4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
b'MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
4N0SA 5FBNC 2W4OA 4G3DA 4ALUA 3REOA 2OKCA 3LDGA 2QG7A 3BCEA 3NSZA 3BXOA 3QC9A 3RK5A 1WCCA 2IFTA 2C3KA 5KZ0A 2IP2A 4ACGA 4DINA 4QQJA 5FXSA 3W2OA 4DQ0A 4AT4A 3GP0A 4FIGA 2OJJA 4ER6A 4YZ9A 3BWMA 2YAAA 2WKMA 4FTTA 3RJCA 3RGFA 1BHJA 4F7SA 3ZBFA 3UIMA 3NUAA 2ITYA 4ERWA 5IQCA 3OFJA 4KB8A 3VS7A 3F82A 2C6MA 3DOUA 1JSZA 3IQ7A 3FKLA 4ZLZA 4Z55A 3FTDA 5EM5A 4C61A 2IBSA 3VVHA 2NYUA 2BFXA 4G3GA 4M67A 2OZAB 5CNNA 4UOEA 1CSNA 2IZRA 3AT3A 3NIZA 4YV0A 2ACXA 4JBVA 2GHMA 5A54A 4FTAA 1OKVA 3PWYA 3ORIA 1R6AA 5AV4A 3HNRA 3ZSIA 3ZFXA 2XIRA 1WXXA 4KINA 2WIHA 3PPKA 4FSZA 3K2LA 3D83A 2YITA 4RC2A 3GGFA 3K6RA 3LQ8A 3VO3A 3ZEPA 5BYZA 4IVBA 2I6LA 4FSMA 2AUHA 3FZOA 3W2SA 3BGDA 5CAOA 3C51A 3GCQA 1QAMA 5JSMA 3FEGA 2JKQA 1NW1A 4HGEA 3W2CA 3W10A 3UPZA 2EG5A 3VWAA 4X3FA 3H10A 3ACKA 4DCEA 4BCPA 4ANQA 3FSFA 2QURA 3D5XA 2PVYA 2YEXA 4BYJA 4GFOA 1OKYA 2C3LA 3D5VA 5E8UA 4HVDA 2ZM4A 3HMPA 4FK3A 4WBOA 5D7VA 4O7NA 4V05A 4GC9A 4O86A 4PDYA 1RI1A 2VGPA 2YM7A 3PXFA 3SC1A 2HELA 2C7RA 3FZSA 3C5IA 5H8EA 5K9IA 2Q0NA 4IDTA 3TUCA 3COIA 3KXMA 5FM3A 5KS2A 5CASA 4RTMA 3TM5A 3GJYA 4FNWA 3EQBA 2BHHA 3W2RA 2X7GA 5L2WA 4ANBA 4PDPA 3UA3A 1KIAA 4MBLA 1Q61A 3F66A 3ORTA 3SMQA 3KXXA 3F5UA 5H8GA 3DZQA 3L1SA 4I0TA 2I40A 3GNIB 3R7UA 4H1MA 4E30A 4NW6A 2Z6QA 1R8YA 2BAKA 3FLSA 4QTUB 3FYCA 3BYUA 4F99A 3FL5A 3IKAA 2C6DA 3MTIA 4YV1A 4HCTA 3ZBXA 4BDDA 4HTFA 2YX1A 1ZY4A 4YSJA 5T68A 3KQVA 3E7OA 3K3JA 1KP9A 2OKRA 3HCCA 5I4NA 1O9HA 4YZNA 4RTSA 3O7LD 2RG5A 4U41A 1UNHA 4N57A 3MESA 4AAAA 5IQGA 2P7HA 3A2CA 3OOGA 3ZU7A 4BGHA 3UYTA 3UJ7A 2BAJA 4PCAA 4E2WA 4IZAA 1D2CA 3OXIA 5L2IA 3VQUA 4LL0A 3KL8A 4RIXA 3QQJA 4M14A 5KX8A 3KEXA 3TKIA 1WBVA 4O84A 2OLCA 2JBOA 5HO7A 3KULA 3QKMA 1J7IA 3BGQA 4Y5QA 5DN3A 4FNZA 1WY7A 4IB1A 5M53A 5DX1A 3L8DA 3R1YA 3NYXA 3OXTA 5CENA 4TRLA 3OS3A 3A4TA 3UP2A 4MNEB 4I92A 1BKXA 1T43A 4I6BA 2JG3A 4MTLA 3H30A 3EQIA 3MERA 2OB1A 4G6OA 3ZRKA 2IVVA 3Q52A 3WIGA 4R77A 3PJ3A 3OOMA 3GUBA 4R7IA 4PL4A 4C4GA 4PMSA 3DBQA 2WMUA 4QMTA 4O27B 1KOBA 5LWMA 4B9DA 4EVIA 5J9LA 1KHHA 3UZUA 2QE6A 4KSPA 5DG5A 5ERGB 3NX8A 3ZM9A 5E8JA 4BYIA 3SOAA 5KCVA 1X1AA 4QT1A 2RFNA 4JX3A 3MJ2A 2YERA 3G8BA 2C0OA 3FRHA 3N4VA 3D2KA 2YUIA 3T0IA 4C4FA 4CKJA 2UW7A 3HV3A 4BHNA 2GPYA 5HG5A 5KZIA 1H27A 1DL5A 3QL8A 3KK8A 4KDCA 2PZYA 4I20A 3IW4A 1M6YA 4KVZA 1ZOHA 4X41A 2GQGA 4WRSA 4RYLA 3CTHA 4DG3E 3LXNA 2X0GA 3OY1A 4OTQA 1JSVA 4RFZA 4EH9A 1XHAA 5TT7A 4P2KA 3UO4A 2ETMA 4WOVA 2QY6A 1NBIA 4PV0A 4FV2A 1WZYA 5DTMA 4XG9A 2YM3A 2A0CX 4IFGA 3TNIA 4G34A 3DKGA 3W2QA 4MD9E 2PVMA 3KR1A 4RSSA 4C4AA 3KY2A 5BUJA 4JXFA 2CGXA 2GCDA 4FSNA 4RWLA 2PV0A 3ENHA 4XUCA 4CD0A 3F3VA 1P1BA 3BLHA 3NNUA 4I6QA 4FR4A 4DEHA 3AGMA 4O0UA 5DTQA 4ZS4A 3QLGA 3BHYA 4IB0A 3E8SA 1M0EA 2CN5A 1WVWA 3K0BA 4RVFA 5FRIA 3MGYA 1YOLA 4ASDA 4RQKA 2ITTA 2XNBA 1I4WA 2WEIA 5GNKA 4BI2A 4X1OA 3HGKA 3Q4TA 5ETFA 3AC3A 4RTRA 1VLMA 3D5UA 4RVTA 5C8KA 4NSTA 2ZIEA 2CMGA 1YVJA 3LMGA 4J1RA 4J8MA 4FOCA 4FKRA 3KXZA 4O0TA 4CCUA 2Y1XA 3C4FA 2WHBA 1FJXA 5ICCA 3QHWA 3O8PA 3A62A 4MXZA 3R8PA 3G90X 4A07A 2O5KA 5L8JA 4RX7A 2JIUA 4KBCA 3QUPA 4RIYA 3EB0A 3DXPA 5HBHA 4XG8A 4P5ZA 4JQ7A 4QYFA 3R8ZA 3P7BA 3O23A 2LGCA 3DLIA 2CPKE 3OC1A 3VUGA 2CN8A 2OGVA 2Y6MA 5CEOA 1IXKA 5KMLA 4ACDA 4CLJA 4PNIA 4FV5A 2QOLA 1ZYDA 4GV1A 2AOXA 3AMYA 1OBDA 4BBFA 3UMWA 1Y6AA 3P9KA 2ZM3A 2B25A 3LLAA 3FMDA 5F9EA 3SM3A 4R5YA 4DH3A 1E1XA 1OPJA 4HG2A 3MVHA 5DRBA 4D0XA 4Y95A 5IH5A 1OIRA 2R6ZA 2WMSA 5K0NA 4I41A 4ZY6A 2EVAA 2XS0A 1F5QA 4HGSA 2DUVA 4QYEA 2Z02A 3TUDA 3TWJA 3QX4A 1AV6A 4AZWA 4EHGA 1CTPE 3PFQA 3RPVA 3FLNC 2ETRA 4DEDA 2C6KA 3EPPA 2RKUA 3VUKA 4Y2HA 5JZJA 2ONLC 4TZRA 3RW9A 1IA8A 4EK9A 3EZRA 3LKMA 4JRVA 3BPRA 4PYLA 4C06A 4NECA 4QMUA 2NP6A 2A19B 2J6MA 3EGVA 4FTKA 2WTVA 4Y46A 4AFEA 2J50A 4IADA 3UJAA 5DWQA 3TIZA 2YM5A 2QU5A 1YI6A 3FKNA 3QU0A 4QVKA 3TDWA 2G2FA 1YRPA 2ZV7A 3GEQA 5JT2A 4D4SA 4PIMA 1JKLA 4MBIA 1R78A 5HLWA 3EMBA 4GOND 4ISCA 3WZKA 3UE4A 4XNEA 4PYOA 3UZTA 1FVRA 5A14A 4HJOA 4GFMA 3TV7A 1P4OA 3DJ5A 4F6UA 2JAMA 3EN4A 1RI4A 5HNGA 4ATNA 2YACA 4QP3A 5LVLA 3UA4A 3GU8A 5EYDA 2ZIFA 2KTYA 1R3CA 3FI2A 2XK3A 4FKGA 3P79A 4XP2A 4A9YA 3GRYA 5IZFA 4EI4A 4YJQA 3QCSA 4HGTA 4D28A 1KE6A 4Q9ZA 2R5TA 3EHAA 5E1BA 3CQEA 4WT6A 3POZA 3R8LA 3LCVB 1G3NA 4J97A 3EIDA 1X19A 4FG7A 2OJIA 5KMOA 4J96A 4U5JA 3UYSA 4LMNA 2UW4A 1OL2A 5BVDA 4U3ZA 4GW8A 3FUUA 4DITA 5IQBA 3LMIA 4AX8A 5E8RA 4FG9A 4DH8A 4FTIA 4DAWA 1N7IA 4U42A 4A7CA 1Q0SA 1AQJA 3VBQA 4YJRA 5EI2A 3THSA 5CANA 3ZTXA 5BW4A 1GOLA 3O31A 3E93A 3G7UA 2C6IA 5FLFA 1BUHA 5CIYA 4FC0A 4QMSA 4UZHA 5DH3A 3NTVA 3KRXA 2OIQA 2QG5A 4B0GA 2QOKA 2QO9A 3NUPA 4JL9A 3WZEA 2YN8A 3SKCA 3DTCA 1KR5A 1Y8CA 1NXKA 2W05A 2ZJWA 4BCQA 2J0IA 3GCPA 5CQWA 4PYIA 3DJ6A 4O22A 3HVIA 3HUCA 1OBGA 5EIWA 3KPVA 5FWDA 3DPKA 2IZSA 4NM3A 4JBPA 2QOCA 2XYNA 5LQNA 3GFWA 4XG7A 2PYWA 3AGLA 3TPZA 3TLJA 3A4OX 3L8VA 4BCJA 3BYMA 1YOMA 1BLXA 4FK6A 3FUTA 1NV8A 1OITA 4F0IA 4FOBA 3PX2A 4DA5A 4ZZOA 4AT5A 4NWMA 