4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
4WD5A 1RQQA 4DFNA 4HGSA 4C06A 4O86A 1FJXA 4AAAA 1U2ZA 1OZ1A 4UBAA 5DG5A 4KIOA 3IPHA 2UW7A 4FGBA 4E33A 1GJOA 3L8PA 1PF8A 3A8XA 2RGPA 3SOCA 2FSLX 3SRVB 2JLDA 3LIJA 4ZSLA 3R7VA 2QCSA 3RJCA 4E6CA 5BMSA 1AF7A 3ENMA 2EJUA 3E8NA 3QRTA 4YMHA 2FK8A 3KN6A 4PDPA 2G70A 3NTVA 2PUNA 3BE9A 2OWBA 4TWCA 3DLZA 2P3OA 2RFSA 5IQEA 1J7LA 2AOUB 2ZTHA 2UYHA 2BUJA 4FKQA 3LFQA 4D0WA 2NXCA 2I62A 5FTQA 4B4LA 1XDZA 4DYMA 1WBSA 4C59A 1GIJA 3VO3A 2NP6A 1CDKA 1IAJA 3ZXZA 2WOUA 4V01A 5HG5A 1VYWA 3BLRA 4IAZA 5BVDA 5HTCA 4EK9A 1CTPE 3FSKA 3G5DA 4ANMA 4FSWA 4P58A 4CKBA 2QODA 2Q0NA 2GB4A 3ODZX 2P3QA 4QP2A 5IKMA 4XYFA 3GCQA 1OUKA 4U0IA 3T3UA 2GPYA 4Z2YA 3QWKA 3M42A 3POOA 4W8DA 2E9OA 3F2AA 4WRSA 2C6KA 2YM5A 3VYWA 4JDJA 2PGXA 4PCAA 4A6DA 2QE6A 4BCPA 3GI3A 2WAJA 3BGQA 3S3IA 4BZOA 5M06A 4IDTA 2XA4A 3RALA 3TUDA 3DR5A 4LFIA 3T7SA 3OOMA 4GG7A 4DH8A 3DXXA 2BDFA 3KQYA 1KE8A 2XCHA 4QP4A 4GEKA 4Q5EA 3PB3A 1YRPA 5EOBA 2W7XA 3GVUA 3ELYA 5E8TA 4QDKA 3UYTA 5FGKA 5AUTA 4BY9E 5EQYA 4DH7A 4W4WA 3FZGA 2ITXA 2XNPA 1YHWA 1FBNA 4C4EA 4CQEA 4E26A 5TKDA 4EONA 3R83A 3S95A 1L3IA 3VUIA 4XP0A 3BWJA 3P7BA 3EYHA 4A4XA 4G3FA 5IA1A 2DULA 4F86A 1H0VA 2XJ1A 4ZMFA 1NBHA 1RI1A 3QALE 5FQOA 2YIQA 1JSVA 4MAOA 3BRBA 3QC4A 3VW6A 3GJYA 3SSNA 3GP0A 1YQJA 2Y0AA 2ITNA 4L8MA 2OI4X 3KU2A 2XBJA 5C8MA 4GT3A 4F85A 4FSXA 4HOKA 3II5A 2IH2A 5D11A 1FVVA 4GYGA 3TNHA 3TV4A 3EFWA 4E4MA 4F1MA 2ZWVA 2Y1XA 3TWJA 4TN6A 4BCMA 3NWBA 2XVDA 3FDNA 1YF3A 3A7JA 4LQMA 5KQRA 5BNJA 1NV9A 2GS9A 2HY81 3LW0A 1T43A 4OR5A 4C3RA 3EL8A 3R1SA 5AP3A 4DINA 5D10A 1OMWA 4XH6A 3DY7A 1W83A 1UFKA 3FRHA 5FADA 1OBDA 3A8WA 3N4VA 3A7EA 4IWOA 3WYYA 5CU3A 3BHYA 2B0QA 2R0UA 4YHTA 4ZTSA 3E3BX 3KQQA 4DKJA 2FYSA 4QP1A 4X61A 2AVNA 4TL0A 4M8TA 2I6GA 5K0BA 1M52A 3PE2A 4IVDA 2X0GA 1U5RA 2JKQA 4EK6A 2I0YA 5HU9A 4IB1A 1ZLTA 4TTHB 1MRYA 4OA8A 4IWQA 5CSPA 1YKRA 2W1CA 3DFCB 4FBXA 4EKKA 1URWA 2Z7RA 4O0XA 4NK9A 1Q99A 5EGSA 3FZOA 1IA9A 3MDYA 4RC4A 3V6RA 3F3UA 5H8GA 5JK3A 1REKA 3P9KA 3IHTA 4MQ4A 4CKCA 5IZFA 4MWZA 5K0GA 1FQ1B 4F1TA 4RIYA 3CGOA 1DI8A 4RIYB 5CY3A 4HVGA 2CKDA 4QP7A 5IU2A 4QMTA 3P4KA 3MVMA 4QTDA 3SG9A 3G2PA 1H1WA 1J1CA 3R9OA 2ZZMA 5C26A 3DP7A 4UV0A 4AUKA 2R3FA 1G8AA 4GH2A 4OA5A 2HNKA 3DXQA 3F61A 4R8RA 2OLCA 2ZB0A 3GDHA 2XEZA 4FT4A 1M6YA 4QNYA 3EQPA 5FUBA 3O8TA 4WT6A 3LCKA 2CHLA 2WMUA 4G34A 1ZMWA 3HA7A 1PY5A 4MTLA 3QRJA 2WTVA 3UA3A 2P33A 4E2YA 1A9UA 1UU8A 2J0JA 3OY3A 5AP0A 1P91A 3K5UA 2ZCJA 5EHYA 4YSMA 3VS0A 3NAXA 5HLNA 3I5ZA 1WY7A 3V5LA 2JH9A 4EH3A 1IAHA 2VDVE 4FSYA 5KKRB 4EHGA 2JJQA 4RWIA 2HWOA 3RKBA 3IGGA 4LUEA 4MF1A 2OO8X 4I92A 4O21A 4Z3VA 3F9NA 3G90X 1QAQA 4QPSA 1YXTA 3IDBA 3LJ0A 1W84A 5HBJA 3VBYA 4YJNA 4OTDA 3RIEA 3F88A 4A9UA 4AQCA 2I0EA 1JWHA 3ZYAA 4PL5A 3AD4A 1ERKA 3C4XA 4GFOA 4YSJA 4EJ7A 5TO8A 5AP6A 3LOKA 4FNWA 4GFMA 3R21A 2GNLA 3FLYA 2VD5A 3GOPA 3ORTA 3QTXA 1F38A 2V7OA 2QR8A 3OCTA 4ZJJA 1JSXA 3OU6A 4FZDB 3R28A 4CLIA 2X4ZA 1I9GA 4OQDA 5CAVA 3DTWA 2CKQA 3GT8A 5K0FA 3LCCA 3BHVA 3C13A 3LJ2A 2JFLA 4O6EA 5IQAA 5JFVA 3A7HA 4PDYA 3TLJA 1YVJA 2O64A 3F2RA 3EZRA 2Z60A 5A4CA 2B78A 2ZM1A 4FK3A 4QMXA 2WTWA 3TEIA 3PA3A 3A7GA 3C4EA 3LXNA 4YJOA 1VQ1A 2PT9A 1GAGA 4RZVA 4DGOA 4FKGA 5CQWA 2HW6A 3CTHA 2VWZA 5I9ZA 3NNVA 2G2FA 4KBAA 2HELA 4OUCA 5EH0A 4O0SA 3UPXA 1YB2A 3FI3A 3E8SA 5DT2A 3FRIA 4C08A 5K8VA 3JWIA 4CFXA 2ONLA 1YXSA 4AZSA 3HA5A 4B6LA 3P5KA 4FR0A 4KRGA 3T9IA 1JKSA 4QQ5A 4A7CA 3OHTA 2OXXA 4WXHA 3VBVA 2A1AB 1ZG3A 2OH0E 4LOQA 3UZPA 1OL6A 4CXAA 2B53A 4CKIA 1MP8A 4H0NA 2QHNA 4HPTE 2QKRA 3VS4A 4ER7A 4I6QA 5J1VA 3CXWA 2O0UA 3MH0A 3P97A 1JQHA 4OTQA 1WBVA 2B54A 5AJQA 2QI8A 5IG1A 3EB0A 4FVPA 1OUYA 4N4SA 2Y4IC 4FIJA 3TL8A 4J95A 1R0EA 4Z7GA 3ZBXA 5IQCA 4FTKA 1RE8A 4L9IA 4TNBA 3ROYA 2KW5A 5CWZA 4RWJA 4PYIA 2OO3A 3FHRA 1SVUA 3LAUA 3RK9A 4C4JA 3KPWA 2QHMA 2V55A 4Y73A 2P0CA 1QCFA 3QUEA 3O96A 4QMOA 3TXOA 5CF8A 3UVQA 4FKJA 3P08A 5IUIA 4R8SA 4L3PA 2GFSA 1PKGA 2R7BA 3V5PA 2AN4A 4HG2A 3O7LB 2C6TA 2OBJA 1WCCA 5LARA 4EK3A 1UU9A 5JRQA 3QU0A 5GM2A 4ER6A 3KPJA 1YWRA 3G2QA 4PYJA 1SMHA 3C0IA 4KD1A 1BC5A 3ZS5A 3DLIA 3UOKA 3MY5A 4AP7A 4BCIA 4G2FA 2CCHA 3DKGA 4K8AA 1QMZA 2YUIA 2EWAA 3C6KA 4QTTB 3N4TA 3LQ3A 1X19A 3COKA 3VQHA 4C0TA 2BRNA 4FK6A 2VTTA 4PQNA 2ZAZA 3QX4A 4PWYA 1O6LA 3MPTA 3QYZA 2OIQA 4DCAA 4MWHA 5CVUA 2UZOA 3I5NA 5AUVA 1H8FA 4FT7A 3ACKA 1OL1A 3QTIA 3W2RA 5F1ZA 4UXLA 4CZUA 2NXJA 3I53A 4WBBB 4F09A 5AV4A 3P2EA 4Y46A 4G9CA 4R3RA 1ZQ9A 4GOMD 1NVRA 2WQBA 1UU3A 3F5XA 4QYHA 2VTJA 4ZSAA 1B38A 1JR4A 1SUSA 4EOLA 2VTPA 4D1ZA 2GFCA 2ZZKA 1JLUE 1YOLA 2ZV8A 2R6ZA 3O2MA 5EHIA 4DMGA 3PA4A 4QOXA 1FGKA 4UZHA 3W1FA 4ACMA 4AFEA 4BHZA 4DEGA 2R4BA 1WBWA 3AC5A 1OB3A 3UBDA 4FIGA 4BLUA 3NDIA 2Y6OA 3RINA 4IH8A 4APPA 4C3FA 4XCUA 1D2CA 3NYOA 3EQBA 1PJZA 2F7ZE 3U6IA 3I60A 4JI9A 4FKLA 4UWYA 3ZUVA 5DH3A 4JDIA 3LCSA 3F66A 4KBCA 4BHNA 2OKRA 4XRLA 5EHOA 3EGVA 3SM3A 4G3CA 2GTMA 3LXKA 1OKVA 1CMKE 2JEDA 1T46A 2UW8A 3FZTA 3QZIA 2YM8A 4GEOA 3VAPA 3VF8A 2ITOA 4I5PA 3VF9A 2UYQA 3EEYA 4HSGA 4W4VA 4YZ9A 4BDDA 