4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
3D94A 3JVSA 5BMSA 3S68A 1YWVA 3OOGA 1OVEA 4OBOA 3KXXA 4RX8A 2Q0BA 2GTMA 4FR0A 5DXAA 4FIEA 4M38A 4EVIA 2CKDA 2OH0E 4FEWA 4YBJA 2OB1A 4CRSA 4HCVA 3BU6A 5B2MA 4M67A 3UJGA 5IG1A 4M69B 5KHWA 1UIRA 2IBTA 3C0IA 4C59A 3GQIA 5DT3A 1PYXA 1L1EA 2FCAA 2GLUA 4OTDA 1AQIA 1WG8A 1WBNA 1I9GA 4ASXA 1G6Q1 2Z7LA 1OR8A 1V1KA 3P7CA 3DMGA 3KQPA 1AV6A 4F9CA 5ERGB 5K03A 5TKDA 4B8MA 3TXOA 4UX9A 2VTLA 1QANA 3FMDA 4GU9A 3TJDA 2YCRA 5AIRA 4R7BA 2P1DA 2QRVA 3I64A 2JLDA 5DT2A 5KQSA 3E63A 3HV3A 3L8VA 3RM7A 3AT4A 3C13A 4ZMEA 4HGZA 1T45A 5IA2A 2XZSA 1LEZA 2W5BA 1INLA 3KB7A 3R0QA 3N4TA 4Q9ZA 4DCEA 5K0GA 2P3OA 3QZIA 4JNWA 2ONLA 4IW0A 4G5JA 3HNGA 4GU6A 4D0XA 1YW2A 4OW8A 1XBCA 4FKSA 1JKKA 5EYCA 4PMTA 3LKDA 3RIEA 4Z9LA 1GZ8A 2WTKC 2F49A 4BDKA 3TV4A 1OUYA 2Y8OA 3BI6A 3CLYA 3E7OA 2EFJA 3WIGA 4YJSA 3VQUA 3FZPA 4BDGA 5AP4A 4RJ7A 4Q5HA 4TWNA 3HDNA 4MBLA 4PP7A 3ZOSA 4TYIA 1BX6A 1OKZA 3NAYA 3WBLA 4ZTMA 3QOXA 4HYHA 4ZSGA 2R5TA 4BTJA 2OPBA 4X41A 3O96A 4O7YA 3QBNA 5DGZA 5AP1A 4F0IA 1EQAA 3KRRA 3RPVA 3UJAA 1REKA 3ORIA 4OBQA 4A6EA 5D11A 1ND4A 4YUZA 4IAZA 3TZ9A 4RTPA 4BR3A 1XJDA 4NTSA 5CVDA 3FLSA 4FV5A 4UWBA 2CPKE 4YZ9A 4O0WA 3LM5A 4EORA 4YMJA 3VC2A 5BVKA 3RPOA 3B8RA 4G3DA 4IAYA 2OBJA 4BC6A 4QP1A 3VS1A 4S32A 1ZY5A 5JRQA 3KMWA 2SRCA 3FHIA 1FPQA 3EVCA 2JC6A 3CPBA 3MN3A 4LL0A 1YOLA 2R9SA 3GCZA 5IISA 3H2BA 3PFGA 5HOQA 3ORKA 5F94A 2RFSA 3GCVA 2V7AA 1MQ4A 5E1OA 2X4FA 1CKPA 1EJ0A 2UW3A 3QQHA 2CCHA 4BN1A 4U3ZA 5K0JA 3M2WA 4EH8A 3RK7A 3UG2A 4C4HA 2GFSA 3DFCB 1OL2A 4YUXA 3VC4A 3WZJA 3LGAA 5KYGA 4ATNA 1Q8ZA 4KS8A 4R1VA 4G6OA 3HP5A 2AYPA 3NNVA 4JG6A 4NK9A 3A62A 3LQ5A 3QCYA 3UBDA 4CMUA 5IH4A 3Q5IA 1Q99A 4BCKA 1U54A 4QNAA 2ZULA 1PXJA 1SQGA 4OTFA 4F9BA 4I6FA 5I9YA 4Y72A 4AOJA 3CR0A 2GPYA 3GO4A 3U55A 2PGXA 3TOSA 2HY0A 2YA9A 3FPHA 2VGOA 4DH1A 4YHTA 4JOAA 5CT7A 5DHJA 1Y91A 4JAJA 3NUUA 3CJTA 4IX4A 3SM3A 4J8NA 5CEMA 1J7LA 4POOA 2JIVA 4R7IA 4I23A 2YM4A 3EVFA 3A2CA 1YZ3A 5EHLA 5CI6A 2ACXA 4X60A 4DFZE 2V7EA 2CKEA 3SG8A 2FSMX 5CQUA 4BDEA 4GIIA 5J87A 3UODA 3KU1A 1YWRA 4O0TA 5E9EA 5T6KA 3ZYAA 4WIHA 4DGLC 3COMA 4ZP5A 2CMGA 2A27A 4CTCA 4FTLA 4CNHA 4DT9A 1OI9A 4RTLA 2A1AB 3O50A 3A7JA 2W4OA 5DR2A 4D1XA 5C9ZA 1KPGA 5HX8A 4BICA 4GC9A 3C3YA 2VDVE 4FYOA 1I09A 2G2HA 1JSUA 2R64A 4FV9A 1BMKA 2GCDA 1PXPA 3OXIA 4FZ6A 4RPVA 5IMEA 3IEIA 1WVXA 4IB0A 4RJ8A 5BVWA 4RX1A 2C6DA 4IVDA 5D7AA 1GIJA 4BGQA 3PVUA 5HIIA 3O7LB 3P23A 5AWMA 4PL4A 3ZEPA 4AA4A 4RQKA 3R1SA 2PPQA 3JWIA 3PX3A 5EW3A 2OXTA 4Z3VA 4LG1A 3NNUA 2YJSA 2BAQA 3BLHA 5M4FA 2PKWA 4FZFB 4JJRA 3EMDA 1PJKA 5CU0A 2QVSE 5E2BA 3HEGA 2PX4A 3MYGA 1OIQA 5LARA 4FP9A 2NRUA 4XRLA 5JZJA 3R2BA 1HMYA 4HVIA 2VWVA 2BALA 4B7TA 1JQDA 2GPHA 1ZMUA 2ITXA 3R02A 5EHOA 3WF8A 1H1DA 4USFA 3FPEA 1G3NA 4LM5A 4E5AX 3ZSIA 3C4FA 2YDKA 1CSNA 4RFZA 3MS9A 1SVUA 3DAKA 2FA2A 1RI2A 4MHTA 3HECA 4TPTA 1QZZA 3EIDA 3I4BA 2P40A 4F4PA 2XK9A 2XH5A 3LCSA 5E1SA 3R8UA 3JWGA 3OU2A 3QKKA 3RW9A 4BGGA 1IRKA 1P91A 5HKMA 3WI6A 3MAGA 3H9FA 2FVDA 1FPUA 3F69A 2F2CB 5CVJA 2E9NA 3ANQA 3F2RA 2HAKA 4QYYA 4TY1A 4FSUA 4MYGA 4P90A 1M7QA 4S31A 5FXRA 1XXLA 1H1SA 4V0QA 2PE0A 4FTIA 2VN9A 2ZV7A 4FODA 4YZNA 3LVPA 2AOVA 2QURA 4R77A 4CFFA 5K0NA 4I3ZA 2Z02A 2VO6A 3BKBA 4L43A 3VJOA 1BHJA 3NUYA 4RIYB 2WK1A 2UZ4A 4H3QA 3HP2A 3NWWA 4WHZA 5DA3A 2WMBA 1VP9A 5JRSA 1ZHFA 5CM2Z 3Q9WA 4W8EA 2UW9A 3TNIA 4QPSA 5CWZA 4YO4A 4G9RA 5HILA 1PW2A 4PTEA 1JLUE 4BHZA 4EZ7A 1KYZA 5HIMA 4FGBA 4LGGA 2Y6MA 4H05A 3TL8A 2RIOA 3UJ7A 1OIRA 4DA5A 4W8DA 2QOOA 2C6IA 3PZHA 4BVUA 1P1CA 4HGTA 3LDGA 1SMHA 2O0LA 3FUTA 5HO7A 3LFNA 4N4SA 4BCJA 2R3NA 4FV1A 1UU9A 2C0IA 4BDFA 3MFSA 3DXPA 5J9LA 3EFLA 3FY0A 3DCVA 3FKNA 4U7ZA 4X63A 4R6WA 4CWAA 2KULA 4X2KA 3RZBA 4FVRA 3VBWA 4ITHA 1J1BA 2UZOA 1JSTA 2XEYA 3PZEA 3TEIA 3QKLA 4DINA 3BWCA 4WNKA 3DKCA 1FVTA 3G5TA 3LCUA 5CF5A 4DGGA 4FTTA 4NZWB 4NU1A 5GINE 3ZM4A 1UNGA 1YHWA 3UZUA 1H0VA 2X7GA 5E8JA 1UU3A 1KE8A 2O64A 3A8WA 3CBGA 3DKOA 4FSNA 4CMOA 4E2WA 2QOLA 3UNKA 1GZOA 3QX4A 3KKVA 3SOCA 5K4JA 4O7TA 2VX1A 2K4MA 3FQEA 3EHAA 3P86A 4EKLA 3D2KA 4O0SA 3LSTA 3FTEA 4L3JA 3KRWA 3P5KA 2ZFUA 3T7SA 3FSKA 4JDJA 4F9YA 3DDQA 4O7SA 1Q62A 4NL0A 5C1QB 3DLSA 3PIYA 4O0XA 4RGJA 3EKNA 3NUPA 4FTOA 4XUFA 3EQPA 5E8VA 3FPQA 5B7VA 3FLNC 5I0BA 1F5QA 3QTQA 4D0WA 4RIWA 2F8LA 2ZIEA 4GOMD 4ER6A 4N57A 3VS6A 1LUFA 1DI8A 2XMYA 4YBKA 4ERKA 2H00A 1KE7A 4Q5EA 2VZ9A 5ETFA 3TTIA 3KXGA 1P4OA 3PA3A 4JBQA 4AT3A 1SG9A 2BDFA 4ALWA 4QMWA 4N6ZA 4DG0E 4KVZA 1QPEA 5ICPA 4U81A 2Y4IB 2V22A 2BVAA 4EH2A 4F7SA 1ORHA 3HA3A 4APPA 5I9UA 4IVCA 4NCTC 3QGWA 2B1PA 3BELA 3LJ2A 4MXAA 3I5NA 2BRHA 4RVLA 5BYLA 4E20A 4EJ7A 1G38A 5FWDA 2RFNA 4ZJVA 2I9KA 1F38A 3AC3A 3GU8A 3UOKA 2YCQA 2XNNA 3BKXA 3H30A 4G16A 3E87A 3CQUA 5HIDA 2H34A 4FSRA 3ZO2A 1CM8A 4I6BA 2ITNA 4HC4A 4RX5A 4DITA 2QONA 4OTGA 3C4CA 2UZVA 3BLRA 