4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
1WVWA 5ANOA 4LV5A 3UZRA 4S34A 4Y72A 3OUNB 5E8ZA 4HSGA 1R0PA 4R1VA 5ETAA 3U8WA 3Q4TA 4I0SA 3U6JA 4HH4A 4I5MA 5CEOA 2EFJA 2JDOA 3D2KA 5AV3A 5I9UA 2ZM3A 2EJUA 2P3GX 3QKLA 2ESMA 3R04A 4AGDA 2CL5A 5FQNA 2Z6AA 4B0GA 3UIBA 3UJ9A 2WMVA 4I1ZA 4O7VA 3UC3A 3ELYA 3EVCA 4CD0A 1NW7A 1Q0SA 2VNWA 5KMLA 3Q4UA 2VUWA 5FEEA 1ZRZA 2WMSA 1YI3A 1J7UA 5DR9A 2OLCA 3SX9A 4MF1A 1P2AA 4C34A 4CMUA 4D1XA 1G6Q1 3GCSA 4AUKA 4XRLA 3BEAA 3AD5A 3QWJA 3MIAA 5AP0A 3W16A 3EMBA 5KHXA 3Q9XA 1PY5A 3WI6A 1DAWA 4J95A 5K0FA 3BCEA 3CSVA 3E88A 4O21A 4K11A 4A9UA 2CCIA 2A14A 3TNPC 5M08A 1Y6BA 3VS6A 5EH0A 3R9HA 4DC2A 3VBXA 2X9EA 2PWYA 1H1DA 3TT0A 3VS2A 3TTJA 3GP0A 3CD3A 2W4OA 1LEWA 4FIIA 2B9FA 2QOQA 2ONLA 4J99A 4XJ0A 4YJNA 5JZNA 2VNYA 4YJTA 1VL5A 2OJJA 4KW7A 2B7AA 4O7YA 3R8UA 2XIXA 3C6MA 3SSMA 5CYIA 4RWIA 1AQ1A 2B52A 3A4OX 3DKGA 3A25A 4EUTA 4USEA 3PJ8A 2PE1A 3EQHA 1FJXA 2ZDTA 2EWAA 2C7PA 5EKOA 5J9ZA 4C4AA 1Q41A 3VBQA 5LQKA 4ZK5A 4C3RA 1JR4A 5KZ0A 2QVSE 3MH3A 3PIZA 1U5RA 4I94A 4FV9A 4ALWA 4DGOA 5CAPA 4K6ZA 5IQEA 3U6IA 1RJFA 2OB2A 3IW8A 3QU0A 4FKLA 2HWOA 4G3EA 3R9DA 1NBIA 4A07A 4U7ZA 3ZZEA 3FWQA 1FPQA 3SMQA 2ZOQA 4K1BA 4BI1A 4XS2A 2IFTA 5EQPA 4AA0A 3ZEPA 1Q97A 2BVAA 1HOWA 2G2IA 2ITVA 1YDTE 3WILA 1APME 4F6SA 3K3JA 2PZRA 4UXLA 4MHTA 3BGVA 3FLNC 4O82A 2FYSA 5E8JA 2JIVA 4B8MA 4QVGA 5A9UA 3G5TA 2IVTA 2VTIA 3KKZA 3G2PA 2BZGA 4QMVA 2YIWA 3EQIA 9MHTA 3QQJA 2YM7A 3DU8A 3Q5IA 4XP2A 2P41A 2YA9A 5AUXA 4QYFA 5CSWA 2YXLA 3LIJA 2XIYA 4L8MA 5DT0A 4WIHA 4ZTLA 1OMWA 3H4JA 1FINA 3RPRA 2CNVA 5LMKA 5M4IA 5LQCA 2V0DA 3W32A 3MN3A 2FSOX 4IH8A 3T0IA 2OICA 4ANBA 2PK9A 3GFWA 3KFAA 3NUPA 1KPHA 2IP2A 3HNGA 3M42A 2B3TA 4M68A 4KS8A 3TZ9A 4L01A 5ANEA 2HNKA 4LECA 4EI4A 2VTNA 2YTZA 5D9HA 3AG9A 4HVHA 2XIKA 4GT3A 4CQEA 5HTCA 5LQFA 1EIZA 2JH9A 4F7SA 4X6QC 3MH0A 3EWHA 2ONLC 3P2EA 3TNHA 1N7IA 3TLJA 2XCKA 4EHEA 2ZMDA 4DEIA 4RX5A 1H27A 2JGZA 5DIAA 2AOVA 1Q5KA 3TKAA 3LFFA 5I9WA 2PVCA 3LSTA 3L8DA 1M2QA 4F09A 2ZB1A 2G70A 3R24A 2JKQA 2C5VA 4L3PA 4DA5A 2ITUA 4RIWB 4K6MA 3O7LD 4BCMA 2R64A 1LEZA 1IA8A 2E9OA 4WRGA 4DFXE 4PQNA 5IU2A 5K05A 2GNJA 4GUEA 3R71A 1RJBA 5DRBA 3KQVA 4PL5A 3P79A 3FTDA 4RVDA 4U7TB 2JD5A 3HRFA 3C0KA 1EH4A 4UY9A 2GNLA 1DAYA 3R2BA 4IAIA 4WRSA 5IA5A 3ZXZA 3MSSA 4QMQA 2XJ2A 4F0GA 1V0BA 3MVMA 5CM2Z 2X0GA 4RWKA 5DHJA 4H1JA 4KBAA 1BUHA 1VIDA 2BZHB 1OZ1A 2OI4X 2R3NA 5EK7A 4KKGA 3IECA 2OFVA 3R22A 4KINA 4E5BA 4YO6A 2DS1A 1R8XA 4C4JA 3CC6A 4CRSA 4BI2A 3L8SA 4MHAA 4O91A 1X1CA 3GRYA 2YIXA 4OX9Y 4UBAA 2PHKA 3OCSA 3UNZA 3R9NA 3G9LX 3ULIA 5JR3A 4I6FA 3FV8A 3JPVA 2PTKA 4HOKA 4R6VA 1UKIA 3G2QA 5HILA 3JS2A 1M7QA 1Z9XA 1LP4A 2ZV2A 1W0XC 2PXAA 4IV8A 1Y6AA 5DX1A 2PY6A 4ACHA 4QP9A 1Q61A 2XP2A 4W4VA 3I9FA 5EKXA 4DCGA 4KIPA 1JQEA 5L2IA 2OIDA 3ZOSA 3KHKA 2ZYBA 3KULA 1ZZ2A 2R3FA 3NUAA 3LJ1A 2VTRA 4YR8A 3DTNA 4HNIA 2PWPA 1WZYA 3WF6A 4CWAA 3TQSA 2NRUA 3P2KA 1UNGA 4JXFA 3KXMA 5AX3A 4HG2A 3U6HA 2O5KA 4FT9A 4IW0A 3ZZWA 2GTMA 4OTQA 3NAXA 4DEEA 3VQUA 2O8YA 4LGGA 4W8DA 4NT4A 3THSA 3EEOA 5ICCA 3AMAA 3TN8A 3KN6A 4GK4A 3D2IA 5D7VA 4B7TA 4QPPA 3KY2A 3WZKA 3F69A 1BX6A 5DBXA 3NLBA 3FTCA 1B38A 2ITQA 3R7VA 3MJ2A 5IH3A 4KRGA 5CCXA 4O7TA 4X3FA 3LFBA 4S32A 3ZBXA 3E7PA 3AOXA 3TZ7A 4X6RA 4W4YA 2W1EA 4X21A 1JG2A 1MP8A 4XYFA 3SXSA 4ZS0A 2YCFA 4R78A 4PDYA 3VHKA 2XEZA 5CT7A 2YDIA 4A4XA 3C50A 3JXWA 2F9GA 2ZJWA 3OMVA 2UYQA 4GJ3A 3E64A 4WUNA 3FMEA 4BICA 5LMBA 3AT2A 1QPCA 1X19A 3L8PA 2VTJA 2WQBA 4NW6A 5H8EA 4DYMA 2YIYA 4EH9A 1KE8A 2Y1XA 4YUYA 3HMMA 3OBJA 4DHFA 3GXOA 1CTPE 4N4SA 1REKA 3IDCA 4N6ZA 4XUFA 5F1ZA 5HBHA 5I9XA 3QOWA 4FTOA 3DDQA 4YO4A 1VEBA 4K2RA 3ENMA 3HA6A 2JBPA 5EI8A 1VE3A 4YV1A 3UJAA 3RM7A 2PLWA 2XZSA 4U6RA 1YWVA 4C08A 4YMGA 3B8QA 4HNFA 5FEDA 4FT7A 4PYKA 4FTCA 4LL5A 4ZSJA 3NGAA 4DCMA 3JVSA 4AW1A 3F3WA 3JY0A 3ROCA 3BYUA 4YNEA 4ZY4A 2QRVB 3AC4A 3R3HA 5M56A 3S68A 3UBTA 2NNWB 2VTHA 4PNKA 5HIMA 4GOOD 3NW9A 4HGZA 1BLXA 3ORNA 4IAYA 1RI5A 3H3CA 2PT9A 3DXZA 5IMXA 5EEGA 3COHA 3FEGA 3HZTA 5KMJA 4XX9A 5D41A 3T8OA 3MVHA 3OG7A 3GOPA 5CSPA 4OW8A 3W2PA 5CZIA 3CGGA 4HCVA 4ZJIA 3B8RA 3LHDA 5JKGA 3UZTA 3FUWA 4RFZA 3OTVA 4G3FA 3GC8A 2YCRA 3KF7A 3W2RA 5CF4A 3UVPA 1ORIA 3FXXA 5JSMA 4AW2A 3GU3A 3QCYA 1SNXA 4I0TA 5HBEA 3AJDA 5EG5A 1PHKA 4D0XA 3WOWA 1IAJA 4TPTA 3KRXA 5FBOA 1L9KA 5DPMA 5FLFA 3BV3A 3TUCA 4UXQA 4IEBA 3MH1A 2C3IB 1H4LA 5EDQA 5CU4A 3FSKA 3GBZA 3EB0A 3K54A 4FG8A 2JBOA 3TNWA 2HW6A 4BDCA 4ZS4A 3BGIA 4IC7A 3LBFA 2Y7JA 2YR0A 1ZGJA 1W83A 5AP1A 3SVZA 2VD5A 3QZGA 2C30A 3HMIA 5EYMA 3CCNA 4EJNA 1OR8A 5E8WA 3EGVA 3LFCA 3GWZA 5HIIA 2XIRA 3LFQA 4KNBA 3GUBA 3M6VA 1JQHA 4TYIA 4HGSA 4KRCA 4RVKA 5IEXA 2VU3A 4XEYA 4DN5A 2R3LA 3GNIB 1QAMA 2P40A 4X0MA 5M4CA 4FSDA 2QO7A 3GCQA 3BHTA 5FM2A 3BE2A 3DXYA 4RYLA 4A4OA 1KSWA 3EQGA 2R6ZA 3U55A 3QQHA 5FG8A 3E3BX 1UNHA 2RKUA 4BCOA 2W5HA 1OPLA 3OFJA 3UQGA 1RI3A 4K0YA 3SGCA 1NE2A 3W1FA 3VQHA 4FNWA 4QPSA 2J9MA 2QD9A 2LAVA 4EOJA 2WMBA 4XG3A 5KMIA 5DTMA 3MB6A 4EHGA 4EOLA 5CVUA 2GHGA 2HXLA 2VV9A 4RIYA 2HZ4A 2AOTB 3NUUA 3V5LA 1XVAA 