3ATSA 1URCA 2E9VA 2GQRA 4YZCA 1TW3A 5ANGA 3PIZA 4QTUB 1KE7A 4CSVA 4HTFB 4RWZA 3DBQA 3C6MA 4V0RA 5HCZA 3OFKA 2GS2A 4BRXA 3DCVA 1XWSA 4QQNA 5HIJA 3W55A 2VGOA 1RI3A 1YHVA 2B9FA 3RCDA 3Q96A 5CU0A 2W1IA 3SA0A 3CJFA 3FTFA 5A54A 5E1SA 2G1PA 3G2MA 2H6DA 4EHEA 3KXXA 4F6WA 5B2MA 3IONA 3VW8A 1YI6A 5FHRA 3ZSIA 2JHAA 1ZMVA 2X8DA 2QU6A 5DI1A 4A06A 4E5AX 5KMMA 4EOKA 3A7DA 3JWGA 5IQGA 4FG9A 2QM3A 3BGVA 3OCGA 2PXXA 4PYNA 1LEZA 4LV5A 2YISA 4EHZA 5DPMA 4DH5A 4CKEA 2XH5A 4R05A 3M6UA 4V04A 1ZMUA 3CR0A 4I22A 4E6DA 5AP5A 3DNEA 4B0GA 4F1OA 3NS9A 1YWVA 5FBOA 1BOOA 4X7QA 3DK6A 3BPRA 1NXKA 1MUOA 3O7LD 5FEDA 5GM1A 4QMVA 3G89A 2BZKB 4J99A 4ATNA 3KMMA 5EMMA 2YABA 4ZSEA 5E92A 2VNYA 5AM6A 2WPAA 5C03A 3L8SA 4PL4A 3CCFA 4FT0A 4L7SA 4YLLA 3WSTA 2IO6A 5GWXA 4EVIA 4RTPA 4K77A 5HE3A 3DTCA 5DWRA 2VTSA 5HESA 2X7OA 2ACXA 3EN9A 3VUMA 2XK4A 1WVWA 4AW2A 1QZZA 5CI7A 2F8LA 5HIMA 5DA3A 5CCBA 5BVWA 5HO8A 4I1ZA 4U45A 2UYOA 2H34A 3V8VA 3AT2A 3DA6A 3GGDA 4C4HA 5E8YA 4IFGA 1MQBA 2HV9A 3V5QA 4EH2A 5CM2Z 5IDNA 4FEUA 3HGKA 3REPA 3TNIA 4H1MA 5DX0A 2GCDA 2HZ0A 3EZVA 3T0IA 3UC3A 4QMWA 1SZMA 3THBA 4D55A 2ORED 1RJDA 1WBNA 2OXTA 4EZ3A 1KUTA 3R8UA 3ZLSA 1KV1A 3O7WA 1M7QA 2ZMDA 4M13A 5E1BA 4RVHA 1X1BA 5E1MA 5B1SA 4U44A 3SKCA 2ZJWA 4WRGA 3AQVA 4E7WA 5LQRA 2PX2A 1OI9A 1WAKA 2VNWA 5AEPA 4QP6A 4NM3A 4XG8A 4F9YA 3A7FA 5LMKA 4QP8A 1H0WA 3OUKA 1I1NA 3OP5A 3P86A 3EGIA 4BP3A 1IG1A 2OZAB 1Q8UA 4BBMA 1QL6A 4GK2A 4NJDA 3AC4A 1R00A 1XH9A 1IRKA 2J7TA 5JSMA 3WZKA 5ANOA 4E5WA 2R3SA 3H9OA 3DH0A 4HZSA 4AOTA 1XDSA 4DLJA 3TIYA 3TI1A 1H00A 2PSQA 5K9IA 3C4FA 4F84A 3DJ7A 4JRNA 4PMMA 5LQFA 2QRVB 4A9YA 4XOYA 3GQLA 1A06A 3ANQA 2WK1A 2YDJA 5FQDC 3GIWA 4FZFB 3HP5A 1Y8GA 4BCQA 4MHTA 5A4LA 2PSSA 4N6YA 2J90A 4F6UA 1NVQA 2UZVA 4EQCA 4TW9A 3VS2A 1QAMA 4GW8A 1OGUA 2CNVA 2QOIA 3QZFA 4ZS0A 2QYOA 3HNRA 3ZC5A 2PVCA 5E9QA 1OIYA 5ETIA 4OW8A 4IAIA 4G5PA 4OBXA 2JDSA 3OXIA 5TR6A 4DGMA 4PONA 3FV8A 4FL2A 2AN3A 2ZFUA 3LL7A 3UJ8A 1ZY5A 2AS0A 4HRAA 2C6EA 3Q52A 5FD2A 3U4UA 4L45A 4NIFB 3I79A 4AGDA 4YUWA 5DTMA 5B2LA 4I5CA 5CF5A 2CN5A 3PPKA 4MBIA 4DE4A 5FHQA 2BROA 3P9JA 4L67A 4BCGA 5AP4A 4AZVA 4GS6A 1BHJA 4QVGA 4Y2HA 4ZJVA 2FYTA 3FKOA 3C4CA 4I3ZA 2C30A 4ZXTA 4AXAA 4EQZA 2Y7JA 4P90A 4IAAA 4ZTLA 3WYXA 3Q53A 4S30A 4G3EA 1RJFA 4RC2A 1XJ5A 2O65A 4EUUA 3AOXA 5LVOA 3UG1A 4D2SA 1WXWA 4RTKA 3OF0A 4S31A 1HMYA 2W99B 4O38A 4PWNA 2UW3A 5H8BA 4YGAA 2JDTA 4YJTA 4KSQA 3NZ0A 3R8ZA 2EVAA 2QNJA 4B9DA 5CU6A 1KIAA 4E93A 2PT6A 2XK6A 3OZSA 3DQWA 4FG8A 4IVCA 2C5OA 2BTSA 5KMJA 4GYIA 2O8YA 4LMNA 3DXNA 2R3NA 3HNGA 2OPBA 4U6RA 1EAMA 4RWLA 5AAFA 3ZDIA 1G60A 4BDCA 2C69A 2VO3A 2ZW9A 3QTRA 4JIAA 3NGAA 5E9JA 3PG1A 5EM7A 2YJRA 4U5JA 2I7CA 4X3JA 4UWBA 4ER0A 1KYWA 1WVYA 5EEGA 4PDSA 1WBPA 4Z16A 5CEMA 3HV6A 3MH3A 5TOZA 4NFNA 3OTUA 3P9CA 4E4NA 4KRCA 4NM7A 5DTQA 2UYCA 5CNNA 3E7VA 3DGKA 4CWAA 5G02A 1AD5A 3R63A 3LFFA 2NRYA 4A9TA 1APME 1V1KA 2QO9A 2F2UA 2JG3A 3KR0A 2W1EA 4GF5A 5HNBA 3ZLXA 4RJ5A 5IUGA 1VEBA 1WMKA 2AZTA 1F3LA 2J0MB 3R00A 5DVRA 3VHKA 3EVAA 3R1QA 4MXXA 5EYMA 3RTPA 2ADMA 1H08A 3BYMA 2XK3A 2WTCA 1OVEA 1M2PA 3Q3BA 5AAGA 3G9NA 3D14A 3QGWA 3QKLA 4HTFA 5AA9A 3UJ6A 2PVLA 2R3MA 3A4PA 8MHTA 2F4JA 4IIRA 2FB8A 4YZDA 5E8VA 3CQEA 3PFQA 2X1NA 3PY3A 4F7NA 4U8ZA 3V8TA 3QCQA 5E8ZA 2W1ZA 4IVBA 4UZDA 3NVKI 2ONZA 4RTOA 2ZDTA 1TQMA 4BTMA 3R1YA 4CT1A 4DFBA 1KXZA 4GQBA 2XKCA 3LMIA 3DKCA 4EOPA 3NNUA 2B2CA 4AFJA 4YUQA 2CL5A 3HLLA 4QQCA 3GWZA 1FPQA 1R8YA 2QKWB 4UEUA 2BRBA 5M44A 2F7EE 3PXYA 4C36A 3ZO1A 3I7CA 3ROCA 2C3JA 5KS2A 2B1PA 3HMIA 5IQHA 3OCBA 5CVEA 3SLSA 5HO7A 4BBFA 4LMUA 4XG7A 4AGWA 4F7JA 1N2XA 5EQJB 4QQJA 3LKZA 4HNFA 2R7IA 5GJFA 4E4LA 4XG6A 3REOA 1EH4A 1BI7A 3Q4TA 3KQWA 3DDQA 4KIFA 5LQAA 1G38A 2IZTA 3LXPA 3LLAA 4P7GA 3HL7A 5EMKA 4I5MA 4BZNA 4DITA 3PJCA 3UNJA 2JAVA 2YM6A 3VJOA 3E23A 2IBTA 4X2FA 1Y6AA 3FZ1A 4FP9A 4YR8A 4GT4A 3HCAA 3KU1A 4UXQA 3NSZA 4CXMA 1DCTA 3NWWA 4JT3A 4R5SA 4YJQA 4E6AA 2Z02A 3ORPA 3OZTA 3SX9A 3C9WA 3OCJA 5K0JA 4EOQA 1QAOA 3R2YA 3KK8A 3PY0A 4O7NA 4ZY4A 3BKBA 5A4QA 2QOBA 3NNWA 3PUPA 4LUDA 5AIKA 2WMSA 4MXCA 3R9HA 3VBQA 4J96A 3QXOA 4LOPA 4X3FC 4EL9A 5IQDA 1QYRA 3MB6A 3MB7A 1CSNA 4P4CA 4APCA 3EVZA 4BDHA 2XM9A 3IEIA 4ER5A 3IKAA 5C27A 5IEYA 1Q41A 5EDRA 3FPEA 3JY0A 4G3DA 4J97A 2VO7A 1Q3WA 3ZO3A 3D2LA 1M14A 1SVGA 3JVRA 3MFTA 3UP2A 2VU3A 1PXPA 4J52A 4X63A 4I24A 4MNEA 4DG2E 5KBQA 3OU2A 4Z9LA 5LVPA 3PPJA 4J98A 3DAEA 4BTJA 2Z7LA 2ONYA 4RG0A 4QMZA 4NWMA 3H30A 5DIAA 2PX8A 4U7ZA 3U81A 4U3ZA 3PSDA 5AUZA 3ACJA 5DEWA 5AFVA 4G6LA 1L3CA 3PY1A 1PYEA 4IJPA 1P1CA 5FQNA 2OKCA 3LQ8A 1PKDA 3OW3A 3OZRA 4ITJA 4IKPA 3G8BA 2PVNA 3RW9A 5ETAA 5L6WL 5GINE 4UB7A 2A19B 3BUSA 2I0HA 4RIOA 3ZSGA 4ZZNA 2H00A 4FTJA 3FPQA 2C0OA 5CENA 3TIZA 3ZLWA 3CP9A 3LHDA 4AT5A 4K6MA 3VC1A 5F2OA 4FR4A 4C4AA 1TVOA 2FA2A 2UW9A 4LRJA 1G55A 1WBTA 4RIWB 4QTBA 3Q9ZA 5KMOA 3GC8A 5T64A 2ZBRA 1R78A 1JOWB 2ITQA 5CQUA 1PHKA 3AG9A 1KOAA 2OJFE 2WO6A 2ZIFA 4JLCA 4PIPA 4OBQA 4YU2A 2VN9A 2Z6QA 1OL7A 3DJ5A 3QCYA 2KTYA 4IFCA 4JJRA 4XBRA 4DLIA 2H96A 1FOTA 4YNOA 3UPZA 3HDMA 9MHTA 