5FXSA 3FQSA 1QAQA 5HEKA 5CEIA 4ERWA 1WBVA 1R0EA 4IVAA 3KPJA 3PVCA 3KXMA 4RZVA 4EKGA 3U54A 4C06A 2P3QA 5CUQA 5EYKA 2X8IA 4L67A 4CV9A 1BOOA 5EOVA 3FHRA 3SX0A 3H0YA 5H9BA 1JG1A 1L3RE 2ZVAA 4JX3A 4BCNA 4MH7A 4ZZMA 3A99A 5D9HA 3RNIA 5CEPA 5AUTA 2VRXA 1JSVA 5K01A 2BRNA 2WIHA 3ALOA 4C3FA 2OLCA 3LMHA 3UWPA 4IX6A 4O7ZA 5M57A 4O7RA 4CVAA 2WTJA 4FUXA 3OEFX 3GC7A 1L3IA 2ESRA 4LUDA 5LMAA 3EN7A 5HLNA 3TWJA 3HYHA 5DOSA 4DHFA 4B8LA 2B25A 5CZIA 5L2SA 3VHEA 2QHNA 2OWBA 4IWOA 4XCXA 4DKJA 4LRJA 2IZRA 3LJ1A 3Q87B 4XNEA 4CKRA 4AFJA 5JH6A 1OBGA 3BWMA 3LMIA 2P35A 3R8ZA 4M97A 4A4OA 1V39A 3TKYA 4YSMA 1PKDA 4JIKA 3ZU7A 3HX4A 5GJGA 4FVPA 1W8CA 3E3BX 4Z7HA 2CJMA 3EQGA 2W4KA 3LM0A 3Q6WA 2A2AA 4BYJA 4ZXTA 4XMOA 5HU3A 1R00A 3PT9A 2C5NA 3UQGA 2BKKA 5U4XA 5HIBA 4YSJA 5LVOA 3OTVA 2VTSA 2W17A 3D2IA 4E93A 4GEKA 2JG3A 1G8AA 4NCTA 3QX2A 4UOEA 4RTSA 3BX5A 1IAJA 4M8TA 4Y85A 5LVLA 1A9UA 1WAKA 1SUIA 4DCGA 5AV1A 1XBAA 2NPQA 3ALNA 1UNHA 3AT3A 3BE9A 3HAVA 3IG7A 2RFDA 4FTAA 3R7YA 4NFNA 4C3RA 3FPJA 4NM0A 4L7VA 3R7OA 3TUBA 3RPSA 1X1AA 3DKGA 3LMGA 3MFTA 4BDJA 4BZOA 4XG3A 3AY0A 4BLVA 3OU7A 1W84A 2ITVA 5CXHA 5HE3A 4C4GA 4K2RA 3CBLA 4LG4A 3UTOA 2PUIA 1KP9A 2PSSA 4ALVA 3A4PA 4OT5A 3UC4A 5M55A 2OZAB 1RJEA 1Y8GA 2I6GA 5P8WA 3ATSA 3F3VA 4EQCA 1H25A 4XV1A 5AUYA 3U9NA 3ID6C 2W1GA 4RIWB 4C04A 2IN6A 1Y8CA 2ZWAA 4EH4A 1T46A 4LV8A 4PWYA 1O6YA 3I6WA 4AOIA 3PYYA 3ELDA 4RSSA 3BXOA 4RZWA 1FP1D 4BF2A 2KTYA 3QC4A 2UW7A 3BU5A 4XG4A 2W1EA 1VR2A 3RMFA 5FXQA 3WZUA 3G88A 3IDBA 3ORLA 3IW5A 4QDKA 4PNEA 4RVKA 2QM3A 2VWUA 5DTMA 2C5YA 1L3BA 2PHKA 3FQHA 4I92A 5C1IA 4B17A 4DTAA 5IMXA 5LVMA 3F3WA 3S1HA 1TQMA 3TI1A 3S00A 4KIFA 4FMQA 4KIOA 3QXPA 3UPZA 2ITOA 5HG5A 5JZNA 3UP2A 3CPCA 4K8AA 4F0GA 1NXKA 3D5WA 4L9IA 4O38A 4OTIA 3DR5A 2ERKA 3QZGA 4V05A 3NLBA 4WO5A 4EKIA 5AP6A 1Q0TA 4BIBA 4J53A 5TR6A 2DYLA 4G3GA 4NT4A 3R7UA 3TN8A 3P79A 1PMNA 4XH6A 2OJGA 3PXFA 2PVNA 3MSSA 3OUNB 4ACMA 4IADA 3OW4A 3SC1A 4YPSA 5L8LA 4KWPA 5E91A 3UZTA 4M15A 2ESMA 5HBJA 3OMVA 5JKGA 3KQWA 3AMAA 5ICFA 4YC6A 5IQIA 5BQ0A 4L46A 3TM0A 5HE1A 3UVPA 5IQDA 3CGFA 4KIQA 4LL5A 4ALUA 1XHAA 4UYNA 1KHHA 3U8WA 3ULIA 1MQBA 2WGJA 2C6KA 4XUEA 1ZWSA 1KV1A 4PY1A 4EZ5A 2VTPA 3SVVA 3BKWA 3SSOA 1LPUA 4C4FA 2VS1A 2GA9A 5HD4A 3NWBA 3E8CA 3QLFA 4PNKA 5L6PA 1JG2A 4LMNA 4FKPA 1RJGA 1DUSA 4AW1A 2XKDA 5DM4A 2XA4A 2AOTB 3VUGA 1X1DA 2V74B 3CSVA 3F2AA 3HUBA 3K54A 1F0QA 4RQVA 3QF9A 3Q2MA 3GXOA 5H8EA 3VSEA 2DWBA 1FOTA 5CEQA 4ZS0A 4EYMA 4CSVA 1YOJA 4ZTSA 3A7IA 1XH7A 2QHMA 2AVNA 3FYKX 5GWXA 3Q4CA 3A7GA 5EI6A 3QU0A 3BGDA 4FOCA 5EHGA 3Q9YA 3C50A 3PRIA 3F2NA 2QOHA 3QCQA 5H3QA 1IM8A 4O91A 3V3VA 4AE9A 2P41A 5K05A 3SSNA 5A9UA 2OBFA 3KXNA 5EPEA 4KDRA 5A4TA 2PZYA 2C6TA 4MXZA 4QTBA 3HCCA 3KCKA 2HWKA 3QYZA 5AP5A 4MBJA 2C47A 2ZOQA 2ZYBA 4TNBA 5IQAA 5CANA 3T0IA 3T3VA 5E4HA 3ZBFA 3W2SA 1Y6BA 5KMJA 4RVFA 1SQFA 3EQFA 4CFUA 5B2KA 4P7KA 1X1BA 4P7FA 4YLKA 4ZTHA 5IKMA 4IH8A 3VNTA 4QRCA 3ZUVA 4KDCA 1YDRE 3GCUA 4RWKA 2IZTA 3KGAA 4K6MA 4IX5A 5CALA 4U3YA 3KU2A 3VIDA 3EEOA 5ANJA 5B1SA 3ENHA 3BHTA 3KQMA 3NUSA 1ZAOA 4ZY5A 4WRGA 4FI1A 2P7HA 5JEBA 3QQUA 4YJTA 2VDUE 2OO8X 4HCUA 2I7CA 4P7EA 2G15A 1OPJA 3DY7A 5HIJA 3I79A 5JK3A 4QMSA 4EH9A 3C0HA 4R8RA 3TKAA 4FOBA 1ZYSA 4FZVA 4GV1A 3HAMA 3QWJA 3EFKA 3QQJA 4KIGA 3NW7A 2X4ZA 1BI7A 3IW8A 1AD5A 4BCFA 2YWPA 4JAIA 4AN9A 2I40A 5EEHA 5DYJA 1N7IA 4TYEA 5IH5A 2VTNA 3MDYA 2QODA 2W1DA 3FL5A 1Q5KA 5CXZA 1FVRA 1I1NA 2E9VA 2UVXA 2WQNA 4KAOA 3A4TA 1PHKA 1N2XA 1VBFA 1J7IA 4H0NA 5C03A 1P2AA 3OUKA 2IG7A 4ENXA 4K1BA 4AOTA 4GK4A 5KNJA 4XBUA 3FMJA 4OA8A 2BTRA 2Y6OA 3NZ0A 3C4XA 3FZ1A 4IM2A 4QQ5A 2GHGA 4C0TA 2HZIA 5EW9A 3EN4A 3PRFA 4D1SA 5IDPA 5K5XA 5AUZA 3BGVA 1P5EA 3POOA 4BDCA 3ZO4A 3UOLA 4EBWA 4JXJA 2QOCA 3NW5A 3CGGA 5HE2A 3TKHA 3B3FA 3SOAA 3UQCA 1OKYA 3W18A 3OFMA 1T43A 1ORIA 4OTQA 2UYQA 2C7RA 1GJOA 2BKZA 2PMIA 1FJXA 4DMGA 3HDMA 3N9XA 4MK0A 5DXJA 4FICA 4BI0A 2NXJA 2JITA 2XJ0A 3V5TA 3ZRKA 5CYIA 4AZFA 3MJ2A 1M6EX 3DOGA 4MEDA 4EH5A 3IHTA 3IW6A 3R7IA 4J7BA 5FTOA 3FXXA 3VHKA 1H1WA 2BAJA 2VWIA 2JDVA 3UP7A 4FG9A 3S0OA 4FT4A 5EYMA 5KMKA 2B55A 3KQSA 2B4SB 3B2WA 3L8XA 4BP1A 4GUAA 3QUEA 2BHEA 3AC1A 5C8NA 5EDPA 3VBQA 3HM2A 5BX0A 1PXOA 1YQJA 1OKVA 2UZUE 3QTRA 4K18A 5L3AA 5ANOA 1STCE 3LQ3A 3GGFA 5C4KA 2OY0A 3PJ8A 1Q8WA 3HVIA 4EK8A 4FR4A 2PULA 4RT7A 2FK8A 5CVFA 4QQTA 2VP3A 3KR0A 2WTVA 4BLWA 4OT6A 2JHAA 1WVWA 5JUWA 4W4WA 3BBWA 4FEQA 4M0YA 4X21A 5A46A 5LMBA 4ZJJA 2QI8A 1EH4A 3EEYA 3QYWA 5F4NA 3NYOA 5B2LA 4K33A 4GFOA 2YXEA 2VX0A 3R8PA 4M36A 3VULA 2RL5A 2Y0AA 4XG2A 5TT7A 2JIUA 4O21A 2HR1A 4IBMA 3EL7A 1RE8A 1JR4A 3VRZA 2YVLA 3G15A 4AUAA 5HG7A 1SUSA 5H8BA 1K9AA 2NXCA 1W82A 4FSYA 4MWZA 4I5HA 5HVJA 3ROYA 5H2UA 4D5HA 2IVUA 5I9VA 2Y1WA 2XYQA 4GVAA 2W4JA 4BP3A 1YXTA 1YVJA 4PYOA 3QQKA 2B54A 3BV2A 2JDOA 2JHPA 3Q53A 4MTLA 3C1XA 4G6NA 1NW5A 5K0CA 4JG8A 