3UJ8A 3LM5A 4YO4A 3RCJA 2QRVA 4IJPA 4S32A 3RPOA 2YISA 2IVUA 3FI4A 4UALA 1XKKA 3U55A 4XG3A 3ULIA 3WSTA 4EJNA 4DC2A 4CTKA 4JR7A 4CCBA 1VP9A 3KXNA 5BP7A 3BGVA 2PZIA 4FTUA 1JVPP 3MJ1A 1OM1A 2X2MA 1LPUA 4JDKA 3VN9A 4QQTA 3VUMA 5C27A 2CKPA 5BPYA 1LP4A 3TNHA 4GSBA 4C2WA 4PQNA 2GPHA 4X6QC 4E2YA 1PXKA 1KV1A 5D1JA 3KVWA 3CKKA 3Q4ZA 5K4IA 3LJ0A 4IJ9A 5HEKA 4YU2A 1JSXA 3I1AA 5EDPA 1ZQ9A 5C0OE 3BZBA 2CKQA 5H2UA 2HAKA 1Q5KA 2PY3A 5AUVA 4WUAA 3RWQA 4IHPA 4Z9LA 2O0UA 1VYZA 2HK5A 4XUFA 3MQ2A 4EK3A 3POOA 1H24A 3OZ6A 3GXOA 5EI8A 4F9BA 3QTIA 3RODA 2HW7A 2J5EA 4IVDA 3CQWA 3IDCA 3RPYA 1QYRA 2A14A 1PJKA 5HE2A 3WYXA 2XEYA 5CI6A 2YQZA 2SRCA 3F5XA 2J7TA 4IWPA 5CZIA 5TKDA 3OFMA 2OBFA 4E4XA 1F0QA 5I9ZA 3MFSA 4BY9E 3ZLSA 2QHNA 4AW0A 2XM9A 4AT3A 3TT0A 3DULA 4DE4A 4HTFB 2BRHA 3PPZA 3O51A 4EEVA 2XCKA 5IQHA 4BBMA 3A7FA 3PFGA 2X8EA 4X6RA 5FP5A 3DLCA 4MXOA 3N51A 3LXKA 1M2PA 3GWZA 2O3PA 2IW8A 3ODZX 3K54A 2Y9QA 4CMTA 3PXRA 2ZV2A 4FS8A 2BCJA 3A26A 3PYYA 5HORA 5HIMA 5IA1A 5IH3A 1OIQA 3C6KA 3OZSA 3ERKA 5DE2A 1EAMA 4PYQA 2H6DA 2VTSA 1NW7A 4O7YA 1URWA 4B7TA 4ER3A 4RT7A 5F2OA 2J2IB 3IPHA 3UOHA 4FMQA 2OFVA 2F9GA 5EOVA 3FPEA 2OICA 3RZBA 2AC3A 4JOAA 2YXLA 1OKZA 3PJ2A 1PYXA 3KFAA 4XG2A 4YUWA 4PGHA 1T45A 1G8AA 5AP4A 3R9NA 4OUCA 1H01A 3QCXA 1CDKA 4TWNA 4E8AA 4JBOA 1HNNA 3OP5A 2IZUA 4D9TA 2IVTA 4O91A 4FODA 3JYAA 2AOTA 3FXXA 1Y8GA 3PVGA 2UZVA 4X2NA 4IC8A 2P0CA 3HVKA 3C3PA 2UVYA 2X8IA 3A8WA 1XVAA 1M2QA 2H11A 1PXIA 3M2WA 4QQNA 3JWIA 4YR8A 4ZTRA 5BMSA 4RGJA 3HA8A 1M17A 4IAIA 3EQGA 1NKVA 1OL5A 2FGIA 4BZDA 5I9VA 5LMBA 3HMIA 4BLWA 4UV0A 1RDQE 4UWYA 2Z60A 2H00A 4EH7A 5FWAA 4OTRA 4U40A 3DTWA 3OTUA 2IO6A 4KIGA 2OY0A 3WZUA 4OA5A 5G02A 3EVFA 3AY0A 5HGIA 5K0GA 3BQCA 3G33A 3R8UA 3F2AA 3EQPA 5DXAA 4F84A 3H9RA 1PXLA 3ZXTA 4I94A 2RF9A 5JGDA 3MH2A 3FHIA 3U51A 4U7ZA 1YW2A 3IGGA 5GM2A 4H3PA 5IISA 2CMHA 4F63A 3ZSHA 3UIUA 4O29A 4Q5EA 1M7NA 3FMNA 4AE6A 2JHAA 3R22A 3P0MA 2ITZA 3DKFA 3CD8A 1ZOEA 2JEDA 2X7FA 3BRBA 4FBXA 4BDIA 1TQIA 2BZJA 5J9ZA 3EVGA 3NYOA 5HX8A 3ELYA 3KF7A 4IDVA 4L44A 3E63A 2IDJA 4PYNA 4QMVA 3SW7A 1OIYA 3QTQA 3KPJA 1FPQA 4IM2A 2IPXA 4ZK5A 1O9GA 3AOXA 2UZWE 3TZ7A 5HX6A 2IBTA 4WG3A 3DGKA 3VW8A 3UBDA 2O63A 4BZNA 5LR6A 4ZIMA 2YIRA 5FXRA 5FGKA 4RLLA 3OCTA 3AT2A 1O6YA 1VPTA 3QV2A 5HCXA 1BL7A 3B3JA 3DAEA 5B2MA 3OCJA 3B8QA 3UTOA 4GOMD 2PVFA 4ZTNA 3VULA 4FVPA 2UW0A 1Q3WA 4WRGA 1GZKA 5CT0A 2EU9A 1XXLA 5BMMA 3CKWA 4F1TA 3HYHA 2E9OA 4C05A 2XNEA 2PUNA 4RX9A 4XRLA 5I0BA 1KWPA 3PTAA 4RIYB 1RJEA 3NUNA 3HA6A 5EEHA 3MH3A 3TJCA 4ITJA 5AAGA 3VRZA 4BHZA 5M4FA 3AWIA 4QMWA 5EC8A 3PRFA 3WI6A 3C0GA 5AP0A 3UVQA 2H34A 2UZBA 4IZYA 3MA3A 5CF4A 4K11A 4YPSA 4LG4A 2WXVA 4ASEA 4DZRA 1MJFA 3ZHPC 4Y85A 2Q83A 3SOCA 1OECA 3OEZA 2HMYB 1H00A 5BW5A 3VS0A 3KQSA 5T67A 4DTAA 4JIKA 2BVAA 1BX6A 4FIHA 1FP1D 4RWKA 3DXNA 1G5SA 2R64A 2YXDA 3D7TB 1I09A 3Q53A 5FTWA 3QTWA 3FPQA 3ITZA 4HVSA 3M6VA 3HCAA 5E9JA 4EZ5A 5HE0A 1YHSA 4GT5A 5DBXA 1W82A 4D0WA 3ZFMA 4EK6A 4ARKA 4O0SA 4Q9SA 4D4RA 3U4UA 5CF5A 2X9EA 4HYSA 4O82A 1XH6A 2HNKA 4FKLA 3UVRA 3BLRA 3OY3A 2OIDA 3ROYA 3SX0A 3QRTA 5LQAA 3EFJA 3VHEA 5KHWA 3P4KA 4ER7A 5HBEA 3QWKA 1J1CA 3DV3A 2CGVA 4CFMA 4BDAA 2QONA 2FK8A 3NVMB 2ZYBA 4I5PA 1S9IA 4IAFA 2QLUA 1T46A 2P35A 1M2RA 4XX9A 5HO8A 2Z6AA 2JH8A 4GRBA 2WNTA 5IQFA 1U59A 2P8JA 2OH4A 5CAUA 2ESMA 3DK6A 3BWYA 3V5PA 2PZPA 4CLIA 3DXXA 4RPVA 4G16A 3F5PA 1XO2B 5KVAA 4JQEA 3NNVA 2XBMA 3TNPC 2NO3A 4M0ZA 2F7ZE 5HIJA 4FV1A 2GQSA 3D4QA 3DP7A 5FEEA 3L9MA 4QTCA 3CTQA 2XRUA 4AZVA 3M11A 2ZAZA 3PJCA 1KE5A 2OH0E 3LECA 4X2JA 3F2RA 1JTFA 3I0OA 3QYZA 3Q6UA 5LQUA 2PPQA 3FL4A 2C7QA 3GI3A 4K2RA 4USDA 4C58A 4KWPA 2BM9A 3BGPA 4HZSA 3W32A 2ZIGA 4ACMA 4BCOA 2UV2A 2QC6A 3WE4A 3HP7A 4BVUA 3O96A 4DEBA 4S31A 4QPPA 4NJDA 4QTEA 4MD8E 2G70A 3A60A 1YUBA 3MTFA 3PRIA 1J3HA 2VUWA 4DEIA 4FV7A 4ZXTA 4YTCA 4DFLA 3LVPA 1H25A 2BZKB 4RVKA 3T7SA 3S2PA 4U3YA 3WOWA 5GJGA 2G1TA 2W0JA 1TW2A 4C36A 5AADA 3E7VA 2ETKA 4FTNA 4FE2A 4GCJA 3TKUA 4BRXA 4M13A 4EC9A 4ASZA 3HEMA 3WILA 5AUTA 1A9UA 4CSVA 2OF4A 3LXLA 5C8NA 4O7ZA 4XLVA 4GG7A 3PSBA 5CD1A 3VC4A 4TYHA 4O6EA 5HBJA 3PWDA 2XK4A 4E6QA 4F9WA 4FI1A 5J8IA 3SRVA 4FV0A 4QTTB 5IH6A 2AOUA 5FULA 3C4ZA 4PYMA 1GZOA 2VWXA 3CCNA 1FGKA 2X2LA 5L2SA 5FDXA 3TMAA 2WIPA 3ZCLA 2HIWA 3DXQA 4XV3A 5FEDA 4ZTHA 4FZVA 3DBDA 3LJ1A 4BCFA 2QRVB 5CEPA 3AC8A 1G55A 1Q8YA 4GJ3A 2VWBA 2HOGA 4FG8A 4L9IA 1RJGA 4FSDA 3NUSA 5FQOA 4L7SA 4GS6A 5M09A 2XJ1A 5EOBA 4Y30A 3G89A 2YVLA 1OUKA 4LGGA 1GZNA 4PCLA 1X1BA 1RW8A 3TEIA 4LWPA 4EONA 3K3IA 2LAVA 1I9GA 1FOTA 2GS6A 3V8TA 3KR2A 3LFCA 2I0HA 3HVJA 4YUZA 4ITIA 1ZHFA 5CX9A 4DFBA 4YUYA 1YXXA 2ZCJA 5C4KA 3EYGA 3HVHA 4TXCA 4FZFB 5D1NA 5IMXA 3DKCA 2YDJA 3NWWA 4Y5HA 4RIWA 4U7PB 4ZEGA 3BU3A 3O4FA 3R04A 2UVZA 5ACKA 2BUJA 3GGDA 4O38A 3TQSA 3DAKA 2JDVA 4Z7HA 1OL6A 4KRDA 5ICPA 2G15A 4WA9A 1KYZA 4YBKA 3E88A 4BDFA 3MPMA 4DYMA 2Y8OA 3NUXA 4MK0A 4CGAA 4YTFA 4BDEA 3C3YA 2ERKA 1EIZA 1KOAA 3QF9A 3THRA 2PKWA 3KHKA 2I7QA 4I6HA 4PMPA 4R1VA 4GOOD 3VJOA 1J91A 4HPTE 3A7GA 5EHLA 4UBAA 1W98A 2FCAA 4E6AA 4EOQA 3KPWA 