4DF0A

Crystal structure of orotidine 5'-monophosphate decarboxylase from thermoproteus neutrophilus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
199
structure length
199
Chain Sequence
NLPLVVALDTEVLKAIDVAKRLKGAVAGFKVGWDLIFEGGISIVGEIARYGNVIVDLKIADVPHVASRVVEKLVNRGACCVIVHGFLHPSLPRGQHVYVLVKMTAPTIYDEMWEKLLNSVQDVRGFVLPGNQPEVVAQARKRIGCSYRIISPGIGPQGGRPGAAIEAGADFEIVGRYVLEDPARISQWAQYRPTCFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine 5'-phosphate decarboxylase
publication title Crystal structure of orotidine 5'-monophosphate decarboxylase from Thermoproteus neutrophilus
rcsb
source organism Thermoproteus neutrophilus
molecule tags Lyase
total genus 65
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4df0A00
1Y0EA 4YXGA 1O5KA 3NQ2A 5AC8A 2YW3A 3PUOA 4IQLA 1HL2A 4O1DA 2FB2A 3W1PA 2GVGA 3PBYA 5D04C 3NG3A 3USBA 2TSYA 2ALDA 1VCGA 1B4KA 2G95A 1HFBA 1FXPA 2OCZA 1EP2A 3W1LA 5ABTA 3M43A 1TTJA 2X1TA 1PS9A 2B0MA 3C56A 2QUTA 4Q32A 2WO5A 1ZNNA 3HOJA 1TTPA 2Y63A 3NQCA 2ZCGA 1PE1A 2WSQA 3LLFA 3STGA 1YXYA 5DXXA 2CFFA 4UFLA 5KZDA 4DELA 4NXSA 3GAYA 1KFLA 1D3GA 4RZ5A 1XDLA 1QOQA 1GVQA 3THAA 4K37A 2Y6ZA 3QC3A 3SJ3A 1F7BA 4FB7A 3W7OA 4BWLA 4OU1A 1M5WA 3WJXA 2R8WA 2J9YA 3IRDA 1RR2A 4G1KA 4C1LA 3C6CA 3W2KA 5K2ZA 3PVFA 1YXDA 4JY8A 4DPPA 1QFEA 3W07A 1Q6OA 3IIPA 4LVFA 1TPH1 5I3KA 4LWWA 2E6FA 4FNPA 1TTIA 3QFEA 4XUGA 2YDAA 5HMSA 4AMAA 1SSDA 3CQ0A 1KTBA 1NEYA 5AHNA 5E93A 1XDMA 4N4PA 4TR9A 3TR2A 3DFNA 5D2VA 3U2OA 3G1FA 1TPDA 3KXQA 3MW7A 4EVZA 4O19A 1OK4A 5CZJA 5G2HA 4GXMA 4K39A 1D3HA 3PB0A 3EXRA 1LTDA 3C2OA 4Z0SA 1W3TA 5HWNA 1H7WA 5DCDA 3W7NA 4LUIA 4UNKA 3IGUA 3TAOA 3B0UX 1W1ZA 4ADTA 3MYOA 4ZQOA 3QMSA 3FA5A 5HNRA 2QDHA 3LV6A 1T99A 3NXFA 3W7KA 1QPRA 5CKSA 2G96A 1H50A 3JRKA 3IVTA 3H54A 3UXAA 4IGHA 2ZA1A 2QUVA 3EWUA 2A6LA 3NQ8A 4MFEA 5BMWA 3KVJA 4XQ6A 2OZ0A 2HSAA 4M6VA 3F03K 3G1DA 4UR8A 3UNDA 4LU0A 1W3NA 2V5BA 3CWOX 3R5EA 4EF9A 2A7PA 3SGUA 2W0UA 2WPBA 4Y9AA 4JTTA 4O1BA 5A8GA 4DO5A 1G4TA 4BFAA 3B8DA 2WJZA 3W23A 1TPVA 3ATYA 3W3OA 3UQNA 2G97A 3GAKA 5BMXA 3TV8A 1TJPA 2A7RA 1GVSA 3N3MA 3GK0A 1LP6A 1J2WA 1R2RA 4IXXA 4JX6A 5K4ZA 1OG0A 4JICA 1S5TA 5G4EA 2QUUA 1G67A 1W8SA 1H62A 1FWTA 3M47A 1KM5A 1JCMP 2FIQA 5LGZA 2V5LA 4UTUA 3TH6A 1YYAA 2NX9A 1VHNA 3O6DA 1LLZA 3M5XA 3OIXA 4A3UA 5EY5A 4GC4A 1WDWA 3LLDA 3NQDA 4O10A 4OV4A 2A5HA 1MEIA 4UMCA 5T26A 1OX5A 3IIOA 3I68A 3W74A 3A5VA 5F4WA 1RD5A 1TV5A 1UCWA 1EIXA 3N9SA 3PG9A 3ATZA 4LRTA 3ZS4A 1TCDA 2E5BA 2KZHA 3TSBA 1LBFA 1FCUA 3LOTA 1THFD 1EWDA 4AF0A 5D09A 3W7RA 5AB3A 3DU0A 5KITA 1O5XA 2ZA2A 3M41A 1DL3A 2X1UA 4HSOA 4Z1CA 1VYSX 1VCFA 2ZZ1A 1SPQA 2VC6A 3UZ5A 5FEPA 2EHHA 3FYOA 2E6DA 2XN2A 3PF3A 3B0PA 2E1DA 3GDLA 2A2IA 1GEQA 1K8XA 3G1HA 2V0TA 2QR6A 3CTLA 1VS1A 4K6AA 3EEGA 1SUXA 4NXKA 1IGSA 4RLIA 1L6SA 2C15A 3H55A 3LCGA 1UBSA 2JGQA 4MVAA 3TXZA 3S5OA 3UY8A 1H61A 2C19A 1FWSA 1Q6RA 1GVOA 1B3OA 1FUYA 3GDRA 3LI0A 3FKRA 5HWMA 3B0VC 1XBXA 4O11A 2RDUA 2ZZ3A 1C8VA 1W5PA 4E38A 2V30A 1O60A 1OYBA 2V8ZA 5LHEA 1G4PA 4O8RA 5IBXA 4N6EA 1G4EA 3O16A 5G4WA 3L0GA 1OFQA 3TNOA 4IMDA 2CLFA 4RR4A 3EX1A 2V9DA 4GJ1A 5L9FA 3R2GA 3LRMA 3MP5A 1JQXA 2DU2A 2BZNA 1FWNA 4LC8A 3W86A 1LDCA 5CPOA 5GVJA 4RXGA 3LBCA 4HNNA 4RKAA 1H7PA 3DFQA 1RQBA 2QJIA 4H4IA 5C54A 3DXIA 3A22A 3CIXA 1D9EA 2HMCA 1OVDA 1TIMA 4GE8A 2AQWA 4WZHA 1R46A 3DBPA 5KSWA 1ICPA 4UTTA 5DY3A 3W1MA 4NU7A 3G0SA 4Y96A 4BI6A 1N55A 3ZR4A 2Y7DA 5U7SA 3FYPA 3W7QA 4GUGA 2OT0A 2E77A 1R30A 1ZAJA 4JYDA 5J5RA 1YLVA 2NX1A 2A6NA 1X1ZA 3TUUA 2OJPA 4HPXA 3BG9A 1L2UA 1G6CA 3G1AA 2NZLA 3T40A 3ELFA 4Y6GA 1W31A 3TQ0A 3ANYA 1KV5A 3W22A 3EWWA 4X9SA 1YPIA 1XUUA 3GR8A 5FESA 5EYWA 3L65A 2GJLA 4OQVA 3ABQA 3LTSA 5BW6A 1WOAA 3KVMA 3PSWA 1RQEA 2DZTA 1U5JA 3FKKA 2OMAA 2VFEA 4LC6A 5K7JA 1S5WA 2E5CA 3S9YA 3PS7A 4R7JA 4OBTA 5U4NA 2PRLA 3CEUA 2RH9A 2X30A 3GR7A 4GUJA 4ZQMA 1FY6A 5FF4A 4YL2A 4ZZ9A 2YYUA 1PCKA 1XL9A 4FX7A 3P8JA 5AHIA 3W7HA 4N9BA 2QJHA 5SWUA 3W1QA 3THQA 1UUOA 4MY9A 4IXHA 3UWWA 4AWTA 4PC8A 1S5VA 4Z1BA 5G1TA 3QSRA 3GNNA 1SO4A 5KZEA 3BG5A 4AAJA 3N19B 4A2SA 4UTWA 3E49A 3SIZA 3F1QA 4M6QA 1BEUA 1TQJA 2TPSA 1GQNA 5DBUA 1YTKA 2A1YA 3NQFA 2QAFA 3RK8A 1UUMA 3W1XA 2X1RA 1OFEA 5HULA 1OX6A 4ORIA 3B03A 3UWUA 2VEPA 7TIMA 1I2RA 1SQ7A 3I7SA 4QM1A 3MWAA 3FOKA 4JYEA 3R89A 4JTHA 5AHMA 5F1UA 4JS3A 4EOUA 4ADUA 1TRIA 3NPWA 1AW5A 4LT9A 3A21A 4UFKA 4UCGA 3PBVA 3C3NA 1NFBA 5K4XA 3PC0A 3W2NA 6ALDA 2CLOA 4H6KA 4YCOA 1GOXA 4CCDA 4NVTA 1ZCOA 4MPQA 2AGKA 3QH2A 4WD0A 4HT3A 4BI5A 1WBJA 4UXDA 2FJKA 3GVGA 4NJJA 5LHFA 2CLKA 1J5TA 1TPC1 2VFHA 3DKJA 3Q37A 2GQ9A 1PHQA 2GVLA 1RPXA 4IPIA 4UTJA 1KM0A 5BOOA 5EBUA 4O0KA 1AMKA 3ABOA 3BLFA 1ME9A 3TW7A 1I2QA 1UB3A 3MJYA 1OYCA 3LXAA 1ICQA 5EKYA 1JR1A 1R2SA 2V81A 3M1ZA 3YPIA 1OF6A 1W0MA 2YPIA 1RVGA 4MIMA 4P61A 1TQXA 1WBHA 4JGDA 1QWGA 1K3UA 1JCLA 2ZQ0A 3EX6A 2NV1A 1A53A 2WNQA 3N2MA 3UWVA 1JRCA 3O15A 4MYXA 2OX1A 2YFNA 3OVRA 3UWQA 4GFSA 1LM1A 3Q58A 3TMQA 1G4SA 2FPVA 2I9EA 1TPUA 1QO5A 2A85A 3MP4A 3RF9A 3ZFHA 5FEZA 1GT8A 1DHPA 3KHJA 3S1VA 3DI0A 2FPTA 3LI1A 4WOQA 4Y8FA 3HBLA 3G1YA 1KFJA 2VELA 2NV2A 3UWZA 3LBMA 3F4WA 2P0OA 4Z1DA 5G2WA 2F7FA 