4DF0A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus
rcsb
source organism Thermoproteus neutrophilus
molecule tags Lyase
total genus 65
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df0A00
3QSTA 3TH6A 4NJIA 5FF0A 2Z1BA 4ML9A 3SSJA 4Z1DA 3HPZA 3NL6A 4CNNA 4RKAA 4O1BA 5HUOA 1NF7A 1T8XA 4E38A 5CKSA 4A22A 3PBUA 5G2WA 4O19A 1FWNA 2V2HA 1ZENA 2YYUA 4IMDA 3SY5A 1W8SA 3OEXA 4IMFA 2G95A 1K7XA 5D09A 1FQ0A 4DF2A 2V81A 5G1TA 1IXOA 1JCMP 2ATSA 1OVDA 1RZMA 3P7YA 2YGYA 4ZMGA 1KM6A 5KTLA 4M6QA 3P8JA 3S1WA 3HMJG 3NQDA 3RMJA 2QCEA 4D2JA 2GPTA 1ZFJA 3DKJA 5HR6A 8TIMA 1HL2A 4M6VA 4UFIA 2XN0A 1H7XA 5F4XA 5T26A 4JEQA 4TMBA 1L6YA 1OHLA 3C52A 3O6CA 2ZA1A 3TNOA 4JX6A 4C1KA 4ZQCA 1A50A 1G7UA 1W5MA 4AXKA 3TMLA 4CCDA 4O52A 5LZLA 1LCOA 3A21A 2NX9A 3QMRA 4HPJA 3O06A 1UJPA 4UTTC 1H7RA 3QJAA 3QQ1A 3B04A 2Q3OA 3MP3A 3TW6A 1QCWA 4JTFA 2PRHA 1LM1A 4GBUA 4XQ6A 1PCWA 2BZNA 3GNNA 1LLZA 3W2NA 4MY8A 3LCXA 3W85A 5DLCA 5HWJA 3CT7A 3EWXA 6ALDA 2EAWA 2J9XA 1EWEA 3KVKA 3MHUA 4FF7A 4NT0A 5IBXA 5J5RA 1WDWA 4FXRA 4WY0B 4DO6A 3FOKA 4MKNA 4FIRA 3HG3A 3NQ2A 2D73A 4WQ6A 1G7VA 1Y0EA 3W6YA 4TX9A 5E1QA 3TJXA 1SSDA 3HB9A 1SO5A 4NVTA 1FX6A 3C2VA 3P62A 1WXJA 4DEFA 2ZRXA 1I2NA 4GRSA 4JIPA 1N8FA 2VFFA 3MI6A 1BWLA 1I2PA 1SR9A 2Y7FA 2A85A 3O07A 1WAUA 4JY9A 4QISA 3TDFA 2GQ9A 3LERA 3W87A 4H4IA 5CG7A 1WA3A 5LGZA 5D04C 1KFCA 3DGRA 3P5ZA 4DPQA 5LSMA 3G1YA 3H55A 1FDJA 2OZ0A 1SZGA 4M7TA 3KHJA 2E77A 3HGJA 2HMCA 3KVJA 2DJXA 3TV8A 5HULA 5I3IA 1TPB1 3CPRA 1FDYA 3P84A 4K8EA 3V1PA 1ALDA 5AYXA 1WV2A 2CZFA 4QAIA 1TIMA 3PBWA 3T44A 1R30A 4HSOA 1X6UA 2A7PA 1ONRA 4FNQA 4MJZA 4XKYA 2EGZA 4B5NA 1QFEA 1XBVA 2YFNA 1SZNA 3LM7A 1ZY9A 3TX9A 2NXIA 1S5VA 3B03A 1UUOA 4KFNA 1DJNA 1JCXA 4IJBA 1EP1A 3L0KA 5KMYA 2A7RA 2DZWA 2ZRUA 4O10A 1M7OA 2B7NA 2WNNA 4JTUA 3S1VA 3TXZA 3W70A 3DZ1A 4O8RA 2QCGA 3GDMA 3QFEA 3GVGA 4NNBA 5A5WA 1W37A 5TBOA 1MEWA 2WPBA 3Q37A 1UUMA 2ZTJA 2JKEA 1RVGA 4UMBA 4RXGA 2A5HA 2NV2A 3RNDA 5BOOA 1ICQA 1KM3A 2FPTA 2I14A 4UTJA 4N2YA 4PFMA 3NQAA 1XI3A 2ATMA 3MHGA 3HGSA 4KFPA 1GTEA 3DI1A 4M7SA 3W3OA 3W1PA 3CB8A 5CSSA 2VFDA 1LOQA 2J27A 5G4WA 1G4TA 3LRKA 2VC6A 1TPUA 3DAQA 4Y6GA 5EPDA 1GEQA 4GUJA 5FEXA 3D0CA 3MYOA 1A53A 4Z08A 3NOEA 5D02A 1SSGA 1AK5A 5FF7A 4A2SA 5U7SA 1JUEA 1O5XA 2FIQA 5U4NA 4UFMA 2EHHA 3M5ZA 4KWWA 4S1FA 1GVOA 1TJRA 2ISWA 4QNWA 1KBIA 5IM51 2X16A 1WBHA 2Z6IA 1JQXA 3P60A 5G2HA 3TR2A 1TRIA 4JS3A 1JQVA 4GUHA 4PL1A 3LI0A 2YPIA 3PAJA 3LCWA 1B57A 3SZ8A 4Z0JA 4I7WA 5KZDA 5LNWA 2FLIA 4LWWA 3GAKA 4ADUA 1QAPA 1XDMA 1I45A 2YSWA 1IIHA 2GJNA 3IIVA 1B9BA 1KFLA 3NL3A 3NPXA 3P8IA 1EP2A 4UTHA 1LRQA 2GOUA 1T99A 3GB6A 2JK2A 3R2GA 4BF9A 1TRDA 3W7EA 3L65A 4N6EA 1H7WA 1JRCA 1GYNA 1SO4A 1TJPA 1H61A 1QNVA 1D3GA 4X2RA 3TK7A 4HHPA 4CCCA 2A4AA 5K3VA 3VNDA 1XUZA 4O13A 5AOUA 1KTBA 4I7VA 1MXSA 4N9CA 4QIUA 3G1HA 3GXPA 3STFA 4RV8A 4JX4A 2FQIA 4UUIA 1UB3A 2W0UA 5DCBA 3QH2A 1YXYA 5EBUA 1VLWA 3TROA 1B4KA 2J6XA 3MI2A 4FX6M 2J9YA 3VKJA 3LCLA 1H7PA 2ZDRA 3G18A 3QW3A 1X8FA 1RR2A 4QQ3A 1ZAIA 2ZYFA 1Q3NA 2ISVA 5D37A 3ZFHA 1DQWA 1SZEA 2JKPA 2WV8A 1ADOA 3TUUA 3MMTA 1CX9A 4PL2A 4AH7A 4JDBA 1OABA 4FHAA 4HN4A 3WJYA 3HGOA 5CZSA 3BW2A 3FEMA 3W1QA 4Y90A 1EEPA 2A7NA 2CLFA 3B0UX 1H1YA 1TPVA 3QC3A 2H3BA 1PCKA 1FWTA 2TRSA 2TSYA 3LI1A 5D2TA 3PM6A 3YPIA 4ICNA 1VRDA 4O28A 3VI2A 5CZ0A 2BTMA 1TPEA 3ZWSA 2QCFA 3W83A 3C4UA 4ZVJA 1DORA 1TYGA 3LV5A 1EPXA 4AF0B 3C2OA 4ORMA 3W75A 3FA5A 3G1AA 4FIQA 1XFBA 1I2RA 3C6CA 3UD6A 4HNTA 2BSLA 4EWND 1BKSA 2GJLA 1CI1A 4M6PA 1O95A 1SFLA 3S1XA 4UNKA 2LLEA 4YWIA 4EOUA 1VHCA 2HTMA 4NJHA 1QPRA 4U28A 1TTPA 1JULA 4QNEA 1F74A 3PY2A 2DZPA 2C15A 3CHVA 1XXXA 3HG4A 5C2XA 1OX5A 4AEOA 3W7CA 2CLMA 4JYFA 1YPFA 3H53A 5LNUA 4RCXA 2Y63A 3ANYA 4JICA 1SW0A 1PS9A 1OFQA 2WO5A 1VYRA 3P67A 4FNSA 1JJKA 4UNLA 1WQ5A 3L0GA 2YXGA 3AJXA 3MUXA 4M5PA 1VPXA 2Y89A 3NQFA 5G1YA 4KKXA 2V2DA 2TYSA 3C8FA 2G96A 4HPXA 2QUVA 1S5TA 2VFHA 2HS8A 3HQ1A 2VKZG 1H7OA 2C1HA 2NLIA 1OK6A 3B4UA 3IVUA 1H1ZA 5LHFA 4PCFA 4GUGA 4LVBA 3T4CA 1GG0A 5TQLA 2V9DA 5DY3A 4CQAA 1L6WA 1PHWA 3LOTA 4NXKA 1XBXA 2CZDA 5AHEA 1O60A 2VXNA 3S0CA 1G4EA 1DBTA 1PHQA 2X30A 1SO6A 2E1DA 2YCEA 1ZCOA 4OV9A 4RJEA 3MO7A 1R2TA 2A6LA 4NU7A 4MZ1A 4UFLA 2G97A 5D32A 3EX4A 1AL7A 4OU1A 5KSWA 1A5BA 2CLOA 1KV8A 1AW2A 3ABSA 5DBUA 1KLZA 2NUWA 3UXDA 4K8HA 5AC6A 3UZ5A 3UWUA 3S5NA 2ZRYA 3O1NA 4O50A 3WK3A 3EWYA 2C0AA 4O15A 4AHPA 1YTEA 2WKJA 3HO8A 4RX0A 1WYIA 1X1OA 1YYAA 3PR2A 3PULA 4JTHA 3CEUA 4OGZA 4HNNA 1HTIA 5D2XA 4LVFA 3VCRA 4TO8A 1H62A 5CZTA 3SI9A 2NXGA 4GWEA 4E2BA 4UTLA 4Z1BA 2VEMA 3MW7A 3FS2A 3L66A 3TAKA 4BFAA 3S9YA 4WY0A 4IX0A 1WOAA 2EKCA 3MI3A 2E5DA 4TMCA 4RLIA 3WK0A 3LLFA 4A3UA 2Y62A 4CNOA 7TIMA 3O16A 3PWAA 1KM4A 3ABQA 3KVLA 2E09A 1EB3A 4LS0A 5L9FA 5KZMA 1GPWA 1LBFA 2P10A 1HUVA 1VH7A 2QAPA 2ZZ6A 4ZL1A 2QR6A 2G5WA 1THFD 2NX1A 1OFOA 1KM0A 1MSSA 4ZQNA 4GFSA 3O15A 3BK0A 5H91A 3MHFA 3I7RA 5D2VA 3T55A 2FPVA 1U83A 2FDSA 3G8EA 3KVMA 1IXQA 2QDGA 3U6WA 3EX3A 1VHNA 2CZEA 2JGQA 4NNAA 3NA8A 2DZSA 2W6RA 1H5YA 4JXCA 4X3ZA 5FESA 2QUTA 5BW6A 1DVJA 2ZZ1A 1W5PA 4GUFA 3SFKA 