1X1AA 4PV0A 4L53A 5ICPA 2BFXA 4HYIA 4E4XA 2WZJA 3EN7A 2YTZA 4G17A 3E87A 2EXCX 3MGYA 5CAQA 4EH7A 2ZBPA 4AE6A 3EFJA 1VPTA 4M69B 3PA5A 2NP8A 4L52A 5DLSA 4J1RA 3ORZA 5DRTA 4DFLA 5HIBA 3PVBA 4XMOA 2VO0A 3SAYA 3DDPA 4K18A 2YERA 3FKLA 3RGFA 4U42A 2FVDA 3EQIA 2DWBA 3MCZA 1JQDA 4D28A 4PF4A 4F9WA 2PZ5A 5HX6A 3OWLA 3G2FA 3PJ8A 4CKRA 4GOND 3FTEA 5CZIA 3QXPA 1OIRA 1Z5MA 4QPAA 3TZ8A 2JDRA 3DAJA 4PMTA 4WKQA 3ZONA 4DGLC 2PJDA 3GU3A 3UO6A 1KV2A 5LMAA 4BBEA 3THRA 2XKDA 2BAQA 3F6XA 3AY0A 2XKFA 4GU9A 3F4KA 2BHEA 4ZJIA 3FJQE 4HPUE 2JFMA 5AM7A 3V5TA 4L3JA 3FMJA 3K6RA 3NWEA 2H1RA 5AV2A 2X39A 3TMAA 3D9VA 3FUWA 4FG7A 2HZNA 4FIIA 4BIEA 2ZWAA 3QD0A 5T6BA 4XV9A 4HGEA 2QD9A 3M11A 2CNUA 5E8XA 4DFYA 3GGFA 4DH3A 1M6EX 1H24A 2WMQA 2BIYA 3R8VA 4B8LA 1R74A 1JBPE 2UZEA 3TDWA 3R0QA 4KNBA 1XXLA 4AX8A 3D7TB 4CFWA 3P8ZA 4FL1A 1NKVA 4IX5A 1CM8A 1LPUA 2XNBA 3OW4A 2YIWA 2DYLA 4JAJA 4AT4A 1OKZA 3JYAA 2UZNA 5IF1A 5EW3A 4EZ5A 5BW5A 5HG9A 3QL8A 5J87A 4BI1A 4EC9A 3FUPA 4CMUA 3F82A 4L42A 3U9CA 1ZYJA 3ATTA 3JR1A 4RVTA 4CTKA 5E8JA 4KS8A 2R3QA 3MCTA 2YXEA 4FGZA 1SVEA 3FMDA 1DI9A 5BQ0A 3O71A 3TN8A 4F4PA 5FUTA 5C4LA 4O7WA 1SG9A 3ORIA 3DXYA 3O23A 4CGAA 4ZK5A 4IVAA 2HXQA 2OFUA 1AQJA 4C4IA 1GZ8A 2QO7A 2W1HA 3FMMA 1DM2A 3NDMA 2VX0A 2W96B 3CCNA 3I7BA 4MH7A 4R7IA 5H9BA 1FPUA 3P79A 4PP7A 4B17A 2YM4A 5EW9A 3GRRA 3SXSA 5EEHA 3KQ7A 4BDAA 3ZFMA 3FI8A 3EFKA 4FOBA 4H36A 3JWHA 4HGZA 4IX3A 3LFEA 4KKGA 4ZSGA 4XV2A 4DEBA 3PYYA 5J9LA 1YW2A 4IC8A 2P2IA 3BLHA 4N6ZA 3EVEA 5G1XA 1EJ0A 3W2QA 4DCGA 3NUUA 4EOIA 2P55A 3ZZEA 4YBJA 3PVCA 4C58A 2C6LA 5DRBA 1Q62A 4NTSA 2WMVA 5EMLA 2I1MA 4FTCA 2CPKE 2NNWB 3MTEA 4LV8A 5HILA 3V3VA 1F5QA 1M2RA 4ANLA 5LCKA 5FM3A 4GC9A 3ORNA 3ZRMA 1Z57A 4HYUA 5HIEA 1FP2A 4ZZOA 4O83A 2YIRA 4FSUA 5F95A 4AF3A 3E8EA 4BVUA 5CVDA 2I9KA 2O2UA 3O50A 4S34A 4I41A 3OWPA 3R24A 2NXEA 2V0DA 3GENA 2VGPA 3CY3A 4JNWA 5KMNA 3UJCA 5AADA 3OWJA 2FCAA 3EVFA 3TT0A 4KS7A 3GB2A 3EQRA 3KPUA 1RI5A 2R3RA 2HWPA 4I94A 4IACA 4CT2A 3HZTA 2VS1A 1YXXA 1XDUA 3TNPC 3C0GA 4O2ZA 5AIRA 2XK9A 4U80A 5DOSA 2BHHA 3D5VA 3SGCA 5DXAA 3UJAA 4ZTMA 2CCIA 4YZMA 4ENYA 2IG7A 4NUSA 5DM4A 1XH8A 5EI2A 1VP3A 3VC2A 3HRBA 3I81A 1Q24A 3VS5A 3IW8A 4FTRA 3HEMA 3PDTA 3FLWA 4JR3A 4QRCA 4D5KA 3F3TA 4R77A 5FBNC 5HNIX 3CKKA 4RBLA 1Q4LA 3FXZA 3ZDUA 2ZIGA 1ZGAA 4FSMA 4H3BA 3LGAA 3OE4A 4NTTA 4V0QA 2YCQA 4YLKA 4JR7A 3VUDA 2ZVJA 1VIDA 3MN3A 4KA3A 5JFWA 1JG4A 4EJNA 2QOQA 4RJ7A 1BL6A 3ULZA 5J9ZA 1NW3A 1CKPA 3UODA 3OBJA 4FTMA 3FL5A 3UIXA 2NRUA 2BILB 4RIWA 5I4NA 4QYYA 2GH1A 4II5A 4AS0A 3EVGA 3D2KA 5E8UA 4O7VA 5CSXA 2PL0A 1TQIA 1TKIA 3KK9A 4Q5HA 4CMOA 1W0XC 3HV7A 2FRXA 4NT4A 4AU8A 1K3AA 2EJTA 5FDXA 1PMVA 1T45A 2YVLA 4YV0A 2C5NA 1RJBA 2W06A 3PSCA 1Q0TA 2X2LA 3GC0A 2CJMA 4CV8A 3Q9WA 4KIQA 2QQ7A 3R9NA 2XNNA 2FPOA 5FTWA 4A9RA 1F3MC 3FMHA 4AOIA 4P5QA 1YOJA 4KRDA 1VLMA 3KF4A 3LPMA 3LKDA 3ELJA 3HMPA 3AXTA 1YDRE 1DUSA 5KNJA 4ASXA 4E5BA 1SM2A 5KHWA 2AR0A 4LWOA 1ZZ2A 5EIWA 4EK5A 4H3PA 1VL5A 2PLWA 4C37A 2PVFA 4FTOA 2IZSA 2UVYA 3DQXA 4L00A 4QQTA 4YC6A 4GVJA 2WB8A 4DEDA 4DG3E 4GVAA 2N47A 3R02A 4O2PA 3KR1A 5FA5A 4E6QA 4F99A 3NCGA 5EOLA 4TYIA 3PXKA 3RAKA 5KUPA 3Q5IA 2FSOX 4EEVA 5DTRA 2ETMA 3VS7A 3ZM9A 4EBVA 4M7RA 3ODYX 5H2UA 2JHCA 2GHGA 3SDJA 4EORA 1JKTA 3LX6A 5DPVA 4FEXA 1OKWA 3FI4A 3L1SA 3H3CA 3NYXA 4N0SA 2XNOA 4QYGA 3PP1A 4F65A 4FSTA 3EQHA 3VJNA 4PNKA 3TM4A 3MVLA 4RQVA 4RFYA 3W33A 3SMQA 5D12A 3VBWA 3QAME 3LFDA 5EDPA 3TM5A 3RZBA 3D5UA 3DBCA 4XUFA 2OXYA 2NO3A 4GUBA 4IZAA 4TPTA 5EYCA 1EIZA 4KBKA 3RPSA 3PP0A 1WZYA 2XRWA 4H1JA 1IASA 5CX9A 4L6QA 5EW8A 3HM2A 1GOLA 3MFUA 2X6DA 2A27A 1KOBA 3ANRA 3MFRA 2IPXA 3R8MA 2PMIA 2IVTA 3UYSA 2P2HA 5IQBA 4GKHA 2CMGA 4CV9A 3FPFA 3O31A 2CKEA 4BLWA 3EMDA 2AC5A 2H11A 3OWKA 3VQUA 4BIBA 3RWQA 5BPYA 3FC1X 3HUBA 2OK1A 5LMKC 3TKIA 1TW2A 4PYLA 5I5ZA 5JGDA 2J5FA 5LMBA 2ZVAA 2R3PA 1QANA 4MHAA 5LR6A 5AAEA 5KKRC 3HX4A 3DT1A 2WA2A 4DA4A 1XO2B 3COIA 4ER3A 4CNHA 3Q04A 4TRLA 4AZFA 2X9EA 3KRLA 3O8PA 3VWAA 3R8PA 4EH8A 4DT8A 4LL5A 3ZTXA 1O9HA 3FPGA 5B2KA 1KWPA 4YUYA 3BQRA 3RM6A 2YXLA 5ICCA 3W16A 3QA0A 3KQPA 1YXUA 1G6Q1 2WQOA 3OMVA 4JOAA 4ALWA 2JBOA 3HVCA 4MD9E 1XH5A 4FSNA 5CXHA 5LCJA 1FP1D 4DCMA 3NX8A 1GZNA 1OM1A 2XRUA 4JBOA 5HU3A 2P41A 2A4LA 4JDHA 3BYSA 2ITZA 2G15A 3MHTA 3KQSA 4FEQA 5H8EA 2EU9A 4CFMA 3DOGA 3NRMA 4FKUA 4RX5A 1LEWA 3F5GA 5L6PA 3Q4UA 3MERA 3BHHA 3NEWA 5DT4A 4HZRA 2AC3A 2ONLC 3SVVA 4F64A 2AOXA 3VSEA 4EWHA 2XZSA 4MK0A 5DR9A 4HYSA 3E05A 1YFLA 4RLKA 4ACCA 4OTGA 5CNOA 1JG3A 4WNMA 3FZSA 2CGWA 4RMZA 3EQFA 5BVKA 3ITZA 2B52A 4FTUA 2UUEA 2VV9A 2NP7A 3PJ2A 3ERKA 2WTKC 3QFVA 2DQ7X 2IN6A 4Q2AA 3UVRA 3H9FA 4FV1A 4EH9A 2HXLA 1UU7A 4GSBA 5LVNA 3FAAA 4OX9Y 2GDOA 3PJ1A 3RAHA 4X3FB 4AN2A 3A26A 3CJGA 3SSMA 3K3JA 3MBLA 4RFZA 4JQ8A 1JTEA 2UZTA 2VZ9A 3BQCA 3UVPA 1VP9A 4E8AA 5E1DA 2J4ZA 2QU5A 4GCJA 1EQAA 3Q87B 3BKWA 4RWKA 5BMMA 1JG2A 4FT2A 5EKXA 4RTNA 3CQUA 1PMEA 2BRMA 4ONAA 3KMWA 4IB0A 4XUEA 3QRKA 4ZOGA 1SQGA 1ZWSA 3G8AA 1PRYA 2CLXA 1H1DA 5CEPA 4IAFA 4RSSA 3OEZA 3P0MA 2DS1A 3ZU7A 1W82A 3UJ9A 2SRCA 2PUIA 