2O63A 5E9EA 3ATSA 4D28A 3G8BA 1AV6A 3DKOA 5ACBC 3BZ3A 3EJ1A 2B9HA 4I93A 4K77A 4F9YA 1O9GA 4M69B 4AT5A 4DM3A 3OFMA 4NYEA 5D10A 4PGGA 3M70A 3WYYA 3TG1A 1WBVA 2JJQA 1JWHA 1BL7A 1T43A 4XG8A 4FKQA 2VZ6A 4J7BA 3PIYA 3QRIA 3BLHA 1YF3A 5AIKA 3HAVA 4DLIA 4YMJA 3EGEA 2IVSA 4YBJA 3V8WA 4EWHA 4AZVA 5M4UA 3LKZA 2BDJA 3M6UA 5E1SA 2F8LA 3E92A 3PPZA 3RJCA 1K3AA 4GG7A 2AOWA 4XG7A 2CCHA 5HLNA 5FRIA 5GJDA 3UJCA 4AE9A 4LWPA 3IHTA 5LQJA 1L3RE 2PX4A 1BL6A 2UZEA 5DSTA 3F82A 2QOBA 3CE3A 1OECA 2EB3A 3UIXA 1YXSA 1HNNA 2Y9QA 3E7VA 4FOCA 4TN6A 1P1BA 2X2MA 3N4VA 3TV4A 3KGAA 3IKAA 4PMTA 4DITA 2HK5A 4UZHA 3UJDA 2CPKE 4QPNA 2GNFA 3VO3A 1YOLA 3U4UA 3OOGA 3ZO1A 3HMOA 4E4MA 3LJ2A 4FP9A 4GU6A 3QOXA 2ZB0A 1RJGA 1P91A 3HDNA 4Z7GA 2FRXA 1YDSE 4FT2A 2H34A 4L44A 5CF5A 3UO4A 2ZULA 4FT3A 4D5HA 5GNKA 2P7HA 2BRHA 3X0DA 5K8VA 1VP9A 4C05A 1R1WA 3LM5A 2GNHA 5ANDA 1BOOA 2F2CB 4YLLA 3WIKA 4L7SA 1ZGAA 3NW6A 3GXLA 3EVEA 2OYRA 2C7QA 3A62A 2DWBA 2C0OA 5LSAA 3ID6C 4R7IA 3ZUVA 5IQCA 5LWNA 4ZSAA 5FBNC 5KCVA 4FTUA 3F61A 3UYSA 4AG8A 4IMYA 5K0GA 5AAGA 2GS7A 3UDBA 2EXCX 2Z7QA 4F7NA 3CJQA 3SGLA 2WTWA 3GCPA 3MIYA 2VTAA 4YJRA 2GQSA 5HLPA 4DTKA 5G02A 4A6EA 1M0EA 1JLUE 3DMFA 3DGKA 4OTWA 3PTAA 3LCOA 2HV9A 4CG8A 3S3IA 4I5CA 2AN3A 1A06A 3SM3A 4RTPA 4G16A 2WQMA 3ER9A 3E63A 1XKKA 2V7AA 4JBVA 2CLXA 4QTBA 4RLLA 2REIA 3MGYA 4W8EA 3CGFA 2RGPA 4IB5A 5C9CA 1GJOA 3PYYA 4XBUA 3ANQA 1IY9A 3UE4A 4E20A 3I58A 4AT4A 4MWHA 4IDVA 1MQBA 4B6LA 3C7QA 3H0YA 3EN7A 4ORKA 4JAIA 3R73A 4QP7A 4WA9A 3IV6A 4IVCA 5EQYA 4E2XA 2ZFUA 2AC5A 2G72A 2PUPA 1RI2A 4UX9A 3W2OA 3UJ8A 1H07A 2QO9A 2YWPA 4I4FA 4DBXA 3VBVA 4H3PA 3CJTA 3BV2A 3TUBA 3O96A 4J96A 4YC6A 2WEVA 4TYHB 4X3FC 4AOJA 1O9HA 2AZTA 2XRUA 2FSTX 3BRBA 3H30A 3JWIA 4YZDA 1E1XA 4AX8A 5IA1A 3A8WA 3T9TA 4X2NA 2WMTA 4V0RA 5DX0A 3Q9ZA 2ZV9A 4WG3A 3TNQB 2XYRA 3WBLA 3O51A 5DNRA 5EMKA 4AZWA 4IJ9A 4BVUA 3ORLA 4C3PA 3ZXTA 4MNFA 4OTGA 4GVAA 2O06A 2JC6A 3H2BA 2PY3A 3ZUTA 4QDKA 2J90A 3KQWA 1OL5A 4F9CA 3OWLA 3EVZA 3RWQA 5CANA 5EOBA 4GOLD 5EZQA 3P9JA 2VN9A 3G5DA 5HBJA 3IEIA 4N57A 3F5XA 4RIOA 2VTLA 3WF7A 4XG6A 4J98A 4RVMA 3S0OA 4KVZA 1PXKA 2J51A 1KP9A 2JITA 4M12A 4ONAA 5C03A 1FVTA 4YJQA 3G89A 1JQDA 3F5PA 3HTXA 1WAKA 2F7ZE 3G51A 4KRDA 3Q60A 2P2HA 3QQUA 3P7AA 4Y5QA 3FL5A 4G31A 5HI2A 2ITOA 4AGCA 4D4RA 3NR9A 4H05A 1ZOHA 4JBPA 4NJ3A 2BKZA 3PXFA 4LOQA 4RA5A 5H3QA 4DFNA 3I5NA 3UA4A 1UV5A 3K0BA 4ACMA 3ME5A 2PVKA 2YUIA 3V6SA 4FNXA 3T7RA 4XUDA 2H9VA 3BBTB 4MXOA 3L9MA 4M15A 4EK6A 4D4VA 1XCJA 1PXOA 4ZZOA 5LCKA 4F6WA 4Z3VA 4MCVA 4ZSGA 4DCEA 1ZHFA 5ICGA 3UIUA 5DEYA 2XYVA 3FLWA 2UZ4A 3M33A 3KPJA 5GIOE 4YLJA 3NYNA 4FZAB 4YJVA 4M97A 4QYHA 3RAIA 2R2PA 2BAJA 2PV0A 2C47A 4QMXA 4RC3A 4B99A 4ANMA 3ELDA 3BWJA 4G17A 4C58A 4A9RA 3DA6A 3VRYA 4DH8A 5C4KA 5LOHA 3MVJA 5ICPA 3EN4A 4L45A 5JQ5A 1YWNA 2ERCA 2NXEA 2ZIGA 3FUTA 4PTCA 3KRWA 2JHPA 2OG8A 1YXXA 3E8CA 4M3QA 4TNDA 5LVLA 3KRJA 3ZSHA 4C37A 3HUBA 5EC8A 5HIKA 3N4TA 4KIOA 4EZ5A 4BZNA 3ZS5A 4V04A 4AS0A 2P1DA 3M11A 4GCJA 2JFMA 3NWEA 3VJOA 2P7IA 3LKMA 4H0NA 2C5XA 3FC2A 3LMGA 2C4GA 4FKUA 3KCFA 4G5JA 4YPSA 3ZH8A 4E2WA 4EKIA 3GENA 5HICA 4CFWA 1QPJA 4XHKB 1UU9A 4ER0A 2J0LA 3ZM9A 4AZFA 1REJA 4ZOGA 4MH7A 4DH1A 3KPVA 3D5UA 4XLIA 2QG7A 2ERZE 2WIHA 3DS6A 1XH7A 3PG1A 3DJ6A 2OXDA 3PVGA 4KBCA 5DEWA 3OROA 3UZPA 2BZIB 3GRRA 2PZYA 4JX7A 3OE4A 2UZLA 2W9ZB 5BNJA 5AAFA 4IAKA 4RJ4A 3TJCA 4YJOA 4RQKA 3QA8A 3FUPA 5JQ8A 4GL9A 2B9JA 5I5ZA 3N4UA 5AP5A 5ICFA 5M09A 5CNNA 5F4NA 1KPGA 4G3CA 5F9EA 1M52A 5FADA 4BCIA 4E93A 2VWWA 5ITAA 3ODYX 4FVRA 3QHWA 1FQ1B 1ZG3A 3B5IA 4E6DA 1WBOA 4CVAA 2O0LA 2G2HA 4FKOA 1Z3CA 3RHKA 4EK8A 1AGWA 5DYJA 4LQMA 3QBNA 4HCUA 1W82A 3R02A 2IW6A 2UW7A 3SRVA 5CF6A 2BR4A 2Z6QA 5J95A 4JR3A 3CPBA 4F0FA 3MCTA 1JG1A 5HIJA 4X61A 4I20A 4HRAA 4UV0A 3P2IA 2V55A 3SKCA 4Z16A 3I1AA 4N0SA 4E2YA 2WTVA 4PONA 2O0UA 2R3GA 2IJMA 1E9HA 3OEZA 4G1WA 3A7GA 3RK7A 1L3IA 5HE2A 2R3OA 1W84A 3ZU7A 4B4LA 2DUVA 4BCFA 3G2OA 1FMOE 3WE4A 2PE0A 3VUHA 4KKHA 5K5NA 5M51A 2BHHA 3DT1A 4ERWA 4QP2A 5DWQA 4TWOA 5FGKA 4FEUA 5J9LA 2IDKA 4LL0A 5E8YA 2FO0A 1FVVA 2R3MA 4WT6A 1R39A 4RTMA 1OIRA 4CG9A 3IW7A 2BZJA 4MD7E 1PXLA 1KE7A 3EPPA 3T7SA 4QQCA 5C26A 2B25A 3LAUA 1O6LA 3UMXA 2IZTA 4D5KA 3RPYA 2CJMA 5BVWA 3ZM4A 2XKFA 4GK2A 5AP6A 3RZBA 4ITIA 3OCJA 2I0YA 2C3JA 2OJIA 2Y4PA 3FZOA 4E1ZA 4W4WA 2GS2A 5CVGA 1MRYA 2EXMA 2RFEA 3SHEA 2YDKA 2VTSA 3MTFA 3EIDA 1NXKA 1TQMA 2WO6A 3BE9A 4FSNA 1P14A 2A4LA 4CKJA 3I5ZA 4FNZA 3EN6A 3V5WA 3HVCA 4RFYA 4C4IA 4CKIA 3VS7A 3C6KA 2VRXA 4YZMA 1OB3A 3JVRA 4K8AA 3R7UA 3SXJA 3ORZA 3D4QA 4DG2E 2JEDA 4OTRA 2VTTA 4FG7A 4MXCA 1S9JA 2W17A 3ANRA 2J0JA 4JOAA 4RGJA 5CX9A 3FKNA 4A9TA 4J53A 4WBOA 4DEBA 2PULA 2WXVA 4Q9ZA 2YQZA 3HVJA 1Z57A 2K4MA 3D9VA 2GPHA 2QQ7A 1WMKA 2WTKB 5HG5A 3VHEA 2I7CA 4CTKA 1Q0TA 2ZV7A 3W8LA 2Z60A 3GDHA 3BGPA 3FZTA 3OCGA 3VS5A 4J71A 4OBXA 5FTGA 4BTJA 1B39A 5JGDA 2UW8A 3KEXA 3PRFA 4ANSA 4DTAA 2IWIA 1KYZA 4FUXA 5CNOA 2X7FA 3IO7A 4D2RA 2AOUB 4QTAA 5DT3A 3MH2A 3M6XA 4ER6A 1P4OA 2YACA 2Q0NA 3R83A 1Y8CA 3E8SA 5DLYA 1XH4A 4ACCA 4LUDA 3O4FA 