4YTHA 5DE2A 5DVRA 4TT7A 4BBMA 5HFJA 3AXWA 4WA9A 3VBXA 3EOCA 3GENA 2OJJA 3KF4A 4KINA 3VO3A 4RJ6A 1VLMA 5KHXA 4JRNA 5DG5A 4L44A 4PMPA 4PMMA 2C6LA 3LLTA 3UJ9A 2HXQA 3O2MA 4JDIA 3R9OA 3C3PA 3R6XA 4FT0A 5JFVA 1BC5A 2YTZA 4GEOA 2Y4IC 2ONLC 3PIZA 5EDQA 1R3CA 1H4LA 3BQCA 3PY0A 4U43A 3MTFA 4J1RA 3WF5A 4ASZA 4GYIA 4YTFA 4GUEA 5DT0A 5AP3A 5IA3A 2QR7A 2WMRA 2XJ2A 2Z2WA 3DJ5A 3NUAA 5DIAA 3W8QA 4PIMA 1OUKA 4A06A 4OBPA 4P7JA 4P58A 2WQEA 4ZIMA 4O86A 3UC3A 4GMYA 1XQZA 5E1EA 4E7WA 4A7CA 2AOTA 2RGPA 3F6XA 3FRHA 1AQ1A 3CTHA 3CXWA 3DP7A 5FUBA 2GH1A 2EX4A 5HGIA 4EONA 2IW9A 3OEZA 4CXAA 4F6SA 5KQRA 3CJFA 4GS6A 4ZY6A 1ZGAA 4AN2A 4KKGA 3LFSA 3QWKA 3DK3A 3ERKA 3HNRA 4EWQA 2XKCA 5KZIA 2PY6A 2BTSA 4FS8A 3WILA 2J9MA 5DLSA 5HICA 3A25A 2JIIA 3BE2A 3LFQA 3WZKA 3GU5A 5TOZA 3UNJA 4HGEA 2XBMA 2P2IA 1NV9A 4YV0A 2QRVB 4D4VA 3RI1A 1KSWA 4JS8A 4RBLA 3QQFA 4DH3A 3W2RA 3G2PA 1B6CB 5EI2A 3RM6A 4EKKA 3B5IA 3W10A 3FZGA 4B9DA 2XP2A 1TQIA 4MD9E 2HY81 1KUTA 1BUHA 3L1SA 1IA9A 4PWNA 3NWEA 3Q7EA 1W7HA 3NGAA 3ELUA 2J90A 3Q60A 3M6UA 3SKCA 3PPJA 3S4QA 3MQ2A 4FK3A 2XUUA 3FUUA 2EB2A 4WD5A 3FE3A 2C3JA 4FV7A 5C8KA 1NBHA 4C62A 3NMUF 3FZOA 3PG1A 2ITPA 8MHTA 4OR5A 4OQDA 2ONYA 3TCPA 1BI8A 4I41A 4PDSA 5IUIA 1PXIA 2O65A 5IQCA 3AXSA 4BI2A 2GNIA 3MPAA 4GG5A 3IONA 2G1PA 2VO0A 1Y6AA 4A4XA 1FINA 1UV5A 1YKRA 5FEDA 4JQEA 4E73A 3OS3A 4C61A 4ZTQA 2J0IA 3CS9A 3Q4ZA 5LJJA 1WZYA 3KY2A 3LXPA 4XP3A 3IS5A 4P7GA 3R04A 2WMVA 3V97A 2GQSA 3OOMA 4GKIA 3FRIA 3UA3A 4GK3A 2YXLA 3WF9A 2O07A 4DEBA 4YUVA 4GT5A 3BU3A 1OL1A 4QQNA 2ZWVA 3LFEA 5T67A 1SKMA 4NM7A 2BCJA 3U4UA 1QMZA 3WE4A 4QMNA 3DMFA 3QZFA 4G3FA 3MGGA 5D12A 2O63A 3NYXA 4E5WA 3I9FA 4QPNA 4QMZA 5K0EA 5FTWA 2PZIA 3QTUA 4CLJA 3TT0A 5FG8A 4PCLA 4ENYA 3EL8A 4ZTBA 5EQEA 1MRUA 3R63A 3W55A 2IW6A 4MTAA 3NX8A 2NXEA 4DH8A 3G90X 4X6QC 2RG6A 5LQKA 4RC4A 3EB0A 2EB3A 1FBNA 3DQXA 4JL9A 3PA4A 4S2ZA 5FD2A 4RWZA 4A6DA 3NVMB 3UOHA 3L8SA 5KKRC 5MHTA 2VTIA 4XG9A 3KR1A 3HMMA 4DTBA 3F7WA 4ANBA 4BDBA 1YXSA 3COHA 4M14A 3C0GA 2HV9A 1NV8A 1D2HA 3BGPA 3DDPA 3I7BA 2X2LA 3F3UA 3A8XA 3LCOA 5CENA 5D1NA 4FTUA 4YJQA 4LWOA 3R9XB 4NM3A 5EHYA 2UYCA 3NYNA 3KVXA 5D10A 5DM1A 2ZV8A 2C7OA 3FTFA 3ODYX 4GCJA 5CLPA 3HMIA 1ZYDA 3G8AA 3JWJA 3LW0A 5F9EA 1OIUA 3SXFA 3D7TA 4HTFB 1WBOA 2QKWB 4R5YA 3LFFA 1LP4A 2WU7A 4EOIA 4FTNA 3IDCA 4PGGA 2PVRA 3BWJA 3RAIA 3PSBA 4FKIA 3KQVA 2VO3A 4RVHA 2P3LA 4RTRA 3V8WA 4F70A 4ITIA 1Q4LA 4L00A 4QYFA 3ZXZA 3AG9A 4FEUA 2ZCJA 2W5HA 5FM3A 2XK6A 1UU8A 3OWKA 3VBYA 5KMNA 5KMMA 4FKLA 3UJ6A 4RTQA 4IWDA 4IM0A 4YZCA 4PYNA 2PZRA 3VS7A 2IZUA 3IPHA 3VVHA 3V8TA 3DPKA 4FSTA 3HTXA 2W9FB 3CD3A 4U44A 4DH5A 3OFKA 4U6RA 3GBZA 1QCFA 4I5PA 1WCCA 3G8BA 2PVJA 3HUCA 5JSMA 2UZLA 4K0YA 5ETCA 4F64A 2QQ7A 4C02A 4DBNA 5EG5A 2G8NA 3BPRA 2O05A 3Q32A 3IECA 3K0BA 3FJQE 4XG6A 4BZDA 4XUDA 2CNUA 1J3HA 1VEBA 1YHSA 4UEUA 5CF6A 2J6MA 4RJ5A 2VDWA 1NT2A 4XX9A 4G17A 4AT5A 4DZRA 5E8UA 2ZDTA 1NW6A 4DEIA 2QU6A 5AV3A 3ZH8A 3QV2A 2V7OA 3MH3A 5AX9A 2O57A 3ERCA 4GK2A 1QPDA 4F65A 4RA4A 3QFVA 4FV4A 3MIAA 1PKGA 2B53A 2IP2A 5KKRB 3THSA 3GC9A 3ZSGA 2J5EA 3H4JA 2BDJA 3K3JA 4E2YA 3G2FA 3NNXA 3AC8A 2C6EA 4XP2A 3EGEA 4FGZA 1TVOA 2VZ6A 3A4OX 4BCQA 3UMXA 4UN0C 5LMKC 4FL1A 3LQ8A 3V5JA 3PXKA 4CTKA 3KCFA 2XVDA 2P0CA 3ORPA 3NCZA 3ELWA 3MH2A 1RI5A 3D2LA 5E8WA 2ZTHA 5EIWA 5BYZA 3G9NA 4U9AA 3VF8A 1I44A 3P9KA 4PIPA 5CZHA 1VYWA 2UVZA 2AVDA 5EI8A 5G02A 5BNJA 4MXOA 4YHFA 1JOWB 4AACA 5FP5A 1X1CA 3POZA 3DTCA 4IX3A 2DUVA 2GNGA 2P2HA 3R73A 4Z7GA 3O7LD 5HU9A 1SVHA 2IVVA 2VGPA 5EYDA 2WIPA 3FKOA 3GCPA 4L8MA 5LWMA 5GJFA 2PX8A 4O0YA 4KW7A 4AGCA 2GAFA 3EQHA 3QTXA 3EMBA 1J1CA 3GDHA 4X3FB 1DAYA 3MW1A 3MA3A 1H0WA 4XCUA 2OFVA 4FTCA 1DL5A 2QOQA 3QC9A 2OXDA 4PV0A 1BL7A 1CMKE 2PWLA 4L52A 2QO2A 3RAWA 3VRYA 3I53A 3D4QA 3P2KA 5DSXA 1DM2A 3MPMA 1DAWA 1KPIA 2JDTA 2C1AA 4G5PA 4UALA 3HA6A 4WG3A 3LCCA 3F7ZA 3MVMA 4LOQA 4TNDA 2GNLA 3EQRA 3E8DA 4X7QA 1KOAA 3C5IA 4A9UA 4CZUA 4ZLZA 3R21A 3FV8A 3RALA 3PUPA 5AIKA 3WF7A 1E9HA 3FKLA 4QMOA 3MESA 5ANDA 2H8HA 4X2NA 3HCDA 2PK9A 5CAOA 3SHEA 4JIAA 1JQ3A 4LOOA 4ZOGA 5L6WL 3SGCA 5FQDC 5K3YA 2F57A 2ITWA 5FBOA 1N7JA 2PV0A 4FE2A 4TYHA 5LVNA 4KWCA 3IKAA 3MI9A 2PMOX 1XH9A 3EN9A 4TWOA 3Q4UA 3DFAA 3P08A 4UWCA 4E5BA 1WVYA 2ZV2A 3BQRA 3U4WA 2VTHA 4XLIA 3W8LA 2R3LA 3R1YA 4CT1A 3BWYA 4FV8A 1L9KA 2OF2A 3D7TB 4HGYA 4HTFA 5EEGA 2ITTA 3BYSA 2XIZA 3RWPA 3ZM9A 1ERKA 2W0JA 4TZRA 1APME 4CT2A 5A6OA 2CKQA 2E2BA 3PFHA 2HYYA 2Y4PA 5HBEA 2AN5A 2I62A 2VUWA 3SV0A 3K5VA 3RWQA 4RV9A 4U0IA 2R4BA 3U9CA 4Y30A 3TMAA 2AN3A 1F3MC 3FZSA 3OG7A 3RODA 5FBNC 2UW5A 2WNTA 3HMNA 4AW2A 4CKIA 4O81A 4ZS4A 2NP8A 2C7PA 4HH4A 4C2WA 4HNFA 2C5XA 4F7NA 2ETKA 3CKKA 3ROCA 4EJNA 1NVRA 4C07A 4WKQA 4RWJA 3AXTA 1M14A 2BRBA 2CDZA 2WB8A 2Y9QA 5KBRA 3RPRA 3M33A 2CGWA 4RSRA 2QO9A 5L6OA 5E9WA 2W1ZA 3DB8A 5F95A 4JG7A 1OL5A 2B9IA 2XCKA 1UKHA 4F1TA 