3DV3A 4CTJA 4QDJA 3I0QA 5AX9A 3EJ1A 3NIZA 4DT9A 4QMQA 3DNDA 3P1AA 4CRSA 4ASZA 2VTMA 4FVRA 1NE2A 1U5QA 3POZA 2OSCA 3L8XA 3HYHA 1XCJA 2P7HA 2R5TA 3UZTA 2UVZA 3OCSA 3VVHA 5FA8A 5DGZA 3MY0A 3ER8A 4RZWA 2GTNA 3ORLA 4EKGA 3OBGA 4QMNA 4S32A 5CAPA 4Y8DA 1SYKA 2NPQA 4RVLA 3GQIA 3UP7A 2WKMA 3GC7A 4L44A 3UJGA 4BYJA 3LFBA 1FMOE 2XIZA 5BVOA 4A6EA 4J7BA 4BGHA 3AMYA 2UW4A 1KPGA 3Q2MA 2PXAA 5ETFA 2WMRA 4QO9A 3KULA 2BZJA 1RDQE 3H0ZA 5CT7A 3TUBA 2C3KA 2VTLA 2EFJA 3FUXA 2W17A 3IOKA 2QOKA 5ICEA 2J0LA 3HVKA 5M09A 3UA4A 1N7JA 3CPBA 3DZOA 3KCKA 4FSQA 4PUZA 5EFQA 4E1ZA 2PX5A 4XG3A 2GAFA 3HMOA 1H4LA 1M17A 4F6SA 2VTRA 1M7NA 4AA5A 5M57A 3A99A 2EG5A 1CKJA 2XNMA 2JH8A 2O0LA 4LECA 5CIYA 3HAVA 2OFVA 3KKVA 1OL2A 3B7PA 1SVHA 5LQNA 5C8NA 2UZWE 5E2AA 1KSWA 1M2QA 4Z55A 4FS8A 1OIQA 3OUNB 1JNKA 2AUHA 2OICA 4D1XA 1YUBA 4DTKA 3SRVA 1YI4A 1J7UA 2Y1WA 4ANQA 5CLPA 3QOWA 3NW5A 4RLLA 3JXWA 4AUAA 4C07A 2WOTA 3FY2A 4V0GB 2WFYA 4Y30A 3GNIB 3P2KA 1NV8A 3GRVA 4FTLA 1WXXA 1ZYSA 2YEXA 4FX3A 1MQ4A 1O6YA 3E62A 3F3WA 3GFWA 1RW8A 4IJ9A 4EYJA 5IA2A 1R18A 3VIDA 4EKIA 2QOLA 2CGXA 4FKVA 3K0BA 4JQ7A 4YJSA 2XYRA 3DXZA 2HZIA 2ITYA 2WMBA 2Z7SA 2BRHA 3AMAA 4NJ3A 3ZUUA 4YTCA 3U6HA 4EOSA 3EVDA 5T68A 3C5IA 4YMJA 2K4MA 5FTOA 1Y6BA 4C2WA 2JIIA 4OTWA 4ALVA 2C7PA 5TF9A 4AE9A 2WU7A 4RVDA 3A4OX 3D4QA 4DEEA 4I6BA 4RTSA 3H10A 4KDCA 3TDVA 4NH1A 3A60A 4Y5QA 3AXSA 3OE5A 4KVZA 2R3LA 3F7WA 4UN0C 5B7VA 2PVJA 4XG2A 1XHAA 5E8RA 3ID6C 3HCBA 1FVTA 2FSTX 3MIAA 4OTFA 3R7OA 3ZRLA 3M6WA 4Y85A 3AD6A 3TJDA 3EWHA 4M15A 2AVDA 5K0EA 4AA4A 4GT5A 1KPHA 2B3TA 3U51A 4FE2A 5JT2A 4U79A 4BDEA 4BCHA 4ZLOA 2E9UA 3PX3A 2F57A 3WF7A 2VTNA 3A62A 2GNHA 2CKPA 2JAMA 3D7TA 3EOCA 3KEXA 3LFAA 4FNYA 2GA9A 5K05A 3QTZA 4FTAA 5L6OA 5AV3A 4QNAA 4WBOA 3NUSA 3SXFA 2IWIA 2P7IA 5CVJA 1OIUA 5CASA 2G1TA 3FXWA 3SD0A 4WNPA 1NW5A 3PT9A 4X3FA 5HZNA 1Q8ZA 2WQEA 5HIIA 4C03A 2IFTA 2OH4A 2VRXA 5AP1A 5HD4A 3OVVA 2JBPA 5FEEA 4BDKA 5BYYA 3HV3A 4JS8A 2AOTB 2VUWA 1VYZA 3V04A 3WARA 4KWCA 4QTCA 5KX8A 3S68A 1FVRA 2BAJA 1R6AA 4ACGA 3O17A 2GHMA 5BYLA 1XQZA 5J1WA 1PXMA 2YR0A 4L7VA 4DZRA 4FV7A 4PY1A 3GRYA 5LQUA 2VWXA 5HE2A 1WFCA 2B9EA 3DB6A 4RVFA 3K5VA 2V5QA 4QPPA 3R30A 4FSZA 3QRIA 3M1SA 3H0YA 3QQKA 4JXFA 5DBXA 5GOZA 2XIYA 3GU8A 1YI3A 3KL8A 3QX2A 2ZM3A 4O7LA 5DR6A 3SW7A 3UG2A 5BXYA 4DEIA 2UV2A 3GUBA 4QT1A 5EYDA 4BCKA 3FEGA 5FULA 1TPYA 4OQEA 3FLQA 2W1FA 3M2WA 4HGLA 4MWIA 5CVFA 4O84A 3OT8A 3W2SA 3OFMA 3VBTA 4ZTRA 5EKOA 3TZ9A 3HVIA 4HC4A 3MESA 5AUXA 2HY0A 2IZRA 4PNEA 4CTCA 3FLNC 3WILA 2OYRA 3QTWA 5KO1A 3UNKA 5EI8A 1R1WA 4O22A 3SV0A 2PY6A 4GK4A 5FCDA 3MA6A 5LJJA 3R04A 4I5HA 3UBTA 4C04A 2HAKA 3F2NA 4NM0A 2VTIA 2Y4IB 4RQKA 4YJVA 2ZV7A 3TACA 4WNKA 5D9HA 2PMNX 1G3NA 3E5AA 3MV5A 1ZYCA 3TNWA 3LKMA 3FMKA 2PKWA 4ZIMA 3M6XA 4PIMA 4J8NA 2YA9A 5K5XA 1ZKDA 3G0EA 4RTMA 5LWNA 5AUYA 3V97A 3TJCA 3E3PA 5EZQA 3N51A 1I09A 2JC6A 3C4ZA 4EBWA 1ZRZA 1XBAA 2OF2A 1YXVA 3RPOA 4FIEA 4X2KA 4BCFA 4DF3A 5HTBA 4XCXA 3G5LA 5L2TA 4CTBA 3EQGA 3AD5A 4F7LA 5IPJA 3SR4A 3GOKA 4UYNA 3Q4CA 1W8CA 1HCLA 3NW6A 2R3JA 5CEQA 4A07A 2IIPA 3GC9A 2PU8A 3DU8A 4F7SA 4DQ0A 2ITUA 4FKWA 3QCSA 3R1NA 2JKOA 2WMTA 2CGUA 3ENHA 3PG3A 3MS9A 1BKYA 2PWPA 4WVLA 4BLVA 4D4RA 3TZ7A 1NBIA 4U7TB 2UZUE 5LOHA 4FKSA 4J53A 4L68A 1UIRA 4IM3A 4NW5A 3PFGA 2PV0A 2J2IB 4WUNA 3SOAA 4RTRA 4WG4A 3UNZA 2BR4A 3HUCA 3TOSA 5DT0A 5ANKA 4OBOA 3TNQB 3W32A 2IZUA 2VTQA 3D94A 1OECA 4KWPA 3FUUA 5E1OA 3CEKA 4ZTQA 3CKXA 3CKWA 1HOWA 2XKEA 3C5UA 3IW7A 2PZRA 5E8WA 4FV3A 4PGHA 2C3LA 4MCVA 3TUCA 2UW0A 3RAIA 3C50A 3W2CA 4EOOA 2LD4A 3MFSA 1KHHA 4BI0A 4CZTA 3SXRA 2IP2A 1KE6A 4G31A 5DM2A 5JR3A 1KPIA 4CD0A 4BCOA 4BP1A 5D1JA 4IBMA 1QPDA 1ZOEA 3V8SA 3LDGA 2W4KA 4X0MA 2PZPA 3PTGA 5BVEA 3BEGA 4TYEA 3AC1A 3HEGA 3D15A 4TYHA 2PVMA 3LDFA 3BE2A 1H1SA 3G0FA 4JX3A 3ZH8A 3BBWA 4F0IA 5F9EA 1ZY4A 2UVXA 4K0YA 5A4TA 3P9NA 4LM5A 4ASEA 4FA2A 1P14A 4NU1A 3R7YA 3R22A 1J3HA 3MH1A 3RCJA 5F94A 4D58A 4L46A 2BVAA 1P2AA 4M68A 1VE3A 3KA0A 3MQ2A 3Q6UA 4KKEA 1L1EA 3BU5A 2RF9A 5KQSA 3Q2JA 2I7QA 3WOWA 4ZY5A 5KMKA 1VZOA 3Q7EA 4FICA 3MIYA 2EB2A 4EI4A 5U4XA 3UJ7A 5ICGA 2QONA 3BV2A 3ZSHA 3D0EA 5I9YA 2YM7A 2R9SA 1Q8YA 3AGMA 4FODA 4TYGA 5FP6A 3LCDA 4ZEGA 1IXKA 1MRUA 2VX3A 2BDJA 1BX6A 2YAKA 2BKZA 3PSBA 3BIZA 4FV8A 5IQIA 3WZEA 3GFEA 1UNHA 3ELUA 4LI5A 3MH2A 3GEQA 1W7HA 2QY6A 5BUIA 3D2IA 4YHFA 3TTJA 2E9NA 3EN6A 2CKOA 4V05A 3VS6A 5E2BA 2GNIA 4BGQA 4JL9A 4NM5A 4DFZE 4D1SA 3R01A 4DEHA 2HOGA 5D7AA 1ZYDA 4EUTA 2XNEA 2J0IA 2XB7A 3KQTA 3NUXA 4BCNA 3RHKA 4HGTA 5ICFA 4CG9A 3Q4ZA 5GIPE 2NXNA 2XJ0A 3K2LA 1A48A 3HMMA 2B25A 3V5WA 4BC6A 3TKUA 2YCFA 2WTDA 4MNFA 3QTQA 5M4FA 1UNGA 5K0CA 4KW7A 5GJDA 1G8SA 1NY3A 3BI6A 4JDKA 5CZHA 5DFPA 5EG3A 4FUYA 2BR3A 2RFNA 4DM3A 1BKXA 3TKHA 4C4FA 5CSWA 4YUXA 2IVVA 4EC8A 4YZBA 5AP2A 3PRIA 4IEBA 5C9CA 4QTEA 2PBFA 2Z7QA 4W4XA 4PCLA 2B55A 5CU2A 2ERKA 5A14A 3NUYA 2C4GA 4XEYA 4GUAA 4PRJA 5H3QA 1GIHA 2BTRA 3W8QA 4AACA 4K11A 1LR4A 2XK7A 3IW5A 3SX0A 4K6ZA 4QYEA 3BWBA 2FH9A 2JKMA 3DOUA 4YNEA 3MWUA 3NW7A 4FTNA 2B7AA 2QVSE 1VBFA 4EKLA 5BVFA 5FEQA 