3ZSIA 4FR0A 1ATPE 4JIAA 4QT1A 4P4CA 4CTBA 2ITWA 1JG4A 2YWVA 4FKSA 3W2CA 5DRYA 1VPTA 1VYZA 3KVWA 3SLSA 1G38A 3CEKA 1HCLA 4R1YA 4JL9A 3RM6A 4FVPA 4H3QA 5DRDA 3ZC6A 5CAOA 3VSEA 3BYSA 2OKRA 4O0WA 4KUJA 5K0CA 3C9WA 4IFGA 3SXRA 1QANA 2ADMA 4ZTNA 2FK8A 5EKUA 1Y8GA 5B1SA 4C06A 4YC3A 2R3RA 5A6OA 1UVRA 3KR2A 5HCZA 5T3QA 3OD6X 5EDRA 1H1RA 2Y4IC 3AD4A 1M2RA 3BBWA 3MFTA 4P90A 1QAQA 3FYCA 3I7BA 3DB8A 4MYGA 4RTQA 3PSBA 4IWNA 2GCDA 4XLVA 3WF9A 3IQ7A 4O0SA 4HVSA 3V8TA 4U81A 4R6XA 3BWFA 5TO8A 3TRKA 5AA9A 4YLKA 4FTAA 4P5ZA 4F9BA 5FP5A 5K0LA 4YUQA 4TL0A 3HUCA 5FULA 3LCKA 3SQQA 4FSYA 4B8LA 2ETKA 3PPJA 3QCXA 4NM5A 3BELA 3BGZA 2OIQA 3BLQA 3ZLXA 1G8SA 3Q2MA 1L1EA 4J52A 3VS4A 4I6HA 4M14A 3NEWA 3FPHA 4CXMA 4AZEA 2F7EE 3KMUA 3OXIA 3QQKA 5JZJA 1J7LA 3S1HA 2ZZKA 3UJ7A 2BFXA 4O7SA 3UPXA 3UP7A 4BI0A 1ZYJA 4HYIA 4JRNA 2O64A 5H9BA 2CGVA 2P0CA 3GU8A 4FZ7A 3GEQA 4KIGA 1OM1A 2OIBA 4U45A 4ZXTA 4CSVA 4GQBA 3DAJA 4RRVA 5BYYA 3IW4A 4GW8A 3EVAA 3S00A 4OUCA 5FEQA 3DLZA 2I0VA 3QRKA 2PBFA 3NWWA 4FV2A 4QMOA 4WNPA 4YTHA 2RFNA 3UQFA 4C33A 1I1NA 4GOMD 3H9FA 4BHZA 4CMOA 3T7TA 1I44A 1Q8UA 3GOKA 5A4CA 5LVMA 3DY7A 3BWYA 1XBCA 4LMNA 4RZWA 4PGHA 3Q04A 3QX2A 2AVNA 5FTOA 4F7LA 1STCE 3V97A 4LGHA 4FNYA 3KQPA 4II5A 4D55A 5D1NA 2W1HA 2B54A 3FC1X 2XA4A 2OBJA 5B0XA 5H8GA 1PJKA 2IBTA 3MY5A 5C27A 3R9XB 1WCCA 4JI9A 5D12A 5HHWA 4AW0A 4R8RA 2C1AA 4C2VA 4GRBA 4GKIA 4JR7A 2BRMA 4PX6A 5JT2A 1H1QA 3NWBA 5BW4A 2IBSA 4NKAA 2NXCA 5EYKA 3ZRLA 4RTOA 4FV4A 3GU7A 3T3VA 3I6UA 3IW6A 5FM3A 4PWNA 3MA3A 4WVLA 2XK3A 2OXXA 5TOZA 1SMHA 3O17A 3RKBA 1PXJA 3D7ZA 3HCDA 2VGPA 5E1OA 1IAHA 4UN0C 4IX5A 1ZKDA 3P71T 2WELA 1OUYA 2W5AA 4IX4A 3O0GA 4OGRA 3U54A 3TZMA 2CKDA 2NYUA 2OO3A 3V04A 1ZLTA 2P33A 3I6WA 3PY3A 3SW4A 2UYHA 4ATNA 3TM4A 3QZFA 1G8AA 2UW4A 3DKFA 3EN9A 5A4LA 3ZEWA 4I41A 4ZLYA 3ZRKA 2AOTA 2ORED 2ZM1A 4BYJA 2HW7A 4O0UA 4LRMA 1FOTA 3GIWA 4FKWA 1EAMA 3LQ8A 5KKRC 3ENHA 4NK9A 2X7GA 2BHEA 4I5PA 5FXRA 3P9CA 3B7PA 3LXNA 3R6XA 3SDJA 5AA8A 1YB2A 5DTRA 2UZVA 2R4BA 4AWIA 3TIYA 1PKDA 1B42A 4EK3A 5AV1A 1TVOA 3LW0A 4G6NA 4WHZA 5G1XA 2GAFA 4PINA 1XHAA 3MW1A 4ZY6A 4FEVA 2PE2A 3R7IA 5IQFA 2O07A 4M38A 4I92A 3DFCB 3R8LA 4EUUA 3KA0A 3NDIA 4GVJA 5HG9A 1JSTA 4QTEA 3KPWA 4YTIA 4EQUA 4HW7A 4AGWA 3IW5A 2EX4A 2BDWA 4TYHA 2Q83A 5KX8A 1M14A 5AUZA 4CLIA 3BWCA 3GRVA 2R7BA 3TM0A 4D4YA 1A9UA 2QOFA 4CFUA 4G3DA 3RAHA 2W06A 1YHSA 2P2IA 2X8DA 2C0IA 4GG5A 2PXCA 3MY1A 4JNWA 2JDTA 3IK3A 3Q53A 2FH9A 3TV7A 3OWKA 3UP2A 4DFZE 1UU3A 2ZLBA 4PIMA 4UOEA 3UBDA 2I6LA 3TWJA 4YJPA 2UW5A 4CMTA 2HXQA 3NSZA 2VP3A 5AP3A 5HX6A 4C03A 3QLGA 4GC5A 4EBWA 3LZBA 4QYEA 3B2WA 1JTEA 1SUIA 5E91A 5A6NA 1A48A 3KREA 4WSYA 4PP7A 2IN6A 4QDJA 4FIGA 1QPDA 1D2GA 3N9XA 3DV3A 3ELUA 1NA7A 3NCZA 3DP7A 4EH4A 3OT3A 3QTWA 2XK7A 4O22A 4RTLA 4CZTA 4FSWA 3DXQA 3RVGA 3UGCA 4EOOA 3QXPA 1SZMA 3OHTA 2PVJA 4TKSA 2VDWA 2OW3A 4GH2A 2OFUA 4C59A 1Q8TA 2B4SB 2PUUA 2UZTA 4F9WA 5BVOA 3FPEA 4PYNA 1CDKA 5CS6A 3LCDA 4FSXA 4QYGA 3UO6A 5IDNA 3MI9A 4KKEA 3EHAA 1X1BA 2VTPA 3CD8A 2HENA 1DI8A 3FHRA 4OR5A 3RALA 1F3LA 3EVBA 2BAQA 3EKKA 2VO6A 3A4PA 3F7ZA 5DLSA 5L6PA 2X8EA 2Y8OA 5CLPA 4YZNA 3DTCA 4DEDA 1W8CA 5IQAA 4R5YA 3A7EA 3AGMA 4DGGA 2J5EA 5EDPA 3RPSA 2AOUA 4I6BA 1KE9A 2IO6A 3F2NA 3TPZA 2XNBA 2GSFA 4ENYA 1JTFA 4ZY5A 2ONYA 3FKLA 2ZZMA 2W1IA 2JKOA 3LFDA 2JDVA 2UZOA 3QCQA 3LGAA 3B3GA 3LCVB 2QHMA 5LQAA 4BDKA 2AYPA 4YGAA 4NTTA 5IUIA 1AF7A 1QZZA 2GNGA 1Z5MA 5IA4A 3MCZA 1Q4LA 2OK1A 2QOCA 2VTMA 3O50A 3OW4A 4H3BA 2CKQA 2X4FA 5CQUA 1OITA 4E4LA 4E4XA 1U2ZA 4ZTBA 4OQEA 3I4BA 2IVUA 5A4EA 4KIQA 2QY6A 3JY9A 4G9CA 2VWUA 4M67A 3SG9A 4D1SA 3FZRA 4ALVA 1JPAA 2CGUA 2WMQA 2PL0A 3H9OA 3HP2A 4FG9A 2OF2A 3RP9A 3ALNA 3R21A 1EG2A 1OKWA 2H00A 4V0QA 2OZAA 2X7OA 5KMNA 4RWZA 3HECA 4C7TA 1YFLA 2UW9A 2C1BA 5DGZA 3A7HA 2CKEA 3C4CA 4F70A 4F84A 5EMJA 2VAGA 3KQSA 2AVDA 2HY81 3I0QA 1FMKA 4L67A 4ENXA 3PP1A 4AN2A 2XYQA 3E05A 3NUSA 3MPAA 5CF8A 3HM2A 4NWMA 2G2FA 1F38A 4JAJA 4TNBA 4HYUA 4FZFB 3NPCA 2WAJA 3QUDA 4NCTC 3T9IA 4C4HA 4E26A 3P5KA 4FTNA 3UG2A 3QLFA 4QMMA 2E9NA 3PXQA 4IQ6A 1YKRA 1O9UA 3IGOA 5E1EA 4EQCA 1ZXEA 4RSRA 5D1HA 5KKRB 1UWHA 3LMIA 5D7AA 1ORHA 1SQFA 1JNKA 3QV2A 5T67A 4KDCA 5CEIA 4FTTA 4OTHA 1YUBA 1OBDA 5JK3A 4CV9A 3QCSA 4Y73A 4EH2A 3R0TA 5AAEA 4O7LA 4NECA 3CVOA 3V8SA 3EKNA 4FUYA 4FZ6A 4E7WA 2CSNA 3JYAA 5EMLA 4AXAA 1NKVA 5HESA 2IPXA 3NMUF 3DAEA 4U7PB 4ASZA 3C5IA 3EQCA 2ZTHA 3TR6A 1PMUA 5HVJA 5KMOA 5M4FA 2XIZA 5C1QB 3EFWA 3TOSA 5CI6A 3D5WA 3D7TA 2QNJA 2Z6UA 4IB0A 5HD7A 4ITJA 2OH0E 3QRJA 3ZTXA 3AMYA 4L68A 4X2FA 1JG3A 1U54B 3FKOA 3P08A 1XXLA 5HFJA 5J8IA 1O54A 5L2TA 4QP1A 4P7GA 1U46A 1XH5A 4CT2A 1HCKA 4O6LA 3ZLSA 4O84A 1NBHA 5ETIA 3UOHA 1SM2A 4ZTSA 4S33A 4XP0A 4Y95A 3G2FA 3S2PA 4APCA 4LI5A 1FP2A 3LXKA 3OW3A 4IZYA 3HYHA 4RVLA 3H0ZA 3OEFX 1OPKA 3FQSA 3ZRMA 3BQCA 4F65A 4BDGA 4EEVA 3NW5A 4FVQA 2HMYB 2PJDA 3REOA 2EVAA 4QMTA 4TRLA 5L2SA 1H0WA 3B89A 3TMAA 3PIXA 5DM0A 3THRA 4YUWA 4UWYA 3TKHA 3FPMA 1JQ3A 4BLUA 2E5WA 2ITZA 4DAWA 4NL0A 5IUHA 2P55A 2WOTA 5E8VA 2WQEA 10MHA 2Y6OA 2CGWA 3HCBA 5DT2A 