3CWNA 1LRNA 3LX9A 4MYXA 3AO0A 4MY9A 3QRHA 1KW1A 4YCOA 3E9AA 1W54A 4OBTA 2Y7DA 3M47A 4N9BA 5AC8A 3T7VA 2ZRWA 3GR8A 3BG9A 3LHUA 2AGKA 4ADTA 2V8ZA 2J24A 4MVAA 1JCNA 3IIOA 1P1XA 1O5KA 4N4QA 3S8HA 4YLWA 3N9SA 4LUJA 2P0OA 2ZQ0A 3A5VA 3LHWA 3BLEA 3LHYA 3M5XA 3DHFA 2NUXA 4L4LA 4BI7A 4NJJA 3KAOA 1YDNA 5D2WA 4HNVA 2NWRA 1OJXA 4TU1A 3UWYA 3WJWA 4X22A 1NEYA 3C61A 1R2SA 3EKLA 4LT9A 1LBLA 3BLFA 4AWUA 5EY5A 2NZLA 1GWJA 1F6PA 3W7DA 4PH6A 3TCEA 1SUXA 1VJIA 1OFPA 2E5BA 1R2RA 2CLHA 3R12A 3B8DA 3LTYA 4UC5A 3MBFA 5CZJA 1IXNA 4LC8A 1W5QA 2QJGA 3DENA 4OWGA 4K7YA 3TU9A 1ZNNA 1IXPA 3VE7A 2GQ8A 1W0MA 1DL3A 1YLVA 1KV5A 3PC0A 3F1QA 1AW5A 3O6DA 1B3OA 2A2IA 4JX5A 5F2LA 4MLRA 2ZA3A 1Z44A 5E93A 5EA9A 3G0XA 3ABOA 4K7VA 4NNCA 4WUIA 2ZZ4A 5LKYA 3DFOA 3E02A 2B7OA 3PSVA 5CPLA 3I7QA 3T40A 3ATYA 1FCBA 2IQTA 4WY0F 1NVMA 1G4SA 3MP5A 4DBEA 3M0ZA 2GUUA 3IEBA 3BV4A 5I3KA 3VE9A 5D05A 4UR7A 3DFNA 3GDKA 1TPH1 4P61A 4Y96A 5F4SA 3IVSA 1LRTA 1R46A 3STCA 4MFEA 3MP4A 2ZFAA 4YMZA 3EWWA 2FPYA 2V5BA 1FCVA 1LZOA 1M7PA 1Z48A 4JTGA 4BWLC 1W3IA 2QCCA 4EF8A 1KTNA 3DH7A 4JTEA 1W5NA 3GIYA 2XN2A 5CSRA 2B4GA 1XCFA 4IPJA 4Z1CA 1IIGA 1A5SA 5D33A 4MZ8A 4UTMA 4UMCA 4IWWA 4MPQA 3EXTA 4LV9A 4GC4A 1TB3A 3LBMA 4ZZ9A 3O6YX 2E6AA 1FXQA 3GDTA 3GYEA 2H6RA 4FNTA 2ALDA 1GJPA 2YW3A 4LRSA 4O1CA 3W74A 5F2GA 3CIXA 2V2CA 3HIJA 3N2MA 4Q4KA 4AMAA 5KINA 3DBPA 3HF3A 3UY7A 1TMHA 5E0KA 5KITA 3DI0A 1Q6OA 1WOBA 1ME9A 3QM3A 5AB3A 4JN6A 3F4WA 2RDUA 2C18A 2QAFA 5C54A 5BNKA 1YXCA 5EKYA 3S1UA 1TO3A 3W71A 3KRZA 2X1TA 4O16A 4UTTA 3TJLA 3HPSA 2E6FA 3NYZA 2DORA 3QMSA 1XC4A 3S5ZA 3LLDA 4AWSA 2W79A 3QW4B 3W7OA 2AQWA 3NXFA 5G5IA 3MBDA 2O7QA 3W2LA 1OYCA 1Q6RA 3HOJA 4MZYA 2QCDA 2V5LA 3SECA 3OG3A 3W1NA 3DFPA 4EF9A 4CNPA 3GXTA 3HG2A 1L6SA 3L5AA 1VS1A 3TSMA 4O4VA 1VCVA 3QEZA 4JD4A 4RXFA 1KA9F 5AHNA 1TTQA 2RKXA 2A6NA 3BG3A 4AF0A 3EX6A 3W9ZA 2RDTA 4UIOA 4A21A 4DO5A 4O53A 3LCHA 1DV7A 3FJLA 2Y7GA 5DCDA 5F1VA 3I65A 4N6FA 3PUEA 1F76A 1YDOA 4IOTA 3M9YA 5FEWA 1QPNA 1YXDA 4UFJA 4BI6A 5CGQA 2VFIA 3QZEA 2ZZ2A 2E68A 3UWQA 3L0NA 1F7BA 3OA3A 5CPOA 3KRUA 4MUZA 5EYWA 1VYSX 3EX1A 4FNRA 5HUPA 4JTLA 1VR6A 5AHLA 2ZBTA 1Z41A 4NUWA 5LNRA 1P4CA 1Q45A 1VCFA 3I6RA 3IGXA 1ZALA 1RQHA 3G3DA 1PIIA 2QF7A 1PL9A 1K8XA 3NQMA 2WJZA 2ZRVA 3O05A 3W76A 1XUUA 1H50A 3FYPA 2GVLA 2GVGA 4BWLA 4DBDA 5H2ZA 1GT8A 2PC4A 2ZRZA 4XTDA 4LVDA 3NO5A 3LRMA 4FX8A 3ABRA 2A21A 5FF2A 3A5FA 1AMKA 3NM3A 3R89A 2WSQA 3B0VC 3T78A 2H8XA 1QPOA 4O0KA 1VQTA 4LW7A 3V75A 2WSYA 3LHVA 5D30A 3G1DA 1X7FA 1EIXA 3L9CA 2QJHA 3L67A 5AYZA 2FFCA 3QYQA 4NJGA 4CCEA 3R8RA 3UPBA 4RR4A 4NQ1A 3PUOA 2CLIA 3C2EA 4KWVA 5I3HA 2I9EA 2Z0IA 1OG0A 3L21A 3USBA 3K30A 1JR1A 1J2WA 4JIQA 4JTKA 1C9DA 2E6YA 2X1UA 3CM4A 3FJ6A 5K2ZA 2E5CA 2GVJA 2J88A 6TIMA 4LU0A 2C6QA 3C2RA 4UFKA 3NZRA 4FO4A 3TFCA 2Y6ZA 3IV3A 4O17A 2A0NA 4MFDA 5AHFA 5HINA 1JCYA 3S42A 3PBVA 3JS3A 2QJIA 2QKFA 3W7HA 3JRKA 1AG1O 3EXRA 4UCGA 2BWGA 3P82A 1SU5A 2E6DA 1QOQA 4WZHA 1RD5A 3THQA 1AW1A 3LB0A 3DFSA 3NAVA 1O94A 5BMWA 3WK2A 2WSRA 1NSJA 3ZWTA 4LVGA 2YFOA 1OX4B 1W5OA 5LGXA 2ZZ5A 3BLIA 1QO2A 3OBKA 4PC8A 1IF2A 2HS6A 1XDLA 4JTJA 3N2XA 2Z6JA 4K39A 4OQVA 3SW6A 1DHPA 4NX0A 4N4PA 4W9TA 4IUOA 4HSNA 1ML1A 2CFFA 4OV4A 4ZQPA 1LOLA 5K9CA 4ONVA 2RFGA 3NNTA 5EMUA 1KM5A 3HJZA 1FWSA 4ALDA 5D03A 1NFBA 5F4WA 1EWDA 3P81A 4HT3A 3PBYA 1LOSA 2B0MA 4FX7A 4UTIA 2F84A 1BTMA 3HBLA 3W2UA 3EWBX 2H90A 2ISSA 5HWNA 4TIMA 3S5OA 3GK0A 1P0NA 1PE1A 3LCGA 3IIXA 5C55A 4OE7A 5AHMA 5GVJA 3E96A 3Q58A 3NVTA 3G1VA 1S3HA 4K6AA 5DN1A 1K8YA 2V30A 4BI5A 1GOXA 2DU2A 5AC7A 3SIZA 1HG3A 3N34A 2AAMA 3L5MA 2DZTA 2QCMA 5AN7A 1D3HA 5DXXA 4MOZA 1TPDA 3H54A 3M7WA 2YW4A 4UR8A 1MO0A 1VGAA 4RZ5A 1QWGA 1DJQA 2NXHA 4ZQMA 3P74A 4O12A 1C8VA 1LLWA 1T96A 1G6CA 4AHQA 2FTPA 3M43A 5FI8A 4DPPA 1TV8A 2GQAA 5AYYA 4O1AA 3PSWA 1KFJA 3CWOX 1OFBA 1X1ZA 3BGJA 4O14A 3SJ3A 3N14A 1KTCA 3G0UA 2QCHA 1UASA 5AFDA 2FB3A 3NQCA 1F05A 3DFQA 5IBXC 3IGSA 2C3ZA 4NZJA 1I8JA 2VFEA 1FDZA 4DXVA 5FF3A 5C5YA 3C56A 2NUYA 2ZA2A 1EUNA 1BWKA 3RFAA 4YCPA 3OHIA 2PCQA 3W1MA 4O18A 3W7NA 2JBMA 1AL8A 3LCFA 4AB4A 2CLEA 3NPUA 3NQ6A 3LV6A 1F5ZA 4POCA 3UWVA 3CTLA 1JUKA 4IX2A 4R53A 3NQ8A 2VEIA 1OFDA 3INPA 3P61A 3GDRA 1VZWA 1Z42A 3N73A 4O11A 2YDAA 2X1SA 3W1TA 1JCJA 4K36A 1N55A 3BVJA 3A9IA 3MYPA 1GVRA 4O54A 1Q6QA 4HIBA 3GXNA 3TFXA 4PTNA 4JYDA 4IXXA 3CC1A 4R7JA 1TPWA 4IPIA 5D2YA 4C1LA 3W84A 3I68A 2X1RA 4P2VA 1SW7A 3LXCA 2JKAA 3THAA 4A2RA 4ADSA 1JRBA 3EKZA 1LDCA 2DP3A 3TC7A 3LRLA 4H6KA 3C2FA 1YTKA 5HWMA 2P1FA 4XWUA 3IRDA 5K9XA 4LS2A 3U2OA 4PA8A 3TE9A 1ZAHA 4QITA 1F2JA 1QMLA 2XN1A 4I9AA 1FWWA 3QF0A 4JR5A 3GLCA 5MHBA 3CU2A 1UCWA 4IXHA 1EP3A 4DO4A 3LHTA 2YYTA 3MJYA 3W23A 3M5VA 5D38A 1L2UA 3W7LA 1GVFA 4LTSA 1TSIA 1LYXA 3FYOA 5DY2A 1WBJA 3WJZA 3DXIA 1SFJA 3PG8A 2TMDA 4PODA 1V7YA 3BARA 3G22A 4J9JA 1YPIA 1W1ZA 3UWZA 1JUBA 1XBYA 3UPWA 4JTTA 4XTIA 3TQ0A 4FB7A 1XL9A 2DZXA 1YADA 3B06A 3F4NA 2VENA 2Q8LA 1FBAA 2BXVA 4GUIA 3G1SA 4DQWA 4WXZA 4AVFA 3NGJA 3TQKA 3E0IA 1XBZA 1D9EA 3E12A 3WFAA 1F6KA 4ZQOA 5HNRA 4GJ1A 3NDOA 5K7JA 2R14A 1W31A 2ABAA 2QDHA 2YX0A 