3NMUF 3MPAA 5JFXA 4HW7A 5EKNA 5HBEA 4FYNA 4ISCA 4FIFA 1ZARA 3WE4A 1Q61A 2WTKB 3ZFXA 4HCTA 2QURA 4HVHA 4KB8A 1H27A 3UQFA 3UWPA 2B9IA 4ANSA 3M4XA 4ZZMA 2ETKA 1NA7A 4XHKB 3C1XA 5HNGA 4IAYA 3W18A 4P5ZA 3PJ3A 3GU4A 2JKKA 3BELA 5G6VA 3I9FA 5HOQA 4D9UA 5EC8A 4E20A 2VWUA 5KZIA 4I4FA 4KABA 5EDQA 4HNIA 2EX4A 4IV0A 4C7TA 5BX0A 1ZOGA 5M4CA 5EHGA 3HTXA 4KAOA 1PXNA 2HENA 3DK3A 4D0XA 1YFJA 4GJ2A 3IW4A 5ANIA 2IGTA 3I58A 4GOOD 4IDVA 4QQKA 4BKJA 1ZXEA 3QZGA 1NW6A 4L3LA 3ER9A 4F63A 5E4HA 2X7FA 3IG7A 3E63A 3BU3A 3DKOA 3QQJA 2YWVA 4ITIA 4FZAB 2VTOA 4LL0A 1GIIA 5DT3A 3FXXA 4X2NA 5M4IA 3KR2A 4M37A 5C8KA 5DSXA 4S33A 2R64A 5ANJA 4GOLD 3W2PA 3ZLYA 3FLZA 2GLUA 5HGIA 5E8SA 3RI1A 3C3PA 3TM0A 1OPKA 3DAKA 5EM6A 1P5EA 4RC3A 3RHXA 1R0PA 3DMGA 4RJ4A 1LUFA 1OPJA 4IX4A 1U54B 4MD8E 4G56A 4NCTA 4RVKA 4JQEA 3OC1A 5CS6A 5EK7A 2B9HA 1U4DA 4DH1A 2Q0BA 3R7UA 3QTUA 5BP7A 5E9WA 3T3VA 4WSYA 3AT3A 5M08A 1J7IA 4AN9A 4C05A 3PIYA 5A4EA 2YX1A 5CUQA 5CVHA 3TZMA 4D4VA 3QD4A 5HG7A 1UWVA 3LECA 4HH4A 5A46A 4FZ7A 4FL3A 3WF5A 1RI2A 3HKOA 3KVWA 3BV3A 2W1DA 3DBFA 2WTIA 3BGPA 3OT3A 3UIMA 3S00A 3EMGA 5GJGA 1UA2A 4PYKA 4JG6A 4BN1A 2V7AA 3UO4A 3FI2A 4D5HA 2HK5A 2J50A 2R3GA 2YCSA 3D83A 3V51A 4M67A 2OIBA 2R3KA 4YZNA 4XUDA 4G6NA 2C1AA 3KVXA 4O0TA 2Q41A 3UFBA 5P8WA 3U55A 4CFNA 1DAYA 5GNKA 3WE8A 3UJDA 2AOWA 3HCEA 2QOCA 3S1HA 3COMA 2JHPA 3RK7A 2XYQA 1NW7A 4ZTHA 4ASDA 5IISA 3CD8A 1UKIA 2PZYA 5JEBA 3BHTA 2V7EA 3D7ZA 3GCVA 5M56A 3ORHA 3CBLA 2G2IA 5EI6A 2RFEA 3VN9A 4ACDA 5FXRA 1YZHA 2H9VA 3E92A 4P2KA 3ME5A 2IDJA 2HWKA 3QQUA 4ZSJA 4JBVA 2IDKA 3QOXA 4IZYA 1ND4A 4MD7E 3BWFA 3NCZA 1MRVA 3LE6A 4CCBA 1JTFA 3BYOA 3HA6A 5ETCA 3W10A 2PE0A 3B89A 3KRXA 4U3YA 2PK9A 3NW9A 2QOOA 3PWDA 3R73A 5KMIA 5IQFA 4JX7A 5ANDA 2WEIA 2QC6A 3TTIA 4C02A 4W4YA 3RPVA 5J95A 4BR3A 5K03A 2FUMA 4F9CA 5JH6A 2FSMX 3NIEA 2C7RA 4MXZA 4QTAA 3K54A 2OU7A 4F9BA 5ERGB 1YHSA 1PXJA 3LQ5A 3BWMA 5T67A 3MJ1A 4KKHA 3FUTA 3QUDA 3DUWA 5IA3A 4MIKA 1IEPA 3PS9A 5K3YA 3KREA 3G6GA 2OB1A 2XIXA 2FO0A 2WGJA 2YZLA 4TKSA 3GU6A 3U4WA 3UQCA 4RA5A 5I9UA 2YXDA 4PTCA 5DN3A 5EYKA 3UMWA 3NR9A 3PXRA 3ORKA 4XLVA 1KE5A 2WELA 4O96A 2ZSUA 2F9GA 1L3RE 4IAKA 2RG6A 3B2TA 5J8IA 4D9TA 4FV5A 2Z2WA 2GS7A 4Y83A 2BZHB 2Z6UA 4C62A 3L9MA 3CIKA 5KE0A 1WG8A 2O57A 2ZOQA 4YUVA 4E2WA 4RFMA 4PX6A 5T3QA 4B8MA 3UOJA 4LG4A 3PZHA 2EB3A 3A7IA 4JXJA 5E91A 2WMAA 5LQJA 3GBZA 2OJJA 1IY9A 3ZMMA 3X0DA 3NUAA 3HECA 4R7HA 1YWNA 2CSNA 3G15A 5LVLA 3QRUA 3Q6WA 4EH4A 5HQ0A 3KQVA 2IBSA 5JUWA 3KKZA 1U46A 2R3IA 2RIOA 3DLSA 3LCTA 4GU6A 4O0YA 3ZEPA 3CTJA 4I20A 4FKIA 4DGNA 1CKIA 2C47A 3BZ3A 4HJOA 4KUJA 3W8LA 3WZUA 4PMPA 5AUUA 2XK8A 4R5YA 5IEXA 3MW1A 1BUHA 3DBEA 2ZV9A 5HE1A 2I6LA 4U40A 4C38A 4IV8A 3OY1A 4PP9A 2VZ6A 1ORIA 1BI8A 1XH4A 5EG5A 2YIXA 3BYVA 4MX9A 3WBLA 5IMXA 2G71A 2PZIA 2YM3A 3NDJA 3DFAA 2JIUA 3QQGA 1G5SA 4USEA 3CD3A 4FZ6A 3DULA 2C0IA 1I4WA 3BX5A 4AZTA 1JPAA 3KXMA 1O6KA 4FIHA 4AN3A 5CEOA 1ORHA 2HMYB 5D1NA 5CYIA 1R3CA 4IADA 5CCXA 3KMUA 3WF9A 4G1WA 4NKSA 3QLFA 5FLFA 3C4WA 5HCXA 3G2OA 3OFJA 4RVGA 5HEKA 4TYJA 1M0EA 3IW6A 3KXNA 3HDNA 2Y6MA 4FTQA 4ARKA 1EG2A 3B5IA 1TQPA 5IH3A 1ATPE 3SSOA 4YMGA 2E5WA 4IQ6A 2J51A 5IA5A 4KIGA 4K9YA 4KSPA 1KR5A 1UKHA 2ITTA 1P4FA 3QCXA 3UDBA 3UZRA 3FPJA 1R8XA 4FZVA 1E9HA 3V5JA 2VDUE 2PE1A 3KY2A 4G6OA 3MJ2A 3FUVA 3R71A 4QPNA 1H07A 3HMNA 3QD3A 4IB3A 4EOMA 4YUZA 4F0FA 5AV0A 4E30A 3L9PA 2CN8A 4G16A 3OS3A 4RJ3A 3CBGA 3LJ1A 4FI1A 5CVVA 1OR8A 3R9XB 2BMCA 3UMXA 1V0OA 2QG5A 1YDSE 3F69A 3GO4A 3SXJA 2BH2A 3PLSA 5B0XA 3OTVA 1BL7A 4IW0A 1ZAOA 2XM8A 5HVKA 4M36A 2HIWA 3C0KA 4X41A 4P7EA 4GL9A 4BI2A 1NT2A 1PW2A 3KGAA 4YC3A 3OD6X 2W0JA 2J6MA 3KQOA 4RVMA 3DLCA 3JY9A 4POOA 5HVJA 3VULA 4ZS4A 4GJ3A 3H4JA 5DE2A 4H05A 2PMOX 4X6QC 3QC9A 3HVJA 2ZV2A 1FINA 4R1YA 3E7OA 3IECA 2PTKA 1JSZA 1AGWA 3GCZA 3PXQA 3JWJA 2ZLBA 1AQ1A 2XBAA 2C0TA 3G33A 3MTFA 3ZM4A 4I23A 4DHFA 5BW4A 2P1DA 5D7VA 3W2OA 1BLXA 3BHUA 3JPVA 4I6FA 2CNQA 2LAVA 1IM8A 1D2GA 3M70A 3EKKA 3PWYA 5AWMA 2R3HA 1PMUA 2BALA 2GPHA 4L43A 4R3CA 4DEAA 3BWCA 5M55A 2HZ4A 3KFAA 3AC8A 3Q9YA 4I93A 3CC6A 4K33A 2OXDA 2AYPA 4IZ5A 4XP2A 3WZDA 3QLGA 5A6OA 2ERCA 3FYCA 3LVPA 3JVSA 4QVKA 3IS5A 4GIHA 1BYGA 4GUEA 2R3OA 4HCVA 5IH6A 3I64A 4M0ZA 3B3FA 3HA8A 1GZOA 3FWQA 2YACA 3ZO2A 2GHLA 4Z7HA 2GNFA 2G2HA 4D4SA 5CT0A 4CFVA 2PPQA 5EQPA 1OITA 2H8HA 3RPRA 2ZULA 4GFGA 3KB7A 2UZ4A 3P23A 3VRZA 5BVNA 1SUIA 3HP2A 4LOOA 2IW9A 5IH5A 5M51A 3E93A 3L9NA 1K2PA 2PY3A 2HCKA 1WZNA 4LWPA 4U9AA 3A2CA 5JN2A 2PMLX 3C0HA 2C6MA 3L8VA 2WD1A 3UQGA 4DTBA 3BU6A 4IM2A 1UWHA 2E2BA 5M53A 3BGDA 5IH4A 1JKLA 3CS9A 4CFFA 3SHEA 3BKXA 4IB5A 1D2HA 5IA0A 1S9JA 1UVRA 3I1AA 4OLIA 4B7TA 3LMHA 2XUUA 3UJBA 5KYGA 4YV2A 2VAGA 2HW7A 4I0RA 4QMUA 2X7GA 3CY2A 4BZDA 3F5PA 3QWJA 2VTAA 3NPCA 3S0OA 1PYXA 4BGGA 2FK7A 2IH5A 5HORA 2OGVA 2PVYA 1Z9XA 4FTIA 2B9JA 2WNTA 2W5HA 3E88A 4UWCA 4JIKA 4NYEA 5FM2A 3ZEWA 4AA0A 3NYNA 4AZEA 5IA4A 5LVMA 5F2NA 3R8LA 3FL4A 4R6XA 3KXHA 2W1GA 4FT3A 1RJEA 3NUPA 4RGJA 3PLAE 3MSSA 2WMWA 3HV5A 4X2JA 1XKKA 4O81A 4XV1A 2X9FA 2PE2A 3LPBA 2YCRA 5L8KA 