4C0TA 5IQHA 3MJ1A 3Q9YA 4FEXA 3R7EA 3GU5A 4AFJA 3SR4A 4X2JA 3QKKA 3DLSA 4QMPA 5BYZA 2BTSA 4ACDA 5CI7A 4ZIMA 2C5YA 3PPKA 4LOOA 3NDJA 2YM3A 3L8VA 1JSXA 4CLJA 3GRZA 3OE5A 2QHNA 3HV7A 2R5TA 4QMSA 3E7OA 1GIJA 3RMFA 5HU3A 1DCTA 5A14A 5CAVA 4H36A 5FUBA 3G90X 1NY3A 4BTKA 5CSVA 3ZMMA 2ZWVA 1HMYA 3DMGA 3BEGA 2GHLA 4IJPA 4UB7A 4WG5A 3JUHA 3W2QA 5EYCA 2YIRA 3UZUA 5BYLA 3NIEA 2O05A 4YHTA 3FTFA 3FZGA 4PDOA 4QQJA 4CFMA 2DPMA 3U9NA 2QOOA 2XRWA 1PMVA 3FI3A 3ODZX 4UEUA 5EQEA 4HTFB 4FOBA 3LCTA 3QXOA 2UZWE 1CKIA 4J97A 3RNIA 4FTKA 4EWQA 1R18A 4P7FA 3P7BA 5F2OA 2FB8A 2YAAA 5CVJA 4GYGA 4GEOA 4JDJA 4EKGA 1B6CB 2X2KA 3O2MA 1F5QA 3Q5ZA 4B9DA 4BCKA 1NW6A 2OZVA 4BRXA 4K33A 3QHRA 3ORPA 3PX2A 2C6TA 1YZHA 5EMMA 3D5VA 1OL7A 3QGYA 4X2GA 4C61A 2R0IA 1IXKA 4D58A 2VWXA 4I6QA 3G6HA 4RZVA 4C02A 2XS0A 3ET7A 4ZLOA 3UO5A 1UNLA 1R8YA 2C6EA 1OIUA 3L1SA 2BR5A 5F94A 3FMKA 4FV8A 3MERA 3HV6A 5DR2A 2PVMA 1G5SA 3PWDA 3R63A 2RIOA 4EC9A 5IQGA 4PL3A 3GU6A 1G60A 4CKBA 3FJQE 3NZ0A 4R3CA 3BHVA 2C3KA 3MFSA 4EH5A 2IW8A 5LXMA 1YXVA 3LLAA 3PFGA 5E92A 3QD3A 4FSUA 2BRBA 2E9UA 4QRCA 3SXFA 4FV6A 4XG9A 4CT1A 1WS6A 2B53A 4OLIA 3UFBA 5GOZA 1INLA 3O7LB 4MWIA 4F7JA 5BPYA 2ZCJA 1GZOA 2X2LA 4OBOA 5BVKA 4QPAA 2OB1A 3H9RA 4RJ3A 1Y57A 3C4WA 2WHBA 4O7RA 5K01A 3LQ5A 2QURA 2JG3A 3R8ZA 3HA3A 3A26A 1SVEA 4IZ7A 2I0HA 4O2ZA 4J8MA 5ANGA 1AD5A 2HWPA 4CKRA 3CBGA 5LMKC 3JWJA 4GUBA 4A06A 5CQWA 3ZUUA 2VDUE 5BQ0A 4X1OA 3TM5A 1YOJA 3C4ZA 4X3JA 2VZ9A 3DLCA 5E2AA 2CMHA 3D94A 5HG7A 2QLQA 3NVKI 3BWBA 5FCDA 4ZTHA 5AEPA 3D15A 2JDSA 3W33A 3WF5A 4QP3A 5K09A 4KBKA 5M55A 4RJ8A 2JKMA 3G15A 3MPTA 2UW0A 3U51A 5CU0A 4Q5HA 5HE1A 4C35A 4QQNA 5EVJA 4IWDA 2FCAA 2OJFE 5FTWA 4EONA 3F3ZA 3VN9A 2P3OA 2VX0A 3RIEA 2XNMA 5JUWA 4GFMA 1IRKA 2YCSA 4BIEA 3MYGA 5GJFA 4PYLA 4WO5A 2VX3A 2ZDUA 3EFKA 2CKPA 3AMBA 4S2ZA 4BDBA 2BRGA 4UYAA 5F2KA 3E8NA 2FGIA 3ZLWA 2R3HA 4AOTA 4BCPA 4EOQA 5EHIA 3C1XA 4LM5A 3SX0A 5C8NA 4WNKA 4DKJA 3QD2B 4JBQA 2RFSA 3TV6A 4RX1A 4O0TA 3TUDA 3FY2A 4FKVA 4I4EA 1YQJA 4PNIA 4WNOA 4Y8DA 4O86A 5DT4A 3C3PA 3OFKA 2W05A 3ZC5A 5GHVA 3MFUA 4XV3A 4YJSA 1GOLA 2BRNA 3P86A 3MB7A 4L46A 4AW5A 3OBGA 4CCUA 3CQEA 5E8SA 2YABA 1D2HA 1WZNA 2PX8A 4PTGA 3MA6A 4KAOA 3R9RA 3UNJA 2ZM4A 4KB8A 2QOKA 1GZ8A 1KE6A 1V0OA 2PUIA 3F6XA 4M36A 4FC0A 5EYDA 4C2WA 2BH2A 4MTLA 5ANIA 3M4XA 3W10A 4QMZA 3BGDA 4PWYA 3I79A 1KXZA 1ZYCA 5T64A 2FPOA 4IZAA 5EHGA 4OA8A 4R8SA 3U4WA 3R1QA 4NTSA 1XCLA 4S31A 5EW9A 4EBVA 1ZMVA 1XDSA 3FPFA 2X8IA 3QKMA 4NCTA 4GOND 3L9LA 2YN8A 3QQLA 3ZDUA 4BBMA 4A7CA 4QMNA 4DH3A 3Q4ZA 2RG5A 1XJDA 2GH1A 4X41A 3NAYA 3DK3A 2QLUA 2BR1A 3LCSA 2J0IA 2C6KA 4U43A 4A9YA 4BTFA 1KHHA 2I7QA 1OKZA 3JWGA 4YU2A 3BU5A 2UZBA 4LG4A 3VIDA 4IM0A 4RPVA 2WMUA 1UKHA 3NUXA 4ZTQA 1RJDA 3R8VA 2C7OA 3FAAA 2XNNA 3LOKA 4AUAA 2BPMA 4ER5A 2PMNX 2OJ9A 3O71A 3WE8A 2F7XE 2DYLA 2V62A 2W9FB 4QNAA 4X7QA 2J0MB 5L2WA 4LG1A 4LWOA 2YJRA 1H0VA 4JG7A 3HVKA 3LPMA 2PVHA 1U54A 4FK3A 3AC8A 4IE9A 3G7UA 1SVUA 1OGUA 4DT8A 1JKLA 4M0ZA 2XM8A 4YUXA 4WXHA 4J8NA 2PSSA 3FMJA 5FA8A 4JX3A 2YM6A 5DX8A 5AP7A 4XOYA 3IG7A 4CFFA 2Q0BA 2XB7A 2XMYA 2WFYA 3E3PA 3NDMA 3QWKA 3R1NA 4FL3A 4O0XA 5AX9A 3OU2A 2XNGA 4L6QA 4BDJA 2IG7A 3CCFA 2PYWA 2WTIA 3SV0A 5KHWA 2CN5A 3TNIA 4YTFA 3KVXA 2A0CX 3FLQA 3WYXA 3SRVB 3F2RA 1CMKE 2ZV8A 2LGCA 2XVDA 5DFPA 3WZUA 5EKNA 5HVKA 3KR0A 3BX5A 3VBWA 4AU8A 4P5QA 3HMNA 3UJ6A 4EVIA 2HY0A 4RJ5A 1V1KA 3BUSA 3OWPA 5KYGA 4BGHA 3EQBA 3QQFA 4Y46A 3HCFA 2F4JA 4DG3E 3LFAA 3QFVA 4TW9A 5KBQA 5HKMA 2IZSA 4E5WA 4E6CA 5CIYA 5E8UA 4CFVA 3CJGA 5GIPE 2OPBA 4BP3A 3AC1A 3BU6A 4FK6A 2BILB 4AAAA 4DFUA 3MQ2A 3HEMA 1XBAA 4RX8A 4E73A 2O57A 3G0EA 3NS9A 4RMZA 3RPOA 2E9PA 4RV9A 1R78A 3Q32A 1RE8A 4E6AA 3QTUA 1UWJA 3UOLA 2GS6A 5FA5A 4KA3A 3ATTA 4BCQA 5ICEA 4YHJA 2WB8A 3KK9A 4EH8A 3DXPA 3PSDA 5EM8A 5C8KA 4U79A 2WQNA 3FSFA 2CNUA 4PMSA 1RI4A 2C0TA 2QE6A 2UYOA 3PT9A 2QC6A 3CKXA 1WBWA 3C13A 2WTCA 4KWPA 3W8QA 1SNUA 1U59A 4FSMA 4IV0A 3ZFXA 1OKYA 4E8AA 1I09A 3P9IA 3MPMA 3QZIA 5K3YA 1K2PA 4HJOA 3QC4A 4QP8A 3ROYA 5ETFA 3K2LA 4DT9A 1XR1A 3AT3A 3OF0A 4DE4A 3FYDA 5E8TA 5HZNA 3PE1A 4L43A 3DTWA 4F1OA 4ZTMA 3FPQA 2XCHA 2IZUA 2A1AB 2J4ZA 2W1CA 4XOZA 2OJGA 4BP1A 3F88A 3EQRA 3NJRA 1XH8A 3OC1A 5GM2A 5P8WA 4RA4A 3VF8A 4C04A 3HP5A 4NUSA 4RIWA 4JG8A 4YV2A 1H24A 1TKIA 4FI1A 4BGQA 5A4QA 3FPJA 4IX6A 1RQQA 3BHHA 2E2BA 3EYGA 2V7OA 5AV0A 3UOKA 4BZOA 1W98A 4Z7HA 3E23A 1H28A 1YVJA 4XUCA 5KUPA 3HRCA 3PY0A 4L42A 3V5JA 4B17A 3Q87B 4CKEA 2W1GA 4AA5A 2ZBQA 4NM3A 3FDNA 3FXZA 4U42A 2WPAA 2PVNA 3DCVA 3AT4A 4R7BA 3PZHA 3R2YA 4YUZA 3EN5A 3G8AA 1Q3DA 3KN5A 2YIQA 1XH6A 3ITZA 5TKDA 4X60A 3O31A 1R00A 1H1SA 5LVNA 1AQJA 3F9NA 1FGKA 3OTUA 4XUEA 2FVDA 2XNOA 3PLAE 4OTFA 5ETCA 5A46A 3FRHA 5HIBA 3SOAA 3TKYA 2GQGA 1SYKA 3V6RA 5EIWA 5B2LA 4HGYA 1BHJA 3R9OA 1GZKA 3IOPA 3LPBA 4F99A 3BZBA 4C4GA 1OIQA 5EOVA 2CGXA 1WXXA 4ER7A 3OPNA 2XF0A 2GNIA 3E93A 1JOWB 3BYVA 3R00A 4OBWA 4YBKA 2JLDA 4TWCA 4IDTA 3AC2A 4O0RA 5EW3A 5JFXA 5E1DA 3DR5A 3D83A 4U0IA 3MVLA 5GM1A 4UZDA 3ORXA 1R6AA 3Q6UA 3DZQA 3TI1A 1FP1D 2WTDA 3PUPA 5JEBA 2FSMX 4WOVA 5IQBA 1XBBA 4IX3A 1G3NA 4FMQA 4DEGA 2AUHA 2C6DA 2X39A 5EPEA 4P7KA 5A4TA 2Y4IB 5C8MA 1LR4A 3EMGA 2E9VA 3UYTA 1ZOEA 2WZJA 3SSNA 2XEYA 4C36A 2ITNA 4IANA 4ITHA 5I0BA 5BVNA 3HNRA 4JDKA 2XK4A 4QVKA 3ZO3A 4OT5A 4C4FA 3V8VA 2JHAA 2VO7A 2WMWA 2NXNA 2VWBA 3BHYA 4FTMA 4LOPA 2WNTA 3Q52A 3HA7A 5CVVA 3P9NA 3FQEA 5K4IA 5IPJA 5L3AA 4AN9A 4BTMA 3DBEA 3CY3A 5HCXA 3DZOA 2A27A 4IAFA 4JVGA 4XV2A 3AY0A 2UYCA 4RIXB 2PUNA 5DM2A 1BKYA 3FI2A 3CGOA 4TTHB 1ZQ9A 4RJ7A 3VJNA 3KQYA 4IB1A 2C6OA 5DI1A 5F2NA 4F0IA 4FODA 4R77A 3O23A 3QGWA 4YHFA 2BFYA 5F95A 3ELWA 4IWQA 3COIA 3KQOA 3I81A 5EEHA 4I22A 3OY1A 3P4KA 3DNEA 3GCZA 4E6QA 4MQ4A 5KVAA 5DVRA 3DNDA 4ZMEA 4NSTA 1NVQA 2BALA 5HO7A 3UJBA 4FKTA 4FTRA 4Y83A 5FD2A 2QG5A 5CAQA 5IA3A 5DG5A 1XDZA 5J87A 4EH3A 2W1DA 3TZ8A 4FEQA 2QR8A 3I64A 4Y85A 2QOHA 3GFEA 4PUZA 1X1AA 5GJGA 4PMPA 2KW5A 3G6GA 5M44A 3VC2A 2EJTA 1VR2A 4MXAA 5ANKA 2QI8A 3QQGA 4GU9A 3OCBA 1N2XA 4FL2A 3VUKA 3VBTA 1URWA 3E87A 2VTOA 4XMOA 1QCFA 1TW3A 3M2WA 1N7JA 3CQWA 5DWRA 3NNUA 3U9CA 4C38A 2GB4A 1WBSA 5E9JA 3GT8A 3EL8A 3CQUA 2BTRA 1SVGA 4PTEA 1EJ6A 3MBLA 2ITXA 4IIRA 3ERCA 3D7TB 3KK8A 3MTEA 4CKCA 3CIKA 5BVEA 5E1BA 2HR1A 1YI4A 2FK7A 2H96A 1UFKA 2Y1WA 4UWCA 1TQPA 4UALA 1MUOA 1ZMWA 4JLCA 3ZCLA 3LXLA 2PU8A 2W0JA 5BUJA 4EZ7A 1UIRA 4DF3A 1VBFA 5DA3A 5EFQA 1URCA 3IOKA 5IQDA 3Q7EA 4EHVA 3FRIA 3GNLA 4FKGA 5IZFA 4BIDA 4FICA 4FGBA 5K0BA 3FUUA 1NVRA 1BKXA 4WNMA 5E9WA 1JVPP 4POOA 1OL2A 4LV8A 3UJGA 5LVPA 3FZSA 2CWWA 5IKMA 1P39A 2FYTA 3DAKA 4AF3A 4XV9A 3FLZA 3MDYA 4EMSA 3I0OA 3KCKA 5AM7A 4C07A 4IHPA 2GTNA 3TL8A 4YV0A 3OXTA 3HEGA 2AS0A 4NU1A 4MQ2A 4JQEA 5IA0A 3BKWA 3A4TA 1H08A 1UA2A 2Y0AA 4HZRA 2IZRA 3GVUA 2GMXA 2R3KA 4L00A 4OTDA 3ZFMA 4ZZNA 5JFWA 3UNKA 4DBNA 1O6YA 2XM9A 4LFIA 5IQIA 3IDBA 3P7CA 2P8JA 4MNEB 4NJDA 1T46A 2YFXA 3QL8A 5D11A 4E4NA 2UZDA 3PZEA 3HRBA 5FHRA 2XNPA 2GS9A 2QU6A 4QYYA 5I9VA 4TYJA 3C4EA 5E1MA 3NW7A 4YC8A 5L8LA 4F63A 5CXZA 1LPUA 4MX9A 4RTJA 1FVRA 3QTSA 3PX3A 4AOIA 4FYNA 4RIYB 2J6MA 2B9IA 3QTRA 3F5GA 3R0QA 3WZJA 3KXNA 3VUDA 3B3FA 4E2ZA 3POZA 3NCGA 3LM0A 3ORIA 4UWBA 5K4JA 4JDIA 4M7IA 5CU3A 3EVGA 4PNEA 4O27B 3HVHA 3SW7A 2GPYA 4FV7A 2PMOX 2ETMA 4V0GB 4H58A 1XJ5A 3MY0A 4FIFA 4JRVA 3LQ3A 3D2LA 2YVLA 3FMMA 1M2PA 3QD0A 2YX1A 5E7RA 4D4SA 4E70A 1SKMA 1H1PA 5CTPA 1NV9A 3LFEA 2PGXA 4YP8A 5TT7A 3OZSA 4G6OA 2HELA 4RC2A 4U5JA 3MWUA 5LARA 4Q5EA 3TEIA 5JFSA 5DRTA 2GLUA 3H10A 5CEPA 3A27A 5HE3A 3TIZA 3PJ2A 3DUWA 4FTQA 3QTQA 5HIDA 1PKGA 4NKSA 4O81A 3V5PA 3LKDA 2QONA 2XYNA 2H6DA 3C5UA 2XVAA 2GA9A 1MRUA 4R6WA 2BIYA 5E8XA 5IMEA 3A61A 5T6KA 3R1SA 1XDUA 4IAAA 1JKKA 2UUEA 2OSCA 3GC7A 4CV8A 3FPGA 4XG4A 2J7TA 5L8KA 2R0UA 5FQDC 4EK9A 3VC4A 4R7HA 3RODA 2R3PA 2W96B 3OUKA 3FQHA 3OVVA 3MGGA 4IKPA 2ONZA 2OKCA 4DTBA 4CGAA 5LQUA 4OTIA 4J1RA 5G6VA 2YXDA 5C9ZA 3D0EA 2VWZA 2B78A 3FUXA 5HOQA 1NW5A 5DOSA 4FKIA 1OI9A 3O8UA 4DQ0A 2I40A 2ZVJA 1BMKA 3DQWA 4XNEA 4YSJA 5KO1A 3PVBA 5JGBA 3A7FA 4HVIA 1EJ0A 4L9IA 2QODA 1WVYA 3FYJX 3P97A 4F85A 3IYLW 1OBGA 3BIZA 1R3CA 4LMUA 3OWJA 4QQTA 3DULA 2J50A 2BUJA 2BROA 3A8XA 2JIIA 3ETAA 4F86A 1JSZA 1Q24A 2XBJA 4PYJA 3KXHA 3R7YA 4BY9E 3HCEA 5HZMA 3P1AA 4RSSA 3CTJA 4DEHA 2VO0A 5C0OE 2WU7A 4P7JA 1WY7A 1SVHA 3FHIA 2GFCA 2VWYA 1Q8YA 4F1MA 5LCJA 4RBLA 3HGKA 5CENA 2P35A 1Q8ZA 2ITPA 2WMAA 2VDVE 3IS5A 3R7OA 4D9TA 5I9YA 5I4NA 5HNGA 3V01A 4MKCA 4WUAA 5DPVA 2VX1A 4X63A 5LR6A 1JKTA 4HPUE 4QMLA 2CHLA 5FP6A 4O7NA 3LDGA 1FBNA 3LCUA 1DM2A 3QA0A 4OQDA 4Q2AA 5ERGB 2NP8A 3DQXA 3V5TA 5CVFA 3OS3A 2G1TA 4GMYA 5KQRA 2QRVA 2JIUA 3R28A 3RCJA 1NW8A 1UU7A 2WKMA 1ZY5A 4FA2A 4BCGA 2ZW9A 2UZUE 3K5UA 2CMWA 1T45A 2XJ0A 4D2SA 3W18A 3OXZA 2CMGA 2BCJA 4RIXA 3CJFA 4HTFA 2ESRA 2O65A 3LL7A 4IVDA 2P3QA 3E8DA 4FGRA 1PW2A 2GHMA 5BVFA 3DJ7A 5CWZA 5EM6A 3NYXA 3RK5A 2HAKA 4L7FA 3W55A 5HX8A 2R3IA 2QYOA 3B3JA 3ERKA 4APPA 4F08A 1XH9A 2PX2A 3NUYA 3U87A 3R30A 5KE0A 3PP0A 3BKXA 2HZ0A 2R3QA 3KQ7A 3LLTA 3EGIA 3P23A 4CTJA 3UC4A 4TWPA 5EZSA 4IAZA 1P4FA 4QQKA 5CALA 5CY3A 3II5A 4O83A 1G55A 3NRMA 3HX4A 4OBQA 3HV4A 4U97A 1WBTA 4GKHA 1KIAA 2AN4A 3QYWA 4PV0A 3EVDA 3RW9A 1EQAA 1DS5A 2GQRA 2PMIA 3SSOA 2KTYA 3HA8A 4PDPA 2UVZA 2XBAA 2Z7LA 4Y5HA 3C51A 3EEYA 3O8PA 1NW1A 4EC8A 2WEIA 3IONA 4EH6A 1XTPA 5ANJA 4R3RA 4IADA 1H25A 5HEKA 2OZAB 2UZNA 2B9EA 2C6MA 2JHCA 1IEPA 3Q9WA 1KYWA 3BKBA 4XRJA 3DDPA 3QX4A 5FUTA 1L3CA 1J1BA 3ELJA 2YEXA 4GJ2A 5CEQA 4BBFA 5IDPA 4ZJVA 5KS2A 4ASXA 5CT0A 3QD4A 2PVLA 3KMMA 3RCDA 3L9NA 3GQIA 4L52A 4BIBA 4MWZA 4FS8A 4O0VA 4PCLA 4TWNA 5M57A 3AXTA 3NX8A 2YXEA 2JFLA 4EYJA 3LVPA 3ZONA 4OT6A 4Y30A 2B55A 2PKWA 3MV5A 4G34A 2FUMA 1RDQE 5BMSA 3CKKA 4G56A 4ASEA 2ZBRA 5AP2A 3FUVA 1PXIA 3HKOA 4K9YA 4TYEA 5FDXA 3RAKA 2QOIA 3AGLA 4R05A 4E32A 2YDJA 1KUTA 4YUVA 3TFWA 2XH5A 3OZRA 5J7HA 5EHLA 2CNQA 4BHNA 5HG8A 4CZUA 5CEKA 4QP6A 3PDTA 4BR3A 2H11A 3A60A 1YW2A 5CVHA 3DH0A 2R7IA 1IG1A 4ZSLA 4MBLA 2KULA 3V3VA 3HDMA 4AZTA 1OKVA 3FMDA 5B7VA 2C6IA 5J5SA 3A7IA 3QRUA 3F2AA 1Q62A 4MXYA 4XBRA 1MJFA 2JAMA 4RTNA 1ZMUA 3EZVA 2YM4A 4TY1A 1KV2A 1O6KA 3DFAA 5HE0A 5CEMA 4KABA 