2PLWA 4HRAA 2CGUA 2PVMA 3OWJA 2H96A 5A4EA 3QGYA 4D28A 2OIBA 2G1TA 2JDSA 4YJVA 4BCGA 3SW4A 4FIGA 3V51A 2OU7A 3R00A 3UIUA 1NW7A 2P4IA 3HVHA 3TM4A 1NVSA 3EGIA 5LCJA 4UXQA 1UKIA 2BMCA 2G2IA 2GHMA 3MBLA 4YTIA 4U7PB 2GS7A 3AQVA 1BKXA 1QPCA 2UV2A 5IQFA 3DXZA 4J8MA 3ORXA 3LDFA 2OI4X 3RCDA 2O8YA 1R8YA 3UFBA 4QP8A 2OH4A 1ZRZA 3QL8A 3O4FA 4AAAA 3TACA 5ETIA 1XDSA 4X3JA 4UWYA 4FKGA 2B0QA 5DNRA 5J5SA 5FULA 2F7ZE 2HIWA 2W1IA 3W1FA 3HRFA 5F2OA 2GNHA 2LGCA 5DPVA 3FI3A 1W0XC 3EQIA 3U6JA 2HENA 2HOGA 3F4KA 4EQZA 2GS9A 2WMXA 5M56A 2OXXA 3G5LA 4ISCA 1TQPA 4UYAA 2E9UA 3ZCLA 3ORHA 4NJ3A 3UJDA 3SRVB 4ACCA 5CF8A 4F7LA 2YZLA 2Y1XA 4AZWA 4BBEA 1EG2A 4DA4A 4QTDA 4CQEA 3AGMA 3EQCA 4DEHA 3VJNA 1VP3A 3A61A 4USDA 1D2GA 3S95A 1X19A 5K0LA 3QQLA 4FTMA 3WE8A 3LECA 4FC0A 4X2GA 4N6YA 4CG9A 2WFYA 5DM0A 4DF3A 3DAEA 1OL6A 1HCKA 2AR0A 3KHKA 2FK7A 2X7FA 3MFUA 4O6LA 4USEA 2FGIA 3UO4A 5CX9A 4AGWA 4IV8A 3PTAA 5EK7A 4FEVA 5EM8A 5GP1A 3I0OA 1ZARA 3MVHA 3KF7A 5AUXA 1SYKA 3ZLYA 3GRZA 1TW3A 4C4EA 1M0EA 2R3FA 4WXHA 3T7RA 3B8QA 3SDJA 2RF9A 5E8RA 3DBFA 4ZY4A 5LMKA 3BBTB 3E93A 3Q04A 5F2KA 4A9YA 3HV4A 4ZTRA 5A14A 4S33A 3JVRA 3PJ3A 4L6QA 2RG5A 2W1FA 2YFXA 3QRUA 3G89A 5HG8A 1JWHA 4CLIA 5CSWA 5HZNA 2IJMA 2OF4A 2C3IB 3HA8A 4C36A 2PVFA 3AD5A 5JQ8A 5EFQA 2J5FA 4L42A 1YUBA 4OX9Y 4E32A 3P4KA 1Z3CA 4JXFA 5CSVA 4IIRA 4ORKA 1O54A 5DEWA 5LR6A 5BUJA 2E5WA 4QQJA 1X8BA 5CVGA 2F9GA 2PZ5A 3COIA 3T3UA 3QHRA 3ZRLA 3WSTA 5D1HA 4B99A 4C34A 4D2SA 4YJNA 3RJCA 3PSCA 2C0OA 4BCPA 5A6NA 5K9IA 5BUEA 4NW5A 1WFCA 3HRCA 5KMOA 1OPLA 2XJ1A 2Z60A 3ACKA 4FIIA 3EVBA 4YC8A 1H07A 5M51A 4GW8A 3RP9A 4OGRA 4U97A 2PL0A 3THBA 2BHHA 2BR3A 2R7IA 3FI2A 3O0GA 4U79A 3A7FA 4KNBA 4BDAA 3D83A 2BZHB 2QCSA 2PY3A 3H0ZA 4O82A 3TDVA 5HX6A 3DUWA 4O7LA 5DTQA 5HORA 5EMJA 2WMSA 2W7XA 2XNOA 2AUHA 4K6ZA 1NBIA 1R8XA 4IB5A 3JR1A 2O06A 5FEQA 2CN5A 5HHWA 2YM7A 4D5KA 3OBJA 5AUVA 1XH4A 3C7QA 4YO6A 1YZHA 5EKOA 5FRIA 4HVDA 1CKJA 2IW8A 3B3JA 7MHTA 4BY9E 2UW4A 3VS0A 5BVFA 5EMLA 3UZPA 3MCZA 4K11A 1SM2A 4FVQA 1ZOEA 3BCEA 3NDIA 3IGGA 5IQHA 4AZVA 5DLYA 4EK9A 2PVKA 3JY9A 1KYWA 2JGZA 2PYWA 4DAWA 4FG7A 5HD7A 2BM9A 4ER5A 2B7AA 2WU6A 4HCTA 4O96A 3L9NA 4RLLA 5JMSA 3LPBA 4NUSA 2ITQA 5J9ZA 3CJRA 3UYSA 3H3CA 4J98A 2XYVA 4ACGA 5I4NA 3CTJA 2BZKB 4LFIA 4PDOA 4E6DA 2VTAA 4C33A 3TV6A 3T9TA 2WAJA 5HBHA 3QXOA 2HW7A 5E92A 2FYSA 4UB7A 3RCJA 4QTTB 1ZMWA 5A54A 4NKSA 4A07A 2GS6A 2R0IA 4FTKA 4O7NA 5AP2A 2LAVA 2OZAA 4X61A 3CGOA 3JPVA 3R01A 4PX6A 4QPAA 4CKEA 2PMLX 4EUTA 3SXJA 4FV3A 1MP8A 4NECA 1SZMA 3MB7A 3OCGA 2Y7JA 3W32A 4BCMA 3DXXA 4EUUA 4LUEA 2IDKA 5CVEA 2JAMA 3TDWA 1Q8YA 5HLWA 4QO9A 3CIKA 5K0FA 3W2CA 2C69A 4YU2A 2VWBA 4QT1A 5AMNA 4X2JA 3K6RA 2IFTA 2UUEA 1M2QA 4JQ8A 3C9WA 4ANMA 4BCOA 5HTCA 2PXAA 5DTRA 2YDJA 5BMMA 3VS2A 3OROA 3OCJA 3P71T 5AV0A 2X0GA 4I6QA 1H01A 5H8GA 4BTFA 3SMQA 1OKWA 3FY2A 4EK6A 1ZG3A 4XUCA 3ER9A 1H1PA 2YM5A 2VTRA 2ITZA 4DCMA 3V6RA 3MY1A 4IJPA 2QO7A 4JI9A 4Y8DA 4FKQA 4I0TA 3R9HA 2W99B 4KKHA 4WBBB 3FSFA 2WA1A 3GRVA 4WVLA 3UOJA 3P97A 5DX8A 3W2PA 2WEIA 4DH7A 3Q5ZA 2A14A 3FPMA 3BEGA 3KRXA 3R7EA 2C3LA 4BDDA 5A3XA 3UVRA 1XR1A 1F3LA 2PBFA 3GJYA 3OZ6A 4W4VA 3OW3A 4EOMA 5GHVA 4XG7A 10MHA 2HCKA 2WXVA 2NXNA 4CFWA 3G33A 4FA2A 3FLZA 4AU8A 3F5PA 4IB3A 3Q3BA 4V01A 3E8SA 1XTPA 4I4FA 2ZMCA 4UV0A 1KE5A 3LHJA 4C38A 3PXZA 3KULA 4F09A 5EZQA 4BCIA 3VS3A 2IDJA 4XBRA 3UJBA 2VV9A 3FWQA 3C51A 4JLCA 4KKEA 3WYYA 1R18A 4DCAA 4FSXA 3E7PA 2H9VA 3D5UA 2DPMA 3M70A 3QUDA 4PUZA 4XOZA 4YJRA 2WMQA 3PJ1A 2Z7QA 3NDMA 3PWYA 3ZTXA 2CNQA 4IZAA 3GFWA 5ICGA 1VIDA 3DXYA 3RINA 3BIZA 3TNPC 2HELA 2QU5A 4DFLA 3JWHA 4GQBA 2WTDA 4P2KA 4X2FA 3DJ7A 1O6LA 1YI6A 3VC1A 3LL7A 4KB8A 3OE4A 3FI8A 5HZMA 1H8FA 4RC3A 4A9RA 3ZFXA 5HCZA 3CQWA 4FX3A 2I0EA 2R3HA 3E88A 4JX7A 4TRLA 2YCSA 1LEWA 1R78A 4U5JA 4QYGA 2CWWA 2YIRA 4N70A 5C01A 2GDOA 1H1QA 3CJGA 5KE0A 3DZOA 3NVKI 5CVVA 5HNGA 1VQ1A 3UIMA 5BVDA 2OZOA 4QYEA 3HV6A 4DG3E 4ZTLA 1NY3A 4Y5QA 5DR9A 4F08A 3AJDA 1H26A 1ZOGA 3GT8A 4EYJA 3MGYA 2VNWA 3TG1A 4ACDA 1WXXA 3EFWA 3VYWA 3PB3A 4GOLD 3QALE 3P0MA 3Q4TA 5G1XA 4QNYA 3HEMA 2J50A 1YFLA 2CKOA 4RJ4A 2JJQA 3PS9A 4NTTA 3BEAA 3FL4A 3L8PA 4APCA 4ZAUA 5M07A 4FKUA 5FTQA 3UNZA 3DT1A 4YTCA 3B7PA 3MHTA 2EG5A 3R22A 2YX1A 3DV3A 5CIYA 3IK3A 2J51A 2EU9A 1FP2A 1H1RA 3FLYA 3Q2JA 4HJOA 4XV9A 3DBQA 5IH3A 3H9RA 4RFMA 1MJFA 4CKJA 1FQ1B 4GVJA 2XKFA 5IUGA 4DEEA 2R3IA 5IUHA 3EPPA 3M6XA 4FNWA 4BRXA 4ZSLA 1DS5A 3FMLA 1KE6A 1JSXA 4DQ0A 2IO6A 2YISA 4B4LA 4V0RA 1NW3A 3CE3A 2G2FA 1IG1A 3O71A 3FC2A 3JUHA 3KXHA 2VX3A 4J99A 4M12A 3DK6A 4NWMA 4DBXA 2ZBRA 1NW1A 4FBXA 4IZ7A 5H02A 4HVGA 3SLSA 3TLJA 3P7BA 4FSQA 3E62A 2BZGA 4FT3A 3IOKA 4YUQA 5ACBC 2I0HA 3DQWA 3SXRA 1WBPA 3QD4A 4BIDA 3OD6X 4XLVA 4CMTA 4DG2E 3D5VA 4FT9A 4H1JA 4RVTA 2OJIA 3R8VA 1ZY4A 4ANQA 4OTRA 5FEEA 5J8IA 3I5UA 2OGVA 4BTKA 2GNJA 1Q3WA 5HO8A 4D9UA 4TL0A 