5KHXA 3PIXA 2VDWA 1GZKA 5DEYA 4BDGA 2YZAA 3PFHA 2V74B 2ITWA 2WU6A 3BGZA 4ERKA 5C0OE 1EJ6A 4PYMA 3KXZA 1LP4A 1Y57A 4I6HA 4MTAA 4U43A 2CWWA 2VWIA 3QV2A 4GC5A 4DBNA 5EIFA 2VWBA 4UY9A 3IOPA 2P4IA 4M3QA 2GQGA 4RRVA 4YP8A 4USFA 2LGCA 3PE1A 4V0GA 3WZJA 5A9UA 5DHJA 2A2AA 3FMEA 5TT7A 5HX8A 5I0BA 3KR9A 4M38A 3TQSA 2UZLA 4IWNA 3UOHA 4QMYA 3ELWA 4TZRA 5DXJA 1PMNA 4QMMA 5HG8A 4AOJA 2P8JA 2F2CB 2A0CX 3LMGA 4DCEA 3TR6A 2XYNA 1UWJA 4ZLYA 4C4GA 2ESMA 5BUEA 1XCLA 3QD2B 2ZIEA 3D5XA 3ZBFA 1AV6A 3SG8A 2CGVA 3LXLA 3MVHA 4PYOA 5L3AA 2VWYA 5L2WA 1U59A 2AOUA 3RMFA 2OZAA 1L8TA 5HI2A 1K9AA 2PVRA 2VWVA 4FGRA 4MYGA 1REJA 1W98A 3R9DA 5IEVA 3EKNA 4GG5A 4O91A 3VBXA 3EN4A 4TYHB 4M0YA 1JAMA 4EK4A 4QYFA 3RM7A 3ERCA 2ZDUA 2C6IA 3B8QA 5FXSA 1PXKA 3V6SA 2P35A 3ANXA 5K09A 4FMQA 5A3XA 2FGIA 4WG3A 5D41A 3WIKA 2BKKA 3C3YA 3B2WA 5CTPA 3R7IA 5FXQA 2YQZA 3RVGA 3MA3A 2I40A 4YTIA 3CGGA 2QG7A 3RNIA 5CAUA 3FTCA 2XYVA 3HCDA 5FWAA 3ALNA 4YJPA 3LCOA 3RPYA 2JITA 4MBLA 4C61A 3FMNA 5J5SA 2XVMA 4D4YA 4O82A 2WQNA 1B42A 4BDIA 4G5JA 3SC1A 3QKKA 3JS2A 4IHPA 4Q9SA 4XP3A 5AX3A 4RJ6A 5AA8A 1VJYA 5CXZA 4B99A 1ZZLA 3U9NA 4E32A 2O5KA 4F70A 4RX9A 4TWNA 2J9MA 2BFYA 2C6OA 1OKYA 1PXOA 4USDA 4WA9A 4WIHA 3P2IA 3FLSA 2BZIB 3E7PA 5M5BA 4C3PA 3UE4A 4G3GA 4IE9A 4IWDA 3CJQA 3ORXA 4MNEB 2G8NA 3A25A 3PVUA 1Q3DA 5LWMA 4CG8A 2WHBA 3GRZA 3FQHA 1JSUA 3VC4A 5H02A 2V62A 1H01A 3F3VA 4O0UA 5DNRA 4X60A 3OG7A 5AUWA 5JRSA 3EPPA 4P7KA 4E2XA 4K1BA 4FV2A 2BRGA 4YJUA 4R78A 2WIHA 2YHVA 4YTHA 2W4JA 5HZMA 3P9IA 3ZRKA 2AOTA 3KRWA 3TV6A 1ZOHA 5JKGA 5K0LA 3GCPA 2OZVA 2QRVA 3HVHA 1Q8WA 3ORMA 3PVGA 1F0QA 4NFMA 5CSVA 2IW6A 3GRUA 3KPVA 2GNJA 3BWYA 4EHVA 2XIRA 2DUVA 2OF4A 4GMYA 1DS5A 5IUHA 3DZQA 2ZB1A 2AN5A 3FSFA 2QR7A 2XNGA 1H25A 3GXOA 4EYMA 3R3HA 4PGGA 2C1BA 2Y8OA 5E7RA 4YO4A 3E8CA 4QP3A 1INLA 2YJSA 2BPMA 3LZBA 1XR1A 1IA8A 3FZPA 4JRVA 1H1PA 4RPVA 3G7UA 4X21A 3VNTA 5HIDA 4RSRA 3LLTA 3QTSA 5HEZA 4YHJA 3LCVB 3FY0A 3QBNA 4UALA 3THSA 5DYJA 4XUCA 4Y72A 3QQHA 4JBQA 2IVSA 3AMBA 3P7CA 2W5BA 4MEDA 5CF6A 4M12A 1ZHFA 1P39A 2HYYA 4CVAA 4NL0A 2C3IB 3VUKA 2EXMA 4BTKA 3NUNA 2JD5A 3DBDA 4NSTA 3LFNA 2JDOA 5DWQA 1OL5A 2I0VA 3R7EA 4FUXA 1V39A 2QO2A 3NVMB 2OIDA 4O0VA 3I6WA 5KZ0A 3UGCA 4ZMEA 3MTIA 5D1HA 4L7FA 5FTGA 3T8OA 5L2SA 3GCSA 4I0SA 4FKOA 5L2IA 3DMFA 4RIXB 3A27A 4W8EA 4FT5A 4H58A 2X81A 4ID7A 5L8JA 2Z6AA 5BYZA 4RX8A 1RJGA 4WHZA 4WOVA 4DN5A 5J7HA 3AGLA 3FKNA 3HCCA 4X1OA 3BCEA 3IQ7A 3RODA 3P78A 5CSHA 4IMYA 2GSFA 2BM8A 3M6VA 4CCUA 5EHLA 3SGLA 4E31A 5HKMA 4NW6A 4RTJA 4DTAA 4RX1A 1FMKA 1NVSA 4XOZA 2X4FA 3FMLA 5DRYA 4NECA 5ACBC 5CF4A 3FQSA 3Q5ZA 2XMYA 3QQLA 3FHIA 2XIKA 3PXFA 3PZEA 4IANA 2BM9A 5F2KA 3QHWA 5HIKA 2V22A 4FV6A 2HR1A 3OPNA 4M84A 4OBPA 4RT7A 2P3GX 2O06A 3FPHA 4O7SA 3M33A 3E64A 5HLPA 2YAAA 3SW4A 4OTIA 3TG1A 2NYUA 3ELDA 4YV1A 2UZDA 3ULIA 1KP9A 5IMEA 3QKMA 5JZJA 3LDUA 5C9ZA 4DGGA 4OTHA 3BT7A 3UIBA 2YDKA 3GU7A 2W05A 2J0KA 5M07A 4XS2A 3E8DA 1H28A 3R9RA 5M4UA 1ZGJA 4ITHA 2VTHA 3QUPA 1DAWA 5LXMA 2VWWA 5CEIA 4A4OA 3T9TA 4ANBA 3HV4A 4C2VA 4EMSA 3C51A 1B39A 1S9IA 1VR2A 4HGYA 4AGUA 1YDTE 3KPYA 3LFSA 3CQWA 3CSVA 4O0WA 3MB5A 5DLYA 2BAKA 3C7QA 4DBXA 4FV9A 1X1CA 3PXZA 2ETRA 2HTEA 1I44A 3IDCA 3MY1A 4UYAA 1E1XA 3NAYA 2ZBQA 3FYKX 1XVAA 3R6TA 3NYVA 3LM5A 4FSRA 4O7TA 2ZYBA 3IV6A 3FC2A 3AXWA 4ZTNA 4DG0E 3DJ6A 1FGIA 3HAMA 4ALUA 3R0TA 10MHA 3KCFA 4FOCA 3B8RA 2CMWA 2QOFA 2ITVA 2UW5A 3DB8A 3MI9A 1P4OA 4KIPA 4Y5HA 4Y95A 4CLJA 2WEVA 5BUJA 4N57A 1X8BA 5HICA 3U8WA 4YJRA 3ZHPC 3FE3A 1SNUA 2CLQA 3O51A 2C7QA 2W4OA 4R1VA 5FDPA 5K4JA 4AW0A 4E73A 4AT3A 2JGZA 5DX1A 4OBWA 4JG8A 5AP7A 4RTLA 3FYJX 1V0BA 4I4EA 3CC8A 3A61A 2O3PA 4MXOA 4LGHA 4EZ7A 4DC2A 3UTOA 5KVAA 2YN8A 3AT4A 5HE0A 1JVPP 3CVOA 2BCJA 1GNGA 2ITPA 3BLQA 3EN5A 4DA5A 3CJRA 3TFWA 7MHTA 3DMHA 3EGEA 4PINA 1OPLA 5C1QB 4R6WA 3O0GA 2CDZA 1PJKA 2BR1A 2QLQA 3QZHA 4JG7A 4M97A 4TWPA 4AG8A 4MVFA 5JFSA 4OT5A 3CTQA 4RTQA 3MGGA 2OJGA 2X2MA 2BR5A 3EHAA 2JDVA 3S2PA 3FTDA 4BF2A 1J91A 4FEWA 4DAWA 3A4TA 5LSAA 3EMBA 1H26A 3G6HA 4I0TA 3LBYA 3RK5A 3ETAA 4FVQA 5J9YA 1SNXA 3RWPA 1BMKA 3HRFA 4WG5A 3N9XA 4XX9A 3KF7A 3VUHA 4BDJA 5HHWA 4FV0A 4BCJA 1XH7A 4R7BA 1MJFA 4FKTA 2PX4A 1MHTA 1XJDA 3KRRA 2IW8A 1H1RA 2ZMCA 3NLBA 4YLJA 3Q9XA 3PTAA 4P7FA 1P1BA 5CI6A 5GIOE 3F3ZA 4ENXA 4MQ1A 3S4QA 4HVIA 1O9UA 4EH5A 3DXPA 3ET7A 4OT6A 5KMLA 4PMSA 5EVJA 2E9PA 4KDRA 5GP1A 3O8UA 5FRIA 5E90A 5AMNA 3WI6A 3ZUTA 2P3LA 4FNXA 2GNGA 2BZGA 3LBFA 3TPZA 2QLUA 4EQMA 1XBBA 3F7ZA 3MTLA 3OXTA 3SQQA 4HVSA 5JQ5A 3H2BA 3O4FA 4I21A 4QMPA 4R6VA 2PYWA 4RYLA 2XYUA 3QGYA 5DM1A 4ZLZA 4NZWB 3MYGA 4DFXE 3B3JA 3IDPA 4O0RA 5A6NA 3EVBA 2Z8CA 3FZRA 3H9RA 3EQDA 4MBJA 3OEFX 4GK3A 4MXYA 5DSTA 3U54A 4HCUA 1XBCA 4XG4A 3DPKA 1YOMA 2CMHA 4LRKA 2ZM4A 2YFXA 2Y4PA 2R0IA 2GU8A 3KXGA 4BIDA 4BTFA 1J1BA 3CE3A 2DPMA 3RAWA 2BDWA 2YIYA 4MXAA 4NCTC 1XH6A 4CMTA 2P40A 4F9AA 4AGCA 5HD7A 4ZTBA 4QMLA 3LM0A 1Q5KA 2GMXA 4RJ8A 1L3BA 3OXZA 4WNOA 2IVUA 3PPZA 2Q83A 2XEYA 4BDFA 3UIUA 2G01A 2G9XA 2PHKA 1JQ3A 5HBHA 2W5AA 1XTPA 3KHKA 5CAOA 3EYGA 4XG9A 3UC4A 4EH6A 