHA 5FF0A 4MJMA 5AHNA 3NR0A 3RFAA 1K02A 3P74A 4UTTA 4O17A 3EWZA 2E77A 2QEZA 1ZENA 3KRUA 1FXQA 3DI1A 5DLCA 3TR2A 1PE1A 1BKSA 3MHFA 4RLIA 3FJ6A 2FPYA 2ZRUA 3USBA 2ZFAA 1FUYA 1M7OA 1W0MA 3UNDA 1IXOA 2Y89A 3MP3A 3VE9A 2X16A 4ICNA 1S5VA 5DELA 1GG1A 3KRZA 4ML9A 5G4EA 5C55A 1GZGA 3WJSA 4RK8A 5EBUA 4JTFA 2ZZ3A 2H3BA 4Q33A 3C56A 4LU0A 1AL8A 3NZ1A 2HS8A 4JTUA 1QPRA 3DAQA 2B0MA 3A21A 3OVPA 5HULA 3FA5A 3S1UA 5LHEA 1K7XA 2AAMA 4O28A 2OX1A 2X1RA 4JEQA 3TQVA 1OFAA 1F74A 3GYEA 4Y8FA 4C1KA 2ZRZA 3W1AA 3T7VA 3W85A 4LV4A 1VZWA 1UUOA 4TU1A 4JTIA 5DBTA 1QPNA 3F4WA 4AB4A 4NZJA 4JTJA 4TO8A 4H3DA 1VQTA 3TAKA 1SU5A 1LLZA 1I45A 1WX0A 1W3TA 1GVRA 2B7QA 2ZA3A 1YPFA 1XUZA 4M19A 3JR2A 1QDSA 2TPSA 3MI2A 4RZ4A 2E5DA 1LYXA 3IIZA 4M6VA 1Z44A 3OHIA 2RFGA 1K3UA 3MWAA 3LI1A 3S1XA 3GKAA 1DQXA 5FF2A 3MYPA 4WY0A 3CHVA 3A24A 2RKXA 3I65A 2HTMA 3PULA 4A3UA 4UTWA 1T99A 3C2RA 4AHPA 3W83A 3LTSA 2C14A 2CLMA 3TW6A 1TIMA 4ADUA 1DJQA 1EUNA 1X1ZA 1YDNA 3ATYA 3VI2A 5F2GA 3Q37A 1L6WA 2W79A 1EX5A 3BLEA 1EEPA 2B7PA 2GQ9A 3UQNA 1ONRA 1YADA 1V5XA 1LLWA 1JQVA 3HBLA 4JTTA 4O54A 1JRBA 4IGHA 2QJHA 1W8SA 3HG4A 2YW4A 1TPFA 4FEZA 1QAPA 2J88A 1LDCA 4H4IA 1AL7A 4UXDA 4OQVA 4PA8A 3GXNA 1FWSA 5AN7A 3PBVA 2CLHA 3TC7A 3QSRA 1TJPA 5G5IA 2PC4A 4LVBA 3GK0A 1G7VA 1W3IA 2NX3A 4CQ8A 3CB8A 5D09A 1JUBA 3NA8A 3QMSA 1Z48A 4NJKA 2YW3A 3QYQA 5DCDA 5K4XA 1TO3A 1K8XA 5L9FA 4PL2A 3GB6A 3IGUA 4IXXA 3SFKA 1QCWA 2CZFA 2QR6A 4LV9A 2VXNA 3F03K 3P7YA 4XTDA 1VRDA 4M7TA 3MMTA 4LS1A 2E09A 4JXCA 3TMQA 3LTYA 3B0PA 1FX6A 2QJIA 3L0GA 3JRKA 2Y62A 1W5QA 2Q8ZA 3NL5A 4JY9A 4O1AA 5D2YA 3MJYA 1P0NA 1T8XA 1VYPX 2QCDA 2YYUA 5I3KA 4LT9A 5U7SA 1H50A 3EX4A 3NG3A 5BNKA 3BGJA 3NQ8A 4NU7A 3TUUA 4ZQRA 4NXKA 3W7NA 3NVTA 2OZ0A 2CZ5A 5DN1A 4ZVJA 2Y7GA 2BXVA 3INPA 4ZZ9A 1AW1A 1SPQA 2GVLA 1KV5A 1OJXA 1X6UA 1W5MA 3Q2DA 4MFDA 2JKPA 2IQTA 4BF9A 1SO6A 4ADTA 4JNMA 1F73A 1UJPA 4LVFA 2NV2A 3G0XA 4FIQA 4P2VA 2H8ZA 2ZTKA 4N9BA 1B4EA 1WAUA 3S9YA 1AW2A 5AHEA 2C1HA 3M6YA 2QDHA 1QO2A 1KM6A 1GQNA 2VC6A 1H5YA 5LGZA 3CM4A 3O6CA 5IM51 5D32A 4MIMA 3RLVA 1XBXA 4S1FA 1KFBA 1KFKA 2QAPA 3PM6A 1TREA 2ZQ0A 3GAYA 2NLIA 3SSJA 4DQWA 2BSLA 3LHWA 1C8VA 3P61A 2B7NA 2J27A 3PBWA 4JYDA 3C61A 1TQJA 2X1SA 4JICA 2FPVA 4WUIA 1SFJA 3A23A 2WKJA 3W7EA 3W76A 1KBJA 3NQDA 2CZDA 1LTDA 2PCQA 1G69A 3M7WA 3G3DA 4MJZA 3DXIA 1KM2A 4GE8A 2JKEA 1SW3A 1LOLA 3PUOA 3QZEA 1C9DA 2TYSA 5FEWA 3S42A 2ABAA 4K7YA 5IBXC 4GUIA 1ZJIA 4IX2A 2GQAA 3B05A 4DO6A 1KBIA 5AFDA 1JUKA 4Y96A 2R8WA 2DZVA 3EX6A 1OFQA 3C4UA 2NUYA 1KFLA 4WOQA 3N19B 4ADSA 1XCFA 2YFNA 4RX0A 5LNSA 4MZ8A 2C0AA 2Y7FA 3PS7A 3OIXA 1XDMA 4JX4A 3W2LA 5KZEA 3NL2A 3NQGA 1N7KA 2QUTA 1I4NA 3RF9A 4NUWA 5G1YA 1OVDA 3W88A 4EIVA 4UR7A 4MY9A 3QJAA 3QFEA 3WJZA 4FXRA 2AGKA 2JBMA 4QISA 5BMXA 2F7FA 5CZSA 4LWWA 3IIPA 1SR9A 5CPMA 3WJYA 1CI1A 4HPJA 5LNWA 5TQLA 1O5XA 4M5PA 1OFOA 2ZA2A 4K38A 5TIMA 2E6YA 3E12A 3MW7A 4JY8A 1WOAA 2A21A 4UTHA 3L66A 1W5NA 1A5SA 1XM3A 3O07A 3W23A 1F6KA 4JTEA 3LXBA 3M0ZA 2EPHA 1MEWA 4GXMA 4LW7A 5LZLA 4ZQMA 2OMAA 3LHVA 1VLIA 2Y88A 2TRSA 3UD6A 1JCNA 1WOBA 2A2IA 3HPZA 5AC8A 3OA3A 1EPXA 2DZSA 5K7JA 3UY8A 2ZZ4A 2W0UA 2PE4A 4Y6GA 4RZ6A 3SR7A 1ZAHA 3D0CA 2I14A 5KZDA 2H90A 2A85A 3IV3A 4CNOA 2Y7DA 4JTSA 3VCRA 5AC6A 3UY7A 3G8RA 3W1UA 3TFCA 1T96A 2C16A 4WOZA 3M16A 1LM1A 2E68A 4JIQA 3ZWSA 1KTCA 1VCVA 3KVLA 2VKZG 3IGXA 1WXJA 2V5LA 1HO4A 1UUMA 2YDAA 3PUEA 2X1UA 4WY0B 4L4MA 1TYGA 4IWWA 2X30A 1K7FA 1OG0A 2EAWA 4R53A 3EX1A 2EGZA 4NT0A 3HGOA 2ZZ6A 2E6DA 3BV4A 1H7XA 4FO4A 4UTIA 3T44A 1XC4A 4OWGA 3M5YA 2FJKA 4N6FA 2DJXA 2LLEA 1R30A 2WQPA 4PH6A 1PVNA 1S5TA 2PRMA 2JGQA 1HTIA 3P80A 4LS2A 1QMLA 1LOSA 2GJLA 1PCWA 5CPNA 2CLKA 5C6MA 1G7UA 1VYSX 3UWYA 1FWWA 3M41A 4QM1A 4IMFA 2WSQA 3TROA 3NL3A 3W7IA 2Y70A 3DKLA 1ME9A 1FCBA 3T78A 3NQCA 1IF2A 3TJXA 4LRSA 4RR4A 3FEMA 4XKYA 2CZEA 3NQ2A 3SW6A 1DHPA 4A21A 4Z1AA 5AOUA 5BW6A 5HWNA 4RJEA 4QQ3A 4JX5A 4FNUA 3G8EA 2PRHA 3EKZA 3M5ZA 3TIMA 5LNRA 1EP3A 1JR1A 5KSWA 3N9SA 4I9AA 2FB2A 3O6YX 4UTMA 3BW2A 1ZAIA 4AHQA 1P0KA 1NAL1 4WQ6A 4O57A 1NEYA 4DF0A 4LY8A 3S1VA 1EWDA 3DHFA 4UTUA 3ABRA 2QJGA 3PUDA 3I7RA 4FX6M 4UMAA 3TDFA 5CZ0A 4KFPA 4EWND 2WV8A 2XFWA 3RU6A 3W7QA 2DJLA 2QCDB 1OFEA 2C15A 2Y6ZA 1KM1A 2FB3A 4A2SA 3DU0A 5HWJA 3W7OA 1B9BA 2R14A 4BWLC 4MZYA 2GOUA 1HL2A 5LNUA 1WYIA 2HMCA 1GYLA 3NDOA 3W2NA 2DU2A 3FYPA 3CWNA 3GZ3A 3G1VA 1L6SA 4UC5A 1WBHA 2H3DA 4LVDA 5BMWA 3E96A 2QCMA 1YLVA 1XDLA 4FNRA 1YDVA 3O1NA 4GRSA 1ZHAA 3LXCA 5I3HA 1XBYA 3O63A 5LHFA 4E2BA 1YTDA 5AC7A 4X3ZA 1GEQA 3L5MA 2Q3OA 1NSJA 2QCEA 5F4XA 2A6NA 3TAOA 2G96A 3PAJA 2A7NA 3TK7A 4JR5A 2R91A 5IBXA 2ZZ2A 3C52A 3KVJA 5AHMA 4M7SA 5DCEA 2ISVA 1FDJA 4K36A 1WQ5A 2E1DA 2QDGA 1M5WA 4O50A 3OBKA 4N2YA 3EXRA 2ATMA 1O60A 4O8RA 1JQXA 1U5JA 3W72A 1W5OA 1K03A 1HO1A 4AEOA 3EWUA 1R47A 2NXIA 3HPSA 4A29A 3ZFHA 1BTMA 3O6DA 1OF8A 2CLFA 6TIMA 4R33A 5EPDA 1QR7A 2CLLA 4TR9A 3CEUA 4GNJA 4Q4KA 2V2DA 