4E4MA 3LFFA 4OW8A 1JG3A 2PSQA 3M70A 3GU3A 3LKDA 4EH2A 5EKOA 3TUBA 5CEKA 4QMZA 1PMVA 2GLUA 5B7VA 4MHTA 5E2BA 2W9ZB 3C0KA 3I64A 4GBED 4M7IA 2P1DA 4AOJA 3VIDA 3D2IA 4I22A 2J9MA 4FT7A 2R3PA 4AFJA 3F3ZA 3LAUA 2O07A 2W06A 2WMTA 4ENXA 4I4FA 3OWJA 1SZMA 1DCTA 5DSXA 2PGXA 2QU6A 4EQUA 3I5UA 4FTCA 3UO6A 4FEQA 5FDPA 3TTJA 3VUIA 3PT9A 3MCTA 2A4LA 4LOQA 4F9YA 2PY6A 2J0JA 3MHTA 2GHLA 3KQTA 2F7XE 4RTNA 2NPQA 1Y8YA 3GB2A 3Q9YA 4C3FA 3X0DA 2HY81 3LFAA 1YDTE 4E1ZA 4YBJA 1UNGA 3WE8A 5EW8A 3G2PA 2JIVA 5JH6A 2R7IA 1YZHA 1DI9A 2J0KA 2GNJA 4O2PA 5I9XA 4RJ4A 3R7YA 4XOYA 2FRXA 4BCIA 4O83A 5G6VA 5FHRA 4EZ7A 4KIQA 3CC6A 5LQCA 5GJFA 4BTFA 1NA7A 4RWZA 4V0RA 5AP7A 4DFXE 1IA9A 3VS5A 5EW9A 5A4LA 3IDPA 2YCFA 4W8DA 3SGCA 3MS9A 1XJDA 1VZOA 2BR1A 4LOOA 5CS6A 4B99A 3HV4A 1KYWA 5EG5A 3LGAA 3PJ1A 5AX3A 1U54A 4FUXA 4BP3A 4L67A 2RFSA 3FBVA 2XBAA 1HMYA 5E8ZA 3V3VA 3JVRA 2F8LA 4GKIA 4FEWA 4PIPA 2JITA 3ENMA 3QTRA 3W33A 1Y6BA 1Q41A 1J7UA 3UJGA 2O06A 2IW6A 4ZTLA 4X21A 4EWHA 4ZMEA 3HKOA 3SAYA 1DAYA 1ATPE 4TN6A 2FO0A 2YZAA 4OGRA 3UZPA 2P3QA 1XBCA 5C8MA 1ZG3A 2C5VA 3CXWA 2HXQA 3KMWA 3GRVA 2CNUA 1DS5A 1VP3A 3BV2A 3ANXA 3CY2A 3C1XA 4L42A 3V8VA 3R01A 1JOWB 3UBTA 3TFWA 1H07A 3EFKA 4UWBA 5EQJB 3EN5A 1WBWA 1F3MC 3K5VA 4NM7A 4MXCA 3G5TA 4I4EA 1XR1A 3RTPA 1H1RA 3TIYA 1BOOA 2C5OA 2XIXA 3H9OA 4H3BA 4ID7A 3BYVA 3CEKA 3A7JA 4ZLYA 3WF5A 3DUWA 2EX4A 4MF1A 4WUNA 4YJTA 3GCVA 3BELA 5GM1A 2VTIA 2BMCA 2OO8X 3LXPA 3TV4A 5E8YA 4BCNA 4XOZA 4BR3A 3QBNA 2P3LA 4APCA 2XUUA 3ZO1A 5J5SA 3KQPA 1R18A 5EDQA 1QAQA 1B6CB 2Y4IC 4OQDA 4R6XA 2B52A 3SXFA 2UZEA 5CVDA 2EUFB 5EFQA 3C4CA 4C7TA 4MNFA 3HCEA 2W17A 4YJNA 5K03A 4ZS0A 5K0CA 1FMOE 2PUUA 4FL3A 3PX3A 3OFKA 4HCVA 4YJSA 4BGQA 5IEYA 3NVKI 5HNIX 2C6LA 3AXWA 3R63A 4X7QA 3DK7A 4NT4A 5K09A 4YZMA 4NL0A 1BKYA 3ORHA 3BEGA 3Q7EA 3E7PA 2PK9A 1SUSA 2UYCA 5KMJA 5E8TA 3IK3A 3VSEA 3Q4CA 3BGIA 3U54A 5DOSA 4YHFA 5GP1A 1W84A 4MIKA 2IG7A 3COHA 3ERCA 3KRJA 4HVIA 1XH4A 2BZGA 3OZTA 4FTJA 4L46A 2VTAA 3EQRA 3ATSA 3GCUA 4V0GB 2VTPA 1U2ZA 5D41A 3OCSA 3W1FA 2FHPA 1YHWA 4GQBA 4DGNA 5K8VA 4FV8A 1GIIA 4OT5A 4GJ2A 1G38A 4CFWA 4EHVA 5ETCA 2QO2A 3PP0A 3G9LX 4NUSA 3FPGA 5DFPA 4YJPA 3OXZA 3TRKA 4M7RA 3QUEA 3H9FA 3CQUA 4RTOA 4I0SA 5HFJA 3DFCB 3PZEA 4Y72A 4CTJA 5CSXA 3ELDA 2QQ7A 3TCPA 5KHXA 3WIKA 4TYJA 5EDRA 4ZTQA 3VW6A 1JKKA 4KRCA 3LFEA 1Q62A 3FMJA 3T7RA 3WF8A 2AC5A 3HDNA 5HE1A 3DCVA 2NXJA 4QYHA 2FPOA 2C69A 2H96A 4O7RA 2C5YA 4GIHA 3Q9WA 2YM6A 2P3GX 2IWIA 1Z57A 1XDSA 3T9IA 2AS0A 4FKOA 3O50A 4F0GA 2KULA 2UVXA 2YM8A 2VX1A 1V39A 4CFVA 5AA8A 2CLXA 5DHJA 2R3NA 4M15A 2B78A 5HD7A 1P91A 5IQIA 3JXWA 2C1AA 2WOUA 3T8OA 2XP2A 3G8AA 3AD5A 3PE1A 4H36A 3PA4A 3A99A 5HTBA 2P55A 4IZ5A 2VDUE 2XVDA 2QO7A 4LUDA 5CLPA 1RJBA 4TKSA 3ZOSA 5J87A 2LD4A 4KKEA 1TPYA 1WBTA 3OW3A 4X0MA 3LFSA 4C3RA 1PY5A 2PXAA 5ANOA 1H1SA 4M68A 2R2PA 3D2LA 4HVHA 2FB8A 3PY0A 4RC4A 4QNAA 5KO1A 3C4WA 3I7CA 2AN4A 4TW9A 2VTLA 5C1QB 3VUDA 1WXWA 4BCHA 1R0EA 4Y83A 3CBLA 5CY3A 3R7EA 1GZ8A 1ZOGA 4RG0A 3PJ8A 2PWLA 5HVJA 2H8HA 3MVLA 2VWIA 4GMYA 2XMYA 4QP9A 5E8WA 4C59A 3OUNB 4RMZA 4EK8A 4MBJA 3ZLYA 3A7IA 3RM7A 4B4LA 3GENA 4PONA 4FSQA 3R83A 1DAWA 2ZMDA 5CT7A 2B9JA 3R1NA 3EFLA 1GIHA 4GT4A 3FSKA 3JS2A 2ZTHA 4RTLA 4LFIA 4K1BA 4BDCA 1H26A 3P1AA 2RFEA 2PLWA 3HCBA 3FPMA 1UKHA 2NP8A 1TKIA 3FUPA 2X6EA 2C0TA 1ZLTA 4BP1A 2C6OA 3CTJA 4IZ7A 3E64A 2V7EA 4N6ZA 2PE0A 3MH1A 3WYYA 3KF4A 3FYDA 4TL0A 1YXTA 3HUBA 3SA0A 2C5XA 4RVMA 3QKKA 3F4KA 4FSUA 3M6UA 3H4JA 5H8BA 3W18A 4KIFA 3C9WA 4GUEA 2QODA 3D7ZA 4KIPA 4ERKA 3LFNA 2WTJA 3NR9A 5E9WA 4KAOA 3VUHA 3BBWA 5BVOA 3IG7A 5F20A 1ZARA 2VO6A 5LQFA 4E7WA 5EQEA 4O7TA 5EM6A 1O6LA 2ITUA 2BPMA 5AUUA 5ICEA 1Z3CA 4U80A 2YJSA 2XYUA 2JKKA 5FM2A 4J53A 3GU4A 5D9HA 3RKBA 2ITQA 2OBJA 2GNGA 4V0QA 3UVPA 3L9NA 2RL5A 1ZMWA 3A27A 3M6WA 1JSTA 1OB3A 5AM7A 1IAJA 3FMHA 4PWYA 4CT2A 4D55A 5JKGA 5FADA 4C33A 4E5WA 3W8QA 4FGRA 3RAKA 1H08A 2J4ZA 3ZSGA 1WS6A 5K0JA 3BWJA 2G8NA 3LL7A 2C4GA 2CJMA 3FMLA 1AGWA 4FV3A 2GNIA 4G56A 2GFSA 2Z8CA 2VTOA 2NRYA 4YUVA 2WTKB 1VYWA 2B55A 2UW6A 3ZS5A 3MVMA 3D5WA 5CF6A 4O7WA 4J98A 3R9HA 4S30A 4OA8A 1PXMA 3ZYAA 3RIEA 3V5TA 1JG4A 5LMKA 3TL8A 5CUQA 4ALWA 2WMAA 3GU5A 3RPSA 1PKGA 2A1AB 2PMIA 3ID6C 2R3GA 5JFSA 5LMKC 2P41A 4R5SA 2ZFUA 3FI8A 3BBTB 4U79A 2V5QA 4I24A 2Q0BA 4XBRA 3FLZA 4BBEA 4BN1A 2V0DA 3MY5A 3UIXA 1H1WA 1XCLA 3OVVA 5CEMA 3BV3A 2QNJA 4FR0A 2JC6A 2UUEA 3VS6A 3F9NA 4YNEA 3P97A 1QPDA 3DH0A 2H9VA 4JS8A 3Q32A 3REPA 3FZRA 4IC7A 1FVVA 2BTRA 2ZB0A 3MB7A 4CMUA 4CWAA 3OPNA 4PDSA 3BHTA 2CKDA 3MN3A 4L43A 4IX6A 5HKMA 4IANA 3QD4A 4NJ3A 5ETIA 5IA0A 2OXDA 5CAPA 3SHEA 4YHTA 5JQ8A 3FUXA 5AV3A 5EHGA 1YXUA 4EYMA 2AYPA 4AF3A 3UNZA 3VF9A 3KB7A 2ZWVA 4R78A 5GIOE 2PVLA 4ZY4A 4QNYA 3ORKA 3GC8A 4IWQA 5LVOA 5DYJA 4LMUA 2HWOA 3ZLXA 2P4IA 4O0WA 3B2TA 4QMLA 3QQKA 3KK9A 3ROCA 3UFBA 5CVGA 4NTTA 4YZBA 5LARA 4P7GA 4MXXA 3P9IA 4QTAA 3CSVA 3ZM4A 5LMAA 2OW3A 3I9FA 2W1FA 3TZ8A 4O2ZA 2PVRA 3G51A 3F2NA 3V04A 3ORPA 5AV2A 1W7HA 5KKRB 4PL5A 4OTDA 5IEVA 3QC4A 2JFLA 3MFTA 3P7CA 3QWJA 4WO5A 4AA5A 2QD9A 4M8TA 2DWBA 