3SQQA 3LX6A 3II5A 3KR2A 5CS6A 2JKKA 4LRMA 3G5DA 3L8DA 2XYUA 4LGHA 1KWPA 3ZZEA 3SSMA 2WKMA 3HMPA 3K3IA 4GJ2A 3E3PA 4G56A 1FMOE 2I1MA 4KABA 3OU6A 4IV0A 1YRPA 2R2PA 3I7CA 4HZRA 1GIHA 4MX9A 2WTWA 3SXSA 1RJFA 2YM6A 3PPZA 5CU6A 4BHNA 5JGDA 5L2WA 1H24A 1WBTA 2WMAA 4KBCA 5FP6A 3LDUA 2AC3A 3L9MA 3NNWA 3AOXA 4RVMA 5CVHA 3VW8A 3KVWA 4PYIA 1V0BA 2RFEA 3PSDA 3KQYA 4GF5A 4ER0A 4JR7A 3DH0A 4FZDB 3UIBA 1JNKA 1MUOA 3HZTA 3PP0A 2R3OA 5IDNA 2Q0NA 1MRYA 3LXLA 4DLIA 4GRBA 3BHUA 3U81A 1HCLA 5EW8A 3GU6A 5BUIA 2QOBA 5LQFA 4PTCA 5I9XA 3TUDA 1O9UA 2VTOA 3EMGA 4KIPA 2JBPA 4JR3A 2VWZA 4RA5A 1PJZA 3VQHA 2BDWA 2O3PA 4IDVA 5HEZA 2EJTA 5JR3A 5DWRA 1REJA 3ORZA 4TYGA 2C3KA 3U51A 2ZBQA 3GU4A 3OP5A 5E2AA 2V0DA 5JFXA 4AA0A 3MB5A 5DRDA 4EHVA 3CVOA 5HNIX 2NP6A 2OYRA 2IWIA 2B52A 2HWOA 2ZAZA 3ZZWA 1SVEA 2O0UA 2XNPA 3EN5A 3E23A 3PXQA 3FAAA 2YN8A 1B38A 3NYVA 3FMMA 2XF0A 4O7VA 4AG8A 2NRYA 2YM8A 2CNVA 3R71A 2IVTA 3DGKA 3HL7A 4E30A 4AF3A 1QL6A 5LCKA 5HTBA 3V5WA 1DI9A 5CASA 1L3CA 3LXKA 4L3PA 3UMWA 2EWAA 4FV2A 4R3PA 3RPYA 3TV7A 3RVGA 2P8JA 3RHKA 4RVDA 3MERA 3UA4A 4DLJA 3OHTA 4I94A 5BYYA 3PVBA 4DFYA 3F3TA 4UXLA 3A7DA 2X6DA 2WMWA 5EHIA 3Q6UA 5AUUA 2NNWB 4I93A 3LIJA 3TZMA 3UGCA 4AGDA 4PONA 3M42A 1G8SA 5GM2A 3I6UA 1W98A 5FLFA 1VYZA 4YV2A 1G60A 3IW7A 2ZLBA 4PDPA 4K77A 5CEKA 4JVGA 2CHLA 1FGKA 4AE6A 1KR5A 4YNEA 3LZBA 1OGUA 3ZRMA 4OUCA 4YZBA 4NJDA 1L8TA 3GU3A 4L7SA 2CCIA 5D7VA 2G72A 4Z2YA 2PTKA 4WRSA 4JT3A 5AA8A 4QDJA 4U45A 4E4NA 2WTIA 2JEDA 4RX7A 4GC5A 4F86A 4MD8E 3PJ2A 2CMHA 3KPVA 5LXMA 2CGXA 4I5CA 1IAHA 4F7JA 3R8MA 3B89A 3NCGA 3M11A 4O0RA 5CU2A 3ORNA 3VWAA 4BYIA 5CAPA 4LECA 4YUYA 3QZHA 3P9JA 3LBFA 3ZLXA 3O31A 5AP0A 3TJCA 1PF8A 4EZ3A 4Z55A 5T64A 2XNGA 5AM6A 4PCAA 4QMXA 3S2PA 3LXNA 4F1OA 5G6VA 4GJ3A 5KZ0A 2REIA 1R39A 2UZWE 3P78A 3PA5A 4DN5A 5HESA 3BGQA 4QMLA 4RIXB 4ZTNA 3R8LA 9MHTA 4CCBA 2UZNA 2OKCA 4LRKA 5A4CA 5LQUA 1OPKA 3ET7A 3FBVA 3ZO1A 3TNWA 2OIQA 4FL2A 5ANGA 5ANIA 3PLSA 5E9JA 3OF0A 4YZDA 4GOND 3IW4A 4QMVA 4FKOA 4PF4A 1YWNA 5LQNA 2EXCX 2DULA 3U87A 3MTLA 4G1WA 4FSWA 4IWQA 4DE4A 2H1RA 2WMTA 3W2QA 3T8OA 2C68A 3P2IA 3GUBA 4IWPA 1ZGJA 1U4DA 5BXYA 1VE3A 3WZDA 3O8UA 4XHKB 5CF4A 3PWDA 3IQ7A 3G0FA 4FG8A 4MNEB 3UVQA 2G71A 2HK5A 3VBVA 1PMEA 3UJCA 5K5NA 5CNOA 1XBBA 3JY0A 2DS1A 4NYEA 4PDYA 4EQUA 5M44A 4RTOA 5LQJA 4E2XA 5E90A 3RAKA 1R6AA 2HNKA 1GY3A 3F9NA 1Y8YA 2O2UA 3V5QA 5BVOA 3MPTA 4CKCA 5J95A 5GJDA 2E9OA 2BRMA 4E6QA 3ZO3A 1PXKA 5IPJA 3HP7A 3F5XA 5IA1A 3LCKA 2JH9A 2J0KA 3ULZA 5CQWA 1RI4A 2XVMA 3GRUA 3HV7A 2PX5A 2FH9A 2WEVA 2YQZA 5KBQA 4G2FA 1KV2A 2IPXA 3CP9A 3I0QA 4TYJA 3WZEA 2HWPA 3EVZA 1ZMVA 3Q9XA 4YHJA 4X6RA 3RHXA 3FUVA 4JBVA 4EOPA 4F84A 2FYTA 2XIKA 3HRBA 3OFJA 2ADMA 3I60A 1TKIA 3DNDA 1OMWA 3IOPA 1JPAA 1B42A 5DT4A 2ZM4A 3R1QA 4UZDA 4L3LA 5C8MA 4O2PA 4EHEA 2B2CA 2BZIB 3P9NA 3OXZA 1UWVA 3QA0A 5T3QA 2N47A 2R3SA 3FUPA 4KRGA 2Z6QA 1JG3A 3AT2A 1Z5MA 4E2ZA 3FPFA 2R3JA 3QAME 4FZAB 3WOWA 4HG2A 2PMNX 5ANKA 2X1NA 3ZDIA 5CEOA 2W1HA 2PXCA 4YV1A 3KR9A 3TFWA 5BP7A 2XS0A 3PE1A 3MCTA 2R3GA 4IFGA 3B2TA 5C9CA 3R9DA 2QOIA 3EGVA 5CY3A 4FT2A 3BGZA 5T6BA 4P5ZA 3T9IA 2A19B 4CG8A 1Q8TA 2JKQA 3DU8A 5E7RA 4AQCA 5CD1A 4YNOA 2VNYA 4WOVA 4UBAA 3SR4A 2YM3A 4IWNA 1R0PA 4EOSA 4Q9SA 4L45A 3IYLW 3M6WA 3PJCA 4IZYA 2OZVA 1SVGA 3LKMA 4FKRA 5IQGA 4I22A 4NW6A 3W16A 4CFVA 2YITA 1JKLA 4F9AA 4NH1A 5I9ZA 3BUSA 1O6KA 5DPMA 5BVEA 2UYHA 2VU3A 4F1MA 4PINA 5CU4A 4M68A 3KULB 4EC8A 4PYLA 4O27B 2YACA 2VO7A 3NS9A 4LV5A 1NKVA 2CLXA 3P1AA 3F5UA 4Y5HA 1SNUA 4BDHA 3D7ZA 3CY2A 1XH5A 3PXRA 4XG8A 5DEYA 2OB2A 2QR8A 4FT5A 4JDKA 3PXYA 3C0KA 2XKEA 4H3PA 4GFGA 3QLGA 4RIYA 4C2VA 2BPMA 2XIXA 3GC0A 3ELYA 1E1XA 2OSCA 4JBPA 4U40A 3O8TA 3BWBA 3O51A 4PYMA 2XRWA 5IA0A 5EIFA 2Z6UA 4PYKA 1PY5A 3UZRA 4EOOA 1DCTA 3GVUA 3OY3A 4GT4A 4EBVA 5DRBA 1PRYA 4WNMA 3LBYA 2JD5A 4IE9A 2XCHA 1RQQA 2V62A 3EZVA 3KK9A 1K2PA 1EAMA 2C5OA 4MQ2A 4J71A 4E26A 2YUIA 3CJQA 2WOTA 2OJ9A 3KQ7A 4P4CA 3QOWA 4IAAA 2J0MB 4TYHB 4M0ZA 4WT6A 4E4MA 2ERZE 1KXZA 4YJPA 4HYSA 2IH4A 5M53A 5HG9A 3HA7A 2A4LA 3LCDA 2R3MA 3GNIB 3LPMA 2NYUA 2JDRA 4FV0A 4X3FA 5I5ZA 3NTVA 1M52A 3QCXA 3F88A 4KBKA 3ANXA 2XNMA 1U59A 3KPWA 2PUNA 1K3AA 4FIFA 4Z16A 5K4IA 1UWJA 5KMLA 3HCEA 4OA5A 2JKOA 3U6IA 5AADA 2GQGA 4DEDA 3O7WA 4MF1A 4PYQA 3DNEA 1WMKA 3P8ZA 2E9PA 3T7TA 2KW5A 1GZKA 3ANRA 2FSOX 1R1WA 4MXCA 3WIKA 3SRVA 3UO5A 3OCTA 2ZB1A 3CC6A 4GH2A 3AC4A 4WNPA 4HOKA 4QP2A 3QA8A 5JQ5A 3GWZA 4IZ5A 5EDRA 3OT8A 2XIYA 4IEBA 4AUKA 2HZNA 2B9EA 4YMHA 4H36A 5HCXA 4PRJA 5E8TA 4C08A 3R28A 3O8PA 3SA0A 2XK4A 5L2IA 2XIRA 3MV5A 2Q83A 2OK1A 4EOJA 4ITJA 2YHVA 3ELJA 3BZBA 3UPXA 2W96B 1JQHA 1S9JA 3OCBA 4U8ZA 4AZSA 2ZZKA 1GIIA 2UZBA 3ACJA 3HLLA 5LSAA 4B6LA 3PDTA 1TPYA 3COKA 2R3QA 2ZV9A 3ETAA 3F3ZA 3Q96A 1MHTA 1HNNA 4O2ZA 4IHPA 4WSYA 3VS5A 2PUPA 4RFYA 5FDXA 4BKJA 3DS6A 3E92A 2O5KA 3UDBA 3NDJA 2AC5A 