3EXTA 4MYXA 4ALDA 2QKFA 4PCFA 1G4SA 4UUIA 5U4NA 1A53A 1SQ7A 4UIOA 3WK1A 3W7GA 4PC8A 5GVJA 4GUJA 2B4GA 4UMBA 3KAOA 4LRTA 1IXNA 3T4CA 3FS2A 2J9ZA 3TW7A 3GKFA 3LHUA 2CWNA 3DFSA 3W7HA 2A1YA 1W37A 5LKYA 1W3NA 2VEIA 3V1PA 3C3NA 2EKCA 3IVTA 1H7PA 1KM4A 2QCLA 3C2EA 3ELFA 4IPIA 2VEMA 1AG1O 2A4AA 1VLWA 3EKLA 4HT3A 2D73A 3CLMA 2JK2A 4AMAA 5H2ZA 2KZHA 5AYXA 4EF9A 1M6JA 1FQ0A 4MVAA 4JX6A 5K2ZA 1TPEA 3R8RA 3BGGA 1OHLA 3W2JA 3MUXA 1SSDA 1Z41A 3HO8A 3LRLA 4UTLA 1DKWA 4IXHA 4GUHA 3UPWA 3W73A 3HF3A 3GDRA 2ZZ1A 1DBTA 3PY2A 4OT7A 1G67A 3O06A 4BI5A 1J5TA 1MO0A 1WV2A 1P4CA 5I3GA 1LBLA 4MZ1A 5D33A 5HNRA 4WZHA 3TQKA 3TXZA 3TFXA 4A22A 2C3ZA 1JCLA 4WXZA 4GJ1A 3ABOA 3C8FA 2J6XA 1DQWA 3SJ3A 1NVMA 3W07A 1LRTA 3RNDA 2I1OA 3WJWA 3GVGA 4RKAA 4O13A 3S5OA 4K7VA 1GWJA 1TRDA 4ORMA 3P82A 4MY1A 3HGJA 1L9WA 3QF0A 1H63A 5A5WA 4ONVA 1Q6LA 3EX3A 1KLZA 3NM1A 3S0CA 3B0UX 2Y61A 1C29A 3DH7A 3R13A 1W1ZA 5KTLA 5HR6A 1JULA 1DV7A 5EKYA 1VHCA 3IIOA 1XUUA 3C2OA 4K8EA 4KWVA 1NFBA 3W1QA 1QWGA 5D38A 1VC4A 4IJBA 3W9ZA 3OVRA 4J9JA 4OV9A 2JGYA 3GX9A 4X9SA 1QPQA 2Q3RA 4CCEA 4LTSA 1UB3A 3C6CA 4LNYA 2ZRWA 5D02A 3IIVA 1H61A 3G1DA 4FX8A 4GC4A 1I2QA 4NJGA 3W74A 1MEHA 2WNZA 1LBFA 3JS3A 3MI3A 4R34A 1SUXA 3LM7A 2QCHA 1TQXA 1TV7A 4RXFA 2DZXA 1H7RA 3OVQA 1H7WA 1PV8A 1G4PA 4BR1A 1TTPA 4CLMA 1I2NA 4UFJA 4LC6A 3CTLA 3RMJA 2DZTA 1KM3A 3BG3A 4BI6A 2A0NA 4N9CA 4XKYB 1W5PA 1JCJA 2RHGA 4XUGA 5E93A 1JCXA 1B4KA 4YMZA 2V9DA 4YXGA 1VHNA 4N02A 1A5CA 3W2MA 4MLRA 3GLCA 4MY8A 1IIHA 5K9CA 2J9XA 1D3HA 1H1ZA 1ZALA 5LNVA 2WPBA 3EEGA 2YXGA 2FIQA 1N8FA 1XKYA 4O18A 2DZUA 4UMCA 4PFMA 4KWWA 2GQ8A 5E1QA 3N2XA 2QUUA 3U8GA 4X22A 5ABTA 1RZMA 2DZPA 5FEZA 3S6DA 1MSSA 5HQEA 1OX6A 3FYOA 3LHTA 4NX0A 4XBKA 3DFTA 4WY0F 4K6AA 2GPTA 3BPWA 2FDSA 1RQBA 4E0CA 3E9AA 4MUZA 1CW2A 5KZMA 4U28A 1D9EA 4JTLA 5F1VA 1IGSA 1GT8A 3UZJA 3MP4A 4FNPA 1KFJA 1PS9A 5HINA 4NZFA 3QW3A 1UCWA 5FF7A 5EL1A 3T55A 3LCFA 1F76A 2YFOA 3STFA 5F2MA 1X8FA 2J9YA 4I7VA 3FJLA 1Y0EA 3L0NA 1KFCA 3LCHA 4MPQA 4QJ1A 2V81A 3TCEA 3GDMA 1SZEA 3CC1A 3TMLA 3LHYA 5K9XA 3O15A 2O7SA 1XBZA 5C2XA 1DVJA 2NUWA 3PBYA 4NXSA 3W7JA 3I68A 1RR2A 3BLIA 1JCMP 3RLUA 1JRCA 3NQ7A 3E49A 2ALDA 1ZY9A 2QCNA 1K8YA 4OHQA 2G97A 4Z08A 4FB7A 4GFSA 1OFDA 3W7RA 3OEXA 3CWOX 2J24A 3U2OA 3CIWA 4LUJA 4CQ9A 3W7CA 3IEBA 1K8ZA 3LXAA 5D2TA 4FNTA 1TTQA 4IPJA 3BG5A 1NF7A 3HG3A 3FFSA 4CCDA 4PEKA 2YGYA 3M5XA 1OF6A 4Z1BA 5H91A 2ZRYA 4UTKA 3GNNA 3BK0A 3STEA 2ZRXA 5DBUA 3CEPA 2H8XA 3LOTA 2WNQA 4HSOA 4XQ6A 5BRBA 3TXVA 3P5YA 3P67A 1PHQA 1S3HA 2A7PA 3CPRA 3BO9A 3F4NA 2E6FA 1KM0A 2X2GA 4O4WA 3G1XA 1ICPA 3KVMA 1O5KA 1QOQA 5D2VA 1N55A 3O05A 4XWUA 5EY5A 2VFGA 3LBMA 1R2SA 1F5ZA 3C0JA 3P8IA 4AH7A 5F4WA 1FY6A 2WJZA 1A50A 1IIGA 1LROA 1R46A 3MO7A 4KKXA 1SW0A 2GJNA 1XFBA 1H7NA 4WD0A 1XI3A 2VFDA 3PG8A 3S1WA 3CT7A 3TH6A 2NZLA 1JUEA 4O1DA 2QCCA 1F6PA 1GOXA 4NJIA 3R2GA 5LSMA 1DORA 5CKSA 7TIMA 3W87A 2G5WA 2VFFA 1I2RA 1X1OA 3FIGA 2VOMA 1AMKA 2E5CA 1RVGA 3HPXA 3PC0A 1F2JA 2DP3A 4AWSA 3W3OA 3L68A 5AHFA 2A5HA 4MYAA 3W1RA 2ISSA 4IX0A 2CFFA 4O19A 2RDTA 3DFNA 1M7PA 1LRQA 1OFRA 5EMUA 3MBDA 2EF9A 2A7RA 2E5BA 1A5AA 4AWTA 5F4SA 4ZMGA 2BWGA 3EWBX 2V0TA 5SWUA 3PR2A 1E51A 4POCA 4DF1A 4DELA 3NPXA 4UFHA 1OYBA 1DOSA 4UFLA 5AHLA 3W7MA 4P61A 2NX1A 1D3GA 1VH7A 1O95A 2RH9A 3UZ5A 1S5WA 5AHIA 1P5BA 3P8JA 2CLIA 3W84A 1V7YA 2NX9A 2YSWA 3R5EA 1W54A 4GWEA 2ZRVA 3NQVA 4LS0A 1TSIA 4DPQA 2DORA 2OJPA 1FCUA 1SO3A 3EX2A 3GXTA 4FX7A 4UFIA 1HUVA 1OYCA 3TC6A 3S5ZA 2UV8G 1YPIA 1OX5A 4NJJA 3YPIA 1JJKA 4QSHA 3BG9A 3LBCA 3M43A 1LBMA 3UWUA 2C13A 1KV8A 2V82A 3W7DA 3IVUA 1GVQA 3L2IA 2GVJA 2CLOA 5HJLA 1ICQA 2Z2UA 3W7KA 3NXFA 4N6EA 1EP2A 1O94A 4O0ZA 4EVZA 3P5ZA 3S5NA 1EA0A 3GR8A 4CNPA 1TPUA 3NOEA 4YLWA 4JDBA 4LUIA 4FIRA 3KXQA 1QFEA 3TE9A 1BEUA 3CQ0A 4O10A 1GVSA 3ATZA 3NYZA 3EWYA 1TRIA 1WA3A 3SGUA 3M5VA 5HWMA 2ZYFA 1B57A 3QW4B 4XTIA 5DY3A 4GUFA 2Y63A 1F05A 1TCDA 4Y90A 3NQFA 1WBJA 3VFLA 1YXYA 4O1BA 2VFEA 2A6LA 3WK0A 3ZR4A 1EUAA 1KLYA 4NNAA 4E2DA 4FF7A 4LC8A 3HQ1A 4OGZA 4C1LA 1VPXA 3IRDA 4UR8A 2OCZA 1Q6OA 1MEIA 1DL3A 4ZQOA 1TJRA 3I6RA 2OT1A 2JKAA 1G4TA 4NNBA 1GPWA 2ABBA 3LLFA 5FESA 3QPZA 3TX9A 4YWIA 3BARA 2WOQA 2VEKA 4K37A 3DFPA 4FHAA 1W56A 1RQHA 1TV5A 3M44A 4UNKA 3W75A 4WX2A 1R2TA 4O53A 3WFAA 3BW4A 3ZWTA 4JN6A 5AYZA 2QCGA 3B0VC 1SZGA 3G1HA 3KHJA 2Z6IA 1TPDA 3TKFA 5AYYA 2XN1A 4ORIA 3L0KA 1EP1A 5CGQA 2H6RA 1BWLA 4WXYA 1GTEA 1L6YA 3FKKA 1LZOA 1VS1A 2FTPA 4AF0B 3L65A 5CPLA 2V8ZA 5G4WA 3TNOA 2Z1BA 3AJXA 1OFBA 5CSRA 4L4LA 3UWZA 3DBPA 5FF4A 1UASA 1G4EA 4X2RA 2PRLA 3PVFA 1VCFA 4YCPA 1FDYA 1K7EA 3DGRA 1PHWA 3OG3A 1TV8A 2VELA 3KRSA 2NWSA 4UTJA 4CNNA 3MHUA 3G1YA 3SI9A 4DEFA 1GJPA 3N3MA 4JTGA 1I2OA 4I7UA 3QMTA 4NQ1A 3HIJA 2F84A 2Z0IA 4UNLA 3KX6A 4HPXA 4N4PA 1EWEA 1MZHA 5I3FA 4QNWA 3HMJG 2C6QA 1FWTA 3W7LA 4O16A 1YTEA 3HGRA 1TPWA 4IMCA 3QRHA 4O4VA 5FI8A 2E6AA 3GIYA 5E0KA 3A5VA 3FKRA 3CU2A 2DZWA 4M6PA 