3P2KA 3GC7A 3KKZA 2OI4X 1A06A 3KQYA 4HVGA 5B2LA 4AP7A 2HZ4A 3BLQA 4M84A 3HAVA 2OZAA 3LOKA 4E2ZA 4IE9A 2WTKC 5C03A 3R24A 3UJ6A 4X3JA 4O6LA 4FA2A 5HIKA 3ELUA 2WFYA 2VTQA 4RVLA 3CCFA 3ULZA 2FVDA 3Q60A 3UQGA 2ESRA 2VWYA 5EM7A 5AUXA 2I0YA 2QHMA 2W4KA 3KQQA 4BDKA 4QTBA 3IDBA 4FKTA 5DI1A 5DIAA 4PL3A 4RX5A 3NRMA 1ZYSA 2EFJA 4BKJA 1KPIA 4O81A 5EZSA 1SQGA 5K3YA 4E93A 3MDYA 4JVGA 2C7PA 4AGUA 2NP7A 5CU3A 3ZUTA 2UW8A 2VX3A 2X81A 3EGIA 2C6EA 3FTFA 5CVHA 2R3RA 4S34A 3E92A 2OJGA 3KQMA 3CVOA 4C3PA 3I0QA 3DDQA 4KDRA 3GCZA 1W8CA 4CZTA 1KE8A 1X1CA 4YP8A 1JBPE 3I53A 3O17A 3MTEA 1Z5MA 4EBWA 2WAJA 4RVHA 3FWQA 4QVGA 3HM2A 4RVDA 5AFVA 3UOKA 1HOWA 1Q4LA 1WVYA 2VNYA 4YTIA 2IIPA 4G3EA 3SSNA 2ZZKA 4NCTC 4O0YA 5E2AA 5HIBA 4N70A 2IDKA 3KRRA 1SNUA 3A7HA 3T3UA 3KREA 4J95A 5K5NA 4LOPA 1WBSA 5F1ZA 3GC9A 4MQ4A 3C13A 4ZSAA 2F57A 4EJ7A 4RRVA 3Q5ZA 4P4CA 4D58A 3LSTA 3F3UA 3PY1A 3NZ0A 4AW1A 3ZXZA 4J8NA 5GWXA 4C03A 1Q99A 2VTMA 3LJ2A 1U5RA 3DNEA 3C0HA 2VTRA 3LHDA 5L3AA 4RJ6A 4AZFA 4C37A 2ONYA 2PL0A 4G3FA 2PVKA 1PMUA 4KD1A 3CGGA 4ZTSA 3UDBA 3ZLWA 2PXCA 5JK3A 4LRJA 4YJOA 3ZZEA 4ANSA 3FLWA 4L7VA 4CXMA 2YABA 3DJ7A 4RFMA 4FT9A 4GIIA 3HA7A 4QPNA 3FMMA 1JNKA 3V5WA 3KR9A 1YI3A 4JT3A 3E3PA 4ZSJA 4FGBA 3HRCA 2ZZNA 5JQ5A 3AXTA 2NNWB 2GA9A 2ITVA 2PU8A 3SXRA 2EXMA 4NTSA 3KCFA 4QO9A 5E92A 1NE2A 3Q87B 4GU6A 2DQ7X 2UW9A 3E5AA 5BVKA 4FP9A 3Q9XA 3OD6X 3DBFA 3QCYA 2A2AA 3OROA 3FMEA 2VO0A 3BKWA 1ZMUA 3KMMA 1J7LA 3SV0A 3SGLA 2GAFA 1V0BA 3R3HA 1WBNA 2QR7A 4Z7GA 2XA4A 3LX6A 4ASXA 4ZJIA 4D5HA 5FQDC 1JKSA 4EK4A 3DS6A 3BEAA 4GK3A 3E8NA 3SQQA 1KE9A 3Q9ZA 2HZIA 5CEIA 2P3OA 3PPJA 3QKLA 4O7SA 2VTNA 3ZC6A 2B53A 4MYGA 2WMXA 5DRTA 3U81A 3EZVA 5EHIA 5HG7A 1YI4A 3GFEA 4MNEA 4MCVA 4K8AA 3T7TA 3G2QA 4D4VA 3QALE 4KW7A 1IRKA 3PS9A 3UP7A 4U81A 1WFCA 2HV9A 4L52A 4M0YA 2UZUE 5H9BA 5AV1A 3LM0A 2VWZA 3SXSA 2VU3A 3AJDA 2YIXA 4QYGA 5AP1A 3GRZA 4CVAA 4BB4A 4NW5A 2WQBA 3EH9A 2GH1A 4E4NA 5DX0A 4ZZMA 5ACBC 3ELWA 2BDFA 4QMNA 5AV0A 4FSRA 3OT3A 2VAGA 5IU2A 4ER5A 3V5QA 3QX2A 4DT9A 5EG3A 3O8UA 4OT6A 5CEQA 4P58A 3CJRA 4POOA 5IUHA 2VTJA 5EM8A 5LQJA 4LV5A 2XIKA 5EKXA 3JPVA 1Q0TA 3VQHA 1NW6A 1M7QA 3MGGA 3KC3A 1INLA 3OU2A 5DEYA 4JJRA 1JR4A 2V7AA 5HI2A 4USFA 4BTJA 4WHZA 4LECA 4PNEA 4PTEA 1OI9A 4I5CA 4PTCA 3V5LA 3TM4A 3DMHA 5L2TA 2R9SA 4HCUA 1PMNA 2W99B 2ONLA 1K3AA 3THBA 3NWEA 3AXSA 1W83A 1QZZA 4FNXA 5BQ0A 4FSXA 2OXYA 1PKDA 2PVHA 4RJ7A 3PTGA 2JHPA 5E1DA 1YQJA 3P2IA 3LHJA 3R1SA 5IA4A 1QPEA 3IOPA 2BRNA 4K9YA 4QQKA 4WSYA 3IOKA 4IMYA 3PIZA 4FTOA 5J7HA 4OBQA 3LCOA 1JG2A 3ZO2A 9MHTA 5E1EA 2BR4A 4AOTA 5DM2A 4GFGA 4JAIA 4UYNA 3TG1A 3HCDA 2F49A 4KBKA 4WD5A 4FIJA 1DM2A 1PXNA 5EYMA 3ALOA 4WG5A 3A7DA 4JAJA 3GT8A 5LVPA 3EMGA 1UWJA 2WA2A 4H1JA 2E9UA 4AWIA 5GOZA 4P7JA 4AW5A 3BQRA 3JWHA 2XJ2A 3HZTA 4I93A 4OBXA 5CAQA 4J7BA 3OT8A 3QCQA 4F1MA 5FA8A 3BHHA 2QOBA 4JDIA 2OU7A 3RVGA 5EGSA 4G9CA 2CGUA 3QGYA 2PHKA 5FTQA 2G72A 2B1PA 5TO8A 5JUWA 3QRJA 5HD4A 1QANA 5GHVA 2OXTA 4CZUA 4E4LA 5EYKA 3R9RA 4L6QA 3FKOA 3QZGA 5FA5A 2NRUA 3IW8A 1DUSA 3RALA 4BI0A 5BVNA 1BC5A 3ELJA 3TACA 5M5BA 1OMWA 2XK8A 3FC2A 3I6WA 4UY9A 3LFQA 1UIRA 5T6BA 3VBVA 2CNVA 4RX1A 5IG1A 1XQZA 2E5WA 3DDPA 3UNKA 3P86A 3V5JA 1V0OA 2F2UA 4QP2A 3RAHA 5DPMA 1SMHA 3ER9A 4FVQA 4DKJA 3O8TA 4H05A 1PW2A 3PXYA 2Q41A 5DT0A 1KE7A 4G17A 3LQ5A 1XCJA 4OTHA 3PY3A 4R6VA 3R0TA 4CRLA 1MRUA 2VX0A 4TYGA 3FPHA 4PYKA 1MRYA 2JHCA 3M42A 5IF1A 2JGZA 5EKNA 1FGIA 2X2KA 4U6RA 2XKCA 5CYIA 4O96A 5J9YA 3NCZA 3KCKA 3KMUA 3F61A 4IV8A 5IKMA 1OGUA 4QP6A 2WTIA 1TQPA 4FV9A 4BTMA 2JDSA 4K33A 3FPJA 3C4EA 4L01A 2BZHB 2CMWA 4DF3A 5M07A 4CRSA 3KQWA 2FH9A 4O21A 3Q04A 5HHWA 5FTGA 1BI8A 3U6IA 5FQNA 4IB5A 5AUZA 4FT0A 3G2OA 3VBYA 2YWPA 4X3FB 4WVLA 5BUIA 3QLFA 3R28A 5FXQA 2P2HA 1YOJA 2W1CA 5P8WA 4AZTA 3C50A 5JEBA 4FUYA 2C6TA 4EH4A 4GYGA 2CLQA 4EZ3A 4GF5A 2YCRA 1VL5A 2CGWA 4DFUA 3EVCA 2G1PA 4G5PA 2YHVA 2EJUA 3HNGA 2AVNA 3MW1A 5HZMA 4U97A 5CWZA 5A4CA 3PE2A 4UEUA 3H3CA 2WU6A 2ZWAA 3LCSA 2PVNA 4ZSLA 2UZLA 4EKGA 3LBFA 3NYVA 5CVVA 5I9WA 3G5DA 4E5BA 1GAGA 3WF7A 4TWOA 2QVSE 3V6RA 5KMMA 1YZ3A 4BI1A 4U0IA 2UZDA 5DXJA 4WNOA 2R3MA 2ERZE 2QLQA 1UA2A 4RJ3A 4R6WA 1Q24A 4EOPA 4HGLA 2OJFE 3DB8A 3RAIA 4FICA 5LQRA 2X4FA 4AE9A 4LRKA 1VE3A 2ZB1A 3GNLA 2O64A 4ANLA 2VP3A 2UZTA 2XNNA 4QMYA 5G1XA 4YLKA 1H4LA 3W8LA 2WOTA 1XH8A 4C4EA 4TYEA 4UZDA 3F88A 1FMKA 2X9FA 4MX9A 2UYHA 4MD7E 2QOFA 4Y8DA 1UU9A 3IYLW 4NM0A 1RQQA 4FKIA 3H0YA 2WGJA 3FY0A 1Y91A 2FSOX 4YMHA 5CSPA 1P1CA 4HC4A 5AP5A 2YIYA 4U8ZA 4F4PA 2F4JA 3HX4A 4ZZNA 1JQ3A 3GU6A 4FIEA 1NV9A 5DPVA 5HU9A 3HMMA 1ZGAA 2CCIA 3IS5A 4RLKA 2WMVA 3VYWA 3KU2A 4YC6A 4NFMA 4BF2A 1W0XC 4RIXB 3FLQA 3UODA 2OF2A 1JKTA 5KMKA 1YHVA 5KE0A 1F38A 5D1HA 3E8CA 2VNWA 4ACHA 2R3KA 3KULB 4IAZA 1XBBA 5EQPA 1IASA 4FNYA 3RWPA 1HCKA 2Y1WA 3Q2JA 2WQMA 3I5ZA 3GDHA 4S33A 3IGOA 4DH7A 3MFUA 2W5HA 3UMXA 4V01A 1VBFA 1ND4A 4X3FC 5JFWA 2GU8A 3P7AA 3KPYA 4B8MA 2G01A 5DM1A 1IAHA 2HYYA 4RSRA 2PX8A 4E2XA 4V04A 4BCKA 3EL8A 4EOOA 3ATTA 3KU1A 1MP8A 3MIYA 4QMOA 5ETAA 5D10A 3ZO4A 4DEEA 4MWZA 3EVZA 3S68A 3B3FA 