2QKRA 4NIFB 3TIZA 5FQNA 3BYVA 5DRTA 2JAVA 3KN5A 4EMSA 3JYAA 3PLAE 4QVKA 3A26A 3E05A 4RWIA 5AAEA 5DX0A 3Q52A 4HGSA 4GSBA 2F7XE 2VWXA 4U7TB 1JQEA 5C4LA 4OTWA 2JKMA 1O9GA 3QUPA 4FNZA 3A60A 2J2IB 2W9ZB 4DT8A 4R05A 4EQMA 4GFMA 5ETAA 2GNFA 4O7WA 2WMUA 2UW8A 2X8EA 3OVVA 4FYNA 4YP8A 1AF7A 5DRYA 4IAKA 5IA5A 2IZSA 4BDIA 3IV6A 5HIKA 2BUJA 4MXXA 1PXNA 2BIYA 5AJQA 5EQYA 4KSPA 1YI4A 4FL3A 4C05A 5AFVA 5EKUA 3QD0A 4JBOA 4PTGA 1OB3A 4QP6A 5EMMA 2ZM1A 3R2YA 3TNHA 1Q0SA 2WA2A 4ACHA 4GYGA 4MNFA 4MNEA 5BVNA 1H08A 1M7NA 1KOBA 5KO1A 1WBWA 3GP0A 4Y2HA 3BYOA 5KVAA 4H1MA 2J0LA 3CD8A 2YAAA 5L8JA 3SX9A 5DWQA 4EOLA 4M37A 4O22A 4E33A 1XCJA 4OQEA 2CGVA 2HTEA 3MVJA 4ZZOA 4II5A 5D1JA 4D4SA 2FPOA 5DSTA 3FC1X 4RG0A 2W06A 1YFJA 4AX8A 5L2TA 5HCYA 3LCVB 3MIYA 4FKWA 1RJDA 5EVJA 3JS2A 4BLUA 2EVAA 3TKUA 5AV2A 4A9TA 5BW5A 2X2KA 1VZOA 5CAQA 5CSXA 2LD4A 2B78A 4U80A 3RK9A 1D2CA 3D0EA 1Q61A 4GG7A 1JSZA 2Q41A 3TZ7A 4V04A 3ATTA 3MTEA 4AGUA 1FMKA 3AD6A 4BI1A 3JXWA 2HMYB 2P7IA 5DX1A 5FA8A 3GCQA 3UYTA 4FKVA 3OBGA 2BM8A 3GOKA 2V5QA 1XJ5A 4L53A 5D41A 1OL7A 3E5AA 4I20A 2FSLX 5F2NA 5CCBA 4RLKA 5I9WA 2F4JA 5FGKA 5IA4A 2QNJA 2WTCA 2AZTA 4D2RA 4PGHA 3EFJA 4R3RA 3ZHPC 2XK8A 4KRDA 3QRIA 4TN6A 2X9EA 2YXDA 4FUYA 4ASEA 2YJRA 1OBDA 2FB8A 4EK5A 2G01A 2J4ZA 2UW6A 2YEXA 3EKKA 3PVWA 3R1NA 5FDPA 3QKMA 5KCVA 3UE4A 5M4IA 4IFCA 5DM2A 2ZZNA 3CKWA 4XP0A 4AZEA 1JG4A 3ER8A 3DJ6A 2QOKA 5HI2A 1PMUA 2WHBA 4FNXA 1QPJA 2X7OA 4G9CA 4JDHA 4O6EA 4W4YA 5ITAA 4AZTA 3QTWA 1S9IA 5IH6A 2CL5A 1UU7A 3B3GA 2YDIA 5HVYA 5CVUA 2VAGA 2WQBA 3KC3A 4KSQA 4MQ4A 5C0OE 3ZS5A 3LJ0A 3OY1A 3MH1A 5CT0A 4C4AA 4CCUA 3I1AA 3DXNA 2QOFA 3NUXA 4H58A 4IMYA 4C7TA 3PPKA 4F6WA 3N4VA 4X0MA 3KXZA 4F85A 4V0GA 3NIZA 1Q3DA 2C30A 2OXYA 4AW5A 4CFMA 2IH2A 3X0DA 5DH3A 2PJDA 2QE6A 4O29A 4E6CA 4DGMA 2HW6A 3NSZA 1VJYA 3AC2A 4HYUA 3HCFA 3P9CA 3G2MA 4XS2A 2CSNA 4CRLA 3TIYA 2PUUA 3EYGA 3BV3A 3GQLA 2R3KA 3ME5A 2VD5A 1SNXA 4FZ7A 3FZRA 4G31A 2YZAA 4G3CA 4MBIA 4WNOA 4ANLA 4E8AA 1XCLA 2BRGA 3AGLA 2PSQA 3NRMA 5CAVA 3GFEA 1JTFA 1VL5A 2FRXA 5DBXA 5JFWA 3DXQA 5M5BA 4KUJA 4CEGA 1RJBA 4MWIA 1ZQ9A 4R1YA 4R6VA 1ZYJA 4I1ZA 4RIOA 4F6UA 3HVJA 4YUWA 2AOWA 4AT4A 3OCSA 4F0FA 1H27A 4ZMFA 3LOKA 2C6MA 2H11A 1M2PA 4KD1A 4O0VA 3LAUA 4KRCA 3BYMA 2X39A 4FIJA 5KS2A 3GI3A 4CV8A 1XDZA 2ZIGA 3HMOA 4TW9A 3R3HA 1U5QA 2VTJA 4I4EA 4QP9A 4YC3A 4D4YA 3OXTA 5AEPA 3E8EA 4I6HA 1MRVA 3IDPA 4AP7A 4XRJA 5E8YA 4EH7A 5HIEA 2UZEA 2YIWA 5M4CA 3R9RA 3H10A 2WQMA 2X2MA 3N4UA 2WPAA 3VW6A 4ZLYA 1YXUA 3DLCA 2XNEA 1PXLA 5EZSA 3DBEA 3I5ZA 3TNQB 4H39A 4XYFA 3GNLA 3OPNA 3QHWA 2X9FA 2V55A 5IQEA 2XEZA 3QD3A 3SVZA 4M3QA 3ORTA 2PVLA 4NFMA 4DEGA 2G70A 3D9VA 2IVSA 5FHRA 2F7EE 3NW9A 1XO2B 2QG7A 3CC8A 2GSFA 4NSTA 4TWPA 3LKZA 4QP3A 4QQCA 1U46A 2ITUA 4OLIA 1QAOA 3FUWA 3PX2A 5E1BA 1HOWA 3CY3A 3KN6A 5CSPA 3FUXA 4MAOA 4DFBA 3K2LA 4BB4A 3OZRA 4QP4A 4IC7A 4FV6A 3BGIA 4XOYA 3OZTA 4X1OA 1KPHA 3ZBXA 2C4GA 3S3IA 4GBED 4IM3A 4F99A 5AP7A 2J7TA 4CZTA 3G6GA 2GB4A 1U54B 5LQCA 3NUNA 4IACA 4IB1A 3MJ1A 3GC8A 4ZK5A 2WTKB 3LFBA 4JRVA 1ZOHA 3DB6A 4D9TA 3F66A 1OM1A 1P39A 1YI3A 1XVAA 2ETRA 5E1DA 4H3BA 4J52A 2GMXA 3HVCA 3ODZX 1W83A 3AD4A 3LFDA 3P7AA 3GEQA 5EM6A 1Z9XA 4TKSA 4RTMA 2HZ0A 3KMMA 3QTSA 2B3TA 3VS4A 1PXMA 4FSMA 4F9WA 3E64A 2YIYA 2X6EA 4UY9A 1UNLA 2I0VA 3FTCA 4E4LA 4M7IA 1M6YA 5AX3A 3KMUA 3PG3A 3QCSA 4ZSEA 4ANSA 3P9IA 2BH2A 3MY5A 3LCTA 1UA2A 2ITYA 2Z7SA 1CDKA 1BKYA 2OG8A 1J91A 4EHGA 4FKJA 3ZXTA 3TRKA 4EI4A 4BCHA 3QTZA 4KA3A 3HCBA 5FADA 2IGTA 2YWVA 3MY0A 4JQ7A 3V01A 3FXZA 2C6OA 3G2QA 2PVCA 1WY7A 3MH0A 2ZM3A 1QAMA 3NR9A 4EK4A 3KPUA 4QPPA 5BW4A 5E9QA 4GIHA 1U5RA 3GB2A 2UZTA 4PP9A 4BGHA 3R7VA 4EOQA 3HCAA 1ZZ2A 2OKRA 2OW3A 3ZFMA 1R74A 5CI7A 4R3CA 3R83A 4ZSAA 5KX8A 4DEAA 2ETMA 3DTWA 5HVKA 3KKZA 3EJ1A 3LE6A 3O17A 3PFQA 3PVGA 5DI1A 3TZ8A 5DN3A 5J1VA 4DC2A 4O83A 1IR3A 2X81A 5AUWA 1EJ6A 5K09A 2WQOA 2Z6AA 1JKSA 2C1BA 3ZC6A 4O84A 4WG5A 3KQQA 4RWLA 3ZDUA 3EVDA 4IDTA 1A06A 4ARKA 3NJRA 3VF9A 2PT6A 2PWPA 4EEVA 3MTIA 1KE9A 4MKCA 2JFMA 4Q2AA 1P14A 5HNBA 2NP7A 4ZEGA 2QLUA 5AM7A 3EZRA 3UBTA 4YLJA 4FT7A 4EHZA 2ZIFA 2ZW9A 3TM5A 3HGKA 1YDTE 4TTHB 5EG3A 3P2EA 3FMEA 5IZFA 2BIKB 1BL6A 4RIXA 5DFPA 3CKXA 3RGFA 1XWSA 2WD1A 4HVHA 5KUPA 3TR6A 3HV5A 4J96A 4QOXA 4Y83A 1IY9A 3IO7A 3TPZA 1LR4A 2GQRA 2JFLA 1XH8A 1Q8UA 3FMHA 4LMUA 4QMUA 5EQJB 3E8NA 5HLPA 2RKUA 2PU8A 3A7HA 2XK7A 2Z8CA 2YR0A 2GFCA 3DKFA 2VWWA 4EL9A 4GUBA 3A7EA 2UYOA 4FSZA 4FTJA 5IQBA 3HVKA 3ORMA 2OO3A 4GOOD 5FWAA 4FK6A 4QP7A 4N0SA 1GOLA 3V8VA 3MWUA 1CTPE 3WYXA 3N51A 4CTBA 2ZVJA 4CGAA 5B0XA 4XV3A 1URWA 1UFKA 2CN8A 3R0TA 1JBPE 5AAGA 3G9LX 4G34A 4E70A 2OJFE 4DFNA 2IBSA 2QY6A 3PY1A 5M09A 5K0BA 1H28A 3CEKA 3AMYA 4MVFA 3WARA 4A9SA 5IF1A 5FQOA 3DZQA 4CKBA 3BWFA 1RDQE 5CTPA 4YGAA 3V04A 4E1ZA 2F2UA 3KQTA 4HSGA 4K9YA 4ER7A 3FTDA 2EJUA 3NEWA 3VUHA 1OZ1A 2AOXA 