3ZS4A 4AXKA 1YTKA 1JVNA 4HNTA 1FBAA 4BI7A 2ISWA 1YYAA 5G2IA 4FXSA 1FXPA 4Z0JA 3NZRA 4QITA 3S5YA 5D37A 3SGZA 3KVKA 4AAJA 4FNQA 1F7BA 4W9TA 3ABQA 3LRKA 3SIZA 1HG3A 2ZDRA 6ALDA 3HG2A 4U4MA 1Q45A 3U6WA 4MLJA 5AB3A 4HHPA 3E0IA 3QH2A 1TPH1 3K30A 3NQEA 5A8GA 3SZ8A 5J5DA 1Q6RA 3DI0A 5CPOA 3UXDA 5FF3A 4HSNA 2BTMA 3QM3A 1O4UA 2P10A 2AQWA 1H7OA 4N4QA 4BK9A 2Y7EA 8TIMA 3TQ0A 3C2FA 2B7OA 1GYNA 2QAFA 3I7QA 3W1MA 2QF7A 4HKPA 3P84A 1PIIA 4KFOA 1GTHA 4RCXA 3NAVA 2YZRA 1G6CA 2NUXA 3O8AA 3Q58A 2WSYA 3NPUA 4IQLA 2QUVA 2Y85A 3NEVA 4S2CA 3PWAA 3STGA 3QPYA 4DXVA 2HSAA 3SY5A 4Z1CA 5CZTA 3N73A 3G1AA 4MFEA 4MOZA 1LP6A 4XBSA 1LOQA 4JTHA 3A9IA 4N9DA 3VKJA 1VJIA 3IVSA 4DO4A 4O52A 3PB2A 3PB0A 1RPXA 3W2KA 1Z42A 2FFCA 2YYTA 5F1UA 3BVJA 1R2RA 5DY2A 4JYFA 3TU9A 3LCIA 4IMGA 3QC3A 2NWRA 4UFMA 4DBEA 1ME7A 1YDOA 3TSDA 2PURA 4JYEA 3HB9A 1OX4B 4DPPA 5HMSA 4NVTA 3NNTA 1P1XA 1EIXA 3S8HA 4JDYA 2R94A 3PG9A 4BWLA 3W86A 1FCVA 3W7PA 5HR7A 4JD4A 1SFLA 3MP5A 4HNVA 1ME8A 3LTPA 4E38A 4GBUA 4Y9AA 4OE7A 1ZFJA 3M47A 1I8JA 2OT0A 3GDKA 3N9RA 1KFEA 1H62A 3G22A 4IMEA 2ZCGA 1FWRA 3T40A 3TJLA 1SZNA 1SO5A 3LCGA 5G1TA 5J5RA 3M1ZA 1XXXA 2VFHA 3TSMA 1L2UA 4DBDA 3NQMA 3DENA 4O15A 3WK2A 3LERA 3DFOA 3F1QA 3O16A 3L5LA 1KTNA 5LGXA 1J2WA 1T0OA 3L5AA 2P0OA 5DXXA 5CG7A 1VR6A 1GVFA 1QPOA 4UFKA 5F2LA 4ZL1A 2V30A 5T26A 3PBUA 1J4EA 3VE7A 3HJZA 1ML1A 2YCEA 5C54A 3SECA 4EOUA 4I7WA 1LORA 1RV8A 1U83A 5DXYA 3L67A 4QIUA 4HN4A 1AW5A 2WO5A 3DFQA 4AF0A 4LVAA 5KINA 5K9DA 1KM5A 3ANYA 3I7SA 3UYCA 5BOOA 1XBVA 4UTTC 4H6KA 1Q3NA 3P62A 1A5BA 1XL9A 2GVGA 1SZFA 2FPTA 3FLUA 3W1LA 3LV6A 2ZA1A 2W6RA 3M9YA 5I3IA 3GDTA 3N34A 1FDZA 3QSTA 3NQAA 4HNNA 2V2HA 2ZTJA 1SSGA 1JCYA 3HGSA 4MKNA 3UWVA 3GNDA 4A2RA 3QQ0A 4LVGA 1KW1A 1YXDA 3UWQA 3LDVA 4O12A 3QQ1A 1OYAA 2V2CA 3R12A 3V75A 3STCA 4KFNA 3W1NA 4S2BA 3WK3A 4B5NA 4TMCA 1BWKA 3MHGA 4UCGA 3L21A 3ABSA 3LGEA 3B8DA 2CW6A 4R7JA 5DCBA 3GR7A 5F2IA 4YCOA 1X7FA 3W1PA 4NX5A 1TMHA 2G95A 5D2WA 4AVFA 1MXSA 4TIMA 3Q94A 4O11A 4IOTA 3B4UA 3UXAA 2HS6A 1I2PA 4TMBA 3IGSA 1QO5A 4BFAA 3KOFA 2BLEA 4K8HA 4PL1A 2FLIA 3EWWA 5TBOA 4CQAA 3NPWA 4N9EA 4AHOA 4FNSA 3GXPA 4QNEA 4AWUA 2QCFA 2TMDA 3G1FA 1VGAA 3H54A 2RDWA 3BW3A 5D05A 5D30A 1TB3A 3HOJA 3L9CA 4OBTA 3G3MA 3KFTA 2ZZ7A 3NPVA 4OV4A 5D2XA 3E02A 1GVOA 3N2MA 3AO0A 1TTJA 2Q8LA 4DO5A 3LI0A 3FOKA 4EF8A 4UTWC 4WJEA 4O14A 2P1FA 3PSVA 3RK8A 2NV1A 3QMRA 5I3JA 3LV5A 4Q32A 1TTIA 3NM3A 2X1TA 1OFPA 4XZ9A 5D03A 4PODA 3THAA 3BLFA 1ADOA 1THFD 3GDLA 5G2WA 2GUUA
chains in the Genus database with same CATH superfamily
5C9XA 4R7OA 3LRMA 1E9LA 1RJPA 5M17A 1TVPA 3I4KA 1NQ6A 4PRWA 4HPHA 3I6TA 4H7CA 1M68A 4C65A 3QOMA 2CLEA 1XRTA 4C6OA 4TX9A 3HZ3A 4PBGA 3TV8A 3WNMA 4BQ5A 3LCXA 3PPGA 3A22A 4LNCA 3AOFA 3W2UA 5MHBA 3CZ8A 4JFVA 5CSSA 2RJGA 3ZJKA 2YL9A 4IUOA 2PTWA 4ZQNA 4FF5A 3G0UA 3EEZA 3KP1A 4GC3A 4XZLX 1V0MA 3NGJA 3BXWA 3NO5A 3LX9A 2FZ9A 3LHZA 3REQA 4IMAA 1HW6A 2YX0A 4IFKB 2JE8A 4M1RA 1XSIA 1SM9A 3UXLA 1YQ2A 4P7QA 3DHDA 4KCWA 1UR3M 5DRCA 4E4UA 2JF6A 2Z2AA 3DZ1A 5A8MA 1KO0A 2EHHA 2OB3A 3DKJA 3G1SA 3WIJA 3LB0A 1BPLB 1OEPA 1EGMA 4NJHA 3VZZA 4F3HA 4MDOA 3TZFA 3PF3A 3NQ6A 5G2HA 1I1WA 2C0HA 1H60A 4ATLA 1EQPA 3W71A 2YR1A 3AS1A 4XSMA 1PZ3A 2XN2A 4HIBA 1RD5A 4HSHA 3ARTA 5ABFB 1OABA 1YXCA 2G50A 5CH9A 2KX9A 2WVVA 1XSJA 3APTA 3R89A 3QR1A 5A95A 2HXTA 1RCXB 3GFYA 4GACA 1FWNA 5HK4A 3LCWA 2BY1A 1KXQA 4US6A 3M0JA 2NXHA 5FF0A 2NVDA 4H6RA 1Z32X 1YE6A 3QGKC 3P74A 1FXQA 1DJIA 4RLIA 3UR7A 2A3EA 2ZRUA 4LCRA 3ZIZA 1JZ2A 3OZMA 2I7GA 1YPXA 3N4FA 3K8MA 4LF1A 5C55A 3M7SA 1TZZA 2ZZ3A 4XZHA 4QHRA 4Q33A 3NZ1A 3MZNA 5IHRA 1JPDX 1QPRA 3C0QA 1W1VA 4XAYA 2W3ZA 5LHEA 2FHBA 4FI4A 1K7XA 4O28A 2OX1A 4YTTA 1UOZA 4J5NA 4C1KA 3E0FA 1QT1A 1PYMA 2WSPA 2ZRZA 3QHOA 3WLJA 4LV4A 1P43A 4I5RA 2E4TA 4ZO6A 1KR0A 3R10A 4TX6A 4AB4A 4NZJA 1HNYA 4TO8A 2VT0A 3OHMB 1WX0A 3HV9A 4ZTXA 2GWNA 2F2HA 3DG6A 3R0UA 2FZ8A 3HN3A 4Y7EA 1M01A 1C7SA 4F79A 1Z44A 2RFGA 3QXBA 3NOYA 2O92A 2V3EA 2Z27A 1MQQA 2PI6A 1OCQA 3L2MA 3MYPA 3CHVA 1Q6DA 1F61A 1VFLA 1T99A 3C2RA 3LTSA 3WDQA 1YRRA 3GR4A 3TW6A 4F8XA 4ADUA 3ATYA 4DM2A 3R58A 5ECUA 1W3HA 1EX5A 4H8VA 1UZ1A 5BYWA 3ZYZA 3VYLA 3UQNA 1ONRA 5RUBA 4FXJA 5DMMA 1H1NA 1V5XA 1LLWA 5HMEA 2ZC1A 3IJ6A 5HMFA 3HPAA 4GYPC 1ENUA 1Q7ZA 2VGBA 3E2SA 1FP8A 4IGHA 2CBVA 4EACA 4AD4A 1W8SA 4LALA 4M80A 3LMZA 1OC6A 1QW7A 3KWSA 1QAPA 4UXDA 5HXMA 3IJ7A 4PUWA 5G5IA 1HVQA 3PWGA 3GK0A 1UKPA 1ZL1A 4QFUA 1V0KA 2QHAA 4CQ8A 3CB8A 1R0MA 3VNIA 3QYQA 5DCDA 1IV8A 5K4XA 3HURA 4PL2A 3IGUA 9CGTA 3C0LA 2VXNA 3P7YA 1M41A 4LGXA 1E5JA 3LTYA 4RDZA 5BU9A 1GOMA 2HE5A 2E9MA 2Y62A 5FJOA 1OC5A 2Q8ZA 5D2YA 1R3TA 2YYUA 1VYPX 1UA3A 3U0HA 4YJ5A 3TN6A 4AD0A 3NG3A 3BGJA 3NQ8A 1QK0A 1QHOA 5LIKX 1ITCA 2CZ5A 3W81A 4XG1A 3DBNA 4KIEA 1KXHA 4PSRA 3GU1A 4ZZ9A 1P1MA 4JCMA 3WL0A 3EMCA 2WSKA 3U3HA 5HPCA 4GA8A 2ZXBA 3Q2DA 4YNGA 2IQTA 2OGYA 5C9WA 2C8NA 4IQEA 4BF9A 4ADTA 1AD1A 1F73A 