1K02A 3E49A 1K8ZA 2O7SA 1SO3A 2DJLA 2ZZ3A 5FEPA 1TPFA 3DKLA 3EWUA 3BG5A 1JVNA 4H3DA 3TSBA 1TTIA 3RK8A 2OCZA 4NXSA 1LTDA 4Q33A 1ME7A 3EWZA 3WJSA 1SW3A 5HJLA 4FNUA 2DZUA 4TR9A 1C29A 4DF1A 3GZ3A 3UY8A 2NWSA 4IMCA 3N19B 2ZCGA 2C19A 5F2MA 4O0ZA 3W1XA 1KFKA 2C16A 2PRLA 1M5WA 3M6YA 3PUDA 3TMQA 4XZ9A 1TTJA 1UBSA 1A5CA 4UFHA 2FJKA 2Q3RA 2B7QA 2WOQA 3O8AA 1YDVA 4UMAA 3Q94A 3GAYA 3W1AA 3BO9A 3QPZA 5FF4A 1T0OA 1H7NA 1H63A 3RU6A 4DELA 2RHGA 3A22A 5DXYA 3DHDA 3UQNA 1FXPA 1R47A 1HO4A 4HKPA 3FFSA 3EXSA 1RQEA 3W73A 1I4NA 3QPYA 3IIZA 2WNQA 3B05A 4JGDA 3ZR4A 3W1RA 4OHQA 1LROA 1YTDA 1ICPA 4L4MA 1VYPX 5BMXA 4N02A 1H51A 3R13A 2KZHA 3FKRA 2QEZA 3NM1A 1CW2A 3WK1A 2HSAA 1DOSA 4ORIA 3GKAA 3I7SA 4NZFA 1EX5A 1VLIA 4QJ1A 4X9SA 2XFWA 3G8RA 2NV1A 4UTKA 2OT0A 4MY1A 4YXGA 4ZQRA 1KM1A 1QO5A 5CPNA 3LCIA 2ZTKA 4BR1A 3N9RA 3Q2DA 2TPSA 3U8GA 3A24A 3SGUA 4EIVA 3L2IA 3TW7A 3GX9A 1PV8A 4BK9A 3PVFA 2Y7EA 4GNJA 3CQ0A 5K4ZA 1MEHA 3PG9A 4RZ4A 3STGA 1FUYA 3P80A 1W56A 1TV5A 1W3NA 1P0KA 4JTIA 3HGRA 4MIMA 1FWRA 4A29A 4S2BA 5FEZA 4LV4A 2VELA 1OX6A 5CPMA 2WNZA 1HFBA 2A1YA 3G1XA 4WX2A 2H8ZA 3W22A 4R33A 4LY8A 1QDSA 2EF9A 4IGHA 4DF0A 1N7KA 4RZ6A 1OYBA 2VEPA 3CLMA 3P5YA 1WX0A 3TSDA 3BW3A 5HR7A 1SQ7A 3OVRA 4I7UA 3F03K 3NQEA 5KZEA 5A8GA 4XBKA 1TCDA 3LXBA 4O1DA 1OFEA 3M1ZA 5F1UA 1A5AA 3KRSA 4JYEA 4MLJA 3EX2A 1PVNA 3C3NA 1ZAJA 1KFBA 1IGSA 4N9DA 2C14A 2BX7A 1QPQA 2YZRA 2C13A 1P5BA 1OFRA 3W7PA 4QSHA 2PE4A 3W7KA 4FNPA 3GDLA 4Y8FA 2OX1A 1MEIA 3OIXA 1OX4A 1SPQA 1M6JA 4XKYB 3RLUA 2NX3A 1B4EA 5LHEA 1Q6LA 3GKFA 3GR7A 3L5LA 4Z0SA 2WQPA 2VEKA 3NPVA 3KFTA 4PEKA 2Y70A 2F7FA 2PRMA 5DELA 4UXDA 3S5YA 1TV7A 5I3JA 2Y85A 1GTHA 2VOMA 3QSRA 1KBJA 3R5EA 3IVTA 3LXAA 1LORA 4LOCA 3W07A 4U4MA 1K7EA 3NZ1A 4UTWC 3GNDA 5AHIA 3W7MA 1GYLA 3UWWA 5C6MA 3G0SA 2FB2A 1FCQA 1VCGA 2R94A 4JNMA 3IIPA 1TQJA 4WOQA 3W2JA 3KX6A 1J4EA 4LVAA 4QM1A 3DU0A 3LGEA 3EEGA 3NG3A 1SZFA 4CQ8A 3NQGA 3NQVA 3W86A 4FXSA 3W88A 3NQ7A 1DQXA 3QQ0A 3BGGA 2H3DA 1GQNA 3LHZA 4M19A 3STEA 1G67A 3M5YA 3UZJA 3LTPA 2BLEA 4IQLA 2JGYA 5ABTA 1ZJIA 3RLVA 3TC6A 4LC6A 1FY6A 5K4XA 3IGUA 2B7PA 4MJMA 5L6UA 4NJKA 1U5JA 3JR2A 3W2KA 4WXYA 1MZHA 1E51A 2QCDB 3M16A 1GVQA 1H60A 3W72A 4G1KA 1RQBA 3S6DA 4JY8A 5TIMA 4JTSA 1EUAA 3QMTA 4E0CA 1GZGA 4K38A 1K3UA 2RDWA 5I3FA 4KFOA 3A23A 3NL5A 4XUGA 4FEZA 3W1LA 3M41A 2QUUA 1G4PA 5HMSA 1KFEA 3KOFA 5G2IA 1GVSA 4N9EA 3CEPA 2Z2UA 2Y61A 3BPWA 2J9ZA 3TAOA 1LP6A 4LS1A 2Y88A 3N3MA 4MYAA 3W7JA 2X2GA 4XBSA 1OF6A 3ZS4A 4WJEA 3LBCA 4R34A 1KM2A 2CW6A 3TKFA 3UXAA 1DKWA 1OF8A 4Y9AA 2RH9A 3TIMA 1TREA 3BW4A 5K9DA 3OVQA 3UYCA 2OMAA 1HO1A 1OYAA 3PB2A 2CWNA 3G3MA 2R91A 1VC4A 3CIWA 4YL2A 3W7GA 1F73A 3OVPA 1K03A 2Q8ZA 2DZVA 3PS7A 3NL2A 2EPHA 5SWUA 2VFGA 4AAJA 2YR1A 4CLMA 3ELFA 4UTUA 5HQEA 3G1FA 3FIGA 1ME8A 2R8WA 3O63A 1QR7A 1BEUA 1G69A 1TQXA 3ATZA 1W3TA 4LUIA 4O4WA 4E2DA 1GG1A 1XM3A 2V0TA 5I3GA 2QCLA 3C0JA 3HPXA 4K37A 1XKYA 3W7RA 3WJXA 2CU0A 3W1UA 2V82A 1K7FA 3G24A 1J5TA 1S5WA 2UV8G 4RK8A 3MWAA 3LDVA 2ABBA 3NR0A 5LNSA 3HG5A 4UTWA 1NAL1 3W7IA 1JCLA 1OK4A 3EB2A 5G4EA 3B0PA 3RF9A 1EA0A 3PB0A 3W2MA 1QOPA 2PURA 3PF3A 5BRBA 1L9WA 1OFAA 3LTSA 3TXVA 5J5DA 2I1OA 3NEVA 4LRTA 1I2OA 5DCEA 5EL1A 4AWTA 2CLLA 3TQVA 4CQ9A 1NF0A 3W7QA 3FKKA 3UNDA 3VFLA 2CLKA 5DBTA 4Q32A 2ZZ7A 5LNVA 4GXMA 1TPC1 4AHOA 3KXQA 1KLYA 1ICSA 2QCNA 4S2CA 4NX5A 4WOZA 3TA6A 4HNUA 1O4UA 2CZ5A 5F2IA 3DFTA 4OT7A 4O57A 3SGZA 4JDYA 1ZHAA 2OT1A 4IMGA 4IMEA 1RV8A 3NPWA 3SR7A 4EVZA 1RPXA 4LNYA 1I2QA 3M44A 2OJPA 4Z1AA 3FLUA 1FCUA 4WD0A 1LBMA 4GE8A 3L68A 1V5XA
chains in the Genus database with same CATH superfamily
1A3HA 1VENA 3WMCA 1U5VA 1I0BA 1PYMA 2GOKA 1NELA 2WW5A 3WL0A 3SSJA 4B5XA 2W63A 3IK2A 1W91A 4AYSA 3Q4DA 3FSUA 3H7UA 3KS5A 1SYTA 3RPTA 5C7HA 1TV4A 1DE6A 2HVNA 3MMDA 3PBUA 1K4GA 5G2WA 1JZ3A 1FWNA 3R1ZA 1D8CA 3CWHA 3URBA 3ZZ1A 1E0XA 3HQOA 4ECLA 1RLDA 2V81A 5G1TA 2RAGA 1OVDA 1FWEC 2OO0A 3P7YA 4P7RA 3ERPA 5KTLA 3GTFA 2Z1XA 4DXKA 4OBSA 3S1WA 3NQDA 4MTVA 4OVXA 5D8ZA 4WDUA 2DIKA 4DAIA 5FJPA 1I60A 1UWSA 4W7VA 2V5CA 2DVXA 2W27A 4XD4A 4U10A 5HR6A 4M6VA 3LU2A 4G7FA 4CU6A 3CMJA 4UFIA 2XN0A 4E5TA 1FH7A 2OOFA 4H00A 1L6YA 4F0MA 3MSRA 2C1GA 4JX6A 3TMLA 3N2OA 2ZADA 1EC7A 1UJPA 4HA3A 1H7RA 3QGAC 4YU1A 3B04A 2Y8KA 1QCWA 3WLOA 4W89A 4H19A 3GNNA 1LLZA 4MY8A 1E9YB 3UCDA 5RUBA 3LCXA 3FY1A 4WCJA 3W85A 5HWJA 3CT7A 4F79A 1ZBVA 6ALDA 3UR7A 2EAWA 2J9XA 1WKFA 1IE7C 3U48A 2V5JA 3ZJKA 4DO6A 3H22A 4WY0B 3PAOA 4MKNA 4FIRA 3NQ2A 3O0KA 1UD2A 2V38A 4I9MA 1SSDA 3NOYA 4PMVA 1XD1A 1V0LA 4A8LA 2A85A 1WAUA 3TDFA 2GGGA 1U30A 3GTXA 1WA3A 3ANVA 3N1AA 1KFCA 4PCTA 3DGRA 4DPQA 4ZO8A 5BXPA 1FDJA 5T9BG 3B8TA 1EGZA 3W26A 1XG4A 2XH0A 2NLYA 3CUZA 5I3IA 1TPB1 4PULA 3WBAA 3N9KA 4DJFA 4IL2A 4QAIA 1TIMA 3PBWA 1AQHA 4B2DA 1X6UA 3QOMA 2A7PA 2EEXA 5FCZA 3CQJA 2EGZA 5H8UA 1QFEA 1PX4A 2YFNA 3NVDA 3LM7A 2X41A 1B5TA 2CBUA 1E0VA 1HVQA 4IJBA 1R3WA 1EP1A 3L0KA 5KMYA 2OSWA 4RDZA 2WNNA 3DUGA 1S2WA 3W70A 2HXUA 1NWTA 3V16A 2XFFA 2PP0A 3CMFA 1OC7A 3GDMA 1T7LA 1DHKA 5TBOA 1W9XA 3Q37A 3OZMA 1TWDA 3F5JA 1Z7AA 5A2BA 5A6JA 3PFMA 4WRHA 