3AMBA 2I7QA 1YOMA 5JGAA 2XNBA 4MQ1A 4PMSA 2ZZMA 2G9XA 2PE2A 4I0RA 4YR8A 5LQRA 4TWCA 3VUDA 5LOHA 1G55A 3GGDA 3FPGA 3CQEA 4ZSJA 4C4IA 1M2RA 4M84A 2CLQA 2EXMA 3DBDA 3M1SA 1JVPP 3F82A 3OTUA 3SD0A 4X3FC 3BZ3A 3CTQA 3FXWA 3NW6A 4ID7A 4IJ9A 5M06A 4CXMA 4FSDA 5AAFA 1UVRA 2I0YA 2ZB0A 3EQBA 4J95A 4XJ0A 3V6SA 5C27A 1JTEA 3KQOA 4I5MA 3EYHA 2BILB 4D58A 4EWHA 5GIOE 1P4FA 5DR6A 4CFXA 2ONZA 4PYJA 4TXCA 2OIDA 5LQAA 3QRJA 3FI4A 2UZDA 3H9OA 1WS6A 3ZC5A 1OECA 3O23A 4I21A 5FTGA 4HZSA 5AA9A 1ZKDA 3EVGA 3FZTA 4WBOA 4QVGA 1BYGA 1RI1A 5EQPA 2YABA 5HQ0A 4QYHA 2XRUA 5C26A 2AOUA 5EOBA 4O0UA 3KEXA 3LHDA 4NM5A 4LWPA 3L9PA 4XEYA 2FUMA 1GNGA 1Q24A 3ITZA 2NO3A 5CSHA 5CU3A 1G5SA 2J0JA 3VUMA 4PL3A 5E8XA 2JH8A 4G6LA 2UW0A 3DK7A 3E7VA 4ZZNA 4DM3A 1XH6A 4I24A 2W1CA 2XM8A 5K8VA 5EGSA 2WOUA 5M4UA 4HGLA 1UWHA 3C6MA 2P3GX 3FDNA 2BR5A 3V5LA 4PL5A 4KS7A 2WZJA 3C4WA 3G6HA 4RMZA 4YLLA 3VUIA 4EH6A 3TUCA 3C4ZA 1YHVA 3R30A 3V5PA 4C3PA 3FYCA 3KREA 4QTUB 1RW8A 5E8ZA 3HKOA 4U42A 3OE5A 3TQSA 1WXWA 2YCFA 3ZEWA 5JN2A 1BLXA 1NA7A 3G51A 3VAPA 5A4QA 1NW8A 1TW2A 2BROA 3DBCA 4Y95A 3DTNA 2VTQA 4IQ6A 3GOPA 4AXAA 3UO6A 5M08A 3EVAA 1M17A 5EMKA 5TF9A 4C03A 5IEVA 1ZLTA 2ZMDA 3ENMA 3KRLA 1GAGA 3OZSA 3THRA 3VUKA 2H6DA 1URCA 5F1ZA 3ZUUA 1AQJA 2B9FA 3RAHA 3ZLWA 3KK8A 2WELA 4WUAA 4LI5A 4A4LA 3D15A 1J7UA 3OT3A 4MD7E 5EOLA 3ZMMA 4CD0A 3UIXA 4DFXE 4E4XA 2BFYA 1H00A 3NIEA 2R6ZA 5F20A 2HXLA 3W2OA 5L8KA 1FGIA 4LYNA 3GIWA 3UQFA 3BHVA 2ORED 5CCXA 3A27A 4QQKA 5GM1A 3DOUA 4HNIA 2R3RA 3KRJA 4BTMA 3R9NA 5IEXA 2R0UA 4FIHA 3G2OA 4ER3A 3EH9A 1WZNA 5ICEA 2C0TA 3PY3A 3KL8A 1AGWA 3LLAA 4U41A 4L01A 4MCVA 4WUNA 5HE0A 1CKIA 4AW0A 4IANA 2AOUB 4C58A 4IKPA 5E8SA 3SAYA 2QD9A 4FNYA 3W33A 4AN3A 3CCFA 3EVEA 3DA6A 4D55A 3AC5A 5J9YA 5EKXA 3C4EA 3TTJA 4LQMA 2I6LA 3I81A 3UJ8A 3FYJX 5GNKA 2AS0A 3SG9A 2YIXA 2PZPA 3D14A 2QC6A 4IC8A 4C4JA 5EC8A 2BR1A 5FCDA 5JT2A 2GHLA 2PXXA 2GTNA 2XK3A 4HVSA 3FMNA 2EUFB 4XV2A 4FTQA 4DYMA 4M7RA 1YF3A 4QMTA 4FEXA 3QRKA 2HZ4A 1V0OA 3EQDA 5FM2A 4FTRA 3ZSHA 4DFUA 5JGBA 4RJ3A 5A4LA 3SW7A 3PE2A 3ZONA 3DLZA 3L9LA 1FVVA 1PMVA 5JFSA 3QTIA 3G0EA 3REPA 3RKBA 4GT3A 2UVYA 1Z57A 4YPDA 4R6XA 3SGLA 1Q97A 1IASA 4GL9A 3F5GA 4YZMA 1KIAA 5T68A 2IH5A 2FO0A 2PX2A 1YXXA 4J97A 3GRYA 4OTHA 4V0GB 1WBSA 4ONAA 1B39A 1E1VA 4PNIA 1IXKA 2VTMA 1JKTA 4AS0A 3U6HA 2FHPA 3BYUA 2XBAA 1Y57A 4LOPA 3VN9A 5EM7A 1ATPE 3FMKA 4M13A 3MA6A 4MHAA 2ZBPA 4RTNA 3QQGA 3V8SA 2ERCA 1PYEA 5ICCA 3KFAA 2BAKA 3GXLA 4ZJIA 3KA0A 4EC9A 5IEYA 2W05A 3K5UA 4QTAA 3GU7A 4Y73A 5ACKA 5E1MA 3NAXA 3R24A 3HA5A 3I58A 1IEPA 2W5AA 1O9HA 4HW7A 3ZUTA 2PT9A 2FSTX 4ZLOA 5AV4A 3G7UA 2VTTA 3GRRA 5J7HA 3GCSA 3TKIA 2PVYA 2R3PA 4WG4A 3DLIA 1RI3A 5KMIA 3C5UA 5J1WA 3REOA 3BT7A 3IGOA 2BFXA 2B9JA 3CCNA 2ZJWA 4QMYA 4QTCA 2XBJA 4BZNA 5CAUA 4QMMA 4BBFA 4DGNA 5FUTA 2XM9A 4C37A 2GU8A 1YB2A 4RX9A 2ZDUA 4I0SA 3OWLA 3Q9ZA 5EKNA 4EK3A 2GS2A 3EN6A 5BPYA 2QYOA 4L7FA 5LVPA 4HPTE 1NE2A 2ZSUA 5LWNA 4R78A 1IA8A 2BZJA 2PVHA 4HPUE 3RK5A 4EH3A 4F63A 3FYDA 2AN4A 4R8SA 5EM5A 2Z7RA 3UG1A 4IVBA 3NPCA 4S34A 4KBAA 2JHCA 3MB6A 3WF6A 4AA5A 4CFNA 2OICA 4MIKA 4RVGA 5EH0A 1GZNA 4RC2A 3R6TA 3BHYA 4YJOA 3PIXA 2XB7A 4C35A 1EIZA 2JBOA 5GIPE 4QMPA 2B9HA 1I4WA 4S30A 1V0PA 2XYNA 4E6AA 3C6KA 4E31A 2P33A 2YERA 2YAKA 4P5QA 2CKPA 4D1ZA 2BR4A 4OBXA 1YDSE 4YURA 3ZLSA 3ZFYA 1JAMA 4DGOA 1A48A 1NVQA 1OIYA 1XKKA 1YXVA 2A0CX 3PTGA 2XYRA 4OBWA 5GOZA 2C5VA 3DAJA 2X8DA 3OC1A 2YIQA 3BRBA 4IAIA 4IAFA 4W4XA 3RTPA 4PQNA 4Y46A 4ASDA 4DTKA 1U2ZA 3AWIA 4G3EA 4AFEA 2IIPA 1ZXEA 3VBTA 4HYIA 2QLQA 4YMGA 4RTJA 4FKTA 1P1BA 2C7QA 3LFAA 2PE1A 4YJUA 2DQ7X 4RRVA 4FGRA 1ZYCA 3FLWA 4NKAA 3FEGA 4B0GA 4EOKA 1QYRA 3PP1A 5IU2A 3KPYA 4RTKA 5FHQA 3MVLA 2VWYA 4UZHA 3BLQA 3BHHA 3DMHA 5ANEA 4CTJA 2QG5A 2CMWA 3OWPA 5TO8A 1Q41A 3QD2B 3MFRA 3F61A 4L68A 5CNNA 4R7HA 4GKHA 3M4XA 3EWHA 1OITA 4R5SA 2PWYA 2OFUA 3D5XA 2P55A 4BIEA 4D4RA 4QMQA 4QTEA 2WO6A 4MXYA 1XDUA 2XVAA 4RYLA 4MWHA 3M6VA 5FA5A 1VPTA 3QRTA 3FLQA 1ZZLA 3LFCA 4AWIA 3DULA 2R7BA
chains in the Genus database with same CATH superfamily
1N92A 2WUFA 3G02A 1BCRA 4FFPA 4H7EA 5ERGB 2G5GX 1QANA 3H2YA 3TJDA 3GT7A 5EIBC 1E77A 2P1DA 4FJ2A 2M6SA 5LBTA 5IA2A 4B32A 2QQ0A 1A1SA 4LPKA 4C0KA 2E6KA 2HV8A 2WZQA 3VZSA 5JROA 4K28A 2C03A 2IZ7A 2AG6A 3W04A 4OBQA 4IAZA 2J31A 4NTSA 1N6LA 4YMJA 2P2SA 3FHIA 2WAYA 2ZB7A 1HNXB 2J8ZA 4O08A 1T0IA 3PWKA 4Q02A 1RXVA 1FS5A 2GAOA 1SD2A 4RVUA 1WDKA 1ZNXA 4FCVA 4G09A 4Z54A 1U54A 3GLGB 1CWUA 1CJUC 1K7SN 5CXSA 3CSUA 3CJTA 1BXGA 5GQSA 3W7AA 3S44A 4LI0A 1T1GA 2Q4BA 2ACXA 3PNQA 1DU4A 2I1LA 1EVQA 2FSMX 4MVJH 2VFAA 3H1PA 3ZYAA 3W3AH 4DGLC 3GC6A 3N58A 4RPCA 4RPIA 1WL8A 4D81A 1JSUA 4ALJA 4ZQFA 5IARA 2VCHA 2IJGX 1T24A 4D41A 2WTUA 1DQZA 1NR7A 3D4PA 3OCXA 3HZOA 1WCYA 4LG1A 2QRPA 5M4FA 4FZFB 2XANA 2VWHA 4ZZ0A 2QZSA 1MVLA 3CEHA 4HVIA 1CQIA 2FLKA 4LJAA 2A57A 