3UO5A 2PULA 2C5VA 5HVYA 5EQEA 1Y91A 1UV5A 3OROA 1Z3CA 4JAIA 3G5TA 1E1VA 5CEKA 4BICA 3ZXTA 5IDPA 1DL5A 2PWYA 2BIKB 5KBRA 3LCUA 1NW1A 2OJIA 5MHTA 4O6LA 5CVGA 4XJ0A 3RP9A 1R39A 1JKKA 1QPJA 3OZ6A 5I9VA 2O05A 3BXOA 3DS6A 5LQCA 2C7OA 5EPEA 1WBOA 1YZ3A 3KRJA 3DKFA 3LHJA 3EQCA 4PNIA 3U87A 5C4KA 4TWOA 2C6DA 3N4UA 1O54A 2PUUA 2EUFB 1U54A 4O29A 4LG1A 4A4LA 2C5XA 4R3PA 4IZ7A 3I5UA 3DK7A 5DR2A 2VX1A 5I9XA 2B4SB 4NKAA 3WF8A 4WUAA 3NNXA 5EM8A 1Y8CA 5EM5A 4O27B 2W9ZB 2WQMA 3MPMA 4H39A 1AQIA 1O9GA 2VP3A 2IH4A 2O63A 3P7AA 1N7IA 2OZOA 5GHVA 1Q0SA 3R6XA 3U6JA 4MQ2A 4AWIA 3HP7A 3I4BA 3MAGA 2F7XE 5EZSA 4OGRA 1PXLA 1RI4A 2RKUA 3ALOA 4YURA 5K5NA 2OY0A 3NJRA 5EMJA 3KN5A 4U81A 2ESRA 2YITA 3VRYA 3JUHA 2WXVA 4IC7A 4LGGA 4RX7A 5HCYA 2WMXA 3BYUA 4GV1A 4CEGA 3QHRA 4O7ZA 3KC3A 4ZY6A 4YPDA 1NW8A 3HA3A 2XP2A 3LFCA 3LSTA 4IX6A 3EL7A 4TT7A 3DTNA 4GBED 2REIA 1UNLA 2C68A 5FWDA 1H1QA 4ZAUA 4YBKA 5ITAA 4RV9A 4ACHA 4U7PB 5F20A 2UZBA 3ZFYA 4CRLA 5FG8A 1L9KA 5K0NA 2IJMA 3OU7A 3PX2A 4IM0A 5CD1A 3HRCA 4FC0A 5ANEA 4EK8A 4YC8A 4PDOA 4EOJA 2XBMA 1JSTA 4XLIA 2RG5A 3TCPA 3IYLW 4C33A 4FKPA 4QP9A 4FSDA 2XF0A 2GS6A 1SKMA 1HCKA 4AW1A 2Y9QA 5E1EA 3AC3A 4S2ZA 2PUPA 5CU4A 4ZP5A 4H3QA 3TV7A 4GKIA 1KYZA 2XJ2A 4U97A 5HLWA 4X2GA 2RFDA 2X6EA 5CALA 1JG1A 3EH9A 3B3GA 3L8DA 1PXIA 2YWPA 3FYDA 3IK3A 4YTFA 3V8WA 4TY1A 3G88A 4XRJA 3Q32A 3MVJA 4RIXA 5E9EA 4AZWA 5CANA 4JBPA 4O7YA 2PXCA 3GNLA 5EKUA 4E2ZA 3BZBA 3ZZWA 5JGAA 4FV4A 5F4NA 3BGIA 4FTTA 4IWPA 3D5WA 4M7IA 5C01A 2QOHA 4PYQA 3FBVA 3WIGA 2OJ9A 1QPCA 4BDBA 5KCVA 1KE9A 4M14A 2ZZNA 4MKCA 3BEAA 4OTRA 5T6KA 4L01A 5L8LA 1QPEA 4TXCA 4K2RA 4BYIA 4F0GA 2XVAA 5DM0A 2PVHA 2XS0A 4FKRA 4LYNA 3CJTA 4CFUA 3IO7A 3EIDA 2C5YA 2PWLA 5AV1A 2VO6A 4YPSA 4FYOA 5EOVA 2KULA 2OBFA 4X6RA 1Q8TA 2GQSA 3V01A 4EWQA 3TKAA 5LQKA 4HVDA 4J71A 3I0OA 4LRMA 2RL5A 3IGOA 3QQFA 4F08A 4P7JA 3PRFA 2XCKA 4U41A 1Q97A 1WVXA 3EFLA 3QA8A 5K4IA 4AW5A 3QYWA 4C34A 1WS6A 3K3IA 3GU5A 2O07A 4JVGA 5C1IA 4E70A 3OOGA 4GRBA 3ZOSA 4XV3A 4PL3A 4CKJA 3VS1A 3VUGA 1JQEA 4C35A 4ERWA 1IR3A 3PVWA 3KULB 2WIPA 4WO5A 2OB2A 2J5EA 1OBGA 3SVZA 4G9RA 2X2KA 4FEVA 3T7TA 2OW3A 2X8EA 4KINA 3KQMA 3CPCA 2A14A 3AC2A 3HCFA 5JQ8A 1V0PA 5JZNA 3CLYA 3ZO4A 2X8IA 5JMSA 5K01A 5FP5A 1GY3A 5I9WA 1HNNA 3TRKA 3WF6A 3EEOA 2WA1A 4UOEA 3L9LA 3QF9A 4GIIA 1X1DA 3UOLA 3Q60A 4ORKA 1STCE 5DRDA 3FQEA 4D2RA 3FPMA 5ACKA 3VS3A 3VHEA 2ERZE 3ZCLA 4N70A 4A9SA 3AJDA 3ZC6A 2PVKA 4Q9ZA 4PTGA 4DFUA 4TNDA 2UW6A 4XNEA 2OG8A 4YO6A 5DX8A 3COHA 3G9LX 4PTEA 3I6UA 5JGBA 3F5UA 2WTJA 1Y8YA 4FT9A 4QMSA 2AOVA 3BBTB 1SQFA 3GCUA 4XBUA 4BB4A 3CGFA 3UZUA 3R2BA 3P71T 3GXLA 3T7RA 3G51A 3EVCA 3AWIA 3TKYA 2F49A 2W9FB 4FNZA 4J8MA 2FHPA 2R2PA 2G72A 2JIVA 5HFJA 4HYHA 2YDIA 4UX9A 4EQUA 1B6CB 4O7RA 4RA4A
chains in the Genus database with same CATH superfamily
4CMEC 2Q3FA 2C4HA 1N6PA 2Y2UA 2JLDA 1EG7A 1DG1G 1LB1B 4U8GA 2PUNA 1J7LA 2BMEA 2J08A 5ALQA 4JBWA 2PUDA 5HTCA 4C6SA 3KWMA 4OCZA 1Y80A 3QMMA 1OZAA 1RXUA 4BV3A 3L46A 4D2IA 4HP8A 2ZIXB 4LHVA 3RT1A 3GI3A 2WAJA 5AICA 5M06A 3RALA 4Q18A 2ZU6A 3CR3C 2XCHA 4ZVQA 3U0BA 3PB3A 3NDRA 3IBSA 1R4MB 1T5SA 3WRYA 4D8YA 1CS4C 1ZLXA 1WCYA 5FX2A 3GJYA 3R2JA 2Y0AA 3KU2A 2Y1XA 3L01A 4H60A 3H5TA 1DAKA 2G5CA 3N8KA 4F9GA 4OR5A 3PD1A 4MMZB 2BEUA 2R0UA 1WF6A 5K0BA 4DDTA 2AG8A 4WSOA 3MMPA 1MRYA 4EFKA 3DFCB 4FBXA 2FUCA 4NK9A 1D03A 1Q99A 3DEHA 1L5ZA 3IPRA 4NBTA 3SDBA 2Z8ZA 1KFEB 2AG6A 3SG9A 4W63A 1HNWB 2O3TA 5C26A 2E7ZA 2NUAB 1R8SA 4HGNA 3GL9A 5HLNA 4CN9A 4W5QA 1YS9A 4LCBA 1T34A 2J3KA 3SI7A 1SBCA 1Q7TA 3AY6A 3HADA 2GNLA 4KMOA 2B99A 4BVEA 5IU6A 4Z0NA 1SXJB 5JS7A 4DA7A 1JJ7A 2J5RA 3PA3A 1F8GA 1KJ9A 3B85A 2PT9A 4RZVA 3W9BA 1DV2A 5HIAA 4FI3C 3B9BA 1JKSA 1T6ZA 1E4VA 3TX2A 1W19A 2QKRA 1GGJA 2O0UA 2O8FA 3JASA 4FVPA 2HW8A 2JFZA 2OO3A 2P0CA 2IYWA 4FHEA 1K98A 6CHYA 3L77A 1T8UA 1NT4A 4R8SA 3PDIB 4TL9A 3G2QA 2F8SA 1QMZA 4PAOA 4C0TA 2Y67A 1H2YA 1AKVA 4B9EA 4PWYA 2HSZA 4UXLA 3G5AA 5BVHB 4QYHA 1JR4A 4ZSAA 2VTPA 2ZZKA 5DVZA 2IYXA 4DMGA 3RG8A 4AK9A 1CJCA 4C2TA 3I60A 3Q7IA 3ZUVA 4F5WA 2OKRA 5EHOA 3TX6A 1P0CA 3WAJA 1GZ5A 2HDWA 1PW5A 1EFKA 2C3PA 4QU9A 1PWXA 3NNSA 1ZNWA 4EHKA 4O8ZA 4DG8A 2VGOA 1ZN2A 4LDQA 2V6MA 3MWFA 3Q0EA 3IONA 1ZMVA 2QTGA 3A7DA 4O4LA 3LKVA 4B40A 3MN1A 1THZA 1G98A 1YR1A 1JA0A 1MQAA 3ECAA 4LJ4A 3VH2A 1X80B 1WNTA 3GPBA 2BZKB 3KTOA 3A2KA 4M9QA 4FFVA 2BKLA 5M29A 5FXMA 3T1VA 2CLSA 4LAFA 3EZVA 4QOHA 4RD3A 1XGKA 2G5GX 4EZ3A 2C7VA 5E1MA 3IKTA 5CK4A 1F8XA 2W6CX 4E7WA 4CF5A 3OKFA 5LMKA 2R7NA 1NJFA 3CW8X 4LBZA 3LY9A 2ZM5A 3ZHSA 2RCNA 3GIDA 4GVLA 3DDNA 4A6XA 5DGDA 4J94A 1VGVA 3OLCX 5A4LA 3O3NB 4EQCA 3NFYA 1KTIA 3KDSE 4YPOA 1Q57A 4N0EA 4ZAGA 5FD2A 4H0FA 4EFLA 2EZ9A 5CA0B 1I7NA 2HBRA 1NP7A 4YRAA 4QUKA 4INPA 3C4CA 2ZRJA 4XGKA 3TLGA 2G63A 1WM1A 3WG9A 4LNUA 5JCJD 3KALA 2F1HA 1KIAA 3OZSA 4OXIA 3BMCB 2O8YA 4B44A 4U6RA 3EULA 3NGAA 5E9JA 4IH9A 2I7CA 1T15A 4Z16A 2FNAA 3SM9A 4KYUA 2VZEA 1JR3D 5K51A 1K88A 4YROA 3NGLA 1W29A 3A6LA 2VNIA 1U0OC 3PY3A 4YJGB 3COSA 3VKHA 2WKQA 4JJEA 3R5HA 1RM0A 2QKWB 3PXYA 2B1PA 5ALGA 2QQGA 