4GNKB 2NV2A 4AVNA 3RNDA 5BOOA 1ICQA 3SBFA 4D72A 2ATMA 3MHGA 1UH3A 2WVTA 3KOXA 3W53A 1IV8A 1QU4A 3E2RA 3VD4A 3N6HA 3Q45A 3WF1A 1V03A 1FKWA 5BU6A 3LQGA 4ZO6A 5CLWA 4Y6GA 2E25A 5EPDA 3UA3A 4AFYA 1A4LA 5CPSA 4AD4A 4QXIA 4W86A 4BY3A 3GC4A 1XPYA 3UESA 4NZ4A 4H2HA 4AIBA 2PD5A 2VTFA 3EA3A 4UFMA 3WD1A 4GVIA 3H7RA 3ITXA 2ISWA 4NYYA 1IZKA 1KBIA 3N29A 3RJYA 2YBTA 3DCPA 2Z6IA 3H4WA 5G2HA 1MVYA 4WLCA 1JQVA 4GUHA 1F3XA 3LI0A 3WNMA 2YPIA 4GZJA 3VNJA 3HV8A 3UU0A 1YNQA 2HWGA 2D22A 3ARYA 4P7NA 9RUBA 3S3GA 2Z1WA 2FLIA 4LWWA 1QAPA 1XDMA 2ZE3A 4YN5A 2YSWA 4D6EA 1IIHA 3T0AA 1I1XA 2J62A 4M1BA 3PJUA 4LUYA 5C2CA 2E40A 2PC8A 3S47A 3P8IA 1GVYA 3SCRA 4O0QA 2YL9A 4PMQA 3KWXA 1C3FA 4DYKA 1T99A 3ZYZA 1K6WA 3LK6A 2JK2A 3W7EA 1DIKA 1CYGA 1JRCA 1GYNA 1X1NA 1TJPA 4CCCA 4E3TA 1B0IA 3VNDA 1XUZA 2I5IA 5JIWA 3G1HA 3GHTA 1B3ZA 3KL3A 1UB3A 2W0UA 1ZP4A 3S2JA 2J6XA 4HMEA 1UD5A 4M24A 5EMLA 1RVKA 3WH7A 4F3HA 4I8DA 5KETA 2ZDRA 4ICCX 1X8FA 5D9NA 5D37A 4WDWA 1TJ2A 4GBDA 3WG6A 3TCSA 4BQ2A 2G3FA 4J1OA 4EWJA 2F6KA 4AH7A 4JDBA 3I6TA 1OABA 4FHAA 4HN4A 3WJYA 3H2AA 3BW2A 1EEPA 2AL1A 4NAFA 5A6LA 1MDRA 2TRSA 1UP2A 3VIGA 2FMNA 3RILA 1Z6KA 3W83A 1KRAC 1DORA 5HAOA 2VYOA 3AIQA 1YMYA 3TYCA 3VOJA 3W75A 1HKWA 2PI6A 3NYDA 2BSLA 2GJLA 1O95A 1PKNA 2OLAA 1SFLA 3S1XA 5HDRA 4UNKA 2LLEA 4PBFA 1JZ6A 2J7DA 1JF5A 4U28A 1JULA 3ZMRA 1O66A 2C15A 1XXXA 3TP4A 5C2XA 4LH8A 4IP7A 3BSGA 1V3JA 2R82A 3ANYA 4ATDA 1E0TA 4NG3A 4DWSC 1OFQA 1XDJA 3P67A 2W61A 1WQ5A 1RP9A 3WLKX 3GNRA 5DO8A 4KKXA 1ITXA 4PTXA 1HJQA 1KC7A 2HPIA 4HPXA 2W9MA 3HQ1A 2OQLA 2NLIA 5CSUA 3B4UA 5LHFA 3WF4A 5AC4A 4U3AA 4GUGA 3K4AA 3N15A 2V9DA 5A8QA 1L6WA 2D0FA 1C7TA 2WSKA 4MADA 2BHUA 4KEZA 3DBNA 1PHQA 2F8QA 4GXPA 1ENUA 2YCEA 5DMLA 3GW0A 3FN9A 4XD3A 3EX4A 4P8XA 5KSWA 1A5BA 3OIHA 1XJBA 1KLZA 1KRMA 1WKYA 3IAQA 4A6GA 1Y5XA 3GD6A 1TWWA 3SUTA 1UPPA 1QHPA 1ISZA 4O50A 3WK3A 2QV5A 3EPNA 2H9AB 4IMAA 1UOZA 1L8PA 1DEDA 5AVNA 1DTUA 4AD3A 1OD8A 4TO8A 3CZGA 4QJ5B 4XKMA 5CZTA 1V6VA 2P88A 3BAIA 7REQA 3VDCA 4JNYA 2JQXA 4UTLA 1REQB 1J93A 1KCXA 1UZDA 1W9VA 2VEMA 3RO8A 1EFZA 2EJAA 2Z00A 4ERIA 2Z25A 2WMIA 4TV6A 4L56A 2Y62A 4CNOA 3RLHA 7TIMA 5I02A 1A49A 1R9ZA 1YDYA 3VNIA 4GLEA 4QS5A 4CCZA 3V0UA 5L9FA 5KZMA 2OQYA 2QPSA 4WVXA 1VH7A 2QR6A 2C79A 3DGBA 3VIJA 1RCOB 1MSSA 3IRSA 3O15A 3MHFA 3I7RA 3RR4A 4PMYA 2QDGA 4J3SA 3VX0A 1GZ1A 4HB7A 3RUBL 2FGZA 3FCPA 2W6RA 4V1XA 4MNJA 4GUFA 4EXAA 1NJJA 3CWNA 4MYXA 3E9AA 2WC7A 4OBTA 4YTUA 4N9BA 1MXGA 2DVTA 3BG9A 3R11A 2PWFA 2CHRA 2W92A 4DJDA 5I24A 2J24A 2XHYA 4CGTA 1JXKA 3VKKA 2QGHA 5FAJA 3SO7A 1QT1A 4LUJA 1FWFC 3MKVA 4C6DA 3VTRA 1YX1A 3BLOA 1C8YA 3R4IA 3EOOA 3DHFA 4L4LA 3EDEA 1YDNA 5FJJA 2QUNA 1UZ1A 1U33A 2IW0A 2XUCA 5EY5A 3EGJA 1GWJA 3ISIX 1SUXA 4S3AA 1CENA 1MW2A 5JMUA 1JAKA 2XM2A 1S1PA 4I6KA 1BHGA 4LBSA 2XVGA 3HV9A 2QJGA 4OWGA 4XX6A 1ZNNA 1IXPA 4QCFA 2Y4SA 1EDQA 3PTKA 1YLVA 1KV5A 4GZEA 2WC4A 3O6DA 1ZLPA 1RJPA 2PF8A 7CGTA 4B9ZA 3WSUA 1Q13A 4JX5A 5F2LA 4MWAB 5IDZA 1HX0A 3LEPA 4QEEA 4NNCA 5I78A 1UWUA 1LQ2A 4KMQA 2BY0A 4JKKA 3PSVA 3T1GA 3ARPA 4DYJA 2IQTA 2FKPA 4WY0F 1G4SA 4HVXA 3SRFA 4D6IA 3TA9A 5I3KA 5D05A 5AY7A 1EBHA 3D46A 3GDKA 1M03A 4RUBA 2OSYA 1TPH1 4ZTYA 3GG7A 2WZTA 1M65A 2FGLA 3USZA 1QNOA 3LPFA 4HPGA 3BOFA 1LZOA 1Z48A 1J12A 4JTGA 1W3IA 2QCCA 6ENLA 3GIYA 2XN2A 2ZWYA 2B4GA 5CSRA 1XCFA 4IPJA 4DN1A 4Z1CA 3A9BA 4MJ2A 1IIGA 4LEFA 3CLWA 1ODUA 5CBIA 4IWWA 3E1F1 3OLGA 1OGBA 3OLEA 2YBVA 3O6YX 3S2MA 4P7LA 1FXQA 3GDTA 3GYEA 4FNTA 1GJPA 2YW3A 1MMFA 2VHLA 1GQLA 3UJRA 3RN6A 3N2MA 4Q4KA 4QLJA 4AMAA 3BLLA 3W82A 4B5SA 3EOUA 4LAZA 1CXLA 5AYBA 4DY1A 1NDWA 3VX1A 1Q6EA 3QM3A 1IZCA 2RGLA 3F4WA 3GNPA 2QAFA 2VC7A 3IJ7A 5BNKA 1YXCA 2HISA 1EJTC 1Q85A 2ZIDA 4UTTA 3TJLA 2E6FA 4WJ8A 2DORA 2HQAA 3QW4B 4DYEA 2AQWA 4X61A 3GO2A 3VGDA 2D0GA 3NXFA 5G5IA 2FH8A 3QZAA 3W2LA 3HOJA 4MZYA 5C71A 2VGFA 4I5XA 3W1NA 3DFPA 4GACA 3L5AA 2V3FA 1ITQA 3KE0A 3TSMA 4Q6JA 4O4VA 2PDFA 2QPXA 1Z3NA 1G94A 1RBOB 4JD4A 3PPCA 1OGGA 3BG3A 4AF0A 3W9ZA 4A21A 3SDOA 4DO5A 5DT7A 2AQOA 5BRPA 5F1VA 3AYRA 3VILA 4REQB 3PUEA 4NF7A 3VGFA 1Y5VA 2CKSA 1QPNA 4UFJA 2VFIA 3GU9A 3QZEA 3T42A 2E68A 1Q7MA 3UWQA 1F7BA 1YHTA 1JXJA 3OA3A 3R6IA 2YB4A 4FNRA 2CXEA 1VR6A 5AHLA 1KWGA 2BFGA 1C92A 1XLCA 3TYBA 4H1ZA 3IGXA 1ZALA 4GZIA 2OX4A 2DT3A 3UERA 1RQHA 1NARA 1EZWA 2PGEA 1T41A 2WJZA 2ZRVA 3ITOA 2X05A 2FVMA 3W76A 1H50A 3MSGA 3WLIA 2JALA 3WQ6A 3RX3A 3OYXA 1TUXA 3RCNA 4S39A 1XFCA 4FX8A 2WVVB 3SQSA 2XGIA 3NM3A 3UXKA 2H8XA 3VC5A 2PDYA 1CNVA 4NRRA 1QPKA 3GNXA 3UJSA 1VQTA 3OHMB 3WIJA 2Q09A 3CAKA 5AYZA 3L67A 1W1A1 3QYQA 4NJGA 4CCEA 3R8RA 1TX0A 2FH6A 4IFRA 3PUOA 4KWVA 3K8LA 4S3EA 5I3HA 2ANUA 2Z0IA 1VJZA 4IIDA 2FMOA 1ZTVA 3ZIZA 2E5CA 1CGWA 1DIEA 6TIMA 4L9ZA 4DBUA 4A3YA 1UKSA 3C3UA 5BOFA 5HINA 1JCYA 2F38A 4F8XA 4PEEA 3QV7A 5IDIA 5ABHA 1VP5A 3W7HA 3JRKA 4G5DA 1AQ0A 5MF5A 1GQJA 1QOQA 1E0UA 4E8CA 2HNEA 1O94A 3WLJA 3WK2A 3G6LA 3ZWTA 3S6TA 1JZ7A 1OX4B 1W5OA 3B0YA 1CECA 1IF2A 4MNMA 3UGRA 2Z6JA 3CH9A 3G5EA 4MHBA 3V0TA 3ARRA 3SW6A 2XVPA 4W9TA 4CVUA 1IWBA 4HYVA 5HQLA 2CFFA 4IISA 4ONVA 2RFGA 4ZOAA 4ALDA 