3SC1A 3NVMB 5AADA 4ERKA 1D2CA 4QP4A 1VYWA 3VF9A 5LMAA 2WA2A 4ZZMA 1XQZA 2CLQA 4IVBA 4QMYA 5A54A 7MHTA 4QNYA 2PZPA 3LCCA 2IH5A 3TCPA 5MHTA 4QQ5A 1IASA 1YWRA 2QCSA 2WOUA 4I21A 4U80A 5M5BA 1OIYA 5AV2A 1IM8A 4GIHA 4FSZA 2B1PA 3HL7A 4V01A 2W4JA 2UVYA 2OXYA 3VUGA 3O7WA 3IPHA 2A19B 4M84A 3ZO2A 4WBBB 5TR6A 4F9AA 4XV1A 3LFNA 3EMDA 3ZFYA 4ZAUA 3VRZA 1K9AA 3P0MA 4FBXA 3PTGA 4DEAA 2XVMA 3CJRA 3GO4A 5IH4A 2WTJA 3KXGA 1KV1A 1JKSA 1X1DA 3FE3A 3VNTA 3R01A 3OOMA 2WU6A 4QMWA 5AUWA 4CFXA 1Y91A 4P2KA 5DR6A 4RX7A 4AE6A 3KR9A 5FHQA 1YDRE 4TZRA 1J7IA 1XWSA 3C4XA 5AFVA 1YHVA 4O2PA 4IBMA 1ZAOA 4AGUA 2V5QA 2V22A 5JRSA 3KKVA 3Q3BA 3F3TA 5HIEA 4PY1A 3RINA 3G0FA 5JN2A 2JAVA 5HU9A 1JSVA 4FSRA 2OBFA 4EQZA 1Q8WA 4IM3A 4NIFB 2PSQA 1NT2A 2FSLX 3M1SA 3UVRA 3VULA 3MTIA 4USDA 1PMNA 3P8ZA 3UA3A 4FL1A 3PWYA 3HVIA 4FZDB 3UQCA 1JAMA 2Y6MA 3AXWA 2NO3A 2RF9A 1PXMA 4RLKA 3QTZA 3TDVA 5IA2A 4PIPA 5BVDA 3KB7A 4EOIA 5EIFA 3W2SA 3MHTA 3IGGA 4O6EA 2NPQA 4FKRA 4HC4A 1Q99A 4U40A 5DE2A 5H02A 5DM4A 4DH7A 5EG3A 4BN1A 1RW8A 5KMKA 4QTDA 2OZOA 2W5BA 3CXWA 5CCBA 3PFQA 2JH8A 5IEVA 4EOSA 4X3FB 3PVCA 5EOLA 5E90A 2OU7A 1KWPA 2G8NA 2NP6A 1FGIA 3L9PA 4DFYA 5U4XA 3BGQA 4I5HA 4CEGA 2C68A 4O29A 4JQ7A 3MS9A 5F20A 2C6LA 3COMA 3DBCA 4MBIA 3GGFA 4MXXA 4CNHA 2ACXA 1SG9A 1F3MC 3E5AA 3B2TA 3BI6A 1SQGA 3DXNA 4NM7A 2R3JA 5HGIA 1DL5A 2V74B 4YJUA 4YURA 3VW8A 3CKWA 3EL7A 2LD4A 5AMNA 3PS9A 4FKPA 4FIEA 1TQIA 4CFNA 1XO2B 3KRRA 2NP7A 5HLWA 3CS9A 3CTQA 2AR0A 1QPEA 4F4PA 1KPIA 3DOUA 4RG0A 3PXZA 2WIPA 4M37A 3BHUA 2OGVA 4I24A 4EHZA 4AP7A 5FWAA 4HYSA 5FXSA 1ZYSA 2WQOA 3KRLA 4BBEA 4BCJA 4U3YA 4NH1A 4JDHA 5FXQA 4RFMA 4G9RA 3KXXA 1KOAA 4IVAA 1OL6A 5T6BA 4H39A 1MQ4A 4U44A 4L3LA 4BDAA 2I6GA 5CU2A 3M6WA 1CM8A 1M6EX 4ARKA 1NV8A 5I9ZA 3ORTA 5T68A 2QOLA 2YERA 4G3GA 4F64A 3POOA 4EKKA 5LQRA 3WF8A 3FMHA 2UW3A 4DINA 2ZIEA 2G9XA 2WMRA 5AJQA 3EVFA 5CVEA 3V51A 5HD4A 3V5QA 3DJ5A 5FDPA 1JBPE 2C5NA 3QTIA 4FR4A 5JMSA 2EB2A 3IDPA 3KQTA 4BC6A 2G15A 3DBDA 3PA5A 2FHPA 1CKJA 1GIHA 3I60A 3KPYA 3VS1A 3KQMA 4PYIA 4Z2YA 4K18A 2G1PA 3C4FA 4BCNA 5GINE 2OXTA 3VYWA 2RG6A 4JIKA 1YHWA 3EFLA 3FL4A 4GC9A 3LBYA 1AQIA 4LRJA 5AUUA 3A7JA 5LVOA 3N51A 4M8TA 5DXAA 1DUSA 3K3IA 3AC5A 1WG8A 3QAME 4ASDA 4ANQA 5EGSA 1R0EA 2J5FA 4OBPA 3VUIA 2BMCA 1L3BA 5LWMA 4E5AX 4BDDA 3PVUA 2J0KA 4M0YA 4WG4A 5AUYA 4N6YA 4CCBA 5KBRA 2WA1A 2F2UA 2GDOA 3DOGA 3NNWA 5FQOA 3KQQA 3NTVA 3KU1A 4FSQA 8MHTA 5HNBA 3GGDA 4YSMA 4AA4A 2QKRA 2Q41A 3PXKA 4ZLZA 2YHVA 4RJ6A 4YPDA 5CXHA 3VVHA 2NRYA 4FKJA 3SVVA 5FTQA 2EUFB 3OY3A 3RAWA 5C01A 4PMMA 5IISA 5DN3A 1MHTA 1PYEA 4NFMA 2HTEA 1U4DA 4TT7A 1M6YA 3A7DA 4FX3A 3LECA 1V0PA 4RVFA 2X6DA 1ERKA 5HQ0A 4RT7A 4GF5A 2HCKA 3FXWA 3AC3A 4IFCA 4V0GA 1OUKA 5HEZA 4A4LA 4C4EA 2H1RA 2J2IB 5HORA 5E8RA 5CSHA 4G5PA 5EHOA 3REPA 1NW3A 3WSTA 1E1VA 4FV1A 2VTQA 3FLYA 2B0QA 1Q3WA 4GK3A 2PT6A 2R3SA 5KZIA 4KS7A 2IW9A 5JFVA 3F4KA 1F0QA 3HP7A 4AN3A 3OU6A 4DGLC 3HCAA 1QL6A 3LFSA 3NNXA 2YZLA 5AUTA 5HTBA 2ZBPA 3BWMA 2F49A 2V7EA 1ZZLA 3A99A 2XUUA 3ULZA 4AZSA 4YZBA 4L7VA 3DK6A 3FI8A 4PYMA 4YNOA 3PSCA 3ORMA 3NNVA 3SOCA 3WIGA 3WZEA 3BT7A 4EOKA 3GC0A 4FYOA 4HCTA 4X2KA 4YZ9A 3GC9A 2YITA 5EI6A 3PG3A 1H01A 3CPCA 3BYMA 3DBFA 3EYHA 3RGFA 4F6UA 4WD5A 3JWHA 4ID7A 4FTIA 4S30A 5CVDA 1W7HA 2OH4A 4FEWA 3P78A 2QR7A 3GQLA 4BDIA 2YM5A 3HLLA 5DSXA 3KMWA 4QTUB 4EL9A 3DB6A 5K0NA 2VWIA 4EOPA 3MAGA 1YXTA 3A2CA 4RWJA 4EKLA 3C3YA 5E9QA 3TXOA 4O7WA 1FPUA 3BPRA 4KSQA 2R9SA 4DMGA 3EQFA 4MNEA 4AACA 5KNJA 2PX5A 3PJ3A 3RK9A 3LXPA 2RL5A 4FT4A 1OVEA 4TXCA 3R8MA 3KL8A 3E62A 2N47A 1OL1A 4EK5A 3O8TA 3I53A 4MBJA 3S95A 3MTLA 2Z7SA 4IC8A 1P1CA 3GRUA 3CBLA 4U41A 3UPZA 1WXWA 4O96A 4YMHA 1H1WA 1H8FA 2C5OA 2I0EA 2YM8A 3C0IA 1VQ1A 1CKPA 1TPYA 4GFGA 1PJZA 3PFHA 5E2BA 4FV0A 4GT5A 4FSTA 4RX9A 4MD8E 4H1MA 1L8TA 3AQVA 3EZRA 3PJ1A 4FT0A 4U9AA 2QKWB 4M7RA 2BAKA 1YZ3A 2NXJA 2XYUA 3FY0A 2GU8A 4EZ3A 2X4ZA 2Z7RA 3F3UA 2ZIFA 3PXRA 3CLYA 3E8EA 4FGZA 3QTXA 1I4WA 2P4IA 1QMZA 4NZWB 5E4HA 4GS6A 4FTLA 4U8ZA 3TTIA 3UIMA 4DCAA 5BX0A 3COKA 3LDFA 3UOJA 3F3VA 5AUVA 1LUFA 5DH3A 4HZSA 3QC9A 5BUIA 5JH6A 5K5XA 3PVWA 4ACGA 4GYIA 2AOXA 3PB3A 2WTKC 4BB4A 2PXXA 5CUQA 5DM1A 2X81A 3CC8A 4BLVA 2IH2A 3C0GA 2W7XA 3SAYA 4DGNA 3AD6A 1RI1A 1TW2A 5BP7A 1PXNA 4F1TA 3CTHA 3G2MA 4DFBA 4DFLA 5K0JA 4MAOA 1GIIA 4O38A 2Z02A 3R8PA 5L6OA 3EFJA 2X6EA 3ZDIA 4JT3A 3PA4A 2ERKA 2W1FA 4JQ8A 3ZBFA 5LJJA 2AC3A 4EH7A 3FTEA 3LMHA 2YJSA 2WK1A 3Q96A 4HGEA 4FZVA 2ETRA 4FTJA 5TF9A 3FI4A 4MVFA 3RPVA 1VP3A 1NVSA 2HWKA 4KIFA 5J1WA 4L3JA 4ZJJA 2BR3A 4KWCA 4BGGA 4IWOA 2I62A 5GWXA 4FIHA 3LX6A 4PL4A 4PCAA 2B2CA 3VBYA 3KF4A 1V39A 2G71A 2OF4A 4DH5A 4QTTB 4RVHA 1KE5A 3VUMA 3HV5A 4Q9SA 1PMEA 2OWBA 1MRVA 3F7WA 4I3ZA 3S4QA 3VS0A 5IF1A 3OT8A 5BW5A 5K03A 5K0EA 2F57A 2G01A 4Z9LA 1BYGA 2BZKB 2C69A 3ZLYA 3GB2A 2ZMCA 2PVYA 1S9IA 4I23A 4NFNA 4O0YA 3THBA 3DMHA 2YCQA 4PRJA 4QOXA 3OZ6A 5HVYA 2I1MA 4KD1A 2XKDA 2PPQA 1IA9A 4OA5A 3QZHA 4O7ZA 3KULB 4PDSA 4RTSA 5CSXA 3Q4CA 4ZSEA 1VLMA 5AV4A 5IG1A 2C3LA 4EORA 2I9KA 3KU2A 4FV5A 4EOMA 3AXSA 4DG0E 3L8XA 4P7EA 4ZMFA 3VC1A 2CKOA 5AIRA 5EI2A 4LRKA 4DGMA 5DXJA 4D0WA 2VS1A 4RC4A 2IVVA 3FMLA 1UU8A 1ZYDA 4L53A 3KR1A 2YZAA 3F5UA 4UYNA 4M13A 5A3XA 4ZTRA 3HCCA 1ZY4A 2W4KA 5HNIX 2ZWAA 3FYKX 4GIIA 2IDJA 3DPKA 3QUPA 4A9SA 3HMPA 1GAGA 2HZNA 2WMXA 2EU9A 5C4LA 5CAUA 5M06A 1R74A 4GBED 1DI9A 2QU5A 3OZTA 2BKKA 2XBMA 1X8BA 3QF9A 4XG2A 3RI1A 5GP1A 2XJ1A 5M53A 4C3FA 2OY0A 4RTKA 3EQPA 2DULA 3C0HA 2PZIA 3DK7A 4BLWA 2ITTA 3T3UA 1YI6A 1YOMA 3FBVA 2HZIA 5EM5A 3Q2JA 2X9FA 4AFEA 2SRCA 4A6DA 2Z2WA 3WZDA 1M17A 3KC3A 3I5UA 4E30A 5CASA 4PF4A 4IACA 4XH6A 2PVFA 3SG8A 2HOGA 2XNEA 4PYOA 4JJRA 4ER3A 3ACKA 5M07A 3QYZA 4D9UA 3FZ1A 4HVDA 5J9YA 1J3HA 3VAPA 5K9IA 3GJYA 4HYHA 3TACA 3OU7A 5DTQA 1PF8A 1VZOA 1JSUA 1WBPA 3HV3A 5D1JA 4BZDA 4HGTA 1QAOA 3UVQA 1YRPA 2Z8CA 4IM2A 4C62A 3MB5A 2PWLA 4JXJA 4GSBA 4DLJA 3GU4A 4AQCA 3KXZA 3NIZA 4BDEA 5C1IA 4QO9A 3PE2A 3UG1A 3NYOA 4R3PA 1YXUA 1WFCA 1IR3A 2BIKB 4I0RA 5CU6A 4ANLA 3PY1A 2XKCA 2QM3A 2ZZNA 3VW6A 3R6TA 3QRTA 2O3PA 2EG5A 3UWPA 3G9NA 4FV3A 4RQVA 1KR5A 1ND4A 4G6LA 3PXYA 3TKUA 5CD1A 3U81A 5EHYA 3EQDA 5IH6A 4E33A 4CXAA 3EOCA 4R5SA 1H00A 1PRYA 5L8JA 4Y2HA 3RHXA 3CR0A 3FMNA 4G2FA 3ZO4A 5JGAA 2AN5A 4NW5A 3LHJA 3ZSGA 1PYXA 4CTCA 4BDFA 1SUSA 4IB3A 3VWAA 1QYRA 3OCTA 4XP3A 3VS3A 4FT5A 3BXOA 4PYQA 3RTPA 1H26A 2W99B 3GCVA 3UTOA 3GI3A 1ZARA 4IWPA 4U3ZA 3DLIA 3K6RA 5H2UA 5AWMA 1WBNA 2YAKA 3ANXA 2VO3A 1VJYA 3GCUA 3Q6WA 1M7NA 4USFA 1RJEA 2CN8A 2GFSA 4EYMA 3DBQA 4V05A 4CRLA 3PA3A 3EH9A 2DQ7X 3HAMA 4HPTE 4BDHA 1CSNA 2HIWA 4LYNA 3FLSA 4NM0A 5ACKA 1OPJA 5BXYA 3G33A 4HGLA 5IEYA 1BI7A 3I7CA 1PXPA 2HYYA 3BLRA 3K5VA 4QMUA 2YISA 4RVTA 4W4XA 3G5LA 3LDUA 1UWVA 3QALE 3F66A 3R1YA 4BCHA 4IZ5A 2XKEA 4RVGA 3ALOA 3MESA 5FWDA 5LQNA 5L6WL 4JS8A 5H8BA 5JRQA 3KPUA 5AM6A 2PMLX 4MK0A 4XCXA 2BDFA 3SD0A 3CY2A 3FZPA 3ORKA 4XCUA 3UMWA 4DZRA 3PRIA 3QUEA 4RWLA 3TKIA 2UV2A 4EJ7A 5B2MA 4GFOA 3SA0A 2PVRA 2IH4A 3ACJA 2BM9A 3G88A 5KMMA 2OO8X 2WGJA 3UODA 4YZCA 3ZYAA 4RTRA 4EK4A 4JBOA 4Z55A 4GT4A 2X1NA 4JG6A 5BUEA 5KQSA 2FA2A 5HO8A 1ZOGA 4DA4A 5EM7A 3ZHPC 3MFRA 3LJ0A 4GEKA 4P58A 4MTAA 1WVXA 4FE2A 2XK6A 2XK8A 4WKQA 3ER8A 4LUEA 4YTCA 3BYOA 2VGOA 1GY3A 3NUNA 3NYVA 3LE6A 3CP9A 3P9KA 3JR1A 3HA5A 3DKCA 4EQMA 5AP4A 5CZHA 3BQRA 4KSPA 3AWIA 1Y8YA 1GNGA 2JDRA 2P3LA 3D5XA 4GV1A 2VWVA 4MD9E 2WD1A 5B2KA 1J1CA 4FIJA 4AT3A 2W1ZA 4MIKA 5BMMA 3TJDA 1J91A 3WARA 1P5EA 2O2UA 2UW6A 2PZ5A 3BU3A 4BKJA 2IGTA 4KDRA 4BYIA 4GUAA 3D14A 2H8HA 5IUGA 1KOBA 4E31A 3DXXA 2JKKA 2ZAZA 2ZSUA 2UVXA 4ZEGA 4D1ZA 1YFJA 1BI8A 3OP5A 3PJCA 4QTCA 1ZWSA 4ALUA 3RWPA 2BM8A 4MEDA 5EQJB 2C7RA 4HVGA 2ZVAA 1U5QA 2QO2A 3ORHA 4MXZA 4TYGA 4ZP5A 4BF2A 5IH5A 2IIPA 2XK9A 4ISCA 2CDZA 2ITYA 2RFDA 3PLSA 2A2AA 4PP9A 5EW8A 4N70A 5J1VA 1BC5A 1I9GA 5HCYA 3TDWA 1GZNA 4MQ1A
chains in the Genus database with same CATH superfamily
2HD4A 3DMYA 3LBAA 5JT1A 4LV5A 4S34A 1TCCA 1E2FA 4R1VA 4G8BA 3MTQA 4MUNA 1ZJ5A 3SC2A 1Y34E 2EDAA 2IHNA 2MSNA 4Y2YA 5BW6B 3QWJA 3AD5A 3EMBA 4A0HA 1DAWA 3HMQA 1Y6ZA 3IBGA 4P6VF 1WHSB 3PUZA 3H9QA 5AD1A 3TT0A 1PS8A 1WNTA 3MJVA 3TTJA 2B9FA 4KW7A 1HE8B 3G9UA 4HDMB 4RWIA 3VHLB 5F4BA 4HNSA 4NX2A 2J0UA 4B3HA 4BTVA 3D8HA 1OY1A 1NBIA 4A07A 3SMQA 2IFTA 1Q97A 5F9FA 4MO2A 3RGWS 2DLNA 5E8JA 2ZR9A 1Z36A 2ZKLA 2F43B 3FSGD 1V8PA 5TGZA 1U2SA 3WNZA 3NUPA 1WVIA 1GPUA 1FLAA 1CR6A 5D9HA 5LQFA 3MS7A 4X6QC 1YQGA 3EWHA 4MGHA 2JGZA 4F09A 3ZCVA 1MIOA 2Q7XA 3H83A 4BCMA 4JI8B 4F3KA 2MWMA 3HVUA 2PKYX 5EXDA 3R7LA 3ZHYA 4HDQB 4RVDA 4YCMA 4KO1S 2FG7C 2D59A 3L6UA 2F55A 3R22A 4YO6A 4BNUA 4BI2A 4MHAA 3GUYA 1PV4A 1M8KA 3AR6A 4C4YA 1EZZA 5JR3A 3TSCA 5BSWA 1Z9XA 4FHDA 3I9FA 3RANA 4DZTA 1H42A 1SBCA 1WZYA 4A73A 3G0GA 4QGGA 3WO1A 2GTMA 1MAUA 2C7BA 5BR7A 4MQEA 5JXWA 1YQ9A 4D46A 1PVVA 2WYIA 2Y6VA 3TXYA 3NLBA 3FTCA 1B38A 1Z06A 3CO0S 5JISA 3REFA 3O3NB 1MB4A 4WUNA 5BNWA 3ABSB 4JITA 2W0MA 1GNVA 1KE8A 4JJZA 4C5AA 5CFZA 2RGNA 1VPWA 4K2RA 4BIMA 3ENMA 5EI8A 5J5VA 3ROGA 3SQOA 1J5EB 2P77A 3ZNPA 3JVSA 3VHXB 1XNHA 5HIMA 3O9MA 4QLOA 3EDOA 5AKXA 1SG6A 3R3JA 3TZ6A 3LBHA 5BSUA 4HDOB 4AW2A 1AK9A 4G4SO 2W9XA 3QCYA 2X76A 2O8EB 3WMXA 5DWVA 3KRXA 3EUAA 4JQYA 1JFVA 4ARVA 3M5DA 3BGIA 4FQ8A 3I23A 5EYMA 4EJNA 5FH9A 5E8WA 5IXSA 2VU3A 1E2KA 4H6PA 2SCUA 1OI2A 4PAWA 1OPLA 3QITA 2I8LA 4FNWA 3E1GA 1GTJ1 1LVUA 4JLPA 4II3A 3I1FA 4D28A 3BZ3A 3OLVA 2WYUA 2FSGA 2Z1NA 4ND5A 4U63A 3SIWA 3EGEA 1EM8A 4DLIA 4ER6A 3RKSA 3F9CA 2WNIA 4ZRDA 3DZJA 3IBTA 4AE9A 3H8JA 4YB8A 4C0QC 3ZDDA 3WYAA 4DITA 3NM4A 1VDMA 4E4MA 1NVMB 1H93A 3IE1A 2G04A 1E3WB 3EW7A 1VL8A 4QRDA 1XAGA 1P2BA 2FETA 2OYRA 3TUZC 3QEMA 5LSAA 2V6GA 3KZXA 5KCVA 5KVQA 5AAGA 2XOXA 4GX2A 1X7ZA 3PTAA 3G2KA 4CG8A 4RPIA 1A06A 4IDCA 4JBVA 2REIA 4F93B 4XBUA 10MHA 2LIPA 3IV6A 3IERA 3W2OA 1GPAA 3N7UA 2HJHA 4U7JA 3JD3A 4TYHB 3S4YA 1CV2A 3K8OE 2IS4A 3TNQB 4MRAA 4AZWA 1C0EA 1Z73A 4GW3A 5CANA 2VN9A 4RVMA 1U99A 1CJTC 4OLJA 3W5BA 4OHZA 3OZCA 1BSVA 3U5TA 4IIYA 5E3HA 4B0PA 5ADWA 3CA8A 1KFBB 4M86A 3ZZTA 4EK6A 3VH2A 5AW2A 3PUWA 4DIMA 4KTTE 3JARB 3KSDO 5GIOE 4YJVA 1PR6A 3FAZA 4A9RA 1K88A 3RTEA 3V46A 1CHNA 2NXEA 4OJNA 3ZCRA 3LQQA 1NQAO 3KRJA 5HX7A 2H31A 1MJGA 1V3UA 1QCCA 5F1PA 1QNLA 4TN5A 4ZOGA 3UA4A 4A6PA 4KBCA 3PC2A 4JJ7A 1YS1X 3NEYA 1EWRA 1GPNA 3BIFA 5CNNA 2XLCA 1T3SA 3ODYX 1SC4A 4E6DA 4F9GA 2VOJA 1AGWA 4RK5A 1W82A 3SRVA 4TZTA 3RJZA 3MCTA 1CEYA 5FDFA 3D7SA 5JAUA 2R6DA 2DUVA 4FNAA 2XUZA 4OBBA 3FMOB 1M73E 1TK2A 3HYLA 1L1RA 1TJPB 3S29A 1OV4A 8AT1A 4MD7E 3A4MA 1SZCA 3U7QB 3ZBQA 4QQCA 4XDYA 4QYIB 3UM9A 1PR3A 2OV8A 3RPYA 2CUKA 3FZOA 3RWMB 2ZUBA 3OOEA 1TQMA 2HUPA 4EHHA 4Y6LA 3KOOA 5LYJA 2KM1A 1BCRB 2Q0HA 5ITZA 4US1R 2J0JA 1Y3AA 1R4MB 2WXVA 2FUNB 3QFRA 2I7CA 4LY3A 2DBQA 3VS5A 3FZTA 1GDDA 3OT4A 4MS1B 4TS1A 2VDNB 2AOUB 5IMSA 3JZAA 1QZTA 3GCWA 3TJRA 4JIAA 5K0ZA 5G1PA 3W2CA 1TA0A 2FWMX 4IFGA 1AGNA 5A6VA 4C1NA 3G9TA 3TW8B 4IXWA 5BMVB 4JEIA 1ZGGA 3K0AA 3V8TA 1MTZA 2SCUB 3BWFA 4Z7JA 5TO8A 3SNKA 1VHTA 4JFRA 3BELA 4LX0A 2ATVA 3TI9A 4DB2A 1EK6A 1AKRA 4BI0A 1SU4A 1JVBA 4YDQA 2OIBA 4U7GA 5J4KA 3RYFA 3SPXA 1HKHA 3PNBA 4YMUA 4C33A 5A4CA 5FTOA 3NGLA 5F9MA 1XL1A 1RYEA 2WTEA 4L5BA 1V8BA 4B2YA 3DD5A 2J31A 3BXPA 5TOZA 4UCQA 5ALIA 1BYIA 3ICPA 2WELA 4YJ2F 1XEAA 5A5GA 5FWXB 1CG6A 2RAPA 2AOTA 1X7ZB 4MIYA 5KKRC 3G49A 2MMCA 4BATA 2A5GA 5J9FA 3HXKA 1TVOA 4FEVA 3A1VA 3KPWA 4TYHA 5KX8A 1E2MA 1O3YA 3GRVA 4ZJZA 3IOYA 4JLSA 1QCDA 2OHFA 2A2ZA 2C8VA 2P2IA 1YIOA 2FH9A 4LYEA 5BQ3A 1UU3A 5AVVA 3JSXA 1YRAA 4F5WA 1ZIXA 1C2YA 3QLGA 4RUKA 5HG0A 2G17A 4QKQA 3NCZA 1UMDB 4B5LA 2OW3A 2GQ0A 3KLNA 4PLVA 1DXOA 5K8IA 4RF5A 4QYGA 3JD1A 5IDNA 1X1BA 2VTPA 4O4LB 2PQ2A 2W2LA 4B8WA 1TVKB 2EFDB 2J5EA 1P5ZB 2W1IA 3QCQA 3FETA 3MCZA 1AQUA 3GJ0A 2ORIA 3G59A 2CKQA 3TZEA 3RSZA 4WK6A 1Q0HA 3H9OA 2CYAA 1EUCB 4MGYR 1KO5A 2FUEA 4RWZA 2NVBA 3W9SA 2UW9A 4FOLA 4QFDA 3SIXA 3KQNA 1DPFA 2NV6A 4G9GA 4C0JA 1P80A 3RTBA 1E3TA 3KK0A 4ZA2A 3TGLA 4RC9A 1F38A 4DEVA 4YMSA 5LVAA 4QMMA 3GLGB 3IGOA 4TLDA 2WVHA 1UDXA 3S2SA 4OTHA 2CSNA 3GEMA 4AXAA 2BHLA 2P5TB 1TQ6A 3KHTA 2FQXA 2J0VA 4RO0A 1KMNA 4P7GA 5I7EA 3AGQA 1B8PA 5JD3A 5ETIA 3OTOB 3JVEA 3RC1A 1DELA 4I9FA 1OMOA 4QMTA 3ZWDA 1KI4A 1VJ5A 3OO1A 4KR9A 2ASEA 2BY4A 3JAKB 2B5WA 4ACDA 3O94A 3PPKA 2MYUA 3BQNB 3G17A 5IX8A 5FUBA 4K86A 4MR7A 3QEOA 4JC4A 4RSMA 2YIRA 1E77A 3FZGA 4Y2QA 3BAZA 4ONEA 4RW0A 3UV6A 1R18A 1XP5A 3CZMA 4GEOA 1JMKC 3ORPA 1J9ZA 3BGOS 4C02A 4ZLOA 3ET7A 1GT6A 2BR5A 3G1TA 5JSQA 4FV8A 3PWDA 1SHUX 3BHVA 3MFSA 4YWJA 2IW8A 4CT1A 3A6EA 2RGWA 2PUCA 5JNSA 1V3QE 1L7DA 2X2LA 2X5OA 4RJ3A 4OL9A 1IIRA 3HCWA 1U1DA 3LI2A 4I8DA 4JOQA 5E95A 3OTHA 1JG7A 2WWTA 4GU5A 1YOJA 3MBOA 5LWHA 2V6BA 2GF9A 3KALA 4H7HA 1EHCA 2FCAA 3F3ZA 2C03A 2QZSA 5T41A 3BJIC 1ID1A 4S2ZA 3AMBA 1CETA 3QD2B 2CXNA 3DTNA 3C3PA 2W2LD 5GV7A 4KI7A 1SU7A 1VJCA 5LDGA 3LX4A 1VLRA 2PX8A 4LY6A 3NWJA 4O1IA 4TVKA 4KB8A 5EZ5A 4FC0A 3FHCB 3T3EA 3BGDA 1ANKA 3I79A 4OI4A 2X8IA 1QHHA 4A7CA 2SHKA 1GJRA 3W3AA 2HZ7A 3C15C 2AMFA 1J42A 2QLUA 3OIGA 2V58A 4NATA 3QXXA 3CB4A 2XOKA 2GVDC 3GDOA 3L8ZA 5FNVA 1YHNA 3EFEA 2CXHA 1RRKA 1H0VA 4JUCA 1U54A 3G7UA 2PGJA 5JS8A 3N28A 5T4FA 3MOSA 1VL1A 2DUJA 2WFYA 2Q5JA 5IUJC 4L6QA 3NDPA 4I9NA 3WFIA 3H99A 4EEZA 1E1RA 1U8TA 3OWPA 5LZ8A 2I5PO 1G9TA 2QXYA 5KBQA 3BHMA 1BDJA 4S1NA 3UUWA 1R6XA 4TWAA 4LE0A 4FJ0A 3W5HA 2GS6A 4I4NA 3PSDA 2QMOA 5L3QB 2UYOA 1NN1A 1ZD5A 1GTSA 1OKYA 3QZIA 1Q1AA 1ISRA 4BECA 2BDUA 4FINA 3NGXA 4ZTMA 2Q5LA 4WLVA 4X7BA 4O3FA 4JG8A 2ZJZA 1H24A 5KVCA 2F17A 4CHTA 4GE0A 4DSUA 4YCDA 2HX1A 2WPAA 4MV1A 4R7BA 3R2YA 3NV9A 3EN5A 3G8AA 1G5QA 3QVJA 4CM8A 3GUUA 3PHCA 1XQVA 4X60A 4ZI7B 1SC9A 4MP6A 2JI4A 1VXOA 3UXHA 2EBFX 2JLDA 4LGVA 1U8FO 5E1DA 2XKAA 3Q6UA 2FEXA 1FP1D 3AKEA 3PCXA 3FCAA 4D4HA 1EWVA 2L19A 4KXXA 4IANA 1AO0A 4PPFA 1JLLB 1W4CA 1PDOA 2WMWA 5DBEX 1COWA 2P9EA 4AN0A 3FDJA 4LYYA 3N2KA 1EXDA 4NH4A 4P98A 4HDMA 4GP6A 1E3QA 2A6PA 5FPSA 3WLQA 3R7WB 2I3BA 2BGMA 3AUFA 1I4LD 1PG0A 3NNUA 4CF7A 3EL8A 2P5UA 3B12A 2GYWA 4UU1A 4MDEA 4BTEA 4P92A 4RE6A 4YJGB 4DF3A 1QUFA 1DC3A 2IHZA 4NSNA 4FGBA 2IYWA 1BFDA 3NATA 4IBOA 2V3CC 2R2AA 3GCXA 4GZ6A 4MQ2A 2XJ4A 1YZNA 3SQWA 3AKLA 2Y92A 1ZD9A 5FBRB 3OOJA 4E4NA 1U0LA 4PG6A 2QU6A 1PDWA 4AJPA 4EFMA 1DTSA 3NW7A 1LPUA 3OHSX 1FVRA 4URYR 9LDTA 2B9IA 3U7FB 3CXUA 1XN1A 3ZHOA 2GZMA 2PMOX 1IOWA 4H58A 3VAYA 3IT1A 4D4SA 2J07A 5CTPA 5LARA 4J75A 4KLZA 2PZLA 1Z0UA 4V1CB 3IUEA 2XZLA 3DUWA 3FNGA 4OOEA 4CMHA 4FGSA 3C5UA 1ZM7A 2VFAA 2I4IA 5KWJA 2QUKA 1O08A 1XDUA 1JKKA 4EY6A 1IHYA 3EDYA 2PE5A 4HPJB 5JBNA 3LOUA 4KH0A 3O73A 3WAKA 4R01A 3P94A 3QOYA 3DTYA 1M1YE 1OHHA 3AFNA 1FDRA 1W8DA 2ZVJA 4XNEA 2VRWA 4AJNA 2JLBA 1R3CA 2NW6A 3LCMA 5T4HA 3T9BA 3HGKA 4ZRNA 2V7GA 4XGKA 4OQDA 3ANMA 5CVFA 3O4GA 1M1NB 2ZI6A 1KJWA 1T45A 3W8NA 3QJ5A 4IVDA 3LY7A 3DJ7A 1O95C 1JN0A 1QFYA 3K2IA 4OMUA 2PX2A 1TGYA 3EWAA 3IVCA 3KU4A 3EDCA 4HLNA 2PUWA 2VAMA 1UXHA 4RCYA 1FMJA 2R9VA 4MJXA 3EFOB 4WBNA 3BFXA 5JNVA 3ZY2A 3EEYA 3UBMA 4R3RA 4AMVA 3DWIA 3EXIB 4FUTA 5FUTA 4MR9A 2EC5A 1BD4A 1QGED 5IS2A 2G6BA 3I09A 3QD4A 1F1BA 4BIBA 2WF5A 4Z49A 3CIFA 3LVPA 1JHXA 3M34A 3WP1B 3V8QA 3FUVA 3PFIA 2QX4A 5EHLA 3MJ4A 2QIPA 1DZ3A 1I2CA 4CKWA 2ZM6B 4LGCA 3LGSA 3P5BA 3NVMB 4FM9A 2CZCA