4HGZA 1R39A 3O0GA 3P2EA 2ITXA 5ICGA 3LIJA 5EQYA 2GTMA 4GUAA 5AWMA 1VJYA 3S4QA 3BIZA 3TXOA 3QA8A 4IVCA 1RI3A 4EKLA 4ZJVA 3F69A 3FMKA 1OUYA 2HWKA 2UYOA 2B9EA 4OTWA 4QMMA 4FIFA 5JZNA 1N2XA 5HCZA 4CKIA 4NFNA 2PVJA 4YZCA 3HAMA 1REKA 2XNPA 4EOJA 5BNJA 2CHLA 5DWRA 3R6XA 2CCHA 4ER0A 1NBHA 2JDTA 4FSTA 3C7QA 2HENA 3ETAA 4X2GA 3AT4A 4A6EA 4A9UA 3HCFA 3NUYA 3S00A 5AEPA 2J51A 5DEWA 2E9NA 3NPCA 2BH2A 3B8RA 2XNOA 4KA3A 5HQ0A 2PVCA 2GMXA 4XRJA 4CKEA 2YXEA 4X2KA 3UQFA 4NKSA 3DLSA 2PULA 4CFXA 5JFXA 3IV6A 1IEPA 1IM8A 3IONA 2XK7A 3T3VA 2HCKA 2QOOA 2VTTA 1BMKA 3FXWA 3UWPA 5EH0A 1X8BA 3EGEA 4K18A 4B8LA 1CMKE 3DA6A 3QA0A 2EJTA 4ZLOA 3QD0A 1IG1A 2E9VA 4JBQA 4CFUA 4QMXA 3A8XA 5F95A 4FTQA 3U8WA 2UW5A 1KPGA 3HLLA 3FYJX 4CKCA 4UN0C 5BXYA 3IECA 4A4LA 3DXZA 3PDTA 3UOJA 4DEGA 1L3IA 4JRNA 5AUWA 4YJUA 1Q3DA 4FEUA 4IW0A 5IDNA 2Z7SA 1QL6A 2HR1A 1OVEA 3R7IA 5IA3A 3EQDA 2P2IA 5CZHA 5IPJA 3FY2A 5H3QA 4R8RA 2VDWA 2PBFA 4TNBA 4X2FA 1M6EX 4KS7A 4AQCA 2PX5A 2JDOA 1RI2A 2G71A 5GINE 4TT7A 2WD1A 4JR3A 3BWFA 3L9LA 3CY3A 4X60A 3MY1A 5JRSA 5DGZA 2AOVA 3ALNA 3UNJA 5EMLA 3F7WA 2ZSUA 5TOZA 4PGGA 3DNDA 4W4VA 4MKCA 3KQ7A 5AMNA 3R0QA 2JD5A 2XNMA 1GY3A 1I44A 1H1DA 2C3JA 5CU4A 4KNBA 1ZAOA 3RP9A 2YDKA 3EKKA 2W1ZA 4AGCA 3ZC5A 4XLIA 4FKJA 4XV2A 3TDVA 4QPAA 3M33A 3S1HA 1KXZA 2WQOA 3EQHA 2R7BA 3NDJA 3RHKA 5M06A 3VAPA 3COKA 3PFHA 4RV9A 3EOCA 3OE4A 1P39A 1XDZA 2O57A 4HRAA 1CKJA 3SSMA 1QAOA 3M4XA 5ANJA 4D4YA 1UNLA 4BDBA 3PIYA 1R1WA 3FRIA 3I7BA 4QDKA 2W1DA 5EK7A 3NMUF 3DAJA 4BICA 4RZWA 5DNRA 3S95A 3PG3A 2XZSA 2GFCA 3D9VA 2ZVAA 4CT1A 3QQGA 4F08A 3UO5A 4J52A 2O8YA 1UV5A 4PDOA 2WZJA 3KRWA 3MB6A 3OBGA 1G60A 2OO3A 2P33A 4S2ZA 4C4HA 3C5UA 1F3LA 4M37A 3G15A 2GDOA 5DSTA 5U4XA 5E8XA 4MWIA 2O65A 2B9IA 5DTRA 3Q96A 4BTKA 4G2FA 5EI6A 1NW8A 2QYOA 3OWLA 4W4XA 3H0ZA 5M44A 3RAWA 5JGAA 3DMGA 5E1MA 4FKSA 4DFZE 4EH5A 1H0VA 5FTOA 4TNDA 4PY1A 3BYOA 3MV5A 3QQHA 2NXCA 3E8EA 3KQOA 3NGAA 4XV9A 4DG2E 4Z2YA 4ZP5A 2WO6A 3U6JA 3PLAE 1HCLA 3DBEA 4R05A 2JAVA 4EC8A 1ZYCA 4NYEA 5EEGA 4G1WA 4LRMA 4HW7A 1Q8WA 1CM8A 4RTQA 5JFVA 3PSDA 10MHA 1PHKA 3JWJA 3JVSA 4HSGA 2B9FA 4DBNA 2Y6OA 4R3CA 2UYQA 3FJQE 2PT9A 1BI7A 3WBLA 2XKEA 2VZ6A 4RC3A 3O7WA 4JG7A 2Z2WA 2XKFA 4F09A 2I6GA 5CVUA 2B0QA 4BIEA 5KYGA 4UX9A 1OIUA 3D7TA 3VS2A 4MQ1A 2BM8A 8MHTA 2FSLX 3UC4A 3GXLA 5GJDA 4YMJA 4QP7A 4FT2A 3RCDA 5HU3A 4L3JA 4CV8A 4CFFA 2O2UA 3TR6A 3TKAA 2ZM1A 1UFKA 3HRFA 5H02A 1OL7A 4PX6A 3D0EA 3ORZA 4ALVA 4DH5A 2QM3A 3KGAA 2WMWA 3I4BA 5C1IA 5DR9A 3ZUVA 3P9NA 4Z16A 4P7FA 4FSWA 2VDVE 2YM4A 3AC1A 4FL2A 3BI6A 4ITHA 3NLBA 4E26A 2ZDUA 1ZWSA 3IHTA 3LDFA 3AC2A 5HNBA 2BALA 5ANGA 4FGZA 4AZEA 2J0MB 3N4UA 4OX9Y 2DS1A 4HGYA 3S3IA 1L1EA 2AR0A 5L8KA 5I5ZA 5JMSA 2ADMA 3GRUA 2GNHA 1Z9XA 3HMNA 2DPMA 2XYQA 4L45A 3SW4A 4IX4A 3HV6A 4NIFB 3P08A 1VIDA 4U7TB 4HZRA 3R21A 1M52A 3QD2B 4F0FA 3NW9A 2F2CB 2CL5A 3N9XA 2QKRA 3F7ZA 5A9UA 3C6MA 3B2WA 3W16A 5M4IA 5IA5A 4CKBA 4IM3A 5AA9A 1R74A 4CMOA 3CS9A 2P40A 5FD2A 2WTCA 2EB3A 4EOLA 3G5LA 3TNQB 3HP5A 1I1NA 1EH4A 5T64A 2WMQA 4XP3A 3U9NA 3BHUA 4WNMA 5CCXA 3WF9A 5DR2A 3RK7A 4LYNA 2VV9A 4GK2A 5EMJA 4KABA 5M51A 5CSHA 4EHEA 2VWVA 3QQFA 3CE3A 4KKHA 2YDIA 3EEYA 3PVCA 2OK1A 4OBOA 1QPJA 4F1OA 4OBWA 2OZVA 1TQMA 4EH3A 4II5A 3PUPA 2Y4PA 3HA3A 1XJ5A 4WIHA 4R7HA 4OTIA 3ORMA 3JY0A 3MPAA 1V0PA 1OL1A 5F2NA 1YWVA 4IAKA 3NIEA 4JG8A 2YZLA 4DHFA 3PVUA 4JDHA 4ENYA 4XYFA 2W9FB 1NW5A 2BRMA 4FKPA 3R73A 5EYCA 4RA4A 2C1BA 3R8MA 3COMA 5DVRA 3I5NA 2ERCA 2GS7A 3NNXA 3R9OA 2C68A 1SYKA 5DM4A 3VS1A 3EFWA 2IN6A 3GOPA 4BIDA 1KPHA 2PMNX 3HL7A 3BE9A 4IAYA 2IZTA 4D5KA 3D94A 5A6OA 1PXJA 3QXPA 3BE2A 1MHTA 3T9TA 4IV0A 3F3WA 4BGGA 3ZDUA 4F6WA 3PB3A 4C4JA 1SUIA 1PMEA 5HESA 2GB4A 4JNWA 3VJNA 2PJDA 5FUBA 2PE1A 4E6CA 3AD6A 4AU8A 5BVWA 2R3LA 3TKHA 4L53A 2DULA 3Q5IA 3KN5A 4IQ6A 2A27A 5IQDA 2ZBPA 3KVXA 5HG9A 4E20A 2R3OA 1MRVA 3SG8A 4DGOA 3P5KA 1RE8A 1XWSA 3BT7A 5HIIA 4A9TA 2XB7A 5BYLA 3CPBA 4I21A 2VWUA 4IIRA 5AP2A 3R1QA 3FPFA 3SR4A 3RK9A 2ITPA 3HP2A 4XMOA 1DI8A 2AOTB 4ACCA 1D2GA 4O0RA 4ZSEA 3NUUA 3ZMMA 1O9UA 5CTPA 4Y73A 2OFUA 1XDUA 4NZWB 3AMBA 4WG4A 3RNIA 4FX3A 1JQHA 1R00A 2ITOA 4I5MA 2PMLX 3ZO3A 4C4IA 3RPRA 3GCSA 1SKMA 3G9NA 4XCUA 3DFAA 2VWWA 1SVHA 3A4PA 2PUIA 4RTJA 4DEAA 1OR8A 3EEOA 4FZAB 5I9UA 4LGHA 4MEDA 3DQWA 2BR3A 2PXXA 4B17A 2V55A 2C3IB 5F4NA 4BDHA 4QQCA 4EL9A 1AF7A 1JQEA 5E8SA 4ZTBA 4MQ2A 5B0XA 1KSWA 3ZUUA 5IMEA 4ZJJA 2OXXA 4M36A 4F64A 3DMFA 3U4WA 5BVFA 5AIKA 5BX0A 1K2PA 5IQEA 4X61A 2CWWA 5DX8A 4HYHA 3PIXA 3NCGA 2WEVA 2OJ9A 3U6HA 4EKIA 2EB2A 2BDWA 2DYLA 3PLSA 4MXAA 2BILB 2W1EA 5DLYA 2N47A 1SM2A 3TI1A 4FIIA 5A6NA 4FT3A 3BWCA 4EOSA 3DT1A 3B5IA 4QP1A 5CALA 3SX9A 4RTPA 4FTRA 4BLUA 3CJTA 3ODYX 1WMKA 2OSCA 4YLLA 1NY3A 1U46A 3QTXA 3ZRLA 2B54A 4R3RA 4EQZA 1LEWA 3HV7A 3L8XA 4DLIA 2ZDTA 1QPCA 4YUQA 1GJOA 4C08A 4A4OA 5AUYA 2YWVA 3E05A 5IQAA 4CG9A 4FZ7A 1ZKDA 2ZBQA 2Z7QA 5DLSA 5F94A 2PUPA 3CP9A 4DFYA 3UZRA 4ZTMA 4L00A 4N6YA 3OCBA 3QQUA 5K0EA 1ORHA 3TNWA 4KSQA 4JXJA 1UU7A 3MVJA 4YO6A 5CF8A 3DXYA 3KRLA 3FI3A 1K9AA 1E1VA 3DY7A 4WBBB 3GIWA 