1NFBA 4HNLA 3L4XA 1EWDA 1NP0A 3P81A 1LOSA 2YCLB 4R7WA 2B0MA 4FX7A 2WC3A 3HBLA 1TELA 3EWBX 2H90A 3MS8A 4YHEA 3VDHA 1XIBA 4YTRA 5HMFA 3IWPA 5C55A 4OE7A 5JU6A 5AHMA 2PUZA 2VZVA 3ALGA 4FSAA 4B3KA 4K6AA 2V30A 3GXMA 4BI5A 3RHGA 5AC7A 2QVHA 3SIZA 3GDBA 1W3HA 4XAYA 2YW4A 1KBLA 4TUFA 1QWGA 2NXHA 4ZQMA 5CAHA 2R24A 1R3TA 1LLWA 1W3LA 1OADA 3M43A 5FI8A 2GQAA 4V1YA 1R3QA 1E4IA 5DEZA 3VD7A 1X1ZA 4O14A 1PZ0A 3G0UA 2OGYA 5AFDA 3NQCA 4H6EA 2PFHA 3VIFA 4NZJA 1I8JA 4DXVA 2WZHA 3WY1A 5H1WA 3OBEA 1V3LA 3BAXA 3VC6A 3T05A 4HOXA 4GXWA 2DV0A 1WZLA 2CLEA 3NPUA 1JUKA 4C6BA 5D4YA 3NQ8A 3LNPA 5JBFA 1OFDA 1OT1A 1W1TA 1XINA 4TX8A 1SR0A 1VZWA 4W84A 3W1TA 1JCJA 1CB7B 2A79A 1CGUA 2OFJA 3GXNA 2VCAA 3WDJA 1JFHA 3R94A 2XGBA 4PTNA 4JYDA 4V27A 3CC1A 2HZGA 3ZR5A 3QV9A 4IPIA 5CC6A 3BH4A 3LXCA 1AH3A 1HVXA 1A0DA 4PCSA 3LRLA 4H6KA 3C2FA 1YTKA 2P1FA 5DMMA 2GSEA 6REQB 2Y5JA 4TX6A 1NDZA 4XWUA 4AY8A 2GQ3A 4JKMA 4W8AA 1FHDA 2QF8A 3TE9A 3NIYA 3UWEA 3OJGA 3MUZ1 1O5QA 1QMLA 2PF0A 4D6FA 4FXFA 1S2UA 1XLKA 3QF0A 3GLCA 4KEMA 1R85A 4RW5A 3OYZA 4IXHA 1WDSA 1OG6A 4RDWA 3MJYA 4L6DA 1LWJA 4WSJA 1AUSL 5B80A 2RDXA 5A6MA 3CUGA 3T81A 2ACQA 1QHZA 1WBJA 3WJZA 2D0HA 3WNOA 2TMDA 1FVPA 4PODA 1V7YA 3BARA 4QDPA 2DSWA 2Y8UA 1YPIA 4IFKA 1K6AA 1VBUA 1VKFA 1JUBA 1XBYA 3UPWA 4XTIA 4E8GA 1KXVA 4QSFA 4TQTA 2EG8A 2I17A 2VQUA 4U5KA 3B06A 1JPHA 3CPGA 2BXVA 1EJSC 4AVFA 5CC5A 2QMKA 4M0XA 3E0IA 1UKQA 5A8NA 2W4XA 2YKKA 3ID7A 3D3AA 1MQPA 2R14A 3R79A 2DJLA 5FEPA 2W5FA 3KL0A 4WKFA 3BJTA 3WH6A 1JVNA 2D23A 3RK8A 1XLGA 2PDKA 3DDMA 1E5NA 1ME7A 1SW3A 4AZCA 4FNUA 4TVCA 2DZUA 3THUA 4BHYA 4IMCA 1QTWA 3DG7A 4O0ZA 1UKPA 4J3XA 4IGMA 3UG5A 1V77A 1KFKA 4DX3A 1IR2A 3MSYA 3GVVA 2SFPA 3WUBA 4TTUA 3TMQA 3N04A 4XZ9A 3EOSA 1TTJA 4DLMA 1PWMA 4GY1A 1M7XA 4G6CA 4I5UA 2J25A 3UA4A 2Q3RA 3PBMA 1DIDA 3O8AA 1VBHA 2VCCA 3AS0A 2BOFX 4GYJA 2NQHA 4F9JA 3AIBA 4RNJA 3A22A 1NOWA 2RJGA 3DHDA 4S23A 3A4XA 4H9ZA 3N2BA 1H49A 1H41A 3A3WA 3VOIA 3U2ZA 5M17A 2E9BA 3B05A 2D2OA 2DT2A 1OWQA 2AMXA 4JGDA 4QE5A 3ZR4A 1WXZA 4OHQA 3LPGA 4URIA 1YTDA 2PLKA 1ICPA 4L4MA 4LAKA 3PTMA 4LAUA 3RYSA 3R13A 4KIRA 1XIDA 3OLDA 3FKRA 1QI0A 1VFTA 3MVIA 3NM1A 1NFGA 1W2VA 4W85A 3I7SA 4S38A 1PBGA 1J0IA 1M7JA 2XFWA 4L7ZA 1KM1A 5CPNA 3LCIA 4YWSA 3VAVA 2TPSA 3U8GA 3SGUA 4LNCA 2HRWA 3CHEA 3A4AA 3GX9A 3T8LA 2Y7EA 3RCMA 5LIKX 4GNJA 3CQ0A 4DXXA 1MEHA 2EPLX 4WJXA 4RZ4A 1FUYA 1EL3A 3S1GA 2VT0A 3GS6A 1EIBA 2O4QA 1AH0A 1W3NA 1P0KA 4JTIA 3HGRA 3A47A 2NVAA 4H9VA 4S2BA 1UWTA 1JZ5A 4WKAA 3TN5A 3HA1A 4CEXC 2HNHA 1RBLA 3NO1A 3L2MA 1OYBA 3CLMA 4DUWA 3BW3A 2J4GA 3OVRA 1XLBA 3HPFA 2DPEA 2WJEA 3NQEA 1M53A 4FLSA 1TCDA 3F5KA 1ZB5A 3LXBA 1DJYA 2F2HA 4FR6A 5CSYA 4QGCA 4IPNB 4FMVA 1KFBA 4B5VA 2AL2A 2C14A 2BX7A 1QPQA 3WLTA 1Q4NX 3SCOA 4X60A 3WD0A 3W7PA 4R9OA 3DHPA 1GJUA 3PJWA 4XAZA 4YVXA 1VFMA 3ARQA 1RJQA 2DY3A 1SJBA 2V69A 4XKYB 4S3BA 3FV9A 2DSKA 3F2CA 1UROA 1Q6LA 4CD7A 4Z0SA 3BJSA 3NPVA 2Y70A 3VABA 3S5YA 5TF0A 3JZUA 3QSRA 4PMDA 2GVEA 4LOCA 4OTKA 5FL1A 2QV4A 4U4MA 4PUJA 1K7EA 1Q7QA 3APYA 1E9IA 3GH5A 2FB2A 1VCGA 1V51A 4Q6XA 1TQJA 3NJ3A 4NHVA 3AUJA 3KX6A 4NL1A 1DWGM 2OWWA 4AZHA 5XIAA 2DSZA 4EPDC 4LVAA 3SCUA 2YLAA 3WQ8A 3SN4A 4CQ8A 1RLCL 3NQGA 3NDYA 3M6DA 1K1DA 4HHHA 4XV0A 2H3DA 3STEA 4M19A 1UD3A 4GJJA 1PZ1A 5ABTA 3ONBA 5LIWX 2ASHA 1V3MA 2PAJA 2DQWA 3MANA 3KBJA 3BMWA 3W72A 2CESA 4G1KA 4LYQA 5C8BB 1RQBA 4JY8A 4JTSA 1ONEA 1EUAA 2EQDA 1GKPA 3S83A 4W8LA 1K3UA 4GCXA 3LSCA 2RDWA 1WDDA 3U0HA 4QG8A 1QNPA 3GHUA 3W1LA 1XIEA 3TAOA 5XIMA 2Y5SA 1E6PA 3WLQA 4XBSA 2I56A 2X40A 1EZ2A 3V36A 4S3DA 4KEVA 1KM2A 1E4MM 1XP3A 3QGVA 4KRUA 3WX7A 3E5BA 2O0TA 3LUTA 2RH9A 2QYGA 3BW4A 4AYGA 2Y5EA 3UYCA 1XCXA 3PB2A 1LT7A 3TN6A 1UC4A 2QXWA 2WM1A 4YL2A 1F73A 4OECA 1XSKA 3GZAA 2VFGA 4UTUA 4IT1A 2XG9A 3TTEA 4CU8A 2WYSA 1XD0A 1ZPTA 4JL2A 5FAGA 3TOYA 4QJ3B 1Q2RA 2EBNA 1W17A 2YL8A 1OQFA 3ATZA 3ITCA 4O4WA 1F4AA 2IPFA 3U5UA 1XM3A 2V0TA 2MANA 3DC8A 4K37A 2FVLA 4JAWA 1J5TA 4LPCA 5A6KA 1UD4A 4GI6A 3MWAA 3LDVA 3NR0A 4JIEA 1RAKA 3U7VA 4DO7A 1ZCCA 1TA3A 3B0PA 2AGTA 4HK7A 3PB0A 3W2MA 3PF3A 2WMGA 1OFAA 3LTSA 3TXVA 5J5DA 2I1OA 3NEVA 4JQAA 2PGRA 4PB3A 3VM5A 5DCEA 4I9JA 1UJQA 3TNBA 5EL1A 4AWTA 3W24A 4C6FA 2CEQA 3L23A 1NF0A 3HFYA 3W7QA 3FKKA 3VNKA 4S3KA 2ZZ7A 4AHOA 4DJED 3BTNA 3TA6A 1N2VA 4DNMA 2CZ5A 5HK4A 4O57A 1ZHAA 2GJXA 5A95A 1PZ2A 4IMGA 3NPWA 3CZKA 3TWAA 1RPXA 4ZOCA 4W4QA 4EP8C 4X63A 5I7GA 2GUYA 3NFUA 3QSTA 1RXOB 3SRDA 3TH6A 1UMLA 5C9XA 4NJIA 5FF0A 2Z1BA 4Z1DA 3HPZA 3NL6A 4DZIA 4O1BA 3B8VA 2HJPA 1T8XA 1EC9A 4P8WA 4E38A 2VZSA 4WGXA 5CKSA 3VIIA 2BVDA 1HF6A 1AZ2A 4O19A 4Q7IA 1A5MC 1KBKA 4UZUA 1S2CA 3ORWA 1M01A 1YW1A 1UD6A 4CD4A 3OEXA 4IMFA 4NRSA 1K7XA 1PAMA 1FQ0A 2PD9A 4GKLA 4XZHA 5ENLA 1JCMP 3M64A 3WQCA 1RZMA 3ZT6A 1B3WA 2YGYA 3VD5A 2MUCA 1KM6A 1MDLA 3RMJA 2P8BA 2IPJA 1YIXA 5I00A 1ZFJA 4HK5A 3MUAA 4KRZA 2E67A 1QWKA 1OZQA 3QHMA 1F61A 4H9XA 1HL2A 1S3TC 3PTQA 4GABA 5T26A 4IJRA 3KTCA 4L64A 2NV9A 1OHLA 3C52A 2ZA1A 4C1KA 1A50A 1B90A 5LZLA 4PUMA 3TLQA 3QMRA 2VX6A 3LQLA 4K68A 3H2EA 1EHNA 3M46A 3QJAA 2QPUA 4F48A 3AS1A 4UB9A 4JTFA 