4O16A 2VFIA 3ABSA 1XC4A 1T96A 3BO9A 1M7PA 1QNVA 3HGRA 2FLIA 5DELA 3E9AA 3TX9A 1H1YA 3O06A 2J88A 5DCEA 3UPBA 1W37A 1ZFJA 1K8YA 3EXTA 4FIQA 3W7MA 1DQXA 5D2YA 3C2FA 1U83A 1KLZA 5DXYA 2NXGA 4AHOA 1TPFA 1FDYA 1VLIA 3NOEA 4AXKA 4LV4A 1JRBA 3NZ1A 4MYAA 3NVTA 4HPJA 2VFFA 1LBMA 4OT7A 3W85A 4JX5A 5DY2A 4AH7A 1CI1A 2ZRWA 2ZTKA 3O07A 5CPNA 3B4UA 3M5YA 2X1SA 1AG1O 1B4EA 1VRDA 3L5LA 4XWUA 3G0XA 4ZMGA 5AYXA 1O94A 1V7YA 5FF3A 1EP1A 1OX4B 3QQ1A 2V2HA 4UNLA 4C1KA 1KBJA 3L68A 2D73A 2IQTA 3EWXA 3NQ7A 4M7TA 1MEHA 4HN4A 1TSIA 4XBSA 4BF9A 2QCMA 1TRDA 4LVBA 4QISA 3HG4A 3STEA 4KWWA 2PE4A 4WY0F 2BX7A 4N6FA 1AK5A 4JTJA 3HPZA 5CPLA 5HWJA 5EMUA 4UFJA 1SW3A 4MOZA 4FNQA 3EKZA 4AHPA 1VZWA 2DZUA 4IMEA 3QW4B 2V2CA 5G1YA 3SECA 3S0CA 3BGGA 1ZALA 4LNYA 4MUZA 3A9IA 3O05A 1EEPA 4MZ8A 4Q4KA 1WQ5A 3LCIA 3RU6A 4L4LA 5D05A 3S6DA 3WK2A 4UUIA 3K30A 1PCWA 3LCWA 4MLRA 1ICSA 1IF2A 4O17A 3W87A 1AW2A 3M44A 2Y85A 4Z1AA 3EX4A 4I7UA 5C55A 4PA8A 2I14A 2FB3A 1DOSA 1H63A 1I8JA 3GXPA 2JKEA 3W7EA 1QO2A 2GQ8A 2YX0A 2FDSA 1W5NA 1K7XA 4OHQA 3WJSA 4WX2A 1QDSA 3LRLA 4O4VA 1YADA 1ML1A 4TIMA 2QKFA 2QCGA 1SW7A 1OYAA 4O0ZA 2X16A 1ZAHA 5EL1A 1IXQA 4FXRA 2QF7A 3W2LA 2AAMA 5TBOA 5CGQA 3MBFA 2GJNA 3HG5A 3S1XA 3SGZA 3TC7A 3IIVA 1F76A 4QITA 5EPDA 4IUOA 3W2UA 3WK3A 3HIJA 3O63A 3P80A 2RFGA 2C18A 4FNTA 4FF7A 3GIYA 3L0KA 5FEXA 1LRQA 2BLEA 3CPRA 3UXDA 2ATMA 2CLLA 8TIMA 3WJZA 2GQAA 1JCNA 4NZFA 4TU1A 1XM3A 1H51A 3NPVA 3NQVA 1LYXA 4N2YA 3OBKA 3DENA 3IVUA 4FHAA 3UYCA 3L0NA 5KMYA 3STCA 1SZGA 3NL5A 4UIOA 1GYLA 1XBVA 1SFLA 2H8ZA 2ZRVA 1GG0A 4YWIA 1SZFA 4O57A 4NUWA 1OFOA 2ISWA 3DHFA 1L6YA 3V1PA 4JY9A 3LRKA 4JDYA 2ZTJA 5HQEA 3OHIA 3P8IA 4NQ1A 1A5BA 3N34A 2DZVA 3UZJA 3Q2DA 4FO4A 5I3IA 3LERA 4XTIA 3TJLA 4HHPA 3L9CA 4K36A 1KM3A 4N9CA 5IM51 3G1XA 3S5YA 3VI2A 3E02A 2VKZG 3PR2A 3QMRA 3P62A 1IXPA 3P81A 1B57A 1KV8A 3D0CA 3GYEA 2ZYFA 2ZA3A 4IMGA 4RCXA 4HIBA 4CCEA 3TKFA 3PB2A 1TV8A 4BWLC 3LTYA 3PUDA 1N8FA 1W5MA 3FJ6A 3QW3A 1ME8A 5D38A 1NAL1 4LY8A 3W1RA 2P10A 4NX0A 2NXHA 3ZWSA 4O15A 5HINA 3G1SA 5DN1A 5KINA 5C2XA 1WOBA 3LGEA 4IPJA 3QQ0A 4RV8A 3FFSA 4HKPA 4JR5A 5D30A 3NL3A 3TQVA 3T78A 5FF0A 2PC4A 1Z42A 3U6WA 2FFCA 4YMZA 4ZL1A 3VE7A 4WUIA 1Q6QA 3AJXA 1ALDA 1OFDA 5J5DA 1YDNA 1NSJA 1H7OA 1VYPX 3TSDA 1DBTA 3W7CA 4IWWA 1B9BA 4U28A 3MI6A 4GWEA 3T7VA 3NDOA 3HGSA 4TMBA 2Z6JA 3R13A 4DF2A 4A2RA 3CEPA 4XTDA 3GXTA 3GKAA 3R12A 5HR7A 3SY5A 1R2TA 3DFOA 2QCDB 3IVSA 1I2OA 2GVJA 2WOQA 3W88A 2Q8LA 1RQHA 4O14A 3MP3A 3MUXA 2ZDRA 1HO4A 3N14A 4PH6A 4AHQA 3TJXA 4ZQRA 3BVJA 4R33A 3VE9A 3MMTA 1V5XA 4GUFA 4KKXA 3CB8A 6TIMA 4GRSA 1RV8A 1SZNA 5AC6A 4UTKA 1KFBA 5FF7A 5K9XA 2ISVA 4NZJA 3NAVA 3QYQA 4NT0A 4RZ6A 2ZZ4A 3TFXA 4JTGA 4LV9A 2NUWA 4GUIA 1PL9A 1HUVA 3L67A 3RMJA 3TSMA 2G5WA 3W7JA 1FDZA 5HUOA 4XBKA 2DZXA 1JVNA 4IX2A 3GZ3A 1YTDA 3BLEA 3P7YA 2ZBTA 5FF2A 4E2DA 1AW1A 1LROA 2B7PA 5BRBA 2QCEA 3HPSA 1Q6LA 3GDKA 1A50A 1MSSA 1P5BA 2YXGA 4BR1A 1QCWA 3I7QA 3RFAA 3CC1A 5HUPA 3W7PA 5F2LA 4R34A 2Y88A 1JCXA 3N9RA 2DZSA 4ZQPA 3N2XA 3LCLA 4TMCA 2QCDA 3KVKA 1FQ0A 3EXSA 3S5ZA 1NF7A 5C6MA 3BARA 3C4UA 2B7OA 3E0IA 3IEBA 1PIIA 3HG3A 4M5PA 2QDGA 3LHZA 2VENA 2A4AA 3NYZA 4KFPA 4NNBA 3EKLA 1IIHA 2Y89A 1FBAA 4QAIA 3KAOA 3TCEA 3M7WA 4MJZA 4LW7A 3GXNA 1M6JA 4GBUA 4PL1A 2VEKA 3C2RA 1KLYA 1LOSA 3DZ1A 1FWWA 3HG2A 4LRSA 5A5WA 2XN0A 1N7KA 4K7VA 4ZQCA 4O53A 2P1FA 4NNCA 1K8ZA 1QPQA 3P5YA 1MZHA 3FJLA 2C13A 3L21A 1DQWA 3M16A 3NNTA 5I3JA 5LNRA 3IV3A 3C0JA 3ABRA 4FXSA 2ZZ7A 3BG3A 3G8RA 1IXNA 1P0NA 2EAWA 3GLCA 3IIXA 4OGZA 3MBDA 4DPQA 2ABBA 4X22A 1IIGA 2J6XA 3DFSA 3W7LA 1PHWA 1YDOA 4DO4A 5CZTA 1XXXA 1BTMA 4N4QA 1MXSA 2W79A 2DJLA 4N9DA 1LZOA 2ZZ5A 1I2NA 2YGYA 2TMDA 5LNVA 1LORA 4IOTA 2B4GA 4JTEA 3O8AA 3KVLA 4JTFA 2CZEA 1GYNA 3W7GA 1A5AA 1W56A 3W7IA 5CG7A 3OG3A 3TROA 1KFKA 1OHLA 4FIRA 4D2JA 4KFOA 4MZ1A 2Y70A 4DO6A 4JIQA 4RXFA 4ADSA 4UFIA 1XI3A 4Y90A 4LVAA 1DVJA 3W76A 2CLMA 4O13A 1WX0A 3P82A 3JR2A 3FEMA 3G3DA 4O18A 4CLMA 3L5AA 2YCEA 2ISSA 4OWGA 2J9XA 1F2JA 1SR9A 3GKFA 1X8FA 1KM4A 5I3HA 3LCXA 2VOMA 1W5OA 2CZ5A 2QCFA 4I7VA 1C9DA 1OJXA 5I3GA 3DHDA 2VXNA 2CLHA 5F1VA 1P4CA 1S3HA 1G69A 2A7NA 3G8EA 3PAJA 3LHVA 4S2BA 1HTIA 1H7RA 2NWRA 2ATSA 1SW0A 1TJRA 4CQAA 1GWJA 2VEIA 3W1TA 1ZAIA 2JKPA 3N73A 3G24A 1TTQA 2ZRYA 3DKLA 1OFPA 3S1WA 4PL2A 3R8RA 3W2JA 1W54A 3MO7A 2O7QA 3Q94A 4O4WA 4J9JA 4AB4A 1VQTA 3W83A 4DF1A 1SU5A 5F4XA 2BXVA 4HNUA 5TIMA 4R53A 3QPYA 2YFOA 4NJHA 4IJBA 5LKYA 1QPNA 4YLWA 4JIPA 2R14A 3VKJA 1JQVA 3TMLA 1I2PA 4O52A 1FCBA 3G1VA 5AYZA 1Z48A 3QRHA 5DBTA 1O95A 2O7SA 3SW6A 3BGJA 3GB6A 1ZHAA 1YDVA 5D32A 2W6RA 3OEXA 3UD6A 4CNNA 3CM4A 3NQ6A 1KM1A 3P74A 1WV2A 3OVPA 1SO3A 3B05A 1ONRA 3H53A 2ABAA 4WOZA 5D02A 5CPMA 2Q3OA 1LRNA 4N02A 2Y7GA 4E2BA 1EP3A 5KTLA 4QNEA 2J9ZA 1K02A 4FEZA 1I45A 4O1AA 2A21A 4RZ4A 3TK7A 5KZMA 4FX6M 5CZ0A 3TQKA 3T55A 4QSHA 3ZWTA 4LUJA 3NM1A 3PWAA 2Z0IA 1M7OA 3MI3A 4CQ9A 3SI9A 4MY1A 3UY7A 1G7UA 4TO8A 4UTMA 3A5FA 4AEOA 1P1XA 4JYFA 3QMTA 3LHWA 1NVMA 4UTWC 1TV7A 3PULA 3LTPA 5AC7A 3PSVA 2RKXA 3G22A 3QF0A 1XBYA 4AWUA 4N9EA 1KA9F 4HNVA 3PUEA 3OA3A 1XBZA 1KTNA 4MKNA 2VFGA 3NZRA 1WXJA 2Y61A 1LLWA 2H90A 3TC6A 3BLIA 2RDWA 1W5QA 