4MH7A 4XEYA 3FC1X 1AQIA 4J99A 1G8SA 3EL7A 5CQUA 5CSVA 2OIBA 3HMOA 3UJCA 3EMDA 2BKKA 3A7EA 4A9SA 2KW5A 5K5XA 4GL9A 4FTLA 5CU0A 1XH5A 2REIA 2YCSA 3LDUA 2IVSA 5JR3A 5FUTA 1XH7A 2XIZA 3V01A 4D1XA 1JSUA 4YLJA 4JI9A 3GQIA 2R0IA 2V62A 4F7NA 5HCYA 2P7IA 4YV2A 3KN6A 3UJ9A 3PG1A 1JLUE 3TTIA 1XBAA 5C26A 5ANDA 4KKGA 1WAKA 1Q8TA 3VC2A 3DOGA 4I1ZA 4IWNA 3E3BX 3G2FA 2R3HA 4PINA 3L9PA 1U5QA 3MTLA 3OHTA 4FKVA 5E91A 2UZNA 4DGGA 4PP7A 1YFLA 3OWKA 2NXEA 5E90A 5K0FA 2AOWA 3ORLA 4EK5A 4IAAA 3UQCA 3ZH8A 5IH4A 3QGWA 1QCFA 3OZRA 3DKOA 4HYUA 3QD3A 3HEGA 5AIRA 3HDMA 4IM0A 4A9RA 3FZGA 3OU7A 2QOIA 4LM5A 3JUHA 3QTZA 3F3TA 5C01A 2WTDA 3CJGA 2BROA 4KS8A 5M08A 3UJDA 3PXKA 4GVAA 3ACJA 2FYSA 1FPUA 1ZMVA 2ZMCA 3BUSA 4HYIA 3EJ1A 3W55A 4C07A 4WNKA 3QUDA 4O7VA 2YJRA 4AN3A 4CQEA 2EWAA 4DT8A 2HW6A 4AGWA 2J0LA 2VD5A 1EG2A 1NT2A 3MI9A 2YR0A 4QQ5A 3BX5A 2W7XA 3S0OA 3AC4A 1NVQA 5KNJA 1SG9A 5CU6A 3HV5A 3M1SA 1S9JA 2JLDA 5CXZA 2X8DA 4FKQA 3F6XA 4IWDA 1LR4A 1FQ1B 1P2AA 4BC6A 3R8VA 3GOKA 4ORKA 5GIPE 2RG6A 1UWHA 4E70A 4CNHA 2X1NA 2PZ5A 4RX8A 3OE5A 5J1VA 2R3SA 3LMHA 4DTBA 3EN6A 3QTUA 5EKUA 4ONAA 4XCXA 3WZDA 4XJ0A 5M4CA 5E1SA 1Q8ZA 4EQCA 4EUTA 3R30A 1VEBA 4FT4A 4XBUA 3EKNA 1UU3A 3MIAA 2XEZA 4IH8A 2V22A 5D11A 4NK9A 3MFRA 4GKHA 4UXQA 4OTFA 3BKXA 3RINA 5FCDA 1YDSE 1ZXEA 5MHTA 2WK1A 3O71A 3OU6A 1WVXA 4OQEA 5E9QA 3PXQA 1B38A 2HWPA 3Q6WA 2E9PA 3FAAA 2XRWA 3E23A 2AN5A 4IVAA 1URCA 5KUPA 5DT2A 1NW3A 2VO3A 4IB3A 3QZIA 1JAMA 3MCZA 3WARA 5LQKA 4I6FA 3FUWA 4AN9A 5DRDA 3FZPA 3KXGA 4M97A 3V97A 2C0IA 2VZ9A 5EVJA 4JG6A 4LQMA 4MHAA 4HNFA 4PMMA 5M57A 2B3TA 4DM3A 2BIKB 3VC1A 4FEXA 3NW5A 3QAME 3NWBA 2R3IA 3BU5A 4V0GA 3AQVA 4E31A 4XG6A 1Q8UA 1H1QA 3GBZA 2O0LA 4UB7A 4QTDA 1KV2A 4TYIA 2R3JA 4AACA 1WZNA 3G2MA 1EJ6A 2W1IA 1O54A 3NDIA 3OCGA 4I5HA 5A4TA 3CR0A 4PMTA 3R2YA 3OW4A 4TYHB 4CTCA 3R7OA 3QZFA 3LE6A 4DFNA 3SRVB 2ZV9A 4PTGA 3KKVA 1L8TA 2AOUB 3I79A 2UZOA 4ZY5A 3QQLA 2X4ZA 2UZ4A 3G0EA 2JJQA 2XK9A 4OBPA 5EHYA 3VNTA 2IH4A 2R3FA 2BIYA 1TVOA 4FTMA 2H1RA 3EYHA 3P71T 4F7JA 1FVTA 4FT5A 2QR8A 3PVWA 1WBPA 3V8WA 5AJQA 3IW6A 3FV8A 4CEGA 2FA2A 3QRUA 4N4SA 3LCKA 3PVBA 1P4FA 3LCUA 2QKWB 4D9UA 3GO4A 2RIOA 4RWJA 2PZRA 5A46A 3SVZA 2OZOA 4RTKA 3A25A 4IKPA 3CKXA 3AC5A 3PP1A 5CXHA 4JIAA 3UG1A 2CNQA 2QOHA 4YJVA 2C7OA 2W5AA 2XK6A 4OLIA 3P8ZA 5C4LA 2JIIA 2GHGA 3QZHA 4XHKB 3R02A 4TWCA 3LFBA 2G2IA 2Y0AA 3MYGA 5K4JA 2VS1A 4DBXA 2XNGA 2CSNA 4H58A 2AZTA 2VGOA 3RHXA 4GEOA 3ANRA 3DK3A 2XBJA 4BDGA 3GU7A 5E7RA 4DTKA 4YNOA 4K6ZA 4C04A 3KA0A 4MWHA 4K77A 4RIWB 5KBQA 4YSMA 3UJBA 1GNGA 5EPEA 3NNWA 5AP6A 5EIFA 3G88A 4RBLA 3LKZA 3BZ3A 1N7JA 4TWPA 3ZONA 3CJFA 3Q3BA 4F70A 1ZRZA 1YWNA 1X1DA 4EQMA 4GK4A 4HNIA 1BYGA 5CU2A 2BHEA 3BU6A 4CTBA 2W4JA 3PSCA 3B89A 4USEA 4R8SA 5ITAA 2IGTA 5DT4A 5DM0A 2WA1A 4LI5A 2W1GA 2VN9A 5J1WA 3LCDA 3C0IA 4NKAA 5L6WL 3LBYA 3R6TA 2C47A 3MY0A 3BKBA 3MSSA 4DGLC 2GSFA 3R9DA 4J71A 4NH1A 3L8SA 5FG8A 4QP8A 4OTGA 4C38A 5LCJA 1XTPA 5LOHA 4TTHB 3LQ3A 4GVJA 4DA4A 3ZFYA 4G31A 5M56A 4FZ6A 4DN5A 2XM8A 1RJDA 4HPUE 4U45A 4AW2A 2ZVJA 4ZAUA 3EVBA 2B7AA 4GH2A 2VRXA 3FXZA 2HY0A 5T3QA 4C35A 3DLZA 4P90A 2YCQA 1V1KA 4K0YA 4F85A 1STCE 5B1SA 5HILA 1SQFA 3VBWA 4RA5A 1RI5A 4L68A 2I7CA 3GVUA 3QFVA 1LEZA 1GIJA 3MB5A 4GU9A 2JKOA 4AG8A 2WQEA 2X39A 2CDZA 3IEIA 4XP0A 1YXSA 1JTEA 3OBJA 5FBOA 4EHZA 4I3ZA 3FE3A 3E87A 2PT6A 2CKOA 3P9CA 3CC8A 4P7KA 1YDRE 3SD0A 4FSYA 3OEFX 1B39A 3K5UA 1L9KA 1MUOA 4YC8A 4G9RA 4EOMA 1UKIA 3MWUA 1IY9A 4RVGA 3VS3A 4I23A 1KUTA 3Q2MA 4MXYA 2JBPA 1SVGA 5DR6A 5LVMA 3QYWA 2G2HA 3O2MA 1MQBA 2B9HA 2V7OA 3KXHA 5I9YA 4BZOA 2HXLA 2BZIB 4XG4A 1TW3A 2CKEA 2PMOX 3HTXA 5C9ZA 5LXMA 4EWQA 5LSAA 4YC3A 2GNFA 4KIOA 4A4XA 3IO7A 5HIDA 2F7EE 3QOXA 5HG8A 3ORXA 5HVKA 5E1OA 5E8VA 3B3GA 2ZW9A 1A48A 1SVUA 2R0UA 4GC5A 4DMGA 3I60A 2WMBA 2Z7RA 4F86A 4A6DA 3ER8A 2WU7A 4FKWA 1YB2A 3NAXA 4DCAA 5ANEA 1U54B 4EORA 4L3LA 3C4XA 3PA3A 3ZRMA 1WG8A 3JWGA 3PZHA 4O7LA 4WXHA 2UW3A 4JX7A 3VRYA 3ZEWA 2OYRA 5E4HA 4PWNA 5CAVA 4CFNA 3TM0A 3CIKA 3G6GA 2PWYA 2EXCX 5EMKA 3GRRA 5L8LA 3DU8A 4QMPA 4RZVA 4FKUA 4M69B 1ORIA 3BHVA 3SG9A 1PXPA 1XH9A 3R2BA 4D1ZA 2I62A 4YUXA 3GQLA 4UWCA 1WBOA 4MVFA 3UC3A 3TKYA 3ZDIA 4W4YA 4F6SA 3OTVA 5HEZA 2I0EA 1UVRA 4TPTA 2I1MA 2FK7A 2PE2A 2XCHA 3A61A 2WB8A 3LZBA 4OR5A 3FTEA 2BTSA 5IDPA 5KMNA 4RFYA 4C02A 2JDRA 4EMSA 5TF9A 2WQNA 3QTSA 4NCTA 2C5NA 3KPUA 5JRQA 4G6LA 3R00A 1VQ1A 5C9CA 3QRKA 5BVEA 2QI8A 2PTKA 2WMRA 2ITWA 4E5AX 2RGPA 4JLCA 4K6MA 3FQHA 4F9CA 5CVEA 4XH6A 2G9XA 2XF0A 5EMMA 1L3BA 3V8SA 4GOLD 4AN2A 3P9JA 3PA5A 2WTWA 4LL5A 5DA3A 3NW6A 4EOIA 2Y4IB 5M55A 3DZOA 4AUKA 3CGOA 3WZJA 4A06A 4UYAA 1CKIA 4WKQA 3DB6A 4DLJA 1PF8A 3E62A 3ME5A 5F2KA 3QHRA 2AN3A 4FEVA 3ZZWA 3GC0A 3ORNA 5HVYA 3E8DA 4R1YA 1H8FA 5HIEA 2IW9A 2W1HA 1APME 5KKRC 1REJA 5JGBA 3TZMA 2OG8A 1JQDA 3DR5A 4L8MA 3UIBA 4YMGA 4JDJA 2PX2A 4AGDA 4AZSA 2OB2A 3CGFA 4U44A 3MAGA 3EVAA 4GYIA 2X6DA 2OWBA 5KQRA 2XJ0A 2YIWA 2WELA 3MPTA 3FLYA 3FHRA 4R3PA 5AAFA 4E6DA 2ONZA 2XYVA 4H3QA 4ZSGA 1AD5A 1G6Q1 3QOWA 3I58A 3EQFA 4M38A 3VF8A 2HTEA 2FSTX 4G3CA 4DGMA 4BDJA 2BKZA 1EQAA 4BCMA 4D2SA 1EJ0A 3D14A 1P14A 3AG9A 4IWOA 4FYNA 3TOSA 3FUVA 1OPKA 5K01A 4QP4A 3PXZA 5B2KA 3I6UA 1L3RE 5CI7A 4GEKA 1J1BA 3OWPA 2HZNA 1BL6A 3OUKA 4CG8A 2YAKA 5IEXA 2ZLBA 4FL1A 4D2RA 3G0FA 4X63A 2C30A 1PYEA 4EUUA 2YA9A 5EOLA 5T6KA 4B6LA 1SVEA 2PWPA 4XV1A 1D2HA 3NS9A 5HOQA 1ERKA 2X7OA 3UG2A 3LCTA 2VTHA 2J5FA 4LWOA 3M6XA 2HZ0A 5CM2Z 4AA0A 4EH6A 5CNOA 2ZULA 5L6PA 4DG0E 5JN2A 1LUFA 4E73A 3BYSA 2XVAA 4UXLA 3RM6A 3SLSA 2Y7JA 2ORED 1OZ1A 3EWHA 4NM5A 4RQVA 5AP3A 3EQCA 1SNXA 4PUZA 2BFYA 3F5GA 3R7VA 2QOQA 3MBLA 3TV6A 4I0RA 5FP6A 1YKRA 1CKPA 5A3XA 4G5JA 3NJRA 2I0VA 5K0BA 1ZZ2A 2O05A 5AAEA 3DQXA 3FZ1A 4QPSA 4PNKA 1ZY5A 2GS2A 4F7LA 3H2BA 1H28A 1Y57A 4GT3A 3HA5A 2IH2A 3ANQA 1YWRA 1ZYJA 4EKKA 2ZZMA 4AXAA 1QMZA 2FSMX 5EZQA 3RMFA 2RFDA 3LPBA 3QXOA 4ANMA 4U43A 5HICA 3N4TA 1OPLA 4KBAA 4PF4A 4YTHA 4E32A 4EYJA 4YPDA 2B4SB 4W4WA 3B7PA 3SDJA 3SVVA 1VR2A 5LCKA 3U87A 1YXVA 4DH1A 1PJZA 3NEWA 4R7BA 2BRBA 3UPXA 4FV6A 5AM6A 5HE3A 3BWBA 3CLYA 5M4UA 3EVDA 3NAYA 5BUEA 2YIQA 3QRIA 4PRJA 5J95A 4C2VA 1NVSA 3UGCA 3KR0A 4RIOA 1MQ4A 3OG7A 4HH4A 1ZZLA 4GG5A 4D1SA 5A4EA 4NU1A 7MHTA 2AVDA 3HRBA 4L3PA 1UWVA 4MTAA 3SXJA 4TY1A 2BR5A 4XUEA 4XS2A 4IX3A 4AA4A 3I81A 1YFJA 4FZDB 5LJJA 5AX9A 4RJ8A 3MA6A 3VBXA 4CKRA 2JH9A 4C34A 3FQEA 2IH5A 5L6OA 1P5EA 3LPMA 5LWNA 3NYNA 5ANIA 4EBVA 2XYRA 1L3CA 2Z6UA 2OPBA 2YFXA 4PP9A 1H0WA 3P23A 5DRYA 2IJMA 3CPCA 1PXOA 2GS9A 4M3QA 4IACA 4C62A 2E2BA 2WPAA 5IA2A 3V51A 3R9XB 3U9CA 4EH8A 1R8XA 4FVRA 3AD4A 3EN9A 1H1PA 3Q4UA 1FP2A 1IR3A 3VS4A 4KUJA 2QCSA 2BAQA 3FDNA 4CXAA 2W96B 2JKMA 4M12A 4RWIA 3NW7A 3CBGA 3FQSA 2R3QA 4U9AA 2VO7A 2BDJA 5FHQA 3DTNA 1O6KA 4IFCA 4P7EA 4YURA 1YF3A 3NDMA 3TJDA 3AMAA 1M14A 5FEQA 5A4QA 4BLVA 4QMQA 5HLPA 2V74B 2FYTA 1PRYA 3ET7A 3IW5A 5IUIA 5KBRA 1FBNA 3CD3A 3LFDA 4APPA 2Z7LA 1B42A 4IEBA 2ZOQA 3HECA 4YHJA 4RJ5A 5CSWA 4ZMFA 3L8PA 2XKDA 4BIBA 4XUDA 2XVMA 3TZ9A 1OKWA 4FYOA 1FINA 2FUMA 2YTZA 2JFMA 3VHKA 4O0VA 3EN7A 3G6HA 2GQRA 1JG1A 1ZGJA 5HZNA 4DCGA 5EW3A 3OF0A 4IX5A 4EOKA 3BGZA 3TN8A 5HLNA 4QYYA 1E9HA 3II5A 3MH0A 4GUBA 5BYYA 4AOIA 4H0NA 1JPAA 3P78A 5ICFA 2ZV8A 3UOLA 1UU8A 4YGAA 4KWCA 2ITNA 5D12A 3V6SA 1Q97A 5E9EA 2PX4A 3RI1A 4QOXA 2W5BA 1AQ1A 4P5QA 5CVJA 5HTCA 2R4BA 4BCGA 4KRGA 3DBCA 4WNPA 3D15A 5CCBA 3CJQA 4Q5HA 4H39A 4YZDA 4QDJA 5TR6A 4FV4A 3IW7A 5IUGA 5LVNA 3LLTA 4PYJA 3JY9A 2ZBRA 4ZOGA 2GTNA 2B2CA 4JQ8A 4CV9A 3HVCA 5CVFA 1NVRA 2BRGA 5ANKA 4LUEA 3SSOA 4LV8A 2XIYA 4AS0A 4LG1A 3LW0A 2I9KA 3EVEA 1JWHA 5EHOA 3JR1A 2J90A 1R0PA 5KMIA 5DT3A 3R71A 1RJFA 3LCCA 4DCMA 5K0LA 4O0XA 2NXNA 4Z3VA 3FZTA 5KQSA 3W2PA 2K4MA 4L7FA 4HOKA 5K05A 2GNLA 4G6NA 3FTCA 2PSSA 4F65A 3VBTA 3O7LB 4IBMA 3OMVA 5D7AA 4AUAA 4MAOA 4QRCA 3WF6A 4C0TA 2XH5A 4E33A 4W8EA 1U4DA 4Q2AA 3FYKX 4F9AA
chains in the Genus database with same CATH superfamily
1RW4A 1XPUA 3Q7RA 4PPNA 3O4GA 4DADA 4G3DA 3H4MA 3IH5A 5JTTA 3BCEA 3F1LA 4LF8B 4LRQA 1A9YA 2IP2A 5FXSA 1E1KA 3KVRA 1HDZA 1RXUA 4OHOA 1P2UA 4ER6A 3WO0A 4YZ9A 4HDQB 1KAGA 2YAAA 4C4TA 1NP7A 1OXKB 1SBHA 1PL6A 4ZI7B 4AY2A 1QWOA 1N34B 1FU7A 3UIMA 5IYZA 1JDBB 1NOJA 5F76A 5IQCA 2IWRA 4Y6SA 3VS7A 3DOUA 1JSZA 3IQ7A 1F9AA 3FKLA 1ZOIA 2IHUA 2WV9A 3ABSB 4EABA 1TTTA 5CB4A 3LF2A 2IBSA 1ZVJA 5CNNA 3ZV7A 1LV7A 3X1YA 3H99A 1L0BA 1EK0A 3AVTA 4LISA 2ACXA 4JBVA 1TUBB 3IEVA 3HK2A 2AYZA 1WV1A 5IK2D 1PQ4A 1DRUA 1OKVA 3NBUA 2J9ZB 4GX2A 3ORIA 5AV4A 3DZHA 1IYZA 4LKRA 4IOLA 2IA5A 3UN1A 3AUFA 1WV0A 5BRNA 2YITA 3N2NA 4JSYA 1F8FA 3K6RA 3ZEPA 2YOFA 1PHPA 4IVBA 4BNJA 2HJGA 4FSMA 1ZJWA 3FZOA 2F4VB 3BGDA 1X6VA 3VR0A 3D8RA 1FFHA 2DE0X 2BGNA 4YPFA 2FW7A 1QVVA 3BWEA 5JSMA 1FUIA 3E2PA 2EWMA 3VJMA 4TYPA 2EG5A 3I2JA 1JSRA 4BDSA 3VWAA 4C5BA 4AJIA 5BNWA 2OC9A 4DCTA 2CCGA 4US2R 5I6DA 4DCEA 1UT6A 3QPUA 2DBZA 2QURA 2YEXA 1H2YA 4QFBA 4BYJA 2JBWA 1EBFA 4IDAA 4BX9A 2BONA 5D7VA 1VYHA 4C87A 3BL5A 4PDYA 1A04A 2YM7A 1ZWKA 3SC1A 5IM4A 2C7RA 4H08A 1ONBA 2BM1A 5JSFA 3C16C 5EINA 3NBXX 4F06A 1PJSA 4MWBA 2VAPA 1P75A 1VHDA 2MYTA 3T3NA 1XPOA 2I8LA 1R9MA 4QBHA 1JLHA 4X93A 2X7GA 4LWQA 1PFYA 3FNQA 3PDCA 3F66A 3SS7X 2CLLB 1Y7PA 3VH4A 3SMQA 4NMXB 3DZQA 2QMOA 3L1SA 3L01A 3KKEA 4LE2A 1TM1E 2XE6A 4FOLA 3GNIB 4EHFA 3R7UA 4DDVA 4XVRA 2YWHA 5LIPA 4TQ9A 4UASA 1CR1A 4MS3B 5HSGA 3KEMA 4LZWA 2F3PA 5JY1A 1DFIA 5LBIA 1GZ6A 5K8LA 3SYTA 4JR2A 3R4CA 3C3XA 1Y7TA 4KMSA 2PJUA 3P9PA 1BFKA 4JFRA 3T7CA 3ZJ5A 4YZNA 4RK1A 4O3MA 2I4IA 3O7LD 2A2ZA 3FHLA 2BEUB 4NAVA 1SUWA 2NTYC 2FZ4A 4OXIA 3MESA 4AAAA 5IQGA 5HPYB 1U2DC 3A2CA 3OOGA 5ADVA 4FYXA 2I4NA 3UJ7A 5BQ5A 2BAJA 4EGAA 4PCAA 4EYQA 5JNUA 3OXIA 4DDKA 2H0QA 1YTUA 5L2IA 3IUPA 3VQUA 3U6BA 4LL0A 2VA9A 3AR9A 3IPAA 5KX8A 4I1OA 1P8AA 3ZI4A 2Q3BA 2OYCA 1IXYA 1CJVC 2ZRHA 5HO7A 4R31A 3UBMA 1TGYA 3KX2A 2R84A 3KULA 4DIEA 1M75A 1WBJB 3QKMA 1G8GA 3K0AA 1WY7A 1GQOA 4GRAA 3B9BA 5DX1A 1K63A 3DC7A 3R1YA 3ZX5A 1JT2A 2YOHA 2FSGA 3UP2A 5KJFA 3F7NA 4I6BA 3CX6A 2YN4A 3H30A 4QUBA 3EQIA 1XTQA 3OUZA 3MERA 4EB8A 1IOVA 4YAJA 3G85A 1XF9A 4K0RA 4R77A 5ALXA 2PA3A 1SIWA 3GUBA 4R7IA 1SRRA 4PMSA 1HMPA 4RZHA 1ELOA 4HWPA 2IC5A 4B9DA 5JAIA 3OLWA 2NO9A 5J9LA 4K9MA 1J49A 1GDTA 1KU0A 4ZOLF 2R6CA 1UBLS 4LZAA 2NQ2C 3R5XA 5DE3A 5KCVA 3MJTA 1SPBS 4QT1A 1NQOA 1X1SA 3G8BA 2YERA 2Q6OA 3FRHA 1P60A 3D2KA 3M82A 3T0IA 3L7NA 2C3MA 4F0JA 4CMEA 3HV3A 3NV7A 2PS0A 1WUYA 2XE8A 5D5HA 2RE8A 1DV1A 5LP6F 5G1PA 3QL8A 1V16B 3T4EA 1M6YA 4KVZA 4PG8A 4J0QA 3GBSA 4WRSA 3GAAA 1B73A 4KTVE 2C9DA 1U7TA 1LSJA 2OCYC 1WCXA 5JYCA 2ZSDA 4YO8A 4OTQA 4ZEXA 4EH9A 3RUEA 4E94A 3L1KA 5KIAA 3AX6A 1ISJA 3LM8A 2QY6A 1NBIA 1YJCA 1PQPA 3AF4A 4FV2A 1U1EA 1UFOA 3Q1KA 4FGUA 4PFSA 1WZYA 4AWBA 1FC0A 2E5LB 2HJRA 4ME6A 3KYDA 1D2NA 1KSGA 2HZBA 2Y1EA 4G34A 3JS5A 1N8NA 3RLFA 5C5EA 1ULAA 4C4AA 3KY2A 1BH2A 3QEMB 1OTHA 5JCOA 4Q0MA 4RWLA 2QTAA 4L7QA 2GVDC 4XUCA 1PR6A 3GP3A 3A6KA 4CD0A 4I6QA 2ANCA 4EB0A 4AG3A 5BWBA 3Q7TA 3HO1A 4O0UA 3BH7A 3PDWA 3NTLA 3NHPA 3P1JA 4ZS4A 3QLGA 3E8SA 1HQCA 2R6FA 4NBTA 4ZJPA 5JSZB 3K0BA 4FS3A 3ZY2A 3MGYA 3BTUA 4U6NA 2ITTA 2BMEA 3RC8A 4RH0A 2PGNA 2JAUA 5GNKA 3TH5A 1OCEA 3HGKA 1ULSA 4TKUB 4ZYLA 5ETFA 3ROKA 5JJKA 1VLMA 2P4HX 3BK2A 4FBMA 4D81A 4NCBA 5C8KA 4GXTA 3KRTA 3DFUA 5CCEA 3LMGA 5D85A 4FOCA 5BN3B 4O0TA 3C4FA 1P19A 4RKQA 5ICCA 3QHWA 1QZ3A 1CRWG 4CIBA 3CLSD 3WHIA 3D7KA 4XDGA 2ZTVA 5TQ2B 1A82A 4KBCA 2FP3A 5JNWA 1DQYA 4JJGA 1DEAA 4FOSA 5EFOA 4JI2B 4L02A 4CUKA 4Q24A 3DLIA 4ZYUA 5FNVA 3RHTA 3QBVA 5MGBA 3TGWA 4ACDA 2Q2NA 4PNIA 3PLNA 4MVJG 4MKHA 3OQNA 2QSZA 3FYUB 5H7XA 1XLTA 1G2QA 1ZYDA 4D6YA 2AOXA 3D1JA 2CZCA 3OOHA 3CMCO 3P2YA 3IXQA 2R6AA 3E03A 1E1XA 1XROA 5HZHA 3WO1A 3MVHA 3O90A 1KEKA 4R2WA 4QHTA 1D2AA 1EQ2A 1IIRA 5BSVA 4H77A 1AY0A 1I2AA 4AO7A 2XS0A 4MQMA 1GU1A 3GLUA 4RLFA 3UDSA 1QGED 3TUDA 3TWJA 4ND5A 4E22A 4L72A 2P0AA 4AZWA 3RRFA 3PFQA 2XNSA 1U5BB 1CWUA 3VYVA 4HHEA 2ETRA 2V97A 3CZ9A 2C6KA 2HPZA 4Y2HA 2QHXA 1U9JA 1P1HA 3QIAA 1IA8A 1SBTA 4EK9A 2MMCA 5EIBC 2AJBA 4C06A 2P6PA 4DR7B 1MCZA 2ET6A 1XXHB 3BMOB 2WP8J 1IVSA 5DGCA 2J6MA 3QXSA 1J09A 4PQYA 4Y46A 2J50A 3UJAA 3U7EB 4R1PA 3FKNA 2I3DA 3ZDEA 4IAOA 2OXRA 4KYIB 2ZV7A 3GEQA 1XWFA 1JEQA 5HLWA 2QRKA 4GOND 1CY4A 4DYVA 2CVZA 2GRJA 3WFZA 3T1NA 4CW7A 4DR3B 2P9EA 4POAA 1ZAYA 1BW9A 1CRQA 2WHQA 1T9GS 2YMMA 5ERXA 1FVRA 1PX0A 4GFMA 1U8EA 2PUTA 4NK5A 6GPBA 3QNWA 1HE5A 2XQKA 4QOJA 1JLSA 2PZ8A 5HNGA 3W90A 4ATNA 4TWJA 4QP3A 3GU8A 2PS3A 4HV4A 1ISGA 3VA7A 3N8NA 1R3CA 1LLDA 3FI2A 2XK3A 2HRCA 4FKGA 5HTKA 3P79A 2GERA 3S2YA 1RXEA 4URXR 5F12A 4NYJQ 5FFNA 4EI4A 3JQ8A 3MM4A 3QCSA 3R9WA 3EFEA 2J3JA 2OSBA 1YJXA 4Q9ZA 2R5TA 3EHAA 2Z58A 5E1BA 2AW5A 4DC9A 3H1TA 4KGDA 5HRAA 2JHGA 3TIFA 1G3NA 1NUAA 4J97A 4JLPA 1CE8A 1VKOA 2OJIA 5KMOA 2JGMA 1MABA 1YZYA 4CMIA 3AKZA 4GW8A 3FUUA 4AKGA 2OLJA 3HNPA 3PXCX 1XP5A 2NZWA 1EFLA 3NXKA 3VO1A 1ZESA 4DH8A 1KR2A 1ZH4A 4DAWA 1AQJA 4U42A 3AHGA 1VI2A 4CN9A 4MGEA 1OYVA 4ZCQA 4WT7A 3O31A 5D3ZA 1YXMA 2C6IA 5FLFA 4M7WA 2YC2C 1DELA 4KXYA 4FC0A 2IZ1A 5BOSB 3PR1A 1ODIA 3NTVA 5AJXA 3KRXA 4Z3OA 2G4LA 1OHHA 3PKZA 3SJ7A 3NBAA 1WZIA 2VP4A 2YN8A 4AF7A 4B2IA 2WF5A 3VJRA 2WHPB 4IDDA 1L4MA 2J0IA 1UEJA 4Z4EA 5CQWA 4MNTA 4PYIA 3DJ6A 1AS3A 2DKNA 3HUCA 1I24A 1JWLA 2ROQA 1UPBA 4JBPA 5KKAA 2Z9BA 2GK3A 4KFTA 1PJ3A 4MRNA 3T34A 3KFLA 3A4OX 2GCOA 5BQOA 5FOQA 5K0SA 4BCJA 3KTAB 2FPRA 4C0QC 4FK6A 1NV8A 4LK2A 1OITA 1R16A 5DXFA 4FC7A 4DA5A 4UMDA 1K1EA 2P30A 2JLZA 2WYVA 2VSXA 4H7PA 5G0TA 5EXSA 4CQNA 1A9RA 4E7OA 4Z3KA 2YISA 4H7KA 2IVUA 3FI4A 2FFHA 1TA9A 2ZU0C 5JVDF 3WJ2A 3SHWA 3O73A 3VVBA 3WSTA 1O2DA 3W4KA 3LQFA 4H3KB 1VP9A 4CM9D 5B3KA 1KDZA 3K1JA 4TMWA 1U8AA 2JFVA 3BGVA 3ZNOA 3AZOA 1YI0A 3AVPA 5F52A 2ZRCA 1WBDA 3W7BA 4GOXA 3DDUA 4XCQA 2OXIA 3WGZA 3ZHVA 1P5RA 3K4PA 1N9ZA 4HQLA 1Z0KA 4H27A 1IPEA 2HYDA 3QVGA 3D6NB 4CKZA 3TNHA 2KYRA 4YJGB 2AG5A 1OXBB 4KO4S 5DYYA 1JJIA 4FKBA 4IG9A 3WL7A 4B32A 4URFA 2IS4A 1T2UA 2WJ3A 2WJWA 4HQKA 2G63A 4ITRC 4JJ7A 1AQUA 3M6MD 5H8WA 2YJ4A 1ZQ9A 5A5FA 5H2UA 3CH4B 1Q5KA 2EEZA 2ZUVA 2GEBA 3MAJA 5EJ8A 4IHPA 2ZQ5A 4BZZA 5BXQC 3RR2A 2HK5A 4QDEA 1QLWA 5H83A 3MQ2A 5D3MB 5EJMA 4EFNA 3TQQA 4O6VA 3BMNB 4JUCA 3RODA 2PO7A 1Z28A 4LJ8A 1KC1A 3BHNA 4YHHB 4BNDB 4ALMA 3PC2A 4K1LA 1PJKA 2W70A 4LI3X 3WYXA 2XEYA 1W36B 4N3BA 1L5LA 1SVWA 4I5EA 3H7IA 5CZIA 3OFMA 4UCFA 2EXXA 4E4XA 1JFSA 1F0QA 1PT8A 2FG5A 3RASA 4AW0A 3ND8A 3O83A 5ITWA 2FPPB 3SNHA 3PEYA 2FRVA 4HTFB 3M3PA 3PPZA 1XJCA 4LOHA 5IQHA 1L7XA 3PFGA 2BGRA 1E79D 5FP5A 3OPMA 3PQEA 4MXOA 3E3OA 2ZI5A 3N51A 5G1OA 1PGOA 3LXKA 2VHYA 4CR6A 2R65A 4KU4A 2O3PA 3ODZX 2Y9QA 3EG9A 4CKEB 2BUCA 1MRZA 2ZV2A 1RWXA 5J2UF 1CRLA 2F62A 2IS2A 5HORA 2QD5A 3GEBA 5IA1A 5IH3A 3H2YA 3EDQA 3OZSA 4URWR 4YAOA 4DLBA 1M2HA 4PLYA 1GL7A 2VTSA 2DWUA 4NQZA 3PBKA 1URWA 4B7TA 4LZJA 3KP1A 2G83A 1XD9A 1A4IA 3DTVB 1REQB 2J2IB 3IPHA 4YYEA 4FMQA 2Z04A 3DCYA 3X2FA 1IVYA 4K6OA 2IHBA 3DUFB 3F3MA 4YIHA 4R9UC 1RWVA 1R0SA 2KQUA 2L18A 5CDGA 3KFAA 5IJZA 5JCJA 2R79A 1T45A 1VCOA 1I1OA 1XCOA 5LBTA 4X6LA 4ZK2A 1G8AA 1EK6A 3R4VA 4A6PA 2IZUA 3RRYA 1R6UA 4NR0A 5F78A 4NV3A 3PPVA 4INOA 3AVOA 2HK6A 3FXXA 1Y8GA 4ABYA 1WKBA 2UZVA 4WI1A 4LF6B 3AZPA 1VCHA 5I7HA 2ZROA 5IM5A 2JIBA 4KSYA 3V3TA 4Q4HA 2H11A 2QX4A 2B8TA 3NOXA 3M2WA