3NZGA 1X96A 1UJPA 4JQ2A 3G0XA 5A6LA 4E8GA 4PCTA 1B4EA 1R7OA 1BGAA 2WHKA 3DUGA 3BQ6A 3B8TA 3PK7A 5AHEA 1JCTA 2C1HA 5JIPA 1HJSA 3M6YA 3LEPA 3W27A 5E6YA 1GNXA 3TOPA 4QBXA 5D32A 3MKVA 2YXOA 1M1BA 1RCQA 3P14A 4BHYA 4S1FA 1KFBA 2J62A 2QAPA 2IQDA 3PM6A 2QUNA 1PSCA 3R8GA 3SSJA 2V5JA 1HJVA 3P61A 1B54A 3A3WA 2WVSA 3E5PA 3PBWA 3C61A 4JICA 2FPVA 3CZJA 2ISDA 4LY4A 3W7EA 1KBJA 3DYPA 3UZZA 4QEHA 4R7WA 5CC5A 2PCQA 3M7WA 3PZVA 1JXKA 1KM2A 1W3LA 4KGJA 2JKEA 1SW3A 3PUOA 3GG1A 2IPWA 1RSCA 3SCSA 1TX0A 1GQKA 1J0HA 2ACSA 3B05A 4DO6A 2E8YA 4Y96A 1CGXA 3OO2A 1J0JA 3IJQA 5I0DA 3RGTA 1VFSA 2UY5A 3N19B 1XCFA 1BYBA 4ADSA 3PANA 2QV4A 4R5EA 2YFNA 4RX0A 5LNSA 1WKFA 3RPTA 3MKCA 4A8RA 3EOLA 2Z1KA 2C0AA 4I6VA 2B31A 5KZEA 4GMEA 4U33A 2Y8KA 4DZHA 3GUGA 1CCWB 2XIMA 1GONA 3BAIA 4MY9A 4G5DA 4GQQA 4GY7A 2OTDA 2D20A 3IIPA 5CPMA 1M3UA 1UD4A 2WW5A 3JZUA 1EC8A 2YCLA 4K38A 2E6YA 3GG8A 1WOAA 4UTHA 1A5SA 3LXBA 4RUBA 2BVTA 4GXMA 3CH9A 4XAFA 4N42A 5LZLA 2OMAA 3LHVA 1ZCCA 4DBUA 2VVSA 1H0IA 4H9TA 1CWYA 5AC8A 2W0UA 4CN1A 4Y6GA 4FK9A 3VDGA 4CU8A 2H90A 3W26A 3BQ5A 4XK2A 3RXZA 1E6RA 3IV3A 1NWSA 1O12A 2CETA 3UY7A 3G8RA 4OOUA 4GIAA 2XINA 3N11A 4D6JA 2J7CA 3H4XA 4Q8PA 4P8XA 1UYQA 3CV7A 3AIQA 1IEWA 2VKZG 1WXJA 3B9EA 2YDAA 4NAEB 4GIRA 1RP9A 4IWWA 1K7FA 2EAWA 4R53A 3S9IA 2EGZA 2WM0A 3BV4A 4UTIA 3PJWA 3VIKA 4JIEA 2FJKA 3DHPA 4W7UA 4N6FA 5FAGA 1PX4A 3UZWA 3RRAA 1ZBKA 1AQMA 2DW6A 5FJJA 2JGQA 1XWYA 4LS2A 2PTYA 1JYVA 2IKIA 4ZOEA 2GJLA 2Y8UA 3CZGA 4GI9A 5C9RA 5CPNA 2CLKA 1XYZA 3M41A 1MNZA 4QM1A 4IMFA 3W7IA 4RW3A 1AJZA 1D8WA 1Q6FA 3E0LA 1ME9A 1FWIC 1FCBA 4NZ3A 3TP4A 2X8RA 3WH5A 4Q8OA 3FEMA 1WXZA 2AKMA 4XKYA 4PSPA 3SW6A 1DHPA 1YEYA 2FMOA 1P6CA 4AXNA 3R6IA 2WLYA 4PMUA 2CBUA 2XG9A 3CYVA 4JX5A 1VBHA 4FNUA 4O0QA 3N12A 1KGXA 4HHHA 3EKZA 3M5ZA 3WUBA 3AXKA 3BW2A 1FFQA 4WQ6A 4CEUC 4HOXA 5H8MA 4EXQA 4LY8A 1WB0A 3DHFA 1L8PA 3VNMA 2YJQA 3ABRA 3OP2A 1A0EA 3TDFA 3N6JA 1HJXA 2WZHA 4L6DA 4Q6JA 2C15A 3S83A 3RYSA 3LZ5A 2ZOXA 4C7DA 3QN3A 1IT8A 1PAMA 4MZYA 3B9AA 2ZX8A 2DU2A 2DW7A 3V1HA 3CWNA 3GZ3A 1IEQA 3G1VA 1Y5XA 3LY0A 2G4JA 1H2JA 1E4IA 3E96A 4V28A 4HCLA 3O1NA 4GRSA 1CENA 3LXCA 3O63A 5LHFA 4P7OA 4DZIA 1YTDA 1N8WA 2IKHA 1GEQA 3FN9A 2Q3OA 3UJEA 5F4XA 3TAOA 3PAJA 3TK7A 2R91A 2ZICA 3KVJA 4M7SA 5DCEA 4C1NB 1FDJA 3FW6A 2ZE0A 4J27A 1JZ7A 1B3YA 4AEFA 1I9CB 5C7VA 5FCZA 3EDEA 3CQJA 1U5JA 3W72A 4QROA 3W53A 2YCKX 1K03A 1HO1A 2NQ5A 3EWUA 1TE6A 1S1PA 4WIWA 1OF8A 4R33A 3T4WA 1E0WA 3GIQA 4TR9A 1EO5A 3H2OA 5BOEA 2V2DA 3VGGA 1T41A 4KF1A 4MYXA 1MUMA 3RPMA 3H2MA 5LA0A 4PCFA 1DQUA 4WEVX 1ITUA 2E1WA 1SQ7A 4XIMA 1KXVA 4KERA 4GUJA 3VM5A 3BV7A 3QOKA 4PYSA 3KAOA 4M81A 3TW7A 1NM9A 2J13A 1IWBA 2CWNA 1WNOA 1W37A 3R8HA 1V6TA 1W3NA 3C3NA 2EKCA 1WKYA 1KM4A 3GBDA 3ELFA 2NQLA 5CSYA 1HZYA 1AG1O 1VFUA 4H01A 4HP5A 2OGJA 3IUIA 3MZ2A 4HT3A 1R9YA 5H2ZA 3ES7A 1E1FA 1M6JA 4MVAA 2HPMA 2CC0A 5K2ZA 3KDOA 3AXMA 1XS2A 9RUBA 4KEUA 1Z41A 3LRLA 1DKWA 3PJUA 4GUHA 3QPEA 1KBLA 3HF3A 1DBTA 3BICA 1SJAA 3O06A 1MO0A 3OGSA 1P4CA 1XSKA 1LG1A 3VD3A 1O1ZA 4C6NA 5A6BD 4GI6A 3ONBA 3TQKA 4KH2A 4IICA 1RH9A 4ATWA 1W8GA 1XIBA 1KD0A 1IZCA 3ABOA 3C8FA 5BRQA 2WMIB 3WJWA 3OQ8A 3S5OA 1Q4NX 3VOCA 2R6OA 2QGYA 3WD0A 1Z9AA 1TRDA 5DO8A 3P82A 2VCBA 3WBWA 1H63A 4ONVA 2F6UA 1TZ7A 3IJ8A 1PIGA 3T1GA 2X7VA 4B3LA 4OIFA 4GX9A 5LA2A 3GVVA 1J6PA 3SADA 1NFBA 3AU6A 1QWGA 3W9ZA 4HMCA 4DHGA 3OVRA 3NCOA 3F2DA 4HU0A 2JGYA 3GX9A 2Q3RA 4B2DA 3PZTA 1UB3A 2ZRWA 3IIVA 4HK6A 1E3XA 2PWUA 4FX8A 1S2CA 1I2QA 5KETA 3NTYA 2V5KA 1LBFA 1QASA 4IQJA 1SUXA 2QCHA 1CLVA 1TQXA 4UB9A 4L9ZA 1H7RA 1UR0A 1PV8A 1E0UA 3UJSA 5DMYA 4Q4MA 2PDCA 2WHLA 2A0NA 4N9CA 4XKYB 4FXFA 2XGZA 1E43A 2RHGA 4L56A 1JCXA 4YXGA 4MLRA 1B90A 2R1KA 4YS1A 4HU4A 2XGIA 1H1ZA 1ZALA 5LNVA 2WPBA 1E9YB 1M65A 4MNMA 2YXGA 2ZUVA 2XVPA 4L1XA 4KWWA 3W82A 2GYIA 1SZRA 4JNYA 1HGYA 5BXSA 4X60A 1RCOB 3AHVA 1MSSA 3FYOA 4NX0A 2ZUWA 3VGEA 3DFTA 5D9PA 4WY0F 1K9DA 1UWSA 2DH2A 1UWQA 2X05A 3E9AA 4MUZA 4JIRA 1V93A 1GORA 1GT8A 3UZJA 3MP4A 1D2KA 4FNPA 2AGTA 1W1PA 3W37A 3QV8A 2UY2A 1UCWA 1VJSA 4WF7A 5EL1A 1XIMA 3IJIA 5DQPA 1HJWA 3FVDA 4UZUA 2J9YA 4QE4A 3FJLA 4Z2HA 1KFCA 3LCHA 2V81A 3T07A 3QHMA 2R24A 2WYSA 1UPPA 1C9WA 4Q8NA 3W7JA 1RR2A 4XVEA 3FVMA 3A47A 3LENA 5T9CE 1J0IA 1JRCA 1PX3A 2ALDA 4TVCA 2QCNA 3GU2A 2ONEA 3CQHA 4UWMA 2G97A 1KWKA 1W9PA 4K8GA 2O0TA 2IQ0A 2DUAA 3U2OA 4MB3A 3CIWA 3VCNA 3W7CA 4BQ4A 4KWOA 4IIHA 4NAFB 1EBHA 1TTQA 4Q3MA 4DJDC 5H6HA 3FFSA 3MY9A 4CCDA 4PEKA 1OIFA 2BY3A 4GCAA 2ZRYA 1IWPA 2DZBA 4Q22A 2ZRXA 1ISYA 1ZBCA 4J3XA 3PBMA 4HSOA 5BRBA 1Z3NA 3K8LA 1E6SM 4OECA 3NO3A 1PHQA 4UBPC 3FAWA 4IGMA 1S3HA 4QJ4B 5IFTA 4J3TA 5A1AA 5J8LA 2E6FA 3M6DA 4HYRA 3P6LA 1AVAA 2QLYA 5F4WA 4E2VA 2DVXA 3FYYA 1S2UA 4AIUA 4KKXA 1XJBA 4GCXA 3S47A 1XPGA 1TR9A 3PG8A 3TH6A 2QNEA 1JUEA 2WBKA 4U2YA 1SJCA 1F6PA 1BYCA 2PD9A 3TJ4A 4NJIA 5CBJA 4BEQA 2AQOA 3T81A 4JNZA 3FA4A 2VFFA 3P93A 1X1OA 2PWFA 2D24A 2VOTA 3LM3A 1RVGA 3PPHA 1ZQ5A 5D9OA 3PC0A 1JD9A 1F2JA 1TZ9A 4AWSA 1ZBVA 3KOZA 4JTAA 4LCSA 2ISSA 3RR4A 1DIKA 3SCTA 5AC4A 2YDRA 1XFCA 5CPQA 3WLLA 4O19A 2RDTA 4UQCA 2VP8A 5A6JA 2X40A 3UW6A 3ZXWA 5EMUA 3VNYA 3GTXA 1MZRA 4HHLA 4Z1YA 1XPYA 5H8UA 2BWGA 4J7RA 2V0TA 5SWUA 3PR2A 2FVKA 1E51A 3NPXA 4UFHA 4IF2A 4XAPA 4MB1A 5AHLA 5IFPA 1MW3A 3T0BA 3W7MA 4P61A 4AIBA 1VH7A 3KL3A 3L4TA 1MMFA 2RH9A 4RE3A 3BSGA 2A3CA 5HNNA 1E71M 2NX9A 4OTKA 1D7KA 1GVIA 3QV9A 4ZFCA 3NVDA 1TSIA 4DPQA 4W86A 3BMXA 3E2VA 2HBVA 1FCUA 1S2TA 2O9TA 3EX2A 1HUVA 1TKKA 3NUKA 3N4AA 3WBYA 1YPIA 2J79A 3YPIA 1JJKA 3BG9A 3LBCA 3PNZA 3MWCA 4O8AA 1KV8A 2V82A 3IVUA 4PUEA 2GVJA 2ZUUA 1JI1A 1J5SA 3QC0A 3W7KA 3EOUA 1GZ1A 4O0ZA 4EVZA 3P5ZA 2QV5A 3S5NA 3II1A 4QAWA 4CNPA 1TPUA 2D0HA 3NOEA 2WC7A 2W9MA 3N04A 4B3KA 1BEUA 4LYRA 4C6BA 4EPDC 3M5VA 2QPUA 5HWMA 1B57A 4GZJA 3IS4A 4H8UA 1WBJA 5GQBA 3A12A 3N2TA 3QV6A 4MKSA 3J7HA 1JPIA 2VFEA 5JXQA 3WK0A 1EUAA 3WLSA 3WH7A 3G5EA 3SY8A 2GSEA 4NNAA 4E2DA 4FF7A 1WXYA 1DEDA 4NYUA 3VD4A 3IRDA 5FJRA 1Q6OA 1MEIA 3CAVA 4V27A 1DL3A 1QW8A 4ZQOA 4E2OA 1G4TA 4NNBA 3LLFA 3O3RA 1E6NA 3AI0A 2XIJA 4FLSA 3ZR5A 1EHAA 2CKRA 2VEKA 2Z1VA 4M0XA 4TV6A 2J78A 4B5TA 1TV5A 1W9BM 3WFAA 4ZBCA 2BXYA 2WWCA 3ZWTA 2QPSA 4U3AA 3G1HA 1R3YA 3KHJA 3TKFA 1LF1A 5AYYA 2XN1A 1PJ9A 1UIPA 3CNYA 3VOFA 2XFRA 3RLGA 4CVUA 1CGTA 3VNJA 4DJDA 5B7ZA 1VS1A 1ODUA 1CYGA 3B8WA 4MB4A 5CPLA 1MWOA 5LXEA 1W1B1 1G4EA 1D8CA 4X2RA 1FDYA 3BTNA 3AMCA 3STPA 3KRSA 2NWSA 3MHUA 3G1YA 5BMXA 1E6PA 1GJPA 4KEZA 3TCSA 2HRWA 2Z0IA 3H2NA 4UNLA 5BU6A 4LBSA 3WL1A 5HNTA 3GW3A 3EYPA 2OQHA 1FWTA 4F0KA 3PZUA 5E0KA 5B80A 3RN6A 1NY1A 4M6PA 3ZS4A 2W63A 3ZSSA 1XQKA 1OCJA 1YTKA 1JVNA 3WF3A 3L23A 3MT1A 1I6NA 4GH1A 3GD6A 5G2IA 1LT7A 1FXPA 4FXSA 1XRFA 3KTCA 1LQ0A 2GGJA 4WKFA 1F7BA 1X38A 4WGHA 2DFAA 3ABQA 3LRKA 2J7DA 1HG3A 5KZ6A 3D6NA 2DUZA 4HHPA 3E0IA 5A8GA 3NQEA 1VB9A 1Q6RA 3DI0A 1WUFA 2ASHA 3PP7A 4AZBA 4RE0A 2BTMA 1H7OA 4N4QA 3TQ0A 2DV0A 1IEVA 2QAFA 4LEQA 1DHKA 3OIHA 1NELA 1B9ZA 4QLLA 3CUZA 1GTHA 1S5MA 4PMQA 4PMRA 3EB3A 2NUXA 3NPUA 4IQLA 2QUVA 4GQGA 3DEQA 1AJ0A 1JDFA 3FA3A 5CZTA 1UKOA 1LP6A 1LOQA 3UPMA 4JTHA 1ZGDA 2NQJA 4N9DA 1C93A 3E3HA 3SQMA 4D6DA 2A3BA 5MKGA 2ZADA 5I07A 3FDGA 3BVJA 3LCIA 4IMGA 3THUA 1BLIA 4JYEA 4DPPA 4M3PA 1NJJA 4RE4A 1K77A 2XU2A 1HKVA 2QT3A 5CLTA 3MUIA 3MP5A 2WVUA 1U1UA 5D8ZA 1JIBA 4OE7A 1S46A 4YVXA 1IHIA 3M0HA 5CGTA 1ZJAA 3SCOA 1REQA 1SO5A 3LCGA 3BH4A 1T40A 4LBRA 3CIVA 3EWCA 3H24A 2OXNA 1UWRA 2VFHA 1WZKA 4S3AA 2P3EA 3DFOA 1KTNA 3OBAA 5LGXA 2HPIA 2DT3A 3IAPA 3SUUA 4Y8EA 1H09A 1K70A 2P0OA 1W9DM 2EPMX 1VR6A 1EDQA 4UFKA 2YKKA 2PP1A 1AH3A 5C2CA 1XG4A 1J4EA 3VE7A 2Z28A 1RLDA 3HJZA 2PDGA 2YCEA 4I7WA 2HK1A 4LUSA 4HN4A 3WD1A 2WO5A 3DFQA 2UWFA 4AF0A 3GH5A 1KRCC 3I7SA 1XBVA 4UTTC 2MUCA 4H6KA 7REQA 3IV8A 3P62A 2OFJA 1XLBA 4AZGA 3FLUA 1M7XA 3W01A 3LV6A 5I3IA 3GDTA 3QSTA 3M0YA 4DYKA 2DSZA 3E0WA 2OR2A 2D3NA 5FKYA 5CGMA 2YB4A 3WLTA 2QXWA 2XH0A 4LVGA 3QQ1A 1GVYA 1OWQA 2OPJA 3V75A 3BWWA 3STCA 1V08A 3MHGA 4GJIA 3B3DA 3M0IA 1GOQA 2CW6A 2G3FA 5I06A 1JF5A 2Z7KA 2Y4SA 3VK5A 2OO0A 5D2WA 4CEXC 3W38A 2I16A 1EJSC 3Q94A 4O11A 4IOTA 3SY1A 3NGFA 1QO5A 2DQXA 4BFAA 4D6IA 3EWWA 5CG0A 2PGWA 4N9EA 4FNSA 3UEQA 2PBOA 4AWUA 2QCFA 3G1FA 1VGAA 1TB3A 2Q01A 3Q45A 2VR2A 1UKSA 3CMJA 2ZZ7A 2V6AA 4DWSC 1R3WA 4OV4A 4GYJA 1PDYA 4NI8A 4DO5A 2WK2A 4C6DA 4UTWC 2P1FA 4X63A 3KTXA 4ZSUA 4HU3A 3AISA 4M51A 4QQUA 1OFPA 4PODA 1CBGA 1ADOA 3GDLA 3OGVA 4AISA 3WDRA 4P7NA 3MPGA 4O1CA 3PZIA 1XIFA 5EU9A 4OJYA 2RDUA 3EXSA 1EC7A 2Z6JA 5EB8A 1ADSA 1CTNA 5BROA 1TUFA 4DBWA 2G3IA 3VKCA 1DWIM 2DH3A 3QKEA 1H1YA 2VFIA 3V4BA 4GIYA 3W1TA 1VYRA 4S3EA 2C19A 1GQIA 4GXPA 1OX4A 4BF7A 3W70A 1HFBA 1MFUA 1SW7A 2YPIA 4GUGA 1I1XA 1CGWA 1BYDA 3TSBA 3PSWA 1XYCA 3N29A 3RX4A 4R9XA 5C5YA 1QBAA 2J8TA 3LD5A 2NXGA 4K39A 3UZXA 2V3GA 3GHTA 4DAFA 1JNDA 3UPBA 1ZSXA 4JIPA 5JH2A 2DIEA 4G1KA 4H41A 4OOZA 2REQA 5CZJA 3IGHX 4LAUA 1VCGA 4QS6A 5CBBA 3U48A 3UT0A 1KTBA 2OU4A 3AS3A 4HA3A 3IACA 1TPC1 4DJEC 1PCKA 5BXRA 2PDBA 3JU2A 1Q6EA 1VP5A 3T2QA 3BJFA 5DANA 1UBSA 3VMNA 2IPJA 3GNPA 4JN7A 1H4PA 2JALA 1KBKA 2CXEA 5A8QA 3BANA 1V02E 3CH0A 3C3UA 3WF2A 1CX9A 4OUEA 1PL9A 3AMDA 1OT1A 2WSRA 4KCUA 3H70A 3GAKA 4AWEA 3DYMA 3OPSA 1PYFA 4R85A 1XIDA 1W31A 1POKA 4RV8A 1OK6A 3WJXA 5A6TC 3CPUA 3BOFA 4Z0SA 1OZMA 3GC2A 3A5FA 1S2WA 3GQYA 3W6YA 3A64A 5KMYA 1FCQA 1R38A 5AYIA 3IIXA 1ZAJA 4KEMA 2BX7A 3AJ7A 3OGRA 5HMDA 1FHUA 3B0XA 4MJMA 4IZGA 4NKCA 4UTTA 2YL8A 1ZENA 2Y5JA 3E1F1 1PE1A 3FJ6A 3N4EA 2ZFAA 1FUYA 1W9VA 3VX0A 1W0MA 2CERA 2PD5A 3MVIA 3AHTA 3MC5A 4C7FA 1S5VA 3VOJA 2DUXA 3AC0A 1GG1A 2CESA 1GZGA 2E0PA 5EBUA 4W85A 3C56A 3ZT6A 1AL8A 2HS8A 3DAQA 2B0MA 3NJ3A 1K9FA 3KE0A 2OQLA 4AVOA 4PRTA 2OZTA 2BVDA 1VFFA 4RDYA 2AAMA 4G56A 3AMLA 1R87A 4JEQA 3ZJ7A 1OFAA 3QQWA 5EMJA 1F74A 3GYEA 4J2PA 1QOXA 3W1AA 3BGAA 3POHA 1VZWA 4S3BA 3T2OA 3B8UA 4IIFA 4TU1A 2OWXA 3WH8A 2Z2BA 3DDMA 3NIYA 1XISA 1Q63A 3F2CA 1H41A 3PTMA 4JTJA 3TAKA 4D1IA 1SU5A 1I45A 1RY8A 1UMYA 4JQ1A 2VX7A 3SUSA 5DT7A 3JR2A 1Q8AA 5C9UA 3CAQA 1TMLA 4ZR8A 1LYXA 4HZMA 2ZIDA 3OHIA 2JF7A 4A3YA 1R85A 4DYEA 3BMWA 3L4YA 5A2BA 4DWSA 1BHGA 3GKAA 4CNUA 4WY0A 1RJRA 1OQFA 3A24A 3AYVA 4A6GA 3R0KA 4MM1A 2BY2A 3WLIA 3ME3A 4A3UA 4UTWA 3UESA 4H19A 3R94A 2VRKA 1UD6A 2CLMA 2A3HA 3CT2A 5AVHA 4IFRA 3VI2A 4ICCX 4K2SA 1DPMA 5DRIA 4CD6A 3BLEA 1JDCA 1V3IA 1IYXA 1EEPA 5FJPA 2FFIA 1ADDA 1YADA 3UG8A 2YB1A 1EFZA 1K6AA 1QI2A 4O54A 2HVNA 2PS2A 1IGWA 3RX2A 3LN3A 3F4CA 3NZQA 1OG6A 3WUEA 4IISA 4W8LA 2WNWA 1LDCA 1SYTA 3LNPA 2JFEX 3PBVA 4C6IA 1CGUA 3TC7A 2PC4A 1GOIA 1W3IA 5ENLA 5D09A 1JUBA 4DJFD 4NJKA 2VNCA 4Z2JA 3TTYA 2GVEA 3CZEA 5A6KA 4IXXA 1DIOA 1C8QA 4QDMA 3DFYA 2HBXA 5JH1A 2YOCA 4XTDA 1VRDA 3MMTA 2P76A 5LIXX 4LS1A 2E09A 1FX6A 3JRKA 2VC5A 3WF1A 1W5QA 3NL5A 4REQB 5I3KA 4Q8TA 2NQHA 1FWBC 4AD1A 1F3XA 3EGJA 4DJEA 2WCAA 1E6ZA 4G7EA 4D1JA 4NU7A 2YXXA 5BWAA 4ZVJA 4C7GA 3INPA 4F9DA 2FJUB 4HVXA 1CXIA 1UH3A 1AW1A 2GVLA 4QDPA 4CKQA 1KV5A 1OJXA 1KCLA 3URBA 4GY1A 1FKWA 2WHMA 3WUGA 1SO6A 4H83A 4GD0A 4P2VA 3S4TA 2ZTKA 1U5VA 3UCCA 3U57A 3AS0A 3S9YA 3TLQA 4PTMA 1AW2A 4AD3A 2B81A 2VC6A 3P0XA 5IM51 2CITA 3PBGA 4XX6A 1VAHA 2QF8A 2RJHA 1YW1A 3RLVA 1OGGA 3FHAA 1KFKA 2GZXA 2ZQ0A 3GAYA 4AX6A 2NLIA 2X42A 4L1WA 4DQWA 3H4GA 1UC4A 2B7NA 2I17A 4WUIA 4JPGA 2R82A 3XINA 3ZO9A 1J96A 4WDUA 2VCCA 1A3HA 1G9HA 2CZDA 3MV01 1G69A 2PDMA 3UA3A 3H7UA 3DGBA 4PUMA 3VFCA 3S42A 3OW1A 4IX2A 1ZJIA 2GQAA 3CHEA 4QX4A 4WOQA 3ARXA 4I5XA 1DWGM 3GRIA 4C6CA 2MANA 3OIXA 1XDMA 3NL2A 2NQ9A 1X7IA 3NQGA 2HCVA 2QUTA 3WQFA 5M1TA 3MV11 5G1YA 1OVDA 2ZXAA 2OWWA 4PMJA 2AGKA 4C90A 2JBMA 4PB3A 3ZVHA 2A3LA 3KBNA 2DIKA 4EPKA 3RIKA 1SR9A 3WJYA 1CI1A 1U2YA 2VDGA 3D47A 1HKWA 1O5XA 4M5PA 1OFOA 4JKKA 2ZA2A 3CAWA 4F2UA 3OBEA 3L66A 3O07A 4JTDA 1JFXA 5CLWA 1XYAA 2FGBA 3T0TA 4LW7A 1FA2A 4HHMA 2TRSA 3VXGA 1XLAA 1A5OC 1V02A 4GO8A 1R7AA 3QGAC 2A2IA 3HPZA 3L2LA 4W8AA 2DZSA 5K7JA 1WZAA 2ZZ4A 1UOKA 1PPIA 4MF4A 4RZ6A 3D0CA 3TLLA 1OC7A 3AHYA 5KZDA 3M46A 4B91A 2GDUA 3VCRA 4NG3A 5AC6A 3CO8A 4V1YA 4H6EA 3TFCA 3LQLA 2C16A 3UGRA 1PEZA 4EAYA 1Q2RA 2PTZA 4PULA 3ZM8A 5C9ZA 4DWSB 1HO4A 1UUMA 3PUEA 4WY0B 1N8IA 4L4MA 3PTDA 1J9YA 1J0ZA 3SB0A 3HGOA 1TV4A 3ZT5A 3WLHA 1H7XA 4FO4A 3T44A 2DJXA 4H6QA 2VC9A 3C8NA 1QNQA 1R30A 4M6UA 1TUXA 4JFWA 2WQPA 2YIHA 1HTIA 1PKMA 1QMLA 1VF8A 4M24A 2G3JA 3TROA 4L6HA 3NL3A 2Y70A 3N1AA 2PF0A 3NQCA 1IF2A 4LRSA 3BSMA 3NQ2A 3V5OA 4EWJA 1YBQA 2G4FA 4A21A 2YA2A 4GINA 3GM8A 4Z1AA 2PLKA 4C6EA 1DWHM 4QQ3A 4ATDA 2QYGA 4IUGA 1A0CA 2OOGA 4CN4A 4F66A 2PRHA 5LNRA 1EP3A 1NP2A 1MNSA 2XYLA 3O6YX 4UTMA 4ASTA 1H0GA 4AHQA 3M0LA 1FKXA 1P0KA 4Q8MA 4O57A 4X61A 1BGGA 4DF0A 4BA0A 3WMBA 3PUDA 3HPFA 5LXXA 4UMAA 1XHGA 4KFPA 4EWND 2PLJA 4GVIA 1KM1A 3CK5A 3ITLA 4WLCA 3M0KA 3W7OA 1E6XM 4BWLC 4MWAE 4EX4A 1WYIA 1JXJA 1ISVA 3NDOA 3FYPA 3GE7A 1DIDA 1L6SA 3AYTA 2H3DA 4LVDA 5BMWA 3K1DA 1YLVA 3GC4A 2KAUC 1XDLA 3LS9A 4HYWA 3SURA 4F0RA 3O2LA 3JW7A 4XZBA 1MRQA 1XRSA 5BZAA 3R11A 1NSJA 4PMZA 4JR5A 4F9JA 5GNZA 3C52A 3WF4A 5AHMA 4ZCWA 3URNA 4K36A 1WQ5A 4P7RA 2QDGA 1JDAA 3D3FA 4AY1A 3B8SA 3H2EA 3CO4A 3TYDA 3OJGA 3M4HA 3EXRA 2DSWA 4W5ZA 4P8UA 4JEJA 1R47A 2NXIA 1T7LA 1J0KA 4A29A 1LWIA 1BTMA 3GG7A 4O1EA 3W0KA 2OYLA 1EJVC 2AMXA 1QR7A 2CLLA 4ZODA 5FIPA 4GNJA 1SMDA 3ENLA 3GTFA 2QKFA 4RNJA 1QW9A 1HL8A 4NASA 1TX2A 1AH4A 1A53A 4UIOA 2AL2A 3WK1A 3TVAA 3DYOA 2E25A 3T4CA 3GKFA 4R3UA 3DFSA 1HP4A 4DIAA 5LKYA 3CPGA 2WZIA 1E40A 3WLKX 4E3VA 3IVTA 4IPIA 1VLWA 3EKLA 4XD4A 1XV8A 5G1MA 4AMAA 4MG4A 1KKOA 4EF9A 1RJQA 2UY3A 4WKAA 2UY4A 3BAXA 3R8RA 3S2CA 1V51A 2DT1A 1AZ1A 1OHLA 3MUXA 2SFPA 5G4HC 4Q8QA 2FTYA 5E09A 2PDWA 3ZVHB 2ZZ1A 2AKZA 3PY2A 4OT7A 2ZX5A 4BI5A 3W00A 4D72A 1D7FA 5D33A 3UG5A 3WD3A 1OSEA 3VKDA 2DY3A 3LGGA 4J3UA 4DXKA 4A22A 2C3ZA 1JCLA 4MWAC 5I77A 2VJXA 3VDBA 1GZJA 4XB3A 3DX5A 4TTUA 3NSXA 2J7FA 3U4FA 4I9JA 1MW0A 4F48A 3GVGA 3VGHA 1GWJA 1OIMA 3VOHA 3N25A 1ONEA 4ZE4A 6ENLA 1IR2A 3HTWA 6XIMA 1KWGA 1YIXA 1XGDA 4MY1A 3HGJA 2IUZA 3VIMA 1UBPC 5CJ5A 3VD9A 4Y9NA 2OEJA 2Y61A 1DJZA 3DH7A 1K9TA 1W1ZA 1JULA 2ISFA 1DV7A 4OBSA 3VUSA 3T09A 5EKYA 4K8EA 1J12A 1XUUA 4L1GA 4MADA 4J9JA 4X9SA 3GNRA 3CZLA 4U2ZA 3PJTA 1EZWA 1K1DA 4XV0A 3VKAA 4ACZA 2IPGA 1MEHA 1DTUA 4C6QA 5TF0A 5CQ1A 4R34A 4BS0A 2DZXA 2OKTA 5C2GA 2H9AB 1DJHA 3ZR6A 1G4PA 4BR1A 2XSXA 4UFJA 1GUVA 4LC6A 4GVHA 1OZQA 3IK2A 2ZUTA 3S6TA 1KM3A 3T0AA 4BI6A 1W5PA 1GW1A 1JCJA 1HT6A 1YBQB 4XUGA 5E93A 1PUDA 4IIDA 3V35A 2V9DA 2Z29A 1J8VA 3EOOA 3W2MA 5K9CA 2QJNA 2W4XA 3LSCA 5HANA 3LUTA 1XDJA 1FP9A 2FIQA 1N8FA 1UWTA 5A8OA 3GU9A 1XKYA 3KBWA 4TOQA 4O1FA 1A5LC 1CLKA 2QUUA 4FMVA 3U8GA 3SCPA 3BAJA 3VDCA 1RZMA 3AXXA 3QLLA 1CECA 2J8FA 4YHGA 1B0IA 3N2CA 4QE1A 3H12A 3QV7A 4K6AA 2GPTA 2FDSA 1RQBA 4E0CA 3TEVA 4B5XA 5KZMA 3AZRA 2EXOA 1EIBA 4E8CA 1US2A 4GK8A 3WLQA 3T9PA 3U2EA 2CXGA 3KOXA 4I9MA 3U4AA 3RM9A 2X09A 2YFOA 2VDHA 2I5IA 2PUZA 1FFRA 4G2DA 3A3HA 2V38A 4K3ZA 2VZUA 4MPQA 2BVYA 4QJ1A 3N15A 3Q65A 3O15A 4HN8A 1XBZA 3WNKA 3CV2A 1DXEA 2NUWA 3GY1A 3PBYA 5AYBA 2D69A 1JCMP 2D2GA 3TC3A 1B2YA 3UA4A 3MSDA 3N2OA 3N17A 3NQ7A 2C1GA 1ZY9A 2FVMA 3WEMA 4Z08A 3ARUA 1W6TA 4GFSA 3W7RA 4WVXA 1XYBA 3OEXA 4H04A 2J24A 1GOKA 3EZ4A 4Q4QA 4D8AA 3SCNA 3IEBA 1K8ZA 2RDXA 5DFAA 2ANUA 1RALA 4HNLA 1NF7A 4GQRA 4CD8A 2DVTA 1VENA 3CWHA 4Z1BA 2XSAA 3GNNA 5HQMA 3STEA 2C7FA 3CEPA 2H8XA 2WPGA 4HCHA 3ZLHA 3P67A 4TX8A 3CPRA 3BO9A 1HIZA 4ECLA 4AZ7A 1KM0A 2EG6A 2X2GA 4O4WA 3KVMA 1N55A 3W02A 3O05A 3FDKA 4MWAA 5EY5A 2VD9A 1R2SA 4HJWA 1XLKA 3P8IA 2YBUA 4EANA 4CGTA 1A50A 3IWPA 1HKJA 1LUCB 3RLHA 4Z17A 1JL8A 4ML4A 1LROA 1R46A 2GJNA 1H7NA 4WD0A 1XI3A 1S2AA 3SN4A 1ZZMA 4DB7A 1R3SA 1TV3A 4O1DA 2BOEX 4MNLA 2BHYA 3RCYA 3R2GA 1QNPA 1CDGA 1BAGA 3HQNA 5GNXA 2IKJA 7TIMA 3W87A 2G5WA 1I2RA 5E0FA 3A6OA 1XIEA 1F8IA 4GNKB 8CGTA 1UD5A 3T0CA 1ZLPA 4TUFA 4NRSA 4MPKA 5AHFA 4WRHA 3W1RA 4Q7BA 2GGHA 4IX0A 3NSNA 1LRQA 1OFRA 3MBDA 4GHRA 1S2VA 2CBJA 5AECA 1N2VA 4POCA 5AZ0A 5E9XA 3RJYA 2I5QA 2PFHA 4PRRA 2PDKA 2WCSA 3P8JA 2O4QA 3CS2A 1V7YA 2Z7GA 4GWEA 1TR1A 2Q71A 2WKGA 2W67A 2E7FA 4FX7A 1OYCA 2FYMA 1UR2A 3S5ZA 2UV8G 4QSHA 2GSJA 2QIWA 3XISA 3FCPA 3KCJA 2J7GA 1LBMA 3WQ8A 3VUPA 2C13A 1S5NA 1GVQA 1A3XA 1W2VA 2Z2UA 2ON3A 3NXFA 1EH9A 3WMCA 1CT5A 1C3FA 3L4VA 1EA0A 5GPRA 4AYSA 3H26A 4JDBA 4J1OA 4KWSA 3TE9A 1GVSA 3V5CA 3ATZA 3NYZA 3BLLA 3VGBA 1TG7A 1WA3A 2YCIX 1QTWA 3RUBL 1ZP4A 3H7RA 3TTQA 1TWZA 4GUFA 1F05A 4Y90A 5EBAA 2BXZA 5D9MA 2A6LA 2WC4A 3WLNA 3ZR4A 1E73M 1YX1A 1JZ3A 4ZB5A 2VMFA 5CXPA 3UR2A 1IT0A 1EF3A 4UR8A 5DMLA 3T8QA 1TJRA 2OT1A 2JKAA 2PDNA 3R0DA 1ONXA 4G7FA 4FALA 1VBRA 1Q7MA 4KRTA 5BXTA 3BARA 2WOQA 4RNHA 1TJ2A 4MNJA 1W56A 4D6GA 3M44A 4WX2A 8RUCA 1R2TA 3WYZA 1ITXA 1WP6A 5A8PA 1ZBWA 4LJ3A 5AYZA 4W87A 4WHBA 3B0VC 3KDNA 4PEEA 2Z6IA 1TPDA 4AQLA 3CGTA 5FD0A 2W91A 4ORIA 3L0KA 1E9ZB 3SCQA 4J3VA 4H7VA 1GTEA 2FTPA 3L65A 1OT2A 1OFBA 4HB7A 1E1CB 4L4LA 3UWZA 3DBPA 4XO6A 4C91A 1T5AA 5HA7A 2PRLA 2WMKA 3DGRA 1UWUA 3OG3A 1KRMA 4A3QA 2VELA 3EKGA 4QEEA 1BD0A 4IIGA 2E67A 3MMWA 4F2TA 3N3MA 4JTGA 1I2OA 4NQ1A 3HIJA 2F84A 4GVFA 1G0CA 2ZXQA 6A3HA 4WGXA 5I3FA 3KTSA 2XGBA 1IT7A 2AOSA 2DT2A 3K4DA 3THDA 1J18A 2PLCA 4F0SA 3EPNA 4CU7A 3FX4A 1YTEA 3HGRA 1TPWA 1X6NA 5FI8A 4ZGYA 3AXIA 4E8DA 4EKJA 4Q7NA 1GOOA 3CU2A 1VBUA 2XFFA 4R9OA 4ICMA 4HNTA 3FAXA 1FBAA 2IXVA 5GJMA 1YYAA 4ZSTA 4IGSA 2Z25A 2DSUA 3T0DA 3NZRA 2CHRA 1CB2A 3S5YA 2XZ9A 4US5D 3G6LA 1L6FA 6ALDA 3RJXA 6CGTA 3HG2A 1Q45A 4MLJA 5AB3A 4DZ5A 4Z2LA 3VPLA 2GSHA 3ARQA 4KRZA 3UXDA 3QM3A 1HP5A 4BK9A 2Y7EA 5JBFA 3C2FA 1GYNA 3W1MA 1PKYA 3ERPA 3I4EA 2PMQA 4HKPA 1DWFM 1XLJA 2L5HA 4MWAB 1EJWC 4RCXA 4JTRA 1G6CA 3UWEA 1KQZA 4YTQA 1OCBA 1EJTC 2Y85A 3WO8A 1GPFA 3NEVA 4XISA 4S2CA 1EBGA 3WNLA 4DXVA 3FY1A 3NQBA 3SY5A 1G94A 3FK4A 1EEXA 4XBSA 4IIEA 1B3WA 2QQ6A 3B9NA 1VPQA 1NDVA 1XW8A 2J75A 5XINA 3NURA 4O52A 2OKOA 5ECVA 2D2HA 1R2RA 5DY2A 4JYFA 2CYGA 5I03A 3QC3A 2R9RA 3HB9A 1RK5A 1S39A 4HPNA 4NVTA 3NNTA 3GZAA 4Q8WA 1EIXA 3S8HA 2YA0A 4JDYA 4GJJA 2R94A 3W86A 1E0TA 5D4YA 3NZPA 1XQLA 3AICA 3LTPA 1DJXA 3O6AA 3OA5A 2ZUSA 3ARWA 4Y9AA 4AY7A 3M47A 1I8JA 2VD8A 4A3HA 3WQOA 1KFEA 3G22A 4XSLA 1EXPA 2ZCGA 3B9OA 2GGEA 3T40A 4X0VA 1RVKA 4JZ5A 3TJLA 1SZNA 5CBIA 1AJ2A 2QPXA 3REQB 1XXXA 2YBTA 1ZRQA 4FLQA 4O15A 7TAAA 3LERA 5ABGA 3O16A 1Q5MA 2PDIA 3L5LA 1T6MA 3P2VA 2VHLA 1T0OA 3N6QA 1EC9A 2ZUMA 3IK4A 1GVFA 1QPOA 2EQDA 3VDAA 4ZL1A 2FGZA 4ZXOA 5T26A 3BJTA 3ABXA 2PWHA 3FXYA 1ML1A 2WZEA 4BY3A 5C54A 1FHVA 1U83A 5C7HA 3H8AA 3UYCA 3UXIA 1V7AA 1JPMA 2PBGA 2GGIA 4BQ3A 1Q3NA 3CLWA 3W1LA 1J10A 4YPJA 1FDZA 1E6QM 3NQAA 3CHDA 1SSGA 2WVVB 1JCYA 1OBAA 1D3CA 2ZX6A 4MKNA 1R3VA 3S2JA 3Q4DA 4GGBA 4WCJA 1XH1A 1KW1A 1YXDA 3AHXA 4Q7IA 3G6MA 4KFNA 4QJ5B 3URAA 4GFIA 4J2MA 2GDQA 2J66A 4TMCA 1BWKA 3UG4A 1H11A 3L21A 3ABSA 3B8DA 3BSHA 4R7JA 5F2IA 2WMGA 1TMHA 1W3JA 1RPKA 1MXSA 1X8CA 1C7TA 4TIMA 3A4XA 1UD2A 2HS6A 4TMBA 3SBFA 3QKZA 1XICA 3KOFA 2BLEA 4KETA 2FLIA 3KL5A 4I9TA 5EGRA 3NPWA 3TN4A 4AHOA 1VEMA 3GXPA 4QNEA 1ZJBA 4PBEA 2TMDA 2WBGA 1V6WA 4GI8A 3H54A 2P50A 2RDWA 2WQDA 3HA1A 1QJWA 3D5HA 4H9ZA 4W7VA 1NH6A 4OBTA 1KRBC 3G3MA 3KFTA 3MCNA 3ANVA 4QCEA 3NPVA 4AZHA 4HJFA 1V3LA 2OLHA 1GVOA 3LA4A 3VKKA 1RK6A 1QRQA 5I78A 4WJEA 4O14A 3ITYA 2E3ZA 2GK1A 3BCFA 2NV1A 4Q32A 1TTIA 3RILA 2X1TA 1B1YA 2C91A 4XZ9A 5D03A 3HJEA 3EA3A 3S6OA 4YTRA 3A4AA 3BAKA 4HNUA 3CMFA 1QXLA 1EF2A 1XLEA 4WSHA 1A5UA 3CIXA 4ZTYA 3TQPA 2VZSA 4AD5A 5KITA 4PTNA 4UNIA 3SIMA 3LLDA 2VGFA 3PWIA 1BF2A 2CU0A 3ITGA 4OU1A 1JPHA 1WDSA 4PUDA 2J74A 3H53A 3VX1A 2XIBA 3MANA 1Q6QA 1T8QA 1LQ2A 6PTDA 4RZ5A 1TPB1 4JIIX 2POZA 3N18A 2ATSA 2NT0A 1H51A 4DUXA 4XZNX 4GZIA 1F9CA 2I9EA 2FQIA 2QIIA 3KCOA 4G8TA 2P0IA 4ZQPA 3ZLFA 3OZPA 3LCLA 2BZNA 4AMCA 1AK5A 1DIEA 3VKBA 1LG2A 3SQSA 3PN8A 1LCOA 4M6QA 3LLXA 3MCOA 4IPNB 3DESA 4DI8A 2O7QA 3NL6A 3N14A 3B03A 1TPVA 5FEXA 5EYWA 4NNCA 3HQOA 1XIHA 2ZXDA 3RMEA 3KCLA 1XIIA 4IMDA 3W22A 1B3OA 2PWVA 2VENA 3MYOA 2J7BA 5FJIA 2ZBTA 2WNNA 4I3GA 2QVHA 1HKMA 3A3XA 1DJWA 2Q8XA 4NSBA 4LOCA 3ZQ9A 2W61A 5EA9A 3EOSA 3W1XA 2CHOA 3QY7A 2V5BA 4W7WA 1F8MA 3VNDA 1NF0A 1F3WA 2HZGA 3SJNA 3EWXA 1G01A 1CEOA 3G0SA 1PXGA 3S46A 5REQA 1OGBA 5K4ZA 3G24A 4HQVA 1KA9F 1QNVA 1SO4A 4J35A 4ZQCA 4F4RA 1WDWA 1LWJA 1IXPA 1C91A 1TWDA 4JTKA 4YL2A 1LRNA 4A8LA 4XKMA 4MHBA 3NR0A 3RFAA 2EPNA 3T42A 3RRXA 4O17A 3EWZA 3DI1A 3TR2A 1Z6KA 3MHFA 4HK5A 2BY0A 4TTGA 2WHJA 4RL3A 4C6MA 4BKNA 1M7OA 4RE2A 4K1WA 3UNDA 2Y89A 3W24A 3I3BA 3VE9A 2X16A 3ARYA 3VM7A 3PPFA 4PUNA 3KRZA 4ML9A 5G4EA 3WJSA 4RK8A 2EG8A 3CTTA 4URIA 4LU0A 4JTUA 4GY0A 3FA5A 3S1UA 1L0PA 3UNTA 1G5AA 3TQVA 2R1MA 1WPCA 2HNHA 4S23A 5A3HA 4Y8FA 2OWCA 2PA6A 1CIUA 3WDHA 4WR3A 3W85A 4C6LA 3C86A 5I3DA 2O9RA 4JTIA 5DBTA 2CLPA 3F4WA 2GJXA 4JL2A 4Q4OA 3KP0A 1WDPA 3CUHA 3AZSA 1X98A 4H3DA 5C0QA 3TN3A 1JI2A 1LLZA 3PAOA 4UOQA 1W3TA 1GVRA 2QJMA 1R3RA 4XUYA 1YPFA 4M19A 4H9UA 4XIAA 1A4MA 3MI2A 4RZ4A 4J4KA 2E5DA 1FH7A 3IIZA 4M6VA 4QG9A 1UKTA 1US0A 4NZCA 1YMYA 1TVLA 5DF0A 1K3UA 1CXEA 3MWAA 3S1XA 3ZVIA 3F5LA 5FF2A 5JBEA 3BLOA 4AC7C 5PTDA 4ZE5A 2HTMA 4K68A 1DYSA 1O5RA 4AHPA 5AZ1A 3UETA 1MI3A 2VVNA 1UH4A 4I90A 1EUNA 1X1ZA 4NP7A 1E0XA 1L6WA 2GOKA 4AX7A 2WLZA 1UPMB 2GQ9A 3LPPA 4FSAA 4YVVA 3CL8A 2YCLB 5AKQA 1JQVA 3HBLA 1EQCA 2XDFA 4JTTA 3CASA 3APYA 4WSJA 3WH9A 3IANA 1JRBA 2QJHA 3QYSA 4JAWA 2J88A 4A35A 5B7YA 2ZE3A 3GXNA 1OY0A 4GI4A 5AN7A 4IFKA 3QSRA 1TJPA 1Q6GA 1G7VA 4U5KA 5CZKA 2NX3A 2WMFA 3UR5A 3GNOA 2WM1A 2GK1B 2YW3A 1ZB5A 3WDIA 4A4AA 4AIEA 1K8XA 2Z24A 3S2LA 3QY8A 3GYCA 1QI3A 1QCWA 2CZFA 4LV9A 4L4PA 3F03K 1W17A 3EDDA 4M7TA 4JXCA 1H49A 3L0GA 1U1JA 4XBJA 3R25A 1XRVA 4O1AA 1J93A 3L4XA 3RAOA 4GYFA 4BJHA 2RUSA 4LT9A 1H50A 5CJNA 2PSNA 3OZOA 4GZEA 3W7NA 5JIWA 3NVTA 2PDYA 1QVBA 2AQVA 1GYMA 4PTDA 1XLHA 3DCPA 9XIAA 5TD4A 3TZNA 4S3FA 3RCMA 1WDRA 3CJPA 3EMZA 4WK9A 3GVRA 1W5MA 5HOSA 4MFDA 4GQBA 2OSYA 4PBFA 3PHAA 4JNMA 2P88A 4AZIA 3RPDA 4LVFA 4A3RA 2NV2A 4C6KA 4NZ1A 4FIQA 5I24A 1WAUA 2W66A 1JAEA 2ESCA 3WLRA 2XM1A 2OZ3A 5LIWX 1IEIA 1ZJHA 2QDHA 2EO7A 1QO2A 2VWSA 5BXPA 1KM6A 3U2CA 1H5YA 3O6CA 1PWMA 2GUBA 4MMWA 3WDJA 1JDEA 1WAWA 4MIMA 4DM1A 5I02A 3PNUA 1V0LA 8A3HA 1YNYA 1BFNA 3R79A 3RU8X 2BSLA 3LHWA 2POTA 2X1SA 3CXOA 1SFJA 1PIFA 3RCNA 2OQYA 4UQDA 3NQDA 4IPPA 1LTDA 1H3GA 2D2OA 3DXIA 3TYCA 3ISIX 4GE8A 3RX3A 1LOLA 1XLDA 3EA2A 2TYSA 5FEWA 1CNVA 4K7YA 5REQB 5IBXC 3QBUA 3VO0A 1JUKA 2R8WA 3U7BA 3H23A 2J4GA 1OFQA 2NUYA 1A5MC 1M03A 2X7WA 1JYWA 4C5YA 3QFWA 5M3WA 1BXCA 3W2LA 3OG2A 4AW7A 1HX0A 1N7KA 4H9MA 4UQ9A 1PZ1A 4UR7A 4PGLA 1CXFA 3BURA 3K46A 4RPPA 4YVPA 3UJFA 1JYNA 5CZSA 4LWWA 4MAVA 2WB5A 4HPJA 4KESA 1BYAA 5LNWA 2XZ7A 3BCDA 3GXMA 3E12A 3MW7A 1P6BA 2BFGA 4JY8A 1XM3A 3SRFA 3F2BA 3VMPA 4Z2GA 2O9PA 2V67A 4F0LA 1B3XA 4JTEA 4QG6A 1MEWA 4HOZA 4CU6A 5EMLA 2VGIA 1JPKA 2YZ5A 4ZQMA 3WY1A 1VLIA 2Y88A 3UD6A 3WSUA 1WOBA 1KGUA 1EPXA 5A6BA 3UY8A 4FP1A 5BRPA 1ZAHA 2GJXB 3AMGA 4Z2IA 4JFSA 1C8XA 3DFHA 1SJDA 2ACUA 4CNOA 2Y7DA 4JTSA 4PMDA 1CZ1A 3C5QA 3V7PA 2VX4A 3M16A 2D1ZA 3ZWSA 1KTCA 3IGXA 1SFSA 2V5LA 1ISWA 1V77A 1RBAA 3HMCA 2I9UA 3B4YA 4JOMA 2X30A 1OG0A 5CAKA 4NT0A 2HQAA 4ZO7A 2E6DA 4L65A 2FHCA 4HA4A 1XC4A 4OWGA 1SFTA 3EDJA 1XLMA 2LLEA 4C6PA 2ACRA 4AC1X 2NQZA 1PVNA 3H22A 3AIWA 3P80A 3BLKA 1LOSA 4TVUA 1X97A 4B5SA 1KR1A 5C6MA 1Q6CA 3KBMA 2WSQA 4KT2A 2FDMA 4AD2A 3M64A 1EJ7L 3T78A 2ZC8A 1XYMA 3TJXA 3ZOAA 3GW0A 2CZEA 4ZO8A 4L64A 5DMNA 3UGVA 5AOUA 5HWNA 4RJEA 3AUOA 4HNOA 2F61A 4L9YA 1HGWA 4U10A 5MF5A 3TIMA 4B5WA 2OYKA 1JR1A 1VJZA 1XGEA 5KSWA 3N9SA 4I9AA 4NRRA 2FB2A 1NWTA 1ZAIA 1TWWA 1NAL1 4EAMA 1NEYA 1I60A 1UMLA 1EWDA 1RBOB 2BOGX 3A13A 2VR5A 3I7RA 5HAOA 3T6CA 4FX6M 2W5FA 2PCEA 5CZ0A 3DC0A 2XFWA 5GJPA 3RU6A 3W7QA 3KS6A 1VIZA 1PZ2A 1KQYA 5HWJA 1VRXA 4PCNA 1BSLA 3U5UA 2NV9A 1HL2A 5LNUA 2HMCA 1GYLA 4F40A 3W2NA 1V4YA 3WQCA 4MDPA 4UC5A 1FWCC 1WBHA 2V69A 3UFYA 2QCMA 1LL6A 4YWSA 1Q7QA 1YDVA 4DVOA 3OODA 2F8QA 3EAUA 2XIIA 2V5DA 5AC7A 1LT8A 3L5MA 4LB3A 2G96A 1XC6A 4GIEA 5IBXA 2ZZ2A 2PTXA 5FL0A 2ISVA 4UQEA 4D9PA 4O50A 3OBKA 4PMNA 1GKPA 3ITVA 3DIPA 1WCGA 2FH6A 2PWEA 4S3DA 2ATMA 1BQGA 1O60A 3VIPA 1NTHA 2PDXA 4E4FA 4HTYA 2PEVA 4AEOA 1FOBA 3G1RA 2CIPA 4P8WA 1VFTA 2ZUNA 3ZFHA 3SUWA 2CLFA 1BF6A 4L9XA 3E2QA 2INEA 5EPDA 5BCAA 3CEUA 4TVDA 4W88A 2EBNA 3H7VA 4X2PA 4Q4KA 4JKLA 4CQDA 4U5IA 2ZVIA 3RITA 3QTPA 1G4SA 4UUIA 5I09A 3TYUA 3WQVA 4B4HA 3VD5A 5GVJA 4DUWA 1EHNA 1POJA 4M82A 4UMBA 3K1GA 1IXNA 3FS2A 2J9ZA 3LHUA 3W7HA 2A1YA 2DEPA 4L7ZA 1XCXA 2A3AA 4I6KA 3VIHA 1H7PA 2QCLA 4JQAA 1RD6A 3C2EA 3E2RA 3GTHA 3PZQA 1UHVA 3KZSA 4NAEA 5C70A 1P0EA 4IT1A 2JK2A 1V3KA 5AYXA 3BOLA 1PKLA 4JX6A 4HMDA 1TPEA 3BGGA 4HZ7A 2BMBA 3W2JA 4ES4A 1SSDA 3GIPA 4IXHA 4DYJA 5FSDC