4FNUA 3M6YA 2CLEA 1TPB1 2YYTA 4IMFA 4JTIA 2C3ZA 2Z2UA 4JXCA 2BWGA 4WXZA 4O54A 3E96A 2GPTA 1QR7A 3FLUA 4LVGA 1GTEA 4KWVA 3LXBA 1UASA 3HB9A 3FS2A 3M9YA 1JUEA 1P0KA 2Y62A 1FCVA 1OABA 3BK0A 3C2VA 3HGOA 3LHTA 1PV8A 4W9TA 2B7QA 3C61A 5AYYA 4CCCA 1F6PA 4LTSA 1TYGA 4OV9A 1G7VA 1ZY9A 2A0NA 3NGJA 3SSJA 3VCRA 3NR0A 2E6AA 1OF8A 1JUBA 4K38A 4NJKA 3G3MA 1IXOA 4FNSA 5AOUA 4ZVJA 2WNNA 5G5IA 1OX4A 4GNJA 3MI2A 3S8HA 1VLWA 3KRSA 3KRZA 4UTIA 3RLUA 3T44A 1KM6A 4CQ8A 5LNWA 3B04A 4LS0A 1VH7A 4EWND 1GTHA 4WJEA 2WKJA 5AHEA 2NXIA 3CHVA 2OT1A 4A29A 3I7RA 2JBMA 2CU0A 2QCLA 3C52A 4PCFA 2FQIA 4IX0A 4NNAA 3AO0A 4AF0B 1X1OA 3DH7A 4PTNA 1JCYA 3CLMA 2J24A 3BW2A 3W73A 3GX9A 5F2MA 1ME7A 3DFPA 3NA8A 5HR6A 1XFBA 3RNDA 2XFWA 1KBIA 5D37A 2C0AA 3PBUA 3HGJA 3KOFA 1XUZA 3HMJG 2E68A 3NO5A 2C16A 1ADOA 1KTCA 3UWYA 3S5NA 3P60A 4M7SA 3DGRA 2TRSA 5G2IA 4KFNA 1HO1A 3SZ8A 2VEMA 1A5CA 3KRUA 1LOQA 2EPHA 1SO6A 1TB3A 2EKCA 4ICNA 1DJQA 3GNDA 2EGZA 4TX9A 5I3FA 1GPWA 1A5SA 1VJIA 3LXCA 3HPXA 4JDBA 1EUAA 1TPEA 1TMHA 2NLIA 1VCVA 4MJMA 4S2CA 1QOPA 2CWNA 3W9ZA 4JEQA 4Q33A 3GDTA 3LDVA 3QPZA 2B7NA 5D2TA 4RX0A 2GUUA 2E5DA 3EX3A 1O4UA 3A23A 2I1OA 4QNWA 3W72A 1NF0A 4I7WA 3LX9A 3P5ZA 4LVDA 3VFLA 4UMAA 4LS1A 3M0ZA 1WYIA 1SZEA 1VHCA 3LB0A 3NQMA 1GVRA 2E09A 4ML9A 5DCBA 2C6QA 3NPUA 3NEVA 4PFMA 1OFBA 4JX4A 1H1ZA 3LHUA 2ZRZA 1YTEA 3BW3A 1SO5A 2F84A 3DAQA 1VGAA 1GVFA 4DBDA 1JJKA 3EX2A 1XKYA 1H7NA 4E0CA 1LBLA 5D2XA 1FDJA 4K8EA 5EA9A 2YSWA 1CX9A 3W84A 3STFA 2HS6A 3L66A 2X2GA 2NUYA 3W2MA 3BPWA 4IMCA 4MY8A 3A24A 4RJEA 4UFHA 3CT7A 1SFJA 3IGXA 1KFEA 3O6CA 5FEWA 4UMBA 4M19A 4I9AA 4P2VA 5D03A 4X3ZA 3S42A 4ALDA 1LRTA 4DF0A 3I65A 2PRHA 1KFCA 4L4MA 5DLCA 4Z08A 3TXVA 5F4SA 1YXCA 3W6YA 3WJWA 1T8XA 3VNDA 3PY2A 5D33A 2RHGA 4M6PA 3W1AA 1I4NA 4B5NA 4JTUA 1H7XA 4MLJA 2NX3A 1K7EA 3OVQA 2C14A 3EB2A 4WQ6A 3WK0A 5K3VA 4DXVA 3INPA 5E1QA 4HSNA 1F73A 2ZFAA 1FX6A 2QEZA 4DBEA 4QQ3A 3NPXA 1K7FA 3WK1A 1XCFA 4JTSA 1AL7A 3NM3A 2DORA 5L6UA 3TAKA 3W71A 3T4CA 3QZEA 3MHFA 1VYRA 3QEZA 1WA3A 1F74A 2HTMA 1L9WA 2NWSA 3KX6A 4MFDA 2CZDA 5C5YA 3EWZA 4GUHA 2ZZ6A 2UV8G 4PODA 5K9CA 4YCPA 1ZJIA 3TE9A 3FIGA 4JTKA 4UC5A 1W3IA 2E6YA 3DFTA 3P67A 4JD4A 1TPWA 4DEFA 5CZSA 4DQWA 4S1FA 1PVNA 2ZZ2A 4OE7A 4MZYA 3HQ1A 1X7FA 2Y7FA 1EUNA 3RLVA 1C29A 1BWLA 1EX5A 1AL8A 2QJGA 1UJPA 2DP3A 4UTLA 2XN1A 1TREA 3O1NA 5HJLA 2R91A 1QMLA 4O12A 3PG8A 4JNMA 4FX8A 4X2RA 5BNKA 2QAPA 1BWKA 3TIMA 1R47A 3QJAA 5F2IA 2QCHA 1Z41A 3TDFA 5FI8A 2ZRXA 3V75A 1OFRA 3HJZA 1E51A 4NJIA 3CIWA 4O50A 4WY0B 3L2IA 1F5ZA 4HNTA 2GOUA 5LGXA 3GDMA 3G0UA 1HG3A 2V82A 1MEWA 3E12A 1H5YA 3NQGA 2RDTA 3LHYA 1EWEA 1TO3A 3WFAA 2PURA 2HS8A 1X6UA 2Q3RA 1QPOA 1Z44A 5H91A 1JCJA 4JN6A 3G18A 4A21A 3NQAA 3JS3A 1OK6A 3HO8A 3L5MA 3MHUA 3TFCA 1Q3NA 1WAUA 3O6YX 5TQLA 4BI7A 4RK8A 4NX5A 1GJPA 3I6RA 2CZFA 4XZ9A 4K7YA 4A22A 3BV4A 1VC4A 3QM3A 3IGSA 1ZENA 2CLIA 3BW4A 5K9DA 1OFAA 4CNPA 4U4MA 4QIUA 1T0OA 3C8FA 4ONVA 5MHBA 5E0KA 3NQEA 1CW2A 1LOLA 5AN7A 5LNSA 4BK9A 3W7DA 2J27A 5H2ZA 4O1CA 2PCQA 2NUXA 2BTMA 1QAPA 4UFMA 4EIVA 3B06A 2ZRUA 2FTPA 3CU2A 3LCHA 3NL2A 4CNOA 4AVFA 3P84A 1J4EA 1KW1A 3LM7A 3M5VA 3DI1A 2DZPA 2EF9A 3W1UA 3QSTA 2WV8A 4O28A 4XKYB 3IIZA 4WY0A 1MO0A 3WJYA 1FXQA 3TA6A 4UR7A 1Q45A 4LOCA 5IBXC 2R94A 1KM2A 3MHGA 2C1HA 4LS2A 3W1NA 1DORA 1EB3A 4NJGA 3W75A 2WNZA 1VR6A 2QCNA 2YW4A 2VFDA 4Z0JA 2Z1BA 1L6WA 4ZQNA 4K8HA 3TW6A 5CSSA 2BSLA 4H3DA 4QJ1A 1JULA 1F05A 5D2WA 4JTLA 1BKSA 2H3DA 2WQPA 5LZLA 3MYPA 4POCA 1JUKA 2H6RA 3PBWA 3W70A 1H60A 1VPXA 1DV7A 1DKWA 5LNUA 2Q8ZA 4ORMA 2JK2A 4PEKA 2CW6A 3PM6A 3C2EA 2H3BA 3UPWA 3M5ZA 4AWSA 1EPXA 2Y7EA 4UTTC 2QCCA 1GZGA 1F6KA 2Z6IA 2H8XA 4EF8A 3S1UA 3F4NA 1RZMA 2WSYA 5AFDA 3EWBX 1LCOA 1YPFA 5F2GA 4WXYA 5LSMA 2V2DA 2TYSA 1FCQA 3P61A 4UTHA 3LCFA 1FWRA 2DJXA 3CWNA 1K03A 5CSRA 1SSGA 2JKAA 2YR1A 4XKYA 2PRMA 5AHFA 2JGYA 1DJNA 1EA0A 3SFKA 2YZRA 3LV5A 2WSRA 2LLEA 3TU9A 1GG1A 3NL6A 4FNRA 2FPYA 3EWYA 2DZWA 5AHLA 3SR7A 3U8GA 3KFTA 3HF3A
chains in the Genus database with same CATH superfamily
3UF9A 2YXOA 1O5KA 4YPJA 3W0KA 2FB2A 3CUGA 3FXYA 1ZS2A 2BS9A 1VCGA 1FHVA 2GSHA 1HFBA 4L80A 5D9NA 4MGGA 2PPGA 1PS9A 3C56A 6TAAA 1VENA 1E6NA 4NRSA 2OEJA 3LLFA 4MNKA 5AKQA 1C7SA 3GAYA 4P7NA 4RZ5A 2VI0A 4JFWA 3A4JA 1QOQA 1GVQA 2E8ZA 4U10A 1B3ZA 3MANA 3QC3A 4WEVX 4OZOA 4BWLA 5CJ5A 4IP7A 5CLTA 3CAWA 4PRRA 3CZKA 2PC8A 3CAKA 3W6MA 3PVFA 4JY8A 1T41A 4DPPA 2C79A 3W07A 1Q6OA 3WLRA 3IIPA 1TPH1 4H83A 3UR8A 4AZIA 4DJED 2NQZA 2E6FA 2JFEX 1UWTA 1KRBC 2V5KA 5JUVA 3QFEA 1XYZA 2YDAA 4QLLA 4F0RA 1NEYA 1QTWA 5E93A 1ESWA 2Z1VA 4RPPA 2NSOA 4TR9A 3DFNA 3U2OA 2DIJA 3G1FA 2DSZA 2QJNA 3WN6A 3AHYA 4W7WA 3WNMA 4O19A 1VBJA 4AZCB 1DE6A 5A95A 5HANA 3DUGA 1UD5A 2OOFA 2OYMA 3MCMA 3ZO9A 4MPKA 5I07A 3ONCA 3PB0A 4GI8A 4A8RA 4IQDA 1FKXA 5C8BB 4GIAA 5DCDA 1E6XM 3IGUA 3B0UX 1TKKA 4ZQOA 3FA5A 4J2MA 3LV6A 3U4AA 2BY3A 5DF0A 4P8WA 3NOYA 1GQKA 4PTWA 3NQ8A 4MFEA 5BMWA 4J5NA 3WH8A 5A8QA 3TTSA 4M6VA 3ITCA 3R6IA 3F03K 3UNDA 1QI0A 3AFBA 1V7AA 3TEVA 2V5BA 2XVLA 4LQ1A 3WUFA 3ALGA 1UC4A 3SGUA 1GOIA 3AZSA 3AIRA 5LA1A 2WPBA 4IQEA 1LL6A 4O1BA 2GOKA 4C6QA 3NGFA 4DO5A 3MUY1 3MPGA 4DB7A 3ATYA 3H4GA 2G97A 1DJYA 1FWCC 3GAKA 5BMXA 3CV1A 6PTDA 3RITA 4OTKA 3CIVA 3CPUA 4JICA 2GGHA 1JDDA 3V36A 4YTSA 3T2QA 1G67A 3BLPX 1W8SA 3VMOA 1XIHA 3CL7A 2BOFX 4HTBA 3MS8A 2V5LA 2QULA 4C1NB 1FFRA 2NX9A 1EL3A 3SM0A 3S4TA 1OD8A 3EA3A 3M5XA 1XH0A 1YBQB 3H12A 2VZOA 1TJ1A 1EJSC 2XVNA 4GC4A 3NQDA 4O10A 4OV4A 1E43A 1MEIA 2QZRA 4H8UA 1WDPA 1BXCA 4BEUA 1VBHA 3O0KA 3ARSA 3NEHA 3RXZA 4LRTA 4XD5A 1TCDA 2E5BA 4XO6A 3BLDA 4DM2A 4DZIA 1THFD 3I6TA 1ZZMA 5D09A 1PZ0A 5AB3A 4DLFA 5A3HA 1GW1A 5C9RA 1O5XA 5FJIA 4HSOA 3PTQA 1TIWA 1ZLPA 2I7GA 1S3TC 2VC6A 1V6UA 2JQXA 3UZ5A 5H8UA 2DSKA 3QGVA 3EA1A 2XN2A 3U5UA 1UWRA 4XIAA 5E9XA 1Q8JA 3PF3A 1Z69A 1GEQA 1K8XA 1TFVA 1TV4A 2QR6A 1VS1A 2VZVA 4K6AA 3EEGA 3VIPA 1VFHA 2HRWA 3ZIZA 3IJQA 3W37A 1NM9A 4M24A 4C6KA 3TXZA 4B5VA 2PFHA 4NF7A 3UY8A 1H61A 2UY4A 2C19A 1Q6RA 2JE8A 1GVOA 4C1NA 3GDRA 1B54A 1YBQA 5HWMA 1S2VA 1R3VA 4GACA 2PGRA 1C8VA 3W27A 4E38A 1AQHA 1NWRA 2V8ZA 1G4PA 3PJXA 1Z6KA 1BVNP 4OBRA 3LBOA 4Q4MA 2WMIA 4JHMA 2ISFA 3N6JA 3TNOA 4AWEA 2CLFA 1PTGA 5L9FA 4KIEA 4KF1A 2DU2A 1W3HA 4L4PA 1FWNA 3BICA 1PUDA 5GVJA 4HNNA 2V68A 4H4IA 2QJIA 2YB1A 1TIMA 3KCLA 4C6NA 1TR9A 4WZHA 5KSWA 3VOCA 4NU7A 5I79A 4QR6A 3WQ8A 3HM7A 5U7SA 1MUMA 4M3PA 3FYPA 3AIQA 3H4WA 3IRSA 5TD4A 4D9PA 1GCYA 1JF5A 3BLOA 3VX0A 4ZTYA 2VL4A 4IIGA 2A6NA 1UQYA 4CD6A 2OJPA 1GEHA 3UXLA 2NZLA 3CLWA 2PLJA 2FKPA 4PN2A 3ANYA 1US2A 3AIBA 4DWSC 3UJFA 1YPIA 4FOJA 2DQWA 4XX6A 3UNTA 3FX4A 5CEWA 2OQYA 5A2CA 3LTSA 1WOAA 3PSWA 1RQEA 4YTRA 4IIFA 2VFEA 4LC6A 1S5WA 3ABZA 2E5CA 3HU7A 3M0VA 4HNOA 3SCOA 4WKFA 2PRLA 2X30A 1W9XA 3WLMA 4CU8A 1Y7VA 3SDOA 3AAMA 4FX7A 2VC7A 5AHIA 4DWSD 2QJHA 3W1QA 4MY9A 4IXHA 4ZOAA 4PC8A 4Z1BA 3TLLA 3QSRA 3KZSA 1MXGA 2GDQA 4YHEA 1LWHA 2I9UA 1K4HA 1AVAA 1M04A 4K3ZA 1QW9A 1MMFA 3FHQA 1YTKA 2A1YA 2QAFA 1J96A 1CGXA 1UUMA 2ACRA 3RK8A 3W1XA 1R9YA 1A3HA 5HNTA 1GQJA 3KTCA 3GIQA 4L6DA 5F1UA 3N2BA 2VDHA 1O1HA 1TRIA 3I4KA 1AW5A 3A21A 1P0EA 2HNEA 4DJFD 5K4XA 2VZUA 4HK6A 4CCDA 1ZCOA 1V0LA 1B3WA 3QH2A 4WD0A 4HT3A 2WVUA 1WBJA 5HAOA 5KEZA 1DIOA 3WMSA 4Q6JA 4AXNA 4IPIA 2FZNA 1SFTA 3N2TA 2OGYA 1XLBA 4O0KA 1AMKA 3ABOA 1CBGA 1KGXA 5FSEC 3LXAA 4ERIA 1V02A 4JKKA 4GHRA 5EKYA 2FH8A 3M1ZA 4O1FA 4LBSA 3TZFA 1UR0A 4WK9A 1K3UA 5ECUA 3EX6A 2VD9A 3UWVA 3WL1A 4MYXA 2OX1A 2YFNA 3F4DA 3URBA 3MU7A 3UWQA 1LM1A 4LFYA 2QV4A 3CL6A 3WBYA 2DUAA 5DRCA 2HISA 3HQPA 3KHJA 3S1VA 3DI0A 1ZSXA 3U4FA 3UWZA 2NV2A 3GTIA 4FLSA 2XFFA 3POHA 1T40A 4TVUA 2P0OA 3TYAA 4J3SA 4NG3A 1LL7A 3UG4A 4O16A 1OGSA 1XC4A 3N4EA 1T96A 3PZ9A 2J79A 1QNVA 3SADA 3HGRA 2FLIA 5DELA 1UR2A 3ARXA 1DWFM 5DCEA 3EDEA 2AL1A 1WDRA 2WCGA 1E1EA 1K8YA 5D2YA 3OGSA 4TX6A 1U83A 1KLZA 1O6IA 1R9ZA 3RO8A 3VNIA 4AXKA 3NOEA 4L6OA 1JRBA 4MYAA 2ON3A 2VFFA 1LBMA 4EX4A 3RRXA 1CGVA 1MI3A 1B0IA 3WDRA 5CPNA 1IZJA 4WCJA 1B4EA 1BTCA 1HJVA 2L5HA 2WC4A 4I5RA 4ZMGA 3RCNA 5AYXA 1OX4B 1NQKA 1ZP4A 4DNMA 2V6AA 4ZA0A 2YCLB 1KBJA 2D73A 1MEHA 5FOOA 1JZ6A 2V5CA 1WE5A 2DDXA 2QCMA 2WJDA 1TRDA 4OIFA 5A8PA 4F2TA 5DMYA 5LYRA 4AY7A 3HG4A 3STEA 1PYMA 3VZXA 2XUCA 4KRUA 1AK5A 5BXPA 2GK1B 4JTJA 4HOWA 4Q8MA 2OWWA 1FWDC 5CPLA 5HWJA 1XRFA 1SW3A 4MOZA 1RA5A 4AHPA 3EDJA 2E67A 1E5NA 3E0LA 2V2CA 3C0LA 3BGGA 3SCVA 1ZALA 5I2UA 4NY2A 4MZ8A 3UP8A 4L4LA 3S6DA 4JTQA 2CETA 3K30A 2BHYA 3LY0A 3ID7A 4U5IA 1M7XA 4Z1AA 3EX4A 3UYIA 1BXBA 4MNMA 3MKVA 1I8JA 3P93A 4GH1A 3W7EA 5BCAA 3GXDA 1RA0A 2E40A 5C9ZA 1NH6A 4OHQA 3WJSA 1TWZA 4WX2A 2C91A 2E1WA 1YADA 1ML1A 4ZSUA 5CXPA 5D9OA 4IM4A 1SW7A 2YCLA 1OYAA 3II1A 2AAMA 1LL4A 3QV7A 2WVSA 3BL3A 3S1XA 3AICA 3IIVA 2W91A 3AS0A 6REQB 2GK1A 3O63A 5B7YA 1NDWA 3GR4A 2RFGA 2VURA 3BMXA 5LIYX 3GIYA 3V0TA 5FEXA 1LRQA 3DECA 1RHCA 2NT0A 2R6OA 2GQAA 1NOWA 1NELA 1CCWB 4D1JA 2FDMA 1XQLA 4R7WA 4GFIA 3UYCA 2Y8UA 3ARUA 3PTDA 2OWXA 1ADDA 3STCA 1SZGA 4UIOA 3AMGA 1XBVA 3N15A 4Z2LA 3S1GA 1GG0A 4JAWA 3ZSTA 4YWIA 4O57A 4NUWA 1OFOA 3VD3A 3EOSA 4NKCA 4AZ5A 4JQ2A 3V1PA 1KQZA 5HQEA 3BXWA 3BWWA 3UZJA 3BGAA 1M53A 2X05A 4XTIA 5IM51 4N42A 3TA9A 3G1XA 3GHTA 2DEPA 6A3HA 4JFSA 4GX8A 3MB9A 1B57A 2VX5A 1BYDA 5GNYA 3S5SA 3D0CA 1TZ9A 4UNIA 1UD8A 4UBPC 2V67A 3AYTA 4BWLC 1UP2A 3TJ4A 1UWSA 3CO4A 2AMGA 4QROA 3MVIA 3W1RA 3O9NA 3ZWSA 1BRLB 2D1ZA 4O15A 1XLGA 5HINA 4FR1A 3G1SA 5DN1A 2YLAA 1L8NA 5C2XA 2ACSA 4RV8A 2CKRA 5D30A 3NL3A 3T78A 2PC4A 4C7GA 3IUDA 5AZ0A 2A3AA 2WKLA 4ZL1A 4F0LA 3VE7A 1UD4A 4C7DA 2OOGA 1YDNA 1RVKA 3PAOA 4IWWA 3BZGA 1A5KC 4GWEA 3OODA 1POKA 1AUSL 4TMBA 5HMEA 3R13A 4DF2A 2BGNE 3CEPA 2VCBA 4WGXA 3TN4A 4C5ZA 3LNPA 4GISA 3T0AA 3IVSA 3KWSA 4HHLA 4FA3A 2Q8LA 4O14A 4OJYA 3GVVA 4QFUA 2KAUC 2WYSA 2W4XA 3N14A 4PH6A 3BCDA 4CD8A 3MUIA 5C9WA 2J8FA 2GSEA 4NAFB 1V5XA 5AC6A 3HPAA 4ROQA 4B16A 5FF7A 1BRLA 1T5AA 1QXLA 3BSMA 4NAEA 4NZJA 1E6ZA 2ZZ4A 4H9UA 3TFXA 4LV9A 3MCNA 4ZBCA 2NUWA 4WHBA 1PL9A 1HUVA 4HYRA 5DX7A 4IJRA 3RMJA 3TSMA 3GNRA 3M0XA 1YTDA 5AYIA 2RJHA 3QXBA 1SZRA 5FJRA 4E2DA 4F9DA 1AW1A 3RR4A 1LROA 2B7PA 4AFYA 4MSSA 2WZEA 1J18A 4BR1A 3FGCB 5HMFA 5HUPA 1KCZA 1G01A 3W7PA 3N9RA 3ZZ1A 3N2XA 4M8UA 3LCLA 4GYPC 1Q6GA 1QW8A 3EXSA 1NF7A 3C4UA 2B7OA 3IEBA 3BLLA 3HG3A 2HVNA 2QDGA 2VENA 1B9ZA 2A4AA 3GDBA 4KFPA 1OB0A 3EKLA 1IIHA 4NAFA 1FBAA 3M7WA 2I57A 4M51A 1M6JA 1O5QA 3ZOAA 2WZTA 2I5IA 1KLYA 3DZ1A 3UWEA 3DC8A 3VNJA 1NFGA 3UJSA 1H09A 3E2RA 4W8BA 1JZ4A 2P1FA 3TC3A 1XRTA 4HN8A 4NNCA 1K8ZA 2DSUA 2C13A 3IV3A 1I60A 1S1RA 3H8AA 5DMNA 5A1AA 1IXNA 3IIXA 2R1MA 1E0TA 4L9XA 1XXXA 1BTMA 1MXSA 2DJLA 2BVWA 3FGCA 2QW5A 5A2AA 1I2NA 3W6LA 5J04A 2B4GA 2XGIA 4H6QA 2CZEA 1GYNA 3URQA 4CU7A 1A0CA 1W56A 3K4AA 5G4HC 5CG7A 3OG3A 3BMWA 3TROA 1KFKA 1OHLA 2RUSA 3KS6A 3M46A 4MZ1A 4RXFA 2PLKA 4J3XA 1XI3A 4LVAA 3LPOA 3VDCA 2C8NA 1IR2A 3P82A 1KCXA 3FEMA 4M0XA 1EHAA 4O18A 1UZ1A 3CAVA 5AVHA 1RBOB 2YCEA 2OSYA 4PUNA 3U2EA 3VKDA 3U2CA 1KM4A 1KGUA 5I3HA 2VOMA 1R8LA 1C9DA 1OJXA 1QHZA 4LBRA 1P6WA 3H4XA 1XJBA 1P4CA 4ML4A 5JH2A 1H7RA 1SW0A 1GWJA 1KR1A 2AQOA 3G24A 2GJXA 2ZRYA 5E5CA 1F8MA 2IS7A 3QLDA 1ZJHA 4PL2A 1UBPC 2QIIA 3KP1A 1R3WA 1XRVA 2AKZA 3C8NA 3CQJA 2BXVA 3IARA 5F4XA 1OY0A 5TIMA 2O4MA 1ITXA 3MTWA 4GYFA 4NIRA 2YZ5A 5LKYA 2DGAA 2D2GA 1KD0A 3TMLA 3O0FA 4O52A 5MKGB 1QT1A 5AYZA 1O95A 1RLDA 4QE4A 3GU2A 4LF2A 2O7SA 3SW6A 3KCJA 5C2CA 1B90A 5AY7A 3UD6A 1V3KA 2FZ9A 3VX1A 1KM1A 3A4XA 2O92A 2O9PA 1BAGA 4HHHA 4KCUA 1ONRA 4WOZA 2ABAA 4QCFA 5AVNA 1LRNA 1E1FA 2Y7GA 5CGTA 4AZ6A 5KTLA 2ALRA 2VR2A 4H41A 5FJPA 3UZWA 3OLDA 2J9ZA 1FWAC 1AH4A 2A21A 3WBWA 5FACA 4PMYA 2VP8A 4DO7A 2VGIA 4QSHA 3ZWTA 3R94A 5HPOA 1P6BA 1XFCA 2EPMX 4OBSA 3QOMA 3A4WA 2Z0IA 4GG9A 1S1PA 3UY7A 1X1NA 4AEOA 3UEQA 3PSVA 3NTYA 3STPA 3PUEA 1XBZA 3E2VA 1WXJA 2H90A 4DN1A 4FNUA 5E70A 3SEPA 3S3GA 3M6YA 2CLEA 1A5UA 5MKGA 2ZUWA 4IMFA 4JTIA 2C3ZA 2NQJA 3RPTA 1VFTA 1QR7A 2R1PA 4XZLX 2J8GA 4WDXA 3J7HA 1JXJA 2DT3A 1BQGA 1JUEA 4ZGYA 1P0KA 1E0WA 1OABA 4IIHA 1T7LA 8CGTA 1J6PA 2CNCA 3C2VA 3HGOA 1RY8A 4F66A 5EFDA 2PGFA 4GO9A 4YJ5A 2J7DA 4CCCA 4LTSA 2Y24A 2E6AA 1OF8A 4K38A 4KH2A 4FNSA 4US6A 5G5IA 3VAVA 3MI2A 5I02A 4ZO9A 2QF8A 3VGEA 3IJ6A 3CUZA 1KM6A 4E8GA 4FMVA 1EKOA 5AHEA 3KL3A 3WIJA 2J78A 3CMJA 2P8CA 3OPSA 4S3BA 3QKEA 4TV6A 2CU0A 2HCVA 1IZKA 2PDGA 2X40A 1N8WA 2DZAA 3PFMA 4C6BA 4RE4A 1JCYA 1OM0A 3CLMA 2J24A 4AYSA 1O68A 1U1JA 4C6LA 2BBFA 4A8LA 2VX7A 4AIEA 2C0AA 3ZM8A 4NYYA 3SUUA 3KBSA 3BH4A 3H2AA 4PGLA 3HMJG 2C16A 1KTCA 3SRDA 4MKSA 5IHSA 4RZBA 1L8PA 1HO1A 1OC6A 1JZ8A 1A5CA 3KRUA 2GQ3A 2EKCA 3FW6A 4X60A 1QHOA 3B9OA 1PJ9A 3HPXA 2ZIDA 4JDBA 1EUAA 1TMHA 1VCVA 4S2CA 2CWNA 4D6EA 3DEQA 4ZO6A 4Q33A 4H2CA 1C9WA 4M1RA 2B7NA 3AS3A 5D2TA 3U57A 2JALA 4I5UA 1O4UA 1U22A 2V5DA 3W29A 1W17A 2J13A 4PMUA 4YTQA 3CHCA 1SZEA 3IWPA 3TR9A 5HA7A 5A6KA 4QX4A 4PFMA 4ZO7A 4PCPA 4PR4A 3VKKA 2PDIA 4S3CA 1GVFA 1JJKA 1JYWA 1JFHA 4E0CA 1N8IA 2VDIA 1W3JA 1DP0A 5EA9A 1JI1A 1H2JA 2NUYA 2D20A 5GNZA 3AYVA 4IMCA 4RJEA 2WMKA 4NZ3A 4H19A 1H49A 1W2VA 4PUEA 3W02A 1S5MA 1UMLA 4PMVA 2PTYA 4DXKA 3BOXA 4ZE4A 4LYQA 2J47A 4GJJA 5DLCA 2J75A 1D7KA 4WKAA 1YXCA 3N1AA 2ZUNA 2ADAA 1W1IE 1T8XA 2RHGA 4M6PA 4BQ3A 4NHVA 3RPDA 1F3TA 2NX3A 4KWOA 4HK5A 5LIUX 1R3YA 1JDEA 4DXVA 5E1QA 3PBGA 2ZFAA 1N82A 4DBEA 3NPXA 5KZ6A 1K7FA 1AQ0A 2OKTA 1OQFA 1F3XA 4GK8A 2NQLA 1AL7A 2OZTA 5CAKA 3N9KA 5DFAA 1GPFA 2OGJA 4NASA 3QEZA 4QDWA 3QQWA 4GUHA 1DJIA 1M41A 2I56A 4N0RA 3WF0A 3V35A 2C7FA 3TE9A 2PD9A 4ZOCA 4JD4A 1JPHA 4DEFA 3R10A 5CZSA 4DQWA 2ZZ2A 1JAEA 2Y7FA 4CGTA 1W2PA 3CL8A 1JPIA 1AL8A 3E2SA 1QNPA 3KWXA 1TREA 2VMFA 4KERA 4FX8A 3AIWA 4IIEA 1GGOA 3RMEA 2W63A 3QJAA 2FGZA 2QCHA 6ENLA 3XIMA 5FI8A 1XLIA 1E55A 4NJIA 1E51A 2D22A 5PTDA 1V03A 1XPYA 2GGIA 2GOUA 4JIHA 1YE6A 3G0UA 3T42A 1H5YA 3OOQA 1BF6A 3NQGA 1UR3M 4JQ4A 3M64A 3UGVA 3WFAA 4JCMA 1QPOA 1JPMA 1NDZA 1Z44A 2GDVA 2DVXA 3WF4A 3ARWA 2J7CA 1E3XA 1NARA 5CZKA 5TQLA 3CZJA 4D6CA 4BS0A 2KX9A 4H6EA 4RK8A 4K7YA 2OSXA 3BV4A 1FTXA 4W8AA 3IGSA 2GYIA 1ZENA 4HTYA 2CLIA 4OKDA 3TN6A 5K9DA 2QQ6A 2ASHA 3BZJA 4CNPA 4U4MA 4QIUA 1H1NA 1J9YA 2XSBA 4ONVA 2EQDA 1TX2A 4GI6A 1R7AA 1CW2A 3IS4A 1LOLA 5AN7A 5LNSA 1C8QA 2PCQA 2NUXA 2BTMA 4W89A 4NL1A 1UH2A 1PWMA 2Y4SA 2ZRUA 3NL2A 4CD4A 1WKEA 1QBAA 2DH2A 5CJMA 5A6TC 1J4EA 1UD2A 4XD3A 5TAOA 1WKFA 3GH7A 3M5VA 2VGFA 3H7RA 4KW2A 1K4GA 4YYFA 5CBBA 4Q8PA 1TUFA 3ITLA 3MZ2A 1PKMA 1MO0A 3WJYA 4EXBA 3RLHA 1UKQA 3RN6A 2R94A 1DORA 4NJGA 2XIOA 4PUDA 2YW4A 1GJUA 2Z1BA 1JYNA 4UB9A 1LG2A 3TW6A 1TMLA 5CSSA 2W5FA 3SCWA 1OWQA 2XG9A 5LZLA 5D4YA 4B90A 2OLSA 4F2UA 5IHRA 5I03A 1HX0A 6CGTA 2E7FA 1DWJM 2OQLA 3UR5A 2JK2A 4PEKA 3WQWA 1WNOA 2H3BA 2J4GA 3SJNA 1PZ1A 1V3MA 2Y7EA 1GZGA 1HJWA 3PHAA 5LIXX 1F6KA 1FHLA 1CGUA 2Z6IA 2J7HA 3F4NA 4V28A 1RZMA 3AMCA 3T09A 2PDMA 5LSMA 3MC5A 1P43A 2TYSA 3P61A 4D8LA 3OVGA 1UD3A 2PRMA 1DJNA 3HZ3A 2YZRA 3FSTA 4BF5A 4JFUA 5CBIA 4FNRA 1V6VA 2Z1SA 1JDFA 4HJFA 4JOMA 1PBGA 1IGWA 4HU0A 1Y0EA 2O56A 1XLAA 2Z7GA 3GWQA 2YW3A 2G4FA 3GU9A 4Q4QA 5D8ZA 3WNPA 3USBA 2ALDA 1B4KA 3GRIA 3PNZA 2G95A 5HQLA 1FXPA 1WPCA 2PBOA 3W1LA 4J2PA 3M43A 1TTJA 4IUGA 5B7ZA 5JIPA 2W9MA 4C5YA 4ZEPA 1W1PA 4GQRA 3UJRA 2PBGA 4FLOA 1UZDA 3VNZA 2ZCGA 4TXEA 1YIXA 1EDQA 2BG5A 2MNRA 3KOWA 1UKSA 1EF3A 3QV6A 4QAWA 4UFLA 4NXSA 1G5AA 1DXIA 3O6AA 1DXFA 4RV3A 3E5PA 2Y6ZA 5I09A 1F7BA 1P6CA 3W7OA 1YPXA 1M5WA 3WJXA 4DYKA 1VBRA 2J9YA 1RR2A 1P0DA 3W38A 3C6CA 4GLEA 5BXTA 2JEQA 4L9ZA 4LVFA 4W4QA 2VVSA 1CENA 1V6TA 3G6LA 5HMSA 1SSDA 3CQ0A 5AHNA 2WHKA 2EO7A 1ISXA 