3SAZA 1WCGA 1LM1A 4XQ6A 3OOQA 1PCWA 3DECA 1JYWA 4JQ1A 2WK2A 3FHQA 2PP1A 4Z17A 2JE8A 1UOKA 2VURA 3WUEA 4FF7A 4NT0A 5IBXA 5J5RA 4FXRA 4LALA 4GG9A 3BCJA 5E1QA 4PSPA 1V02E 1SO5A 4PE8A 1EHAA 1FX6A 4B5UA 2Q6ZA 4RL3A 1VFLA 3P62A 4DEFA 4OUIA 4Y2WA 3SN1A 3MI6A 1BWLA 1I2PA 5C2GA 2GGJA 4ZOBA 4M1RA 3O07A 4AZ7A 4NZ3A 2D3NA 2QDDA 2GQ9A 4H4IA 5CG7A 2P3ZA 5LGZA 2OZTA 1XLLA 3KEHA 1UP3A 4PRWA 3WH9A 2OZ0A 1SZGA 1U2YA 3NQBA 3KHJA 4Q4PA 1EXBA 4GH3A 2E77A 3KS6A 2A3HA 3KVJA 3CPRA 4DWSB 2FJUB 3P84A 1UHVA 4K8EA 1TWIA 2EG7A 2J7FA 1ALDA 1WB0A 3V1PA 1HGYA 1WV2A 4WR3A 1R30A 3XIMA 1PSCA 4QX4A 1V8EA 1XS2A 1HP5A 3AFBA 2C71A 4C6KA 1ZY9A 3BLDA 2POZA 3B03A 4XIAA 1JCXA 2GFTA 1RP8A 3OGVA 1R87A 2ZX7A 1B2YA 3NURA 1PDYA 5BU9A 5C0QA 2ZXDA 2X1IA 3S1VA 3TXZA 3HQPA 4AIEA 3S9IA 4O8RA 2QCGA 1KR1A 1BXNA 2D3LA 4XG1A 4UMBA 1QNSA 4UTJA 4N2YA 1V6TA 1XI3A 3KBNA 1RJRA 1EF2A 1GTEA 4PBEA 1FH9A 3D47A 2ZUWA 4QG9A 5CSSA 5AZ0A 4IZGA 2EKGA 1AMYA 3GWQA 4H6QA 2VC6A 1OGSA 3SB0A 1OC6A 4E4UA 4GUJA 2ZX8A 3S2LA 4Z08A 1D8WA 5D02A 3GM8A 1UBPC 5BCAA 4A2SA 5U7SA 1UMYA 2OLHA 3CZEA 2FIQA 5U4NA 3WQEA 2EHHA 4KWWA 1E6SM 4S1FA 5FD0A 5AVHA 3CUHA 4D71A 2X16A 2BGSA 3IJ8A 1R7AA 1JQXA 4LB3A 4G2DA 1V08A 4PL1A 3GW3A 4MPKA 3LCWA 2VQTA 2P5NA 3SZ8A 2WMHA 5LNWA 3GAKA 2XVNA 2DW7A 4CQDA 2VJXA 3VINA 1GOWA 3DFYA 2RUSA 4MMWA 4R5EA 1KFLA 1O6IA 3NPXA 1EP2A 4UTHA 1I6NA 2HV5A 1GVIA 8CGTA 3MO4A 4PN2A 2EPKX 3EYPA 1DJIA 2ZICA 4BF9A 2OELA 4MDOA 3BE7A 3GVRA 1KXHA 1GOMA 3MC5A 4TXEA 3N13A 1VRXA 1H61A 1D3GA 3TK7A 1ODZA 4FALA 1DJGA 5K3VA 4O13A 3CUFA 5AOUA 4PYSA 1MXSA 4Y8EA 1OD0A 4RV8A 2OYKA 3MWCA 1CLVA 5DCBA 3GG0A 3AOFA 1I75A 3G18A 3APGA 4HMCA 1RR2A 1XH0A 2ZYFA 2ISVA 3ARWA 3B8UA 4YTQA 1KKRA 5E6ZA 1NIUA 4GISA 1KNWA 1RK6A 2BG5A 2QQ6A 4DAFA 4LCSA 3TUUA 1CX9A 3FAWA 1K9EA 3UEQA 3FEMA 4YPJA 1H1YA 1TPVA 3EDFA 3SGGA 2O9TA 3CZ8A 2VX7A 3LI1A 3YPIA 4O28A 1VRDA 2QCFA 4IG2B 3C4UA 5A69A 2XH4A 5A6BA 3C2OA 1EF3A 3FXGA 4MB3A 3RM8A 3FA5A 4FIQA 3C6CA 3UD6A 4HNTA 3C86A 4LX4A 4DBWA 3CV6A 3DIPA 4EOUA 1VHCA 4GIRA 4QS6A 1SJDA 2HTMA 1GJWA 2ACUA 1TTPA 4MWAC 3SADA 1F74A 4E2OA 3WD3A 1VEPA 1GHSA 3CHVA 3C0QA 3HG4A 4LUSB 4AVOA 1YPFA 3NGFA 3KOZA 2WNWA 1TZ9A 2GLKA 1JPIA 1SW0A 3WQPA 2I57A 2ZXAA 1NY1A 1PIGA 3KBWA 4B3LA 4X9YA 2XIJA 2X09A 3CAWA 3GRIA 5IRPA 2CBIA 4UNLA 2BOGX 1DPMA 2HK1A 2Y89A 4QEHA 5CAKA 2YA0A 4GZ7A 4CD5A 1S5TA 2VFHA 4DJDC 2C1HA 1ONXA 1OK6A 3IVUA 1H1ZA 3CL6A 1IGWA 4Z2LA 2IKHA 2X7VA 3BV7A 5CBBA 5FJTA 1GG0A 1TKKA 3LOTA 4NXKA 2VO5A 2CZDA 2PDUA 2VXNA 3DYMA 4H9MA 3S0CA 1G4EA 2X30A 1SO6A 5GNYA 3ZT7A 2ACSA 1XIHA 5JQ9A 1P0EA 4MSSA 4NU7A 1F3EA 3B9NA 2G97A 1CLXA 5D32A 2J8FA 1SFTA 4DWSD 3OW1A 1KV8A 3ABSA 2NUWA 3AIVA 2YA2A 1S2AA 4HYWA 4MGGA 5AC6A 4ZXLA 3JUGA 2V5DA 1N8IA 2C0AA 3HO8A 3PR2A 2NVDA 2PTYA 3JU2A 1CT5A 3CEUA 3OQEA 1P0DA 1TE1A 3FAXA 3SI9A 2XJ7A 4GWEA 1MW0A 1J0YA 4GYPA 1ECEA 4J3UA 2ISDA 1XH2A 3FS2A 3K2GA 2PTDA 4GX8A 4IX0A 2WWCA 1JEZA 3MI3A 2E5DA 1DYSA 3GHSA 3WK0A 3PBGA 8RUCA 3O16A 3PWAA 4KPLA 1KM4A 3T0CA 5FKYA 2E09A 3ZR6A 3OA5A 4LS0A 1LBFA 3EWDA 1HUVA 3VDAA 4ZL1A 2G5WA 2NX1A 3EPOA 3VA8A 3SCWA 1OFOA 1KM0A 3BK0A 3T55A 2FPVA 2PDCA 3G8EA 1IXQA 3B4YA 3PZNA 2JEQA 5CPTA 3CPUA 2GDUA 2JGQA 4XD6A 1AVAA 4NNAA 3NA8A 3VGHA 1HNYA 1AZ1A 1H5YA 4X3ZA 5FESA 3ARTA 5BW6A 2ZUSA 3R43A 4GINA 1W5PA 4PRRA 5FL0A 1LRNA 3LX9A 3V5CA 3GHRA 3N2CA 1KW1A 4C7DA 3T7VA 3V7PA 4ROQA 2V8ZA 2ZUNA 4LGXA 4FZIA 1P1XA 1O5KA 5I6SA 1EO7A 3S8HA 4YLWA 3AYVA 4H9UA 3LHWA 4A3HA 3QYSA 3BJFA 3BLEA 3CYJA 1LUCA 1OJXA 3UWYA 3WJWA 1NEYA 1MZRA 1LBLA 2VGIA 1US3A 2G4FA 1RA0A 1Q6CA 1J0HA 3TOPA 4CQBA 2NZLA 8XIAA 2W66A 4HTYA 1F6PA 2PEVA 4PH6A 1FWHC 4UWMA 1EBGA 2E5BA 2GZXA 3R12A 3B40A 2VZOA 2GJRA 4Q22A 3T2QA 1W5QA 5LXEA 2X0SA 5LIUX 1DL3A 1PYFA 4R27A 1G01A 3F1QA 3T2PA 3V0SA 2A2IA 3N3TA 1AH4A 2YCIX 1Z44A 1V0KA 1Q8JA 4FR1A 3BSHA 3UJ2A 1XPGA 4WUIA 5HNTA 2GVYA 2UBPC 3E02A 2B7OA 5CPLA 1NVMA 3B9EA 3M0ZA 3IEBA 4X2PA 3H4XA 4V33A 1FWAC 2YDQA 5BYWA 2YB1A 4UR7A 4KIEA 4P61A 1GOOA 4MFEA 3MP4A 2ZFAA 3EWWA 2FPYA 5B7ZA 3PHAA 2J8TA 1XIIA 5IXEA 2A3AA 4A3QA 3CASA 1XIMA 5B7YA 5I0DA 2V3GA 3LBOA 4J40A 3H2MA 3GBEA 3KZPA 5DQPA 3EXTA 4GC4A 1TB3A 5E09A 4HZ7A 1R86A 2H6RA 3CB3A 2BY1A 4O1CA 5F2GA 3ITTA 4ML4A 1UR9A 3CIXA 3HIJA 1MNZA 5KINA 3W6MA 4N0RA 1E1CB 4NAEB 3PPFA 3WQFA 1CCWB 5E0KA 3GIQA 5I5RA 3CHFA 3IUHA 1VIWA 1ME9A 5JUVA 4W88A 2ZE0A 1UA3A 5C54A 1BG9A 4CN1A 4PTVA 3WNKA 4C5YA 3P2VA 1HQTA 4G7EA 3ANUA 5EKYA 3S1UA 4MAVA 2PZNA 4RNHA 3W71A 4JIHA 2X1TA 4O16A 1EXPA 3S5ZA 3LLDA 1CXIA 3UJFA 4JZ5A 5C9RA 2NSXA 1E72M 4QFUA 1OYCA 3W37A 3SECA 3UPMA 2OYLA 4D1IA 3HG2A 3AIUA 2BY3A 1L6SA 3RX2A 1JD7A 2WQDA 4OUEA 2XIMA 2VGBA 2WHJA 3DX5A 1D2KA 1JFXA 3QEZA 2YL5A 3M0JA 2Z1SA 4PMJA 5AHNA 1TTQA 3TTQA 2C8NA 1BWVA 1XF0A 5EMKA 3H4GA 5HANA 4OBRA 5PTDA 1UW9A 2NVCA 3FJLA 4PGLA 1Z69A 2A3EA 5DCDA 3URQA 3SRHA 5HNNA 2FFIA 3TVAA 2HDJA 3FGCA 2VCBA 1XRTA 3BAKA 1F76A 1YDOA 1XYLA 3R8HA 5CGQA 4D6CA 1B9ZA 3QN3A 1O12A 3MUCA 5BXRA 5CPOA 2Z24A 1YPXA 1P43A 5EYWA 4C90A 1GYMA 2ZBTA 4HQVA 4NUWA 4KRTA 2VGGA 1PIIA 2QF7A 1PL9A 4HU4A 2GVLA 2GVGA 4DBDA 1GT8A 2PC4A 4ROPA 4GFIA 4XTDA 2WCSA 4IL0A 5EU9A 4WSHA 3ABRA 2A21A 5FF2A 2WSQA 3B0VC 4ATWA 4ZEPA 3AIEA 2PDWA 2OODA 3ZJ8A 1QPOA 3V75A 2WSYA 5D30A 1J10A 2QIIA 4V15A 1X7FA 3L9CA 2QJHA 1YEYA 2HBVA 4ZO7A 1DJHA 2QMJA 4NQ1A 5ECUA 3SUUA 3UG4A 4B4HA 2I9EA 1CPUA 1OG0A 4PUUA 6PTDA 2JF6A 3USBA 1JR1A 1TJ1A 1C9DA 3CM4A 2X1UA 3OLIA 1ITUA 5K2ZA 2ZX9A 1GKRA 3QKEA 5HMEA 1OBAA 2ZC1A 3VVGA 3CBWA 2Z2BA 2Y6ZA 1IYXA 1F9CA 2FZ9A 3A64A 4YYFA 1J2BA 3SQMA 1J0KA 3B97A 3S42A 4U5IA 1XW8A 2A3LA 5LA1A 1E5JA 5HMDA 2P3EA 1AW1A 1XKJA 3NAVA 3ZXWA 5BMWA 3LSBA 1TV2A 4JCMA 2YFOA 1W2PA 4O8AA 3RPMA 4XZWA 1BYCA 1QO2A 3UG3A 3S9ZA 1XDLA 1R38A 3NXLA 3ARVA 3PWIA 4N4PA 3MB9A 4IUOA 4HSNA 1ML1A 4XZNX 4OV4A 5K9CA 1FA2A 1L8NA 1R6WA 5EMUA 1TZZA 4JTRA 3WLNA 1JGMA 3PBYA 1GZJA 5D8WA 4UBPC 4L5ZA 5HWNA 2J66A 4D6JA 4IIFA 1EJVC 3IIXA 3MU7A 4L80A 3E96A 3G1VA 4P5UA 3CUIA 4GY0A 1S3HA 4A3RA 1K8YA 1HG3A 3N34A 2AAMA 1BVWA 3L5MA 4ACZB 1MW3A 5AN7A 2PGFA 2VDHA 1TPDA 3M7WA 4UR8A 1NOFA 4RZ5A 1FFRA 3P74A 4N7QA 4O12A 2EXOA 3AXXA 4CNUA 2BNJA 2BMBA 1G6CA 3VPLA 4AHQA 4DPPA 1TV8A 5AYYA 4O1AA 3PSWA 1KFJA 1M41A 1OFBA 3N14A 3TN4A 3F2BA 3UVIA 1UASA 3GXFA 3WUFA 4FXJA 4QCEA 3W27A 1XLDA 3CT2A 1AQFA 3IGSA 3U2CA 1ZJBA 3ZVHA 2XSAA 3K46A 1FDZA 5HQMA 3P93A 1V0MA 5FF3A 3O3RA 1U22A 4Q3MA 4CU7A 4BKNA 3KW3A 3KZSA 1CB2A 2ZC8A 4O18A 3W7NA 2JBMA 4XK2A 2OEJA 3MCOA 1AL8A 4GO8A 4AB4A 4OFCA 3NQ6A 5EMMA 2O55A 1F5ZA 1X38A 1KXTA 1OCJA 3CTLA 3T08A 2VEIA 4HP5A 4XAGA 3SEPA 1QXLA 1Z42A 3N73A 2WVUA 4O11A 4Y9MA 2X1SA 3LENA 3BVJA 1CTNA 3A9IA 3MYPA 4RE3A 4HIBA 2I5QA 3FSTA 1TVNA 4FLQA 1KGUA 5D2YA 3I68A 3THAA 2JKAA 4A2RA 4ZE4A 4AZGA 1HKVA 4TTGA 1RCQA 1TFVA 1ZBCA 4PA8A 1HJVA 4K1GA 3R0KA 1WNOA 3QTPA 1GOQA 2YZ5A 3M0LA 4I9AA 1ZUAX 3QY6A 5MHBA 1UCWA 2UWFA 3LHTA 3AXHA 2DIJA 4WDXA 5D38A 5DMYA 1HL8A 3QR0A 3W4RA 1LYXA 3FW6A 3V3WA 3CUJA 4J3ZA 1SFJA 3CIVA 3PG8A 4C6MA 4AC1X 4HPHA 3WELA 1VFOA 2E8ZA 1DWFM 4ZB5A 4Q4MA 4JTTA 2FHCA 1DWIM 4E4PA 1YADA 1EDTA 3WD2A 2VNCA 2GK1B 1R9YA 4Z2HA 3G1SA 4DQWA 4WXZA 1GQKA 4JN8A 1XBZA 3H2OA 3WFAA 3ES7A 4GJ1A 2WANA 5EFFA 3NDZA 3CUXA 4AD0A 3AZRA 2PDGA 4W87A 2VUNA 4H3DA 1FOBA 5A8MA 4GX9A 1J0JA 4UQAA 4NXSA 4Q8UA 4GKTA 3EWZA 5REQA 1AFSA 3PP7A 2QNEA 3BQ5A 3I10A 1C29A 4DF1A 3C5QA 4IFOA 3THCA 4L65A 3N19B 2ZCGA 3O0FA 2ZOXA 3W1XA 4QJ4B 1RPKA 4IP5A 3AZSA 2XZ9A 4F0HA 2DEPA 2B7QA 2WOQA 1JGIA 1JAEA 4I90A 3T0BA 5I2UA 4LBRA 4UMAA 3T09A 3IGHX 3VU2A 4KCVA 3GAYA 4GIAA 2VM8A 3VNLA 4DBSA 1E56A 1JPKA 1TX2A 2PP3A 5CG0A 1ITCA 4DELA 4LF1A 5C70A 1JZ8A 4GOAA 1GUVA 4HKPA 2BVYA 1HKMA 3EXSA 2PWHA 3R8GA 3W73A 1I4NA 3GQYA 2D1ZA 1U1JA 3W1RA 4D1JA 1XV8A 5BMXA 4G9PA 1M04A 1YBQA 2KZHA 4J28A 2QEZA 3VOGA 3VXGA 1CW2A 1JL8A 4RV3A 1XSIA 4QJ1A 4X9SA 3SURA 3G8RA 3HN3A 4FOJA 2NV1A 1O68A 4UTKA 1C8XA 3KOWA 4ZQRA 2E4TA 3II1A 3Q2DA 4HTBA 4RDYA 3BDKA 1V02A 1PV8A 4BK9A 3W0KA 3HTWA 1ECQA 1MFUA 3WF2A 4PUWA 3SN0A 3E3HA 3V18A 1FWRA 4JQ2A 2VELA 1AD1A 4YTSA 2A1YA 4WX2A 3G1XA 3W22A 2H8ZA 4R33A 1RK5A 2E0PA 3PZTA 4UOQA 4BS0A 2VEPA 4HU0A 4Z2JA 4IG2A 2BHYA 5HR7A 1SQ7A 4IQDA 4D8ZA 3F03K 3U4FA 5KZEA 4H8VA 5A8GA 4H8HA 1NWRA 2O9PA 3MVTA 3C3NA 3K1GA 4QP0A 3EA2A 2YZRA 2C13A 3RLGA 4JTDA 1E15A 4QSHA 3KHDA 4PTDA 3OTRA 4Z2KA 5HNUA 4Y8FA 3SCTA 1PJ9A 3OIXA 4H7VA 3BANA 5FJIA 3RLUA 2ESCA 4JQ4A 2NX3A 3XINA 3TW9A 3EZ4A 1S46A 1H2JA 3GKFA 3GR7A 3L4TA 1G5AA 7A3HA 2FYMA 1FP9A 1PWLA 4QG6A 1GTHA 2OXNA 2VOMA 4TOQA 5CEWA 2XYLA 3IVTA 1LORA 3B8SA 4PFHA 1SZRA 1W3KA 3W7MA 1GYLA 2FVKA 1EYEA 4DLFA 2R94A 4JNMA 2XSXA 4PMOA 3W2JA 1JPMA 4HGXA 5CBJA 4HU3A 4PZVA 4QM1A 1VD6A 3LGEA 2Y1HA 3UETA 2REQA 3MCMA 1ZU8A 2QS8A 3HURA 4WGHA 1DE5A 3BGGA 3LHZA 1G67A 2J7BA 3M5YA 4Q8PA 1E3ZA 1XYMA 3LTPA 4AD5A 1XLIA 3SCSA 3RLVA 2VUYA 4U2YA 4A8NA 1A4MA 3QY8A 5K4XA 4MJMA 5L6UA 3CL7A 1U5JA 1KRCC 4PCPA 1W1IE 1MZHA 4EXBA 2QCDB 3L4UA 3M16A 1E1FA 1H60A 1L2QA 3S6DA 3L4VA 3QMTA 5I3FA 1HJSA 3PZ9A 2QUUA 2XTKA 2VC5A 2Z2UA 1JD9A 3N3MA 4XSMA 2X2GA 1OF6A 1F3TA 4M6UA 3ZS4A 3LBCA 3I6EA 3D3FA 2E1WA 2CW6A 3WH8A 1QATA 4LUTA 3T4WA 1WUFA 2HE5A 4OZOA 4ZB0A 4HMNA 2RJHA 2PWGA 4H6RA 1HO1A 4DNHA 1JPDX 2R91A 5CC3A 3CIWA 3OVPA 2XH2A 1FWIC 3RJXA 3WLMA 1O1ZA 3AMCA 3ELFA 4Y9NA 3HQNA 1PTGA 3BZGA 2V5KA 4LYRA 5HQEA 1MQQA 3G1FA 5E5CA 1R3SA 4P7QA 4PB4A 5C9ZA 3O63A 1S1RA 4MWAE 4E2DA 1IEVA 2NT0A 4AXNA 1ADSA 2QLYA 2XWEA 1XKYA 4KH2A 2CU0A 1P7TA 3KDNA 3PFRA 1K7FA 1HT6A 1EJRC 4XZBA 1XYCA 3B3DA 5LNSA 2PDIA 3HG5A 1MI3A 1J79A 1JCLA 4GI9A 1R9XA 2PCEA 5G4EA 1Q6DA 4C1NA 1QOPA 1JDCA 1PEZA 5BRBA 2WHKA 2EPNA 4LRTA 4NAFB 1QW8A 1WZMA 1QK0A 2VVNA 2FZBA 4CN6A 5IHSA 2CLLA 2JEPA 3TQVA 1P6WA 3RU8X 4PUDA 3UNDA 3VFLA 2CLKA 5DBTA 1IT0A 2QCNA 2G3JA 4WOZA 4HNUA 2CHOA 2TODA 3CXOA 5F2IA 2D24A 3UGVA 1RV8A 3SR7A 1BTCA 1I2QA 1JNEA 4GE8A 3QOKA 2WKGA 3L68A 4NI3A 3P6LA 3VCCA 2VDGA 1V5XA 1XYAA 4AQLA 2G8ZA 4IGNA 4ML9A 3E2QA 3ME3A 4RKAA 5FJUA 2J74A 5HUOA 1NF7A 4IPLA 4JFUA 2P0IA 5CPQA 4A22A 3NEHA 3WN6A 4B92A 2DSUA 2V2HA 1MYRA 1XC6A 1ZENA 1J9YA 3UZYA 3NZGA 3SY5A 4A8RA 1W8SA 4AUBA 2YL6A 1T5AA 3VIMA 3BZJA 1TIWA 1IXOA 5AECA 4F0LA 2ZX5A 4XBJA 3QV6A 2FTWA 2Z29A 3AIWA 3AMGA 1DJZA 4D2JA 3DKJA 4RE4A 3WQDA 1Y7VA 3QGKC 1XLHA 1ZJAA 4JEQA 1AODA 1BYBA 5GJMA 5ABFA 4PRTA 3TNOA 4AXKA 4CCDA 4O52A 2KAUC 4HPJA 3NSXA 8XIMA 3SSZA 4ZE5A 3O06A 1RUSA 2D2GA 4XISA 4K3ZA 3SRKA 3MP3A 3TW6A 3CNYA 2IUZA 4GBUA 4S3GA 3PZUA 2PDBA 1V79A 1GOKA 7REQB 3W2NA 1DXFA 2VRJA 5DLCA 1XCWA 2YCKX 4V28A 4Y9PA 2XVKA 1J8VA 1EWEA 1X7IA 5E0CA 1PZ3A 3FOKA 2B81A 2WMIB 2I9UA 1G7VA 4DUXA 4S3FA 3W6YA 3TJXA 3HB9A 4NVTA 4DB7A 4GRSA 4AISA 4C6JA 1Q2SA 4JQ3A 2Y7FA 3QLLA 4JY9A 3LERA 4DZHA 4FOUA 3VKAA 3P5ZA 4RZBA 3RIKA 4H7CA 2OKOA 3AAMA 1MUCA 4XO6A 4FP1A 3HGJA 2HMCA 5HULA 1FDYA 4KESA 4CNSA 3R0UA 5M2FX 3KBSA 3FDGA 4ZENA 2YBUA 5AYXA 1RD6A 3VZXA 3U57A 3T44A 5JBDA 1E6RA 4HSOA 4ZB2A 2UY2A 4ZSUA 3ZJ7A 1LT8A 4FNQA 4B5NA 1BPLB 2OGJA 1GPFA 4HMDA 1KQYA 1W3JA 3C0SA 3TX9A 5BWAA 1S5VA 4KFNA 3DOPA 2R1PA 4B3ZA 2DZWA 4O10A 1BF6A 2J77A 5FA5A 3FYYA 2OG9A 1C9WA 4EX4A 1TWSA 5I79A 2F6XA 1BFNA 3DZ1A 3M0IA 2FZMA 4GI8A 2CBJA 1J01A 1TMLA 4UR9A 3GVGA 2HK0A 1BG4A 1MEWA 2WPBA 4QR6A 1UUMA 2ZTJA 1RVGA 1F3WA 4RXGA 3VIKA 2D2HA 1KM3A 2FPTA 1OEPA 2I14A 4PMRA 4R3UA 2DGAA 4PFMA 3W25A 4Z42C 3NQAA 3IJLA 5EB8A 3TEVA 1FRBA 3HGSA 4KFPA 3DI1A 3AYTA 3PUGA 1EOKA 4H04A 1H0GA 4CD8A 2PTXA 3CB8A 3ZM8A 2BGQA 1B30A 1TCMA 1FH8A 2J27A 4ZXOA 3RMEA 3UCCA 2OOGA 5G4WA 1G4TA 1QRQA 4F0KA 4YNGA 3UZWA 1X98A 5FEXA 3D0CA 3MYOA 3NOEA 2BS9A 2VEFA 2R1KA 2OZ8A 4QNWA 1HZYA 5IM51 2CETA 4H8UA 2X0YA 3P60A 4WF7A 2AKMA 3TR2A 1TRIA 1ZP3A 4JS3A 1NDVA 4DZAA 3PAJA 5FJOA 1VFUA 3UXIA 4IIEA 1B57A 3A3XA 4Q4RA 3URAA 2YCJA 3WEZA 5HJYA 5FSEC 3MCNA 1IWAA 1H11A 4XSLA 4CD6A 1BF2A 3TYDA 1WO2A 5GQBA 2NQ9A 2GJNA 3GTNA 2O9OA 2DSVA 3IIVA 1B9BA 5A2CA 2VD8A 3UBPC 4ATLA 3NL3A 2V67A 1MWOA 2GOUA 3GXIA 2OSXA 3GB6A 3WH5A 3R2GA 1IEWA 3REQA 3ZJ6A 1SO4A 3APTA 4HHPA 3ZLFA 2A4AA 5FOOA 1XWYA 2ZKMX 5AKQA 1KTBA 2IKGA 3WZ0E 4BZYA 1WDRA 3FNDA 3IANA 1S2VA 3AYSA 2QW5A 3BCFA 3GXPA 3CGTA 2FQIA 4HCLA 2V68A 3PWGA 2W62A 1YXYA 5EBUA 1VLWA 3TROA 3CAVA 1E1EA 1UPMB 3RRXA 1CDGA 4FX6M 3GG1A 4C60A 2J9YA 3VKJA 1H7PA 3TQPA 3QW3A 3E38A 1ZAIA 1Q3NA 3ZFHA 2J79A 2JKPA 2WV8A 3L4YA 4HJWA 4AX6A 4I6VA 1F8IA 3MMTA 4PL2A 4JHOA 4F2UA 3HGOA 2EO7A 5AYIA 3W1QA 4Y90A 3WNPA 5E6YA 2A7NA 3AHYA 4GYFA 2V6AA 3B0UX 4MB1A 2ZUMA 2H3BA 1FWTA 5D2TA 1E73M 4ICNA 5CZ0A 2BTMA 1TPEA 3ZWSA 4MKVA 4TVDA 2ON3A 4ICMA 4ZVJA 1TYGA 3LV5A 3RPDA 4AF0B 4C6LA 4ORMA 4EE9A 3BICA 3G1AA 4JCLA 1XFBA 1I2RA 4HNOA 1XYZA 4EWND 1CI1A 4GMEA 4M6PA 2PA6A 4D6DA 4XZIA 3CYVA 4AEEA 4JKLA 4NJHA 2BBFA 4FPSA 1QPRA 4XVDA 3N18A 2DUZA 8A3HA 4Q8WA 3TTOA 1EOMA 5H8MA 1OX5A 3W7CA 2CLMA 3T2OA 1RCXB 3F5LA 3CAQA 4WHBA 1Y5WA 1UZHA 3ES8A 3M0KA 4QHRA 1K9FA 5IHRA 4RCXA 4JICA 4JHZA 4Q4QA 2HXTA 1PS9A 2FGBA 1CBGA 7TAAA 2QDEA 4FNSA 3V4BA 3K5XA 3NZQA 2YXGA 3MUXA 5CCZA 4DZ5A 3NQFA 5G1YA 5E70A 1BYAA 2TYSA 1HJUA 4RW3A 4H8NA 2PDLA 2G96A 3LM3A 2QUVA 2HS8A 2VKZG 1H7OA 1V3KA 3MKCA 3ITLA 5I06A 3CS2A 3A6OA 2BASA 4LVBA 2PBOA 3QZ6A 4MWAD 5DY3A 1PPIA 2I16A 2VOTA 5DANA 1K9DA 2PU1A 1DBTA 1LL7A 4GVGA 3LNMA 3MO7A 1GCYA 1R2TA 4KERA 4MZ1A 1EDGA 4QE4A 1OIMA 2ALRA 2CLOA 4OOZA 2O92A 1AW2A 5DBUA 1P6CA 2BVWA 1W1VA 1AJ0A 2ZDSA 4HCHA 3V35A 2WM0A 4K8HA 3UZ5A 4C6NA 5AZ1A 3U5YA 3UWUA 2ZRYA 3O1NA 2WLZA 1VJSA 4DJDD 3EWYA 1YTEA 2WKJA 1RHCA 1WYIA 1YYAA 4Q8MA 2ONEA 3LD5A 3RM4A 4JTHA 1TR1A 3LPPA 1PDZA 2XINA 1HTIA 5D2XA 2PLJA 1H62A 1NU5A 5IOBA 5H6HA 1SMAA 1KR0A 1UWIA 2Z7KA 5FJRA 4E2BA 1BRLB 3DFHA 1PX3A 2VEGA 1HIZA 4J2PA 1HN1A 2Q71A 3OODA 3ECQA 3MW7A 4ZA0A 3TAKA 1IEIA 1G0CA 2XISA 4WY0A 5MKGB 4FA3A 2WSPA 1SGJA 2EKCA 3EDDA 3L7RA 3LLFA 3WMSA 1IZJA 1D7KA 4IGSA 3ABQA 3H8AA 2AQVA 1EB3A 3CV1A 3OQ8A 2QAPA 2ZZ6A 1A5LC 1THFD 3TR9A 5KZ6A 1PKLA 4GFSA 5D2VA 1U83A 2FDSA 1U1UA 5A94A 2JIEA 3U6WA 1XISA 1VHNA 2QHAA 3VIPA 2CZEA 3NWRA 5A2AA 4YHGA 1DVJA 3TLLA 1B3VA 4CUCA 3F4VA 4MY9A 1V3HA 1E6NA 4E8DA 2ZRWA 3GR8A 2BV9A 1O5RA 3LHUA 3DESA 2JF7A 4N4QA 4E3VA 3AQUA 3N9SA 3SJNA 4LCQA 3N6JA 2NQJA 4GQBA 3LHYA 3VZZA 1RALA 3M5XA 2NUXA 1OY0A 4BI7A 5D2WA 3KAOA 3SUWA 2NWRA 4X22A 3C61A 1N8WA 4LT9A 1WP6A 4AWUA 1WKEA 3SY1A 2CC0A 3TCEA 1JYVA 1VJIA 2IKIA 1KB3A 1OFPA 3IJ6A 3IJDA 1R2RA 4GQRA 3B8DA 1V4YA 3LTYA 3FVDA 3MBFA 1IXNA 3DENA 3TU9A 4H9TA 3VE7A 2GQ8A 1W0MA 4JIRA 3PC0A 5CLTA 2GGEA 4LCRA 3DN5A 3EB4A 4MLRA 1FHUA 1V6YA 3AALA 1V6UA 2JIWA 5E93A 3CV7A 1JZ2A 4HYRA 3ABOA 1OT2A 1KFWA 3WQWA 1Q65A 2VR4A 3I7QA 3T40A 3ATYA 1FCBA 3C2YA 1GKQA 4PB5A 4Q8TA 2GUUA 3BV4A 1GW1A 3N6QA 3V5FA 1QHOA 1OZMA 2BOEX 1E0WA 3IVSA 1LRTA 1WZKA 1MUMA 4A05A 1W9PA 7PTDA 3S2NA 1FCVA 1JI2A 3I4KA 1KTNA 3DH7A 3M4HA 1QW9A 4AY1A 5XINA 4PTMA 3U4AA 4IFKB 4PSRA 1OC5A 5D33A 2XM1A 1PB0A 4MZ8A 4XIMA 4UTMA 4Q8VA 4LV9A 1GQIA 3URNA 1PTDA 3F4CA 4XVEA 2FTYA 4P8VA 3LBMA 3IARA 1CXHA 4AW7A 3DHUA 2L5HA 2YXXA 2BVTA 3PZVA 4PMUA 2ALDA 4B5TA 3DC0A 2G3NA 4LB4A 4S3JA 2V2CA 3OPSA 2GJPA 3QTGA 1J5SA 3LGDA 2XSBA 3HF3A 3UY7A 4V2XA 3KCOA 1TMHA 2WAGA 1MUWA 3GY1A 3DI0A 2J47A 4JN6A 2RDUA 3WCZA 5CXPA 1PXGA 1QI5A 5H8PA 4AZCB 2XFRA 3W28A 2XGZA 3NYZA 4F4RA 1BSIA 3SCVA 1XC4A 3GIPA 2W79A 1ISWA 3FXYA 3W7OA 4JFVA 2HEJA 3MBDA 3MJMA 3THDA 1Q6RA 3IV8A 3GTIA 2QCDA 3OG3A 2DT1A 3N11A