1XNGA 3FFAA 1G38A 3NBAA 4MUMA 1UJCA 3BMOB 2UYGA 3LBNA 5GJVC 1E5DA 4W8HA 3D31A 1AGPA 1Z2AA 2R0QC 3ORPA 1P2DA 4Q3NA 2QOBA 4BFSA 1SRRA 2C3YA 3A36A 1Q41A 2QTVA 4WOPA 2IXEA 4E12A 1RAEA 4UU0A 3C3DA 3ZX5A 3QWHA 4KQJA 4N40A 3G1UA 2R6FA 3WL8A 4A23A 2Q3EA 3TIZA 4GLLA 1CNEA 1XZKA 3R3XA 3CVUA 1GWNA 3CTMA 4MHOA 1E99A 3RIYA 3QCYA 2J9GA 4XFJA 4CEJB 4CU2A 4AE6A 4W1RA 2VWQA 1RKXA 1TZMA 4FEEA 5HX6A 3OWLA 5IK2A 4BNXA 3AUXA 3QXPA 1SUPA 3WKDA 2CFIA 1KAEA 3SN6A 5JZOA 1QIFA 2EFHB 4RAOA 2Z95A 2QD9A 1M6EX 2V6IA 5EPUA 4IQ4A 3TDWA 3TH5A 1A9YA 1POWA 4TWIA 3SYNA 1W2GA 2J3LA 2R8ZA 5KPJA 3O23A 2AJDA 5IJZA 1SVNA 4R7IA 1UFRA 3P79A 1FP4B 4UCXA 1S3SA 1EGHA 3GRRA 4OYRA 1YO6A 3ZFMA 4YXWA 1O8BA 4R3NA 1M34B 1VB5A 4KQFA 5KB3A 4X5OA 2V5UA 1ISJA 3ORNA 3GRCA 3GJ5A 5F95A 4GM4A 4TUYF 3VH3A 4AP6A 1CQZA 4HN9A 1RKUA 1TIKA 3NBYC 3GLFE 3TNPC 5DOSA 1N6NA 2REQA 2IG7A 2GXSA 3LBAA 3PFWO 4E07A 4HYEA 3PDTA 3F3TA 4EG6A 2WEKA 4X7MA 4I1SA 1WPQA 2WU4A 4A2QA 3JATB 1GG8A 1UK8A 1WIWA 2GK6A 3MRXA 2NO9A 3CVVA 4R84A 3L1IA 4ANFA 3RANA 4NT4A 4WGGA 3USCS 5FBQB 4BWGA 2W06A 2RHBA 4LWQA 1H0RA 4TVSA 3KF4A 1KZ6A 3LKDA 4YAWA 3HMPA 1U0JA 3SQDA 2WU3A 3UMMA 4YRFA 1QYVA 1VL5A 2I8CA 4QQTA 2C1ZA 2B8NA 4CLDA 3PXKA 4UQPA 4JJIA 2RGUA 3EFOB 1WDWB 4BP8A 3KYJB 3IT0A 1ORTA 2GYVA 3FNEA 1E89A 3X1XA 1GZUA 4UQOA 1VLHA 4R98A 1WCXA 2UVPA 3SKXA 2DU8A 3FC1X 2ZVAA 4O2AF 2ZXFA 4MHAA 5A0VA 2WB2A 3DT1A 3Q04A 4AZFA 3O8PA 4BNLA 2PG3A 1F3OA 5P21A 4I1OA 3TB4A 3DPSA 1G6Q1 4CBVA 4IDAA 3MJEA 5HU3A 2P41A 2ZRCA 3LYHA 1J5EB 2Z98A 1GXSB 4LVNA 2FZGA 2XMRA 1KORA 3ULKA 4A26A 3CY6A 2AC3A 2ONLC 4DIUA 1ZSYA 4Y2TA 5JJ5A 3ITZA 4QGAA 4AROA 1C2YA 1V48A 2A1IA 3ECCA 2YFHA 1JVBA 3PU6A 4GWGA 1VP9A 3T3NA 1KOJA 4RWKA 3NP7A 4EPXA 1TJ4A 2I8LA 4HAIA 4UHDA 3ZJ5A 3EFEA 1MRSA 4GR5A 4MR7A 5JYEA 2WWRA 3UZTA 1QO7A 1GO2A 2XGGA 3EDOA 2CLEB 1COWD 4DS3A 4ARCA 4DLXA 1FUKA 3VZPA 2ZYDA 5LZ7A 4DBLC 3LVQE 2W17A 4LVUA 3EGOA 3M2TA 1VBNA 4ZGWA 2WF9A 2VJAA 2HO5A 1CZRA 1SULA 1HTTA 1OTXA 3ZU6A 3A1EA 3NW5A 1MV8A 3EPRA 3VOAA 1NV8A 1WXXA 4L5CA 1SOUA 1KKUA 1MEJA 2BRHA 5L40A 4YMJA 4ALVA 4AF7A 1JKJA 4NH1A 1C0EA 2ZJ1A 2FSTX 1M0SA 5LP6F 1DCKA 1I13A 3NKLA 2MSCB 2JGFA 4GDFA 1K08A 2JAMA 3EOCA 2VH1A 4I9NA 4W1QA 4NPAA 4MKRA 2GFIA 1WCV1 4LWZA 2WQEA 3GFQA 5F52A 4MPRA 3WARA 5AH0A 1DOHA 4PY1A 4HLCA 4F9TA 4L8VA 3NIDB 4JYZA 4HMQA 4QPPA 3U7QB 5DCUA 3CE9A 3GU8A 4TLMB 2NW6A 2A1UA 3NWJA 2GETA 2W37A 3OT8A 1RLOA 4LHZA 4YRSA 4HLDA 3TQCA 4X8OA 3KVVA 2IBTA 5BN5A 3TJCA 1NRIA 1RRCA 4BCFA 4L3VA 4YHBA 4YCNA 1ZI8A 3ZDDA 1U8UA 1X77A 1RLUA 4EYQA 4H2DA 1P17A 2GTPA 4DOMA 1U28C 4CM3A 3DU8A 1AUPA 3CLRC 1C3LA 4C0KA 1APBA 1E79D 1OKKD 4DM7A 4RTRA 3E4DA 5BWCA 3GLIE 3W32A 1VFNA 1HOWA 4FV3A 3KTFA 3TUCA 2PIDA 2Q7XA 3TLEA 2Y05A 4C6HA 4ZT7A 3P9ZA 4CD0A 1T3TA 5K8UA 3V8SA 3LDGA 2ZJZA 2BMAA 2FSUA 2BMWA 1E2JA 4H7PA 4JX3A 3IQWA 2VRCD 4D58A 1KI6B 5KOJB 5KMKA 4ALLA 4EZIA 3T52A 1LK0A 3LCDA 1QK3A 3WZEA 1I2CA 1UNHA 2XUFA 2V4MA 4V05A 1PNTA 4MYUA 5E2BA 4EMBA 4DFZE 4DEHA 1SXJE 3IP1A 4D44A 1UEJA 4DRZA 1U63A 2MYPA 3BL5A 3GEMA 5GJDA 3PE4A 4FUYA 1I4DD 2ERKA 4YJ2F 4DBZA 2GCGA 4LJ6A 1SXJA 4YVFA 4UPEA 4YJFB 4EKLA 5JFXA 5ERYA 4UFPA 3EA4A 4KB8A 4B85A 2B9IA 1JA9A 2OO7A 5G6VA 3BELA 2NUBA 4HDRB 4HNIA 1VI6A 3BN3A 1KYTA 1ZOGA 4CT0A 4GJ2A 3OSZA 2LKCA 5GVSA 2BSXA 2X7FA 4YUWA 4NG4A 2R64A 3W2PA 4M1OA 3GJ4A 3RI3A 5E8SA 3VYUB 3ZBPA 3DAKA 3WIEA 2GUWA 4RJ4A 1L6IA 1QIMA 2HBQA 2GF0A 2R6AA 1Y7LA 3NVAA 2W2TA 3PI7A 2HK5A 2R3GA 4NENB 2WNHA 1U7XA 3IDSA 1YRWA 3RS3A 3T06B 1RQRA 5IISA 3JQAA 3CB2A 2G2IA 2HWKA 3UDTA 4IZYA 1ND4A 5ETCA 2HSGA 1SHKA 1MB9A 4GLJA 4I5IA 3IHWA 5IM5A 3DUWA 2CXSA 4QBKA 3QXSA 2VHTA 1L7MA 3T9FA 1KE5A 2JRCA 4QDOA 1UBFA 1T4CA 3L9MA 2RB5A 4KPFC 4I6LA 4B71A 5JAIA 4DQUA 2R3IA 4PRLA 2GYUA 2HK7A 4QDEA 3L49A 5ALXA 3WBLA 1NW9B 3K0AA 1FDOA 2XMPA 3BX5A 3GUUA 1JPAA 1NF8A 1H69A 1FDIA 3A05A 1T2AA 3IW6A 4ARKA 1QYXA 3BOSA 3T9DA 4K9DA 4B3DA 4XQGA 3EPLA 3QXHA 5KTMA 1Z35A 2B0JA 2VDUE 1KEVA 2HXYA 1E7QA 4B8WA 3GO4A 4RV5A 4I0WB 1FUIA 1ND6A 4OSOA 1RXVA 4RVMA 3DLCA 5T4EA 3BJZA 2W98A 1PJSA 3NBKA 2JLVA 5JPDA 1JSZA 2CVFA 3JWJA 2C9YA 3ZX4A 3MTFA 3U5TA 1NR1A 5TSDA 1PMUA 3LQQA 4MLZA 4FFRA 4BL5A 2OXDA 4HR7A 3QVVA 4Y2RA 3DL2A 3OBBA 3TYXA 1CS0A 3OM0A 5L3SA 3MUOA 2WD8A 3RPRA 1C4XA 5A6SB 3DEAA 1E6EA 1WW3A 3CZ5A 3UQGA 4MGKR 2PANA 4TLLB 3QEAZ 4B46A 2W2KA 3OZEA 3O4RA 2VTAA 1ONOA 5JCXA 5JSFA 5FM2A 4MEJA 1SHTX 5AJHA 4XDHA 4FUTA 3PLAE 2WMWA 1Z37A 1JLRA 2WFLB 2QD5A 5BUCA 1XRQA 4KR6A 1X92A 5DBGA 4ERKA 1DAOA 2VG8A 2O2ZA 3MOGA 1XZJA 2P8JA 2R1VA 1J0DA 1HDYA 2Y1DA 2H4HA 2P91A 2I3DA 1MDBA 4I50A 1L8TA 3EN4A 3ZWNA 1OBCA 4ERNA 3AM5A 3EOBI 2J0QA 2IS2A 3WIKA 2YY6A 4OUDA 5HDBB 1QNLA 3U1BA 3OIVA 1V9LA 3FTCA 5FWAA 4BC1A 3COWA 1JHQA 4PV7A 4TOIA 1J2TA 4BGUA 3AZPA 2ZU0C 1AK9A 2G8NA 5E9AA 5IS2A 3VC4A 3CGWA 1GM5A 4E2XA 1EP9A 2WIFA 1WPGA 2X1VA 3FNGA 1M2VB 2SCUB 5K0LA 2QRVA 3EFHA 4EHNA 2IW6A 2WM8A 1H25A 2M2IA 1MOQA 1XR1A 4CCYB 1UKAA 1XRMA 1BDBA 1F2TA 4ZMEA 4EGAA 2O8NA 4LTNA 1SXGA 4AWBA 2Z6AA 3CLSD 4IF6A 1CUYA 1P3JA 3P78A 2NTNA 2EZTA 1HC7A 3KKMA