3QLLA 1OK4A 5G2HA 3WCZA 3I10A 4MB4A 1TELA 3SN0A 4D6GA 3GO2A 1KXTA 3A6OA 1LTDA 3C2OA 1GVIA 2GFTA 3G77A 4CCZA 4DUVA 4LANA 4KCWA 1W3TA 1A3WA 4V33A 3WDJA 3W81A 3W7NA 5DO8A 1E9YB 1YMYA 4ADTA 3MYOA 3QMSA 1WP6A 4J1OA 1T99A 3WD0A 3W7KA 2EXOA 2G96A 4YU1A 1H50A 3IVTA 5BU6A 3UXAA 4IGHA 1S39A 1KNWA 1GOQA 4A3HA 3D6NA 3EWUA 3REQB 3KVJA 1CLKA 3N18A 2OZ0A 3FVMA 4C60A 1DJZA 4JZ5A 1MXDA 3K4WA 4U3AA 3COTA 2A3BA 3G1DA 4QRNA 1LQAA 3R5EA 2A7PA 1TJ2A 3L4VA 4Y9AA 4JTTA 2W27A 3VNLA 2FGLA 1Q8AA 1E3ZA 5EB8A 3B8DA 3WLKX 2FVLA 4PBEA 2WAGA 2PP0A 3RCYA 3GQYA 1J2WA 1R2RA 4JNYA 1H0IA 3SCTA 3GC5A 3VGGA 2OFJA 4KCVA 4XAGA 3UVIA 1VFMA 1V0KA 1FWHC 2WVVB 5IRPA 2PF8A 3KL0A 4ZOBA 4UTUA 1UP0A 3N29A 2Z25A 3TH6A 1YYAA 5C0QA 4KRTA 3K4DA 4A3UA 5EY5A 2QXWA 3FA4A 1WDWA 4IFRA 3LLDA 2A5HA 1JPKA 4ZE5A 3VFCA 3IIOA 1R0MA 2WLZA 3AS2A 3REQA 5F4WA 2CBJA 1EIXA 4JBRA 2GL5A 1Z8AA 3PG9A 3ZS4A 3L4UA 3T07A 3TSBA 2NW0A 1EWDA 4BKNA 3SRHA 4R85A 2VM8A 1SJBA 4RE2A 4XG1A 1HIZA 5EBAA 3M07A 1VYSX 2Y1HA 3BAYA 4B9ZA 5JH1A 2EHHA 4P7OA 4FAMA 3MSRA 4W7UA 4U2YA 2QV5A 1NDYA 3M0YA 2PWGA 3D46A 4IT1A 1TWIA 3B0PA 3THCA 2XH4A 4GZJA 1EBGA 3G1HA 4I8DA 3F2BA 3WQ6A 3CTLA 4V1XA 4HU8A 3CHEA 3NZGA 2C15A 2JGQA 2X0HA 5M03A 3E74A 4L1WA 1PIFA 4MVAA 2WVVA 1AA1B 1FWSA 4RDVA 1B3OA 4B4FA 4E8DA 1YNPA 4HA0A 3B0VC 1GORA 2RDUA 1GKPA 2ZZ3A 2BY1A 3NURA 4TVCA 2V30A 1OYBA 4XVEA 4G7FA 3GH5A 2I16A 3AMKA 1DTUA 1GZJA 3SCNA 5G4WA 3I3BA 3QN3A 4AD0A 4AVNA 1EXBA 5JIWA 4AISA 1ODUA 3R2GA 3ARVA 1XC6A 1JQXA 3ARRA 3GHUA 3SCQA 1XISA 4JTRA 4LC8A 1LDCA 5CPOA 3RX3A 1UKPA 3LBCA 3CZGA 4RKAA 4YIWA 3GY1A 1RQBA 4PB4A 3A22A 3HFTA 2XWEA 1XD1A 3LD5A 4PEEA 2YXXA 5LA0A 4IPLA 1R46A 3DBPA 1V0NA 4PE8A 1ICPA 4UTTA 3SUWA 3POCA 4H2HA 3PZTA 4Z2IA 4Y9MA 4LY4A 2OT0A 1JYXA 1Z3NA 2E77A 1R30A 1E0XA 5J5RA 4F3HA 2GVEA 1UPMB 1V4YA 3WQ4A 3MO4A 4A3YA 1TR1A 4LYKA 5A2BA 3RAOA 4HPXA 1RH9A 1X6NA 2O9TA 1K9FA 1QU4A 4HZMA 3EWWA 2B31A 1XUUA 4HNCA 5FESA 2POTA 1AZ2A 2PLCA 4D6IA 4OQVA 4JKLA 1ELSA 1IEIA 3GG1A 3IJ7A 3B8VA 4K8GA 3K5XA 1UH4A 3RU8X 5T9BG 4E4PA 1U5JA 4D8ZA 2XFYA 2OMAA 3OHMB 3S9YA 4OBTA 5U4NA 3GR7A 4ZQMA 1FY6A 4YL2A 2OLHA 5GNXA 3WX7A 3WBXA 2YYUA 1PCKA 5T8GA 4P8VA 4C7FA 1YDYA 3T4WA 4AIOA 3P8JA 4H9TA 4TX8A 4Y9PA 4GQGA 2WZMA 2X1IA 2WWDA 2PDQA 5G1TA 1Y65A 4JHZA 5KZEA 1AJZA 3H2CA 4FI4A 2P0IA 4AAJA 3N19B 3CMFA 4A2SA 2XIMA 4GXPA 3E49A 3WMBA 3SIZA 3F1QA 1IEXA 2MANA 4DI9A 4IP5A 1BEUA 1TQJA 1FKWA 2TPSA 5DBUA 3B9DA 3VGBA 1OFEA 3B03A 1J0HA 5FIPA 3W25A 1SQ7A 3HTWA 3MWAA 3R89A 3LPPA 3OB8A 4JS3A 1XP3A 4ADUA 1K1DA 2TODA 2RAGA 2Q8XA 3PBVA 1Q2SA 4UTFA 3L12A 2V38A 3RO6A 3W2NA 4A3RA 4YCOA 3EBVA 2TAAA 1TUXA 1MW0A 4WLCA 2PGWA 4BJHA 1EGZA 1I0BA 5LHFA 2CLKA 1TPC1 4H01A 5GJPA 1I0DA 1JYVA 3C0QA 5I77A 1KM0A 3IANA 1Y5VA 1DWHM 3SY1A 1XYCA 1QRQA 3TW7A 1ICQA 2GJRA 2V81A 1W0MA 1RVGA 4MIMA 2PF0A 1TQXA 1XGZA 4JGDA 4DBUA 1MNSA 4K1WA 3O15A 4Z2JA 2I17A 4GFSA 3Q58A 1G4SA 1TPUA 2W61A 1V93A 5A8MA 1AQMA 1XLHA 1DHPA 1JG9A 3UXKA 4Y8FA 1F07A 2AKMA 3F4WA 4L61A 3VMNA 5DMMA 3AUOA 4Z1DA 1QBBA 1EEXA 5G2WA 2F7FA 4MDPA 2VFIA 1ZQ5A 2W67A 1V79A 3GTFA 1TG7A 1RJQA 1M7PA 5HBFA 1EOKA 1PEZA 3BOLA 2BVTA 1H1YA 1XIFA 1UUQA 3ZYZA 3DYOA 3EXTA 4AQLA 2NXGA 5ABHA 4W85A 1VFOA 3NZ1A 3GUGA 3W85A 5DY2A 4H00A 2ZRWA 4IFKB 2ZTKA 2QMJA 4IF2A 4P8XA 3TVAA 1VRDA 3L5LA 4KRZA 2D23A 1IT7A 2QVNA 4DX3A 3LEPA 5CSUA 2V2HA 2VRKA 1CGYA 2IQTA 4M7TA 4CQDA 2DH3A 4JNZA 3CQHA 4XBSA 3H2FA 4EKJA 1ZBKA 3E6EA 3S2MA 3NDZA 1AD4A 2BX7A 3WQOA 4N6FA 1C90A 1XCWA 1OCQA 3HPZA 4ICCX 5EMUA 1XLEA 2Z00A 4FNQA 4AW7A 1Q6FA 5FCZA 4FZIA 3UA3A 2IUZA 3E38A 3LZ5A 3SECA 2E8YA 1FH9A 2XH0A 2YOCA 3A9IA 3O05A 1EEPA 4Q4KA 1WQ5A 3GVRA 3N25A 5HJXA 4W84A 5D05A 3WK2A 2VCAA 3N6HA 4UUIA 4EACA 4GZIA 5E09A 4BF7A 1VP5A 3WLQA 2PDCA 4MLRA 1IF2A 3QV9A 4O17A 1AW2A 3EOLA 1UMYA 4AZ7A 1DJXA 4L9YA 3TWBA 1EHNA 3GXPA 4GQBA 2JKEA 4IFKA 4ZB0A 1QO2A 2GQ8A 3TYZA 1RCXB 2FDSA 1K7XA 1XX1A 1QDSA 2WM0A 4I5XA 1EYEA 3U7VA 4LCSA 3NXLA 1OT1A 2QCGA 2CHOA 4G7EB 2QF7A 1TCMA 3ZR5A 3WD3A 5AC5A 2GJNA 3TC7A 2QMKA 2WMGA 4HPHA 3MSGA 5EPDA 4XB3A 3WK3A 1F4HA 1W3KA 3ARQA 4IP4A 2IQ0A 3P80A 3RJXA 2C18A 1R7OA 3URAA 4QS6A 2EJAA 3R7MA 1B31A 2QNEA 3CPRA 4GKTA 1CLXA 3ZLGA 3QR3A 1J0JA 1EPVA 3NPVA 3M0IA 3DENA 3L0NA 4KETA 3AXXA 4GYJA 1GYLA 5H1WA 1SFLA 2H8ZA 1SZFA 5EMYA 1HT6A 3UESA 3PNUA 1REQA 1L6YA 1VJZA 2G3FA 4JY9A 1LJYA 3ZSSA 3P8IA 1XR2A 3WLLA 1A5BA 3GNXA 5I3IA 3S2CA 1XIBA 2QHAA 4K36A 3S5YA 1VEMA 1XW8A 4PMRA 4E8CA 4G7EA 4CUCA 1Y5WA 3EKGA 3CQKA 2ZYFA 4IMGA 1HJQA 3TKFA 3PB2A 2VO5A 4I6KA 3MMUA 1N8FA 5RUBA 4XO7A 1CXKA 4BZYA 1ME8A 1NAL1 4LY8A 3HMCA 5M17A 1E40A 1FWFC 4PMNA 2YB4A 2DFAA 4MUPA 5KINA 2GUYA 3FFSA 3IAPA 2ICSA 5FF0A 3WMLA 2HDJA 4ZO8A 2GGJA 1Z42A 4ERAA 3U6WA 3SY8A 2R24A 1ONEA 4EPBC 1Q6QA 1X97A 4AX6A 5CG0A 3QC0A 1ALDA 5J5DA 1JXKA 2Z29A 3QGAC 3NZQA 1B9BA 2WJEA 3MI6A 5DMLA 3GE7A 2HPIA 3HGSA 1DXEA 3FN9A 3V5FA 7REQB 5HR7A 4ZB2A 3SY5A 3PPFA 1R2TA 1CNVA 4I9TA 4JN7A 2WOQA 3ZXWA 3MP3A 3D3FA 3HN3A 3OTRA 2J7FA 3LK6A 4AMCA 1F3WA 3TLQA 4PMDA 1V0MA 1W1B1 1T6MA 4YWSA 5JQ9A 1K6AA 3BVJA 3VE9A 3MMTA 1F3EA 1KXVA 4KKXA 4AZHA 1IT8A 4NI8A 5HQMA 5CPSA 4HZ8A 2ISVA 3BE7A 3AIEA 3QYQA 9XIAA 3ZJ8A 4JTGA 4ASTA 4IPPA 4PYSA 1YHTA 3L67A 4KT2A 3DFYA 2HNHA 3B8IA 2VR5A 3AHZA 1QK2A 5HUOA 2DY3A 2DZXA 1R6WA 4QEEA 2F61A 1JEZA 4IX2A 4QE5A 3BLEA 4QBXA 4C6MA 1KXHA 1B30A 5BRBA 3EEZA 3BTNA 1MSSA 4Y8EA 3V3WA 1P5BA 4URIA 1QCWA 1KRAC 4C6JA 3RFAA 2QGYA 1HL9A 4R34A 2C1GA 3MMWA 5XIMA 2QT3A 4HMDA 4R3UA 5DT5A 4H1ZA 2PWHA 4Y7EA 3BARA 1E5JA 4GD0A 4GY7A 4M5PA 3WLPA 1RPKA 2XZ9A 3NYZA 4NNBA 3M0LA 4QAIA 3TCEA 4HYWA 1BPLB 4AD1A 1M01A 3LM3A 2CWXA 4PL1A 2VEKA 4QJ3B 2GGEA 3W4RA 1Q7ZA 3MWCA 3HG2A 4LRSA 1PB0A 5A5WA 4K7VA 2BY2A 2WJFA 1J6OA 3S83A 1MZHA 2HVOA 3UPMA 1ECQA 3L21A 1DQWA 3F5JA 3NNTA 5I3JA 1XD0A 1C8YA 4LBUA 4AC1X 3GXMA 3OZPA 2ZZ7A 2ZVRA 3GLCA 3OW1A 3ITGA 1OC5A 4DPQA 5FAGA 2O9RA 4W87A 4EK7A 2ZXQA 1OT2A 4N4QA 2W79A 4AD4A 4N9DA 3UJ2A 5LNVA 3VA8A 5C2GA 4LEQA 3VDHA 2CKSA 4CD7A 5C7VA 4JTFA 2WHLA 1A5AA 4YN5A 3W7IA 1YQ2A 3GXIA 4KFOA 2ZE3A 3VC6A 1EYWA 1B3XA 4GYKA 3P3BA 2HBVA 3WDHA 3U48A 4BHYA 3U5YA 4I9JA 3G3DA 2YA1A 3L5AA 1KCKA 3GFXA 3SUTA 1HKWA 4JPGA 1ECEA 3SFWA 4OWGA 3GKFA 1X8FA 1A4LA 4UWMA 1E4MM 4EE9A 1C7TA 3N2OA 4A05A 4L5ZA 4KIRA 1XS2A 5F1VA 3KM8A 1S3HA 5A6JA 2ATSA 1TJRA 4BCEA 3NSMA 4CQAA 2IKHA 1ZAIA 2W62A 1TTQA 3DKLA 3BCFA 2NLYA 4A6GA 3WBAA 3LPGA 4O4WA 1JPDX 2P53A 4TQTA 4YTTA 1JFXA 4XZNX 2YFOA 4JTDA 4JQAA 1A3XA 1AFSA 4WDTA 1JQVA 1P1MA 5HOSA 1I2PA 4I90A 3PZMA 4QG6A 1GW9A 3DIPA 3BGJA 2PZ0A 4REQB 1A5OC 1W1TA 1MUCA 1FP8A 4HU3A 3HFYA 2VUNA 4CNNA 4E2VA 1S38A 3R8GA 3P74A 4K2SA 1JZ5A 1KC7A 3B05A 1UJQA 3A64A 2J7EA 2D0GA 3S6OA 1M7JA 4E2BA 1EP3A 3AXMA 3OA5A 6XIMA 4QJ5B 3A13A 4O1AA 2VOTA 2WW5A 2Z1XA 3TK7A 1UA3A 5CZ0A 5GJMA 3IJ9A 1A80A 3T55A 4LUJA 4IGSA 3NM1A 3P0XA 3MI3A 2REQB 4CQ9A 4UTMA 3LHWA 1EQPA 3CXOA 3PULA 4ROPA 2XM1A 3LTPA 5AC7A 2ZUMA 2PA6A 2RKXA 4AWUA 4N9EA 3S2LA 2ZKMX 1TJ0A 4HSHA 7A3HA 1ADSA 4Z2KA 4H7CA 4QSFA 1LLWA 3LPFA 1ZRQA 2RDWA 1W5QA 1BD0A 4MF4A 3CYVA 4FALA 2Z2UA 4WXZA 1TVNA 5ABGA 4REQA 3FLUA 2R9RA 1FA2A 5IOBA 1GTEA 3LXBA 3NO1A 2WANA 3FS2A 5EMKA 4JFTA 3H2EA 3NCOA 3ITVA 2R1LA 3MA8A 1HL8A 3ZT6A 3OLEA 3AQUA 2WB5A 4W9TA 3C61A 4LCRA 3FJNA 1TYGA 4B91A 3CHDA 4XV0A 1ZY9A 5IFTA 1J0IA 3VCRA 3VM7A 3G3MA 1IXOA 4WJ8A 5AOUA 4ZVJA 2WNNA 2BDQA 1W91A 3I6EA 1AODA 1X6LA 1X7IA 3BAXA 1GKQA 1OCBA 2REQA 1KFWA 1TVPA 3KRZA 4UTIA 3T44A 2WWCA 3W01A 3B04A 1VH7A 2DT2A 1KO0A 4EWND 1GTHA 3IJ8A 2BMBA 2WKJA 3AISA 4U31A 1EJUC 2JBMA 3C52A 3ZJKA 2GWNA 3WD2A 1TZ7A 4JN8A 2XWDA 1J8VA 4PTNA 4ERGA 2Q71A 3V16A 2VNCA 4XZBA 5F2MA 1ME7A 3NA8A 5HR6A 1E6QM 1PKYA 2XFWA 4HOZA 5EMJA 1WAWA 3OGVA 4HD5A 4PZVA 1XUZA 2E68A 3NO5A 1ADOA 3G6MA 3BSGA 3S5NA 1Q63A 4P5UA 3VD5A 3ECQA 3EDFA 2TRSA 3PTKA 1XIIA 4LYRA 2D2JA 1SO6A 2IKGA 1TB3A 3T8QA 4ICNA 3VDBA 3GNDA 2XZ7A 4TX9A 5I3FA 1GPWA 1A5SA 1VJIA 4INFA 3P14A 2Z26A 4AD5A 3WDQA 4GYPA 4I6VA 3CASA 3LU2A 1MYRA 2FFIA 3W82A 3QPZA 5CJNA 5EMLA 3AU6A 4J3TA 1V02E 4B3KA 4QNWA 3W72A 4IICA 5HPCA 1NF0A 2BXZA 2WPGA 2YL5A 4I7WA 1TE6A 4UZUA 3HJEA 3WENA 2WMIB 4UMAA 1WB0A 1WYIA 1VHCA 2XINA 1GVRA 1X98A 5DCBA 3OZMA 3WUEA 3AROA 2AL2B 2ZRZA 3BW3A 1PWLA 1SO5A 3DAQA 2YCIX 3AOFA 5AECA 1WZAA 1OEPA 3EX2A 3WUBA 2Q09A 4XZIA 3ARPA 1FDJA 4P7RA 4Z42C 2HS6A 3SB0A 4CVUA 1KR0A 1R9XA 3CT7A 3IGXA 3RRAA 1KFEA 3O6CA 2ACQA 5FEWA 4M19A 2VWTA 4J3WA 5DEZA 3I65A 4EWJA 1PZ2A 4Z08A 3TXVA 2G37A 5LIKX 1EJTC 4LUSB 3WJWA 3PY2A 5D33A 1YE4A 3ES8A 1UHVA 5I3DA 3EYPA 3OZYA 1HKIA 1Q66A 1K7EA 3OVQA 2C14A 1GOKA 3CUIA 3C3UA 3INPA 1BVZA 1SMAA 2GDUA 1FX6A 4ZODA 2QEZA 3WK1A 2PB1A 1XCFA 4JTAA 1V08A 2EKGA 3GS6A 5I78A 4GY1A 2DORA 4HPGA 3VOFA 3VIJA 2AL2A 3T4CA 1JD9A 2Z1WA 2HTMA 3MUZ1 1POJA 1L9WA 4MFDA 2P3EA 1CEOA 2QVHA 3QHNA 1WDSA 4G1NA 2H9AB 4YCPA 3B8UA 4KMQA 4LCQA 3R43A 4C90A 1VRXA 4PTDA 3TNBA 4JQ1A 4JHOA 3UW6A 2WZHA 1C29A 2XN1A 2INFA 3O1NA 1MQPA 1QMLA 4NI3A 4X2RA 4LUSA 4MNJA 2GSJA 1R47A 5F2IA 5EGRA 1BFNA 3W00A 3NSNA 4E2OA 3WQCA 3QY7A 1MW3A 3V75A 1Q85A 3HJZA 1GOWA 4O50A 3L2IA 1A0DA 2R82A 2XVPA 5LGXA 4GVGA 2V82A 3JZEA 1HXJA 1XDJA 3B0YA 2HS8A 5HJYA 4GVIA 5H91A 1JCJA 1PAMA 2Y8VA 4JN6A 1QW7A 2PDFA 1JL8A 3HURA 3K8MA 3O6YX 1WAUA 5H6HA 1EC7A 3L4WA 4BI7A 2CZFA 2IXUA 2WVTA 1XKJA 2YCJA 3EOUA 4A22A 4Q6XA 5A6BD 4L1XA 3VCNA 3Q65A 1EOMA 2H9AA 4V27A 2CXEA 3AIUA 4GNVA 1OFAA 3FNDA 3BUVA 1CXLA 2Z2BA 1GQIA 1MUWA 3AYRA 3C8FA 4XBJA 5E0KA 2XSXA 3WQVA 4ICMA 5H2ZA 1A47A 1TA3A 1E0VA 1WCGA 4CNOA 2FTPA 3EWCA 2E9MA 3CQIA 3P84A 1XG4A 1Y5XA 3LM7A 1UR8A 3GVWA 1NFPA 2DZPA 1G9HA 2WV8A 4O28A 4HPNA 3VIIA 3IIZA 3BDKA 3WQDA 1HF6A 2PWEA 1BF2A 3TA6A 4ATDA 3K46A 1Q6DA 5IBXC 2C1HA 4CQCA 3AXHA 3W75A 3BURA 2GLKA 2WNZA 2ISDA 4MAZA 1YEYA 1L6WA 4K8HA 3HA1A 1E6RA 4AVOA 5D2WA 3UG3A 4JTLA 4B4HA 3LLXA 1BKSA 2H3DA 1A5MC 3L2MA 5AZ1A 3BV7A 3MYPA 3PPGA 1JUKA 4S3AA 3VDGA 3MVTA 4NILA 4G2DA 5LIWX 3U9IA 2OODA 3M5ZA 4AWSA 1FH8A 2QCCA 4XK2A 3RX4A 4JL2A 1R38A 1E6SM 2WSYA 1YPFA 1GJWA 1O1ZA 1XICA 2DUXA 3T05A 1UKOA 5F2GA 4WXYA 3L23A 4CD5A 1FVPA 2Z24A 4ZXOA 2IPFA 2XPKA 1K03A 1MQRA 1DEDA 5AHFA 2JGYA 5BYWA 2V3GA 2JIWA 3SFKA 1P0BA 3ZT5A 2WSRA 2LLEA 3EMQA 4DZ5A 4EXQA 1QASA 2FPYA 3F5LA 1W6TA 2DZWA 5AHLA 1D7FA 3KFTA 3V0UA 4YXGA 4XAPA 3NQ2A 2VYOA 4IQLA 1HL2A 4O1DA 3THDA 2X0SA 3W1PA 2GVGA 3PBYA 4OOUA 5D04C 5I23A 5CC6A 4B2DA 4MWAB 2TSYA 3PZOA 4H7VA 2OCZA 1EP2A 2X1TA 2UY3A 1XYFA 2IKIA 4K68A 4IIBA 1QNRA 2WO5A 2BNJA 3GHSA 3HOJA 3ME3A 3T0DA 3PFRA 4AIUA 1VKFA 4QG8A 1PE1A 2PP3A 2WSQA 1DE5A 5DXXA 3FAWA 2VQUA 5KZDA 1KFLA 1W1YA 1XDLA 4Q8VA 3MV11 3AJ7A 3THAA 4IZGA 3SJ3A 4E3TA 1V3IA 4OU1A 2CXGA 1FRBA 4ZENA 4EAMA 1YXDA 2X7VA 1KWKA 1CZ1A 3AYSA 5I3KA 3FDGA 3BMVA 1UKTA 1TTIA 3ONBA 1L6FA 4XUGA 2PWFA 2ZXBA 1IEQA 2ACUA 4MNLA 4B15A 3TW9A 1KTBA 1XLJA 3FA3A 3USZA 1OADA 1XDMA 3MMDA 4N4PA 1UA7A 3H2OA 1TPDA 4MWAA 3KXQA 3ZLHA 2D24A 4O0QA 1MWOA 2D0HA 3WNLA 4GXMA 4NP7A 4K39A 3T2OA 1D3HA 3KEHA 4R9XA 3EXRA 3BJTA 4OUEA 3KBWA 3T81A 3KTXA 4Z0SA 1I1XA 4Q4RA 1H7WA 2E9BA 2PDHA 4UNKA 3TAOA 1W1ZA 1QNSA 4GBDA 3S47A 3SCPA 5HNRA 3EZ4A 2QDHA 4DBWA 3NXFA 2QJMA 2PCEA 3QHMA 3JRKA 3H54A 2RJGA 1R3RA 2NVAA 2ZA1A 2QUVA 1HNYA 2A6LA 3ERPA 1H4PA 2HSAA 2AAAA 5BXRA 4J27A 3FK4A 5JMUA 3WLIA 1KKRA 1ODZA 1UROA 3H24A 3M0JA 2HJPA 1A4MA 1XSIA 2OZ3A 4GIEA 5A8GA 3A4AA 3PANA 1G4TA 4BFAA 2WJZA 3W23A 3UQNA 4QCEA 3SBFA 1RALA 3CJPA 3GC2A 5FA5A 1TJPA 2A7RA 1GVSA 1XGDA 3N3MA 3GK0A 2YIHA 4AZGA 3D3AA 5K4ZA 1OG0A 3KHDA 2Y5SA 5G4EA 5A94A 1GZ1A 2QUUA 5XINA 3M47A 1KM5A 1JCMP 1FWGC 1KKOA 4L7ZA 1S2CA 2FIQA 5LGZA 5JBFA 1VHNA 5HXMA 2RGMA 1RBAA 3OIXA 3OQ8A 3IAQA 3SUSA 2ZOXA 3CZEA 3OO2A 3VDAA 4IIDA 1GK8A 4UMCA 5T26A 1OX5A 3VC5A 2IMRA 4DYJA 1YRRA 3W74A 1G94A 2A3HA 3N9SA 4ZTXA 3ATZA 2VZSA 2KZHA 3WNNA 1FCUA 3LOTA 3N11A 1L2QA 3BAWA 4DAFA 4AF0A 3DHUA 5KITA 1V8EA 4Q4OA 2WCSA 3M41A 1AQFA 1DL3A 2X1UA 4Z1CA 1A0EA 3T9PA 1EZ2A 1VCFA 1SPQA 1HJSA 3CBWA 3FYOA 4DLMA 3SAZA 2E6DA 2ZWYA 4NAEB 1ITQA 1QJWA 1ZBWA 2PU0A 3S2JA 3BLKA 2FTYA 2V0TA 2J77A 4NXKA 1IGSA 4PB5A 4RLIA 1W9DM 3H55A 1UBSA 1ZL1A 3ES7A 4DBSA 2YLLA 4LB3A 3PPCA 3WQFA 3LI0A 1B5TA 1R3TA 4CQBA 7CGTA 1X8CA 4DJDC 3RG6A 2PDJA 4O11A 4AG0A 1R87A 3XISA 5LHEA 4TTGA 4N6EA 3WFZA 4AYGA 4IMDA 3EX1A 3FHAA 4GJ1A 3LRMA 4UOQA 4Q3MA 2BZNA 3JUGA 3R25A 3URNA 1A5LC 1CT5A 2VT0A 2I5GA 2V3EA 4RXGA 4FLQA 3RM4A 3DFQA 2G50A 1ZP3A 4F0MA 3DXIA 3VD9A 1XYMA 3WEOA 2EEXA 3CIXA 4Q22A 1OVDA 2FGBA 3B8SA 1EQCA 4B5SA 3W1MA 3G0SA 4Y96A 4BI6A 2WC7A 2Y7DA 4HMCA 4JYDA 5LXEA 2NSXA 4RDWA 3UFYA 1YLVA 1NTHA 2FH6A 1HKKA 1G6CA 3G1AA 3T40A 2E4TA 4Y6GA 4PCSA 4YHGA 1KBLA 4C6FA 1KV5A 1WDQA 4X9SA 3EPNA 3GR8A 5EYWA 3M7SA 3GW0A 3L65A 4Q8UA 2GJLA 1F8IA 3B8TA 4FOUA 5KETA 1HP4A 5BW6A 3KVMA 1Q65A 4NSBA 2DZTA 3FKKA 1IR1A 1ITUA 3RHGA 1TWWA 2ZX5A 5BWAA 5K7JA 5GPRA 4R7JA 2VC9A 4DAIA 4GUJA 2J7GA 5BZAA 4ACYA 5FF4A 3KE0A 4ZZ9A 1H11A 1GHRA 3WQEA 4HZ7A 4PUJA 5BOFA 3W7HA 1AJ2A 3THQA 2X42A 2NVDA 3LA4A 4PUKA 1S5VA 3DGBA 3EOOA 2QDDA 1SO4A 3CH9A 5I0DA 4CN4A 2W92A 5LXXA 3V0SA 4KGJA 4XZHA 2D3LA 1KB3A 1L6GA 5GJNA 1GQNA 3ITOA 3MSDA 7ENLA 1EDTA 2ZXAA 1TE1A 2GJXB 5HULA 1OX6A 4ORIA 3UWUA 1DWAM 2DVTA 3I7SA 4EXAA 4JYEA 3LSBA 4R88A 4J4KA 4EOUA 3NPWA 4LT9A 3TN3A 4UCGA 3N13A 4IPNB 5D9PA 1NFBA 4Q4PA 3PC0A 3GHRA 2CLOA 4H6KA 4C6CA 1HW6A 3OYXA 1PDYA 1GOXA 3TOYA 1UR1A 1I1WA 4UCFA 4MPQA 4ZSTA 4BQ4A 6XIAA 4UQ9A 3CV2A 3DX5A 2FJKA 3GVGA 4NJJA 1NWTA 2VFHA 3KW3A 4QG9A 3QYSA 3WYZA 2GQ9A 2GVLA 1RPXA 2PTXA 2CYGA 5BOOA 5EBUA 2PAJA 3E1F1 3WELA 3BLFA 1UR4A 1ME9A 1Z7AA 2Z1KA 1UB3A 3MJYA 4UQEA 1OYCA 5H8MA 1G1YA 1XLLA 2CITA 4LUTA 3APGA 2YPIA 3AC0A 4P61A 4J3UA 1UIOA 1J2BA 2VGGA 3GD6A 3VU2A 2ZQ0A 2Z7KA 3N2MA 2ANUA 2QPSA 1JRCA 3VNYA 3GNOA 2F9RA 3TMQA 1E15A 3S9IA 3APTA 5CH9A 1QO5A 2A85A 1BG4A 4LGXA 3MP4A 3RF9A 1GT8A 2FPTA 3LI1A 4L1GA 3AIVA 1Q6CA 4WOQA 1KFJA 2VELA 3LBMA 4TV5A 3TTEA 2FTWA 1CIUA 1EJXC 3KL5A 3ABSA 7ODCA 4WIWA 3WH9A 1EFZA 3BO9A 3E9AA 3HQNA 4GINA 3TX9A 3O06A 5IDIA 4QXIA 3RIKA 2DSWA 4MM1A 3SIMA 3Q4DA 1E9LA 1W37A 3L4TA 4FIQA 3W7MA 2JEPA 3C2FA 4WJXA 5DXYA 1XCXA 4AHOA 3LZ3A 4DJEC 1HN1A 1FDYA 1TPFA 5C71A 4O8AA 2CHRA 2OG9A 5FL0A 3VNMA 3NVTA 2CEQA 4OT7A 4JX5A 1CI1A 1LWJA 1QI3A 3M5YA 2XH7A 4XWUA 3WH5A 4W88A 2YBUA 5M1TA 5FF3A 1EP1A 3QQ1A 3OYZA 3BAKA 1F61A 1XIJA 5A8NA 3WMCA 1GVEA 3QY6A 4FF5A 3L68A 3EWXA 1US3A 4PCTA 2ZC1A 4LVBA 1CECA 4QISA 3GFZA 1XIEA 4KWWA 4PTMA 1UOZA 3I3EA 1W8GA 3OBAA 1J5SA 3AMDA 3A9BA 3N12A 4BQ5A 1V77A 4UFJA 3EKZA 4J3VA 4IMEA 3QW4B 4QDMA 4Q7IA 1ONWA 4IL2A 4Y2WA 4IH3A 5G1YA 3VINA 3K1GA 3S0CA 4MUZA 2WMHA 4MG4A 1NDVA 1PCWA 5CAHA 3LCWA 1GONA 4EPKA 1ICSA 5E0CA 2NT1A 3W24A 4OFCA 1UP3A 4I7UA 5C55A 4QLJA 3NJ3A 4A35A 4U2ZA 2HQAA 4XKMA 2PSNA 1UWAA 3SURA 4DUXA 4XSMA 1W5NA 1AH3A 3FVDA 3QFWA 4O4VA 2CBUA 5EMMA 3T2PA 3ZLFA 3VUPA 5ENLA 4TIMA 1FWBC 2CHNA 3PZIA 4DXXA 1EJVC 2HE5A 1D2KA 1VBGA 2X16A 5EL1A 5TBOA 3NWRA 4IFOA 4AY8A 3MBFA 3HG5A 1JGMA 3SGZA 2VTFA 4G6CA 1OBAA 3UT0A 1CDGA 1F76A 4QITA 3W2UA 1YX1A 5F7UA 2OPJA 1FOBA 2INZA 2R1KA 3CHFA 4FNTA 3CK5A 1LG1A 4FF7A 3Q67A 3TYEA 5G1MA 4DYEA 3UXDA 2ATMA 8TIMA 4MDOA 1XIGA 3E0WA 3WJZA 4AZCA 3DFHA 3WF1A 4GGHA 1XM3A 2PDWA 1XG3A 4N2YA 3LN3A 4HHMA 1S46A 3IVUA 1EZWA 1HJUA 2OX4A 4IGNA 3GSMA 4XVDA 4F2BA 1HVQA 2X2YA 1MRAA 3F7JA 8XIAA 3ZJ6A 2ISWA 1Z9AA 4QE1A 3EDDA 3DHFA 4JDYA 4PSRA 4NQ1A 3N34A 1EJRC 3VABA 1WXYA 4IGMA 4FO4A 3VIOA 1DWGM 3LERA 4A8IA 3TJLA 4HHPA 3F2CA 4N9CA 1P7TB 2X8RA 3HPFA 1EXPA 3MT1A 2ZICA 3VI2A 3E02A 1EBHA 1Q5MA 4RNHA 3ITTA 1IXPA 2Z28A 5M2FX 3GVQA 4B2DD 4JL1A