4BTLA 1V1JA 4QBKA 1M7QA 3G17A 2AOVA 2HFKA 1U3VA 3N7UA 3AUKA 1H8EA 1MCZA 3GJTA 4JH0A 1LDGA 2VP0A 3DO6A 2A84A 2HMAA 3L49A 6AT1A 4YJ3A 1P7PA 3G6WA 3I76A 3QFFA 3CX3A 1V5EA 3DKCA 4DGGA 4G5OA 1CR1A 4ZGGA 1YHWA 1KDZA 3ROMA 3DKOA 3RSHA 1V48A 3EHAA 4EKLA 3LSTA 1KAQA 3BWEA 5F78A 3DDQA 3OEEA 4QUAA 3F6EX 4YRPA 4RIWA 4GOMD 2BSAA 2ZE8A 3N8NA 1XPRA 1NJ1A 3MYRA 2QBYA 1E4YA 1C0IA 1F38A 2GEUA 3PHLA 1NXOA 5J5VA 1DO0A 1S9HA 3FSGD 1EX1A 4E4YA 2H4YA 2HJSA 3C4CA 2EV9A 5SICE 4KEAA 5KI6A 3AI2A 4IIBA 3W0PA 2XAOA 2VSFA 1NQUA 3AFIA 4RZVA 2HMWA 3B7WA 4CV9A 3OSUA 1WWKA 4BCNA 1JSVA 1XU7A 2ZSJA 3GZNB 4LUDA 5L2SA 4NG4A 5K2OA 4IWOA 3GBPA 3U3OA 5JH6A 1FMTA 1OBGA 1L8AA 4X91A 1LW7A 1G8AA 2H18A 1OX6A 2ADFA 4EG7A 5KREA 2Q99A 3MFTA 4BDJA 3R76A 4I5EA 1DQPA 1O89A 4QUGA 5ALSA 1C80A 1BKSB 1RJEA 4ZVOA 5KHLB 2QM8A 4Z4EA 1K6EA 3VNAA 4RSSA 3BXOA 4LDAA 1SIBE 1XRPA 3TR5A 4M0UA 4ZEWA 1RW4A 1OUMA 2MSDB 1DINA 1YZKA 4DFDA 3D5WA 3FOAA 4M8NE 3NLBA 4EKIA 4L1KA 4IADA 4GWLA 4D96A 3UZTA 4MKZA 5E91A 5L4LA 5HBJA 3EJWA 1QE0A 2L2QA 3RUHA 3F3KA 2DBQA 1MLDA 5E0KB 1GLVA 3DMPA 2HMSA 4G8CA 3L4EA 4MKXA 4L57A 3O8LA 2JFUA 5BSKA 4RLSA 4QOJA 3T9EA 3A7GA 1GAQA 3QU0A 2OO5A 2QOHA 3ZN2A 3MTQA 2ATCA 2ENWA 2J9FB 1TJYA 4P7KA 4L85A 5CAEB 3KGAA 4K6MA 3RSZA 2JCGA 3WLPA 3Q7RA 4TSFA 2OO8X 1NF9A 4C7XA 5FKJA 1QPGA 3WIUA 5JK3A 3V00A 3C0HA 2NG1A 4ONEA 1ZYSA 1E98A 2JIOA 3VHXA 3G79A 3U1BA 2J08A 4YRRA 3OJOA 2HZBA 4LC1A 1EHCA 4XGKA 4AOTA 1IBKB 3VZPA 1JW9B 1XHEA 4RF5A 2P2NA 3QU2A 5CA1F 4Q18A 4ZI5A 3KOYA 4NENB 2CB0A 5CYIA 4UM7A 1HYHA 1BYIA 4JMLA 3KQSA 2HCRA 3WL8A 2BHEA 3COYA 3BHNA 1DAHA 4BIMA 3OZGA 5CBPB 3UGJA 1O97D 4QQTA 5KTSA 1R6TA 4YQYA 2VF2A 2AI2A 4LVCA 2JFBA 1T2UA 2Y0AA 1TQHA 1N6HA 3G15A 2NXCA 1SUSA 3N8HA 2F9FA 1PJRA 3ZJYA 5EZ6B 2VZ8A 2Y1WA 5F12A 4XWKA 5I5GA 3GENA 4O33A 4KINA 4JRNA 4Q7KA 4DLNA 3DM9B 3D0QA 4PMMA 2C5SA 3R9OA 3U09A 4ASZA 2BTQB 4I2NA 2YS7A 2WQEA 5LL6P 1NA5A 2MJLA 3B6ZA 3X2FA 4EONA 1SRQA 4F6SA 1PGJA 1I24A 1AUVA 1T36B 3QW4B 5HICA 3BE2A 3PIIA 2PK3A 3ZUPA 4I81A 3AP2A 4DH3A 4BAZA 1CRLA 2PUTA 4KVZA 2XP2A 2HY81 4UNNA 4YAWA 4DNXA 1YDFA 1GO2A 4YLEA 1NBHA 3CUKA 1R6XA 4OQDA 4KXMA 4B81A 2C8LA 3KUCA 4C61A 1V41E 1NRIA 5GMOA 3LXPA 3IS5A 5LNK1 2GQSA 5LLTA 3BU3A 2A9VA 2QJWA 4XD7D 3QZFA 2G06A 4QWWA 4E5WA 3I9FA 2A4KA 1W96A 4MTAA 5DGTA 3H99A 3TD2A 5KKRC 4RCVA 3AEYA 4PANA 1ZNZA 2QNRA 5EHYA 3NYNA 3RYIB 3KVXA 3CNOA 2ZV8A 4GUDA 2C7OA 3MELA 2XB4A 4MUIA 1L0BA 2H57A 3T5BA 3TB4A 4N01A 1PJ8A 3WWZA 4IM0A 1C3OA 2IYLD 1YZUA 2W9FB 3ODGA 3GBZA 4RDHA 1XV5A 3RTBA 4UEUA 1JR3E 4DR7B 5CA0A 3NHKA 1Y1RA 3V3KA 3ENZA 2ZXFA 3Q7TA 4QOFA 1A8QA 4LJKA 1JHMA 1UBJS 4KUGA 1TMKA 4A8JC 4RCZA 5EJ8A 2QZPA 4PRZA 3RYFA 5C1DA 3T1NA 1YJBA 4RAQA 2LR0A 3POZA 1FRFS 2JAPA 1SVHA 5EWLA 3EQHA 5ALIA 4ZDKA 2NO9A 3I0MA 1BL7A 4LYDA 2E18A 4L28A 4GLOA 3EQRA 4A9UA 3NCHA 3R21A 3L8ZA 1ST0A 1PEAA 4LFCB 3GGPA 1Z36A 2RSLA 1Z6GA 2APJA 1Q50A 3MI9A 1VJGA 1PFUA 1MNQA 4S1NA 3BQRA 1L9KA 1YQEA 4C3UA 3IHWA 1APME 2CKQA 4JVSB 3SV0A 4CG2A 5CGQB 3OG7A 2IPOA 4ZS4A 4BGDA 4C2WA 4TN5A 2XHEA 1OA1A 5K4AA 6CHYA 5BYJA 2I7TA 3ZKWA 3AR7A 4TS4A 4L0DA 4RGYA 2JDSA 2ZWOA 4W5RA 4GX2A 3MBLA 1DMRA 1N8NA 1QLWA 5JHHB 3K2QA 5J5SA 2OSBA 1XZGA 1TQPA 4FOPA 4CU2A 5GZ6A 5CF8A 2I87A 4DA4A 2CJXA 1PEKE 1Q5PA 1CE8A 3EXHB 2PVPA 4IHQA 1HCKA 5FTWA 2X7FA 4HDMA 4XD2A 1J7JA 4KHPB 3GZNA 2R3FA 2GYWA 4WXHA 3O7MA 4WXYB 3DBFA 5IAJA 3QRUA 4EW1A 5JRZA 3GMIA 5EFQA 4IIRA 2QX9A 4YI5A 4ZQHA 4F4DA 5BUJA 4AF8A 4GX1A 3ND7A 3PKZA 4FEGA 4DWJA 4RETA 2XJ1A 1W5AA 3THBA 3DWEX 3V3TA 3L01A 4YO6A 4V1CB 1EDOA 2GZ1A 3MLAA 1L4LA 1D0VA 4TS3A 3NDIA 3AHFA 1H6DA 4EK9A 1Y4ZA 3U7JA 2G1JA 4PSUA 5I8PA 2XYVA 5GONA 3ZDYB 1E1NA 2FSHA 3LDHA 1QCZA 4KGZA 1YZVA 2FYSA 3RD5A 4MKRA 3HZZA 2R0IA 5CB4B 2VT7A 2PMLX 1W8DA 4NECA 2XNDD 3R3ZA 4LUEA 3EPLA 3OCZA 1QS0B 1E18A 4CMIA 4ZOLB 2YM5A 1B8VA 4MVJG 1F3LA 4DDMA 2Y0BA 3G33A 1TPZA 3G68A 2YNMD 5CNJA 4KE7A 5FUMA 4BCIA 1GZ7A 2ZU0C 3C51A 1FXSA 3DBOB 4PUZA 1E7SA 1SVSA 3BIZA 2QMUA 1NONA 3VC1A 1YZGA 3OE4A 1XNHA 4JX7A 1YK1A 2DWOA 2V0GA 1I0ZA 4J7CA 3CUVA 1PP4A 1UKZA 1Q0QA 1ENOA 1FDVA 4EYJA 4ACDA 1GPYA 4R40A 3RRBA 1SXJD 3M8KA 1FSSA 4ZAUA 3RYHB 2X1MA 3HJAA 1FP2A 3DUFA 4P7BA 3R5JA 3TTSA 2Z1MA 1OH6A 3EPPA 3M6XA 2EZ4A 3O71A 2DGDA 4Z9AA 1JLLA 3KYCB 3OC0A 4C0SA 2J3IA 3IOKA 3IMGA 2I0HA 2Z95A 3L7BA 1XKXA 3RVLA 2OJIA 5A4KA 2YJ5A 1IBRA 3H6KA 4BO4A 3EYWA 3PPZA 4ETMA 5JYBA 1P4RA 3UCFA 2B1JA 1V0BA 3IAEA 4N8SA 4EARA 5EW8A 4PR0A 2PGLA 5FO0A 4YRCA 1I6KA 4HN4B 4KIPA 5EHZA 2BDWA 1N25A 3SR0A 4MI1A 2VP4A 4M1WA 3NHFA 1PUJA 2IWIA 2AH5A 1WSAA 4OIMA 3HL7A 3FNHA 3IUSA 4MRRA 4JQOA 4IFEA 5L6MB 2HX1A 3PICA 3ZE7A 3PYXA 5FLFA 5AK0A 4K77A 1H3EA 5IKOA 3MMPA 4OUCA 3A1TA 4MW5A 1TIBA 1SXJC 3WAJA 4JSRA 4CCYA 2MINA 4MD8E 1QRSA 3BF7A 1M74A 3IV9A 4INAA 3OZ7A 3ORNA 4M9XA 5AP0A 3KOOA 1DIBA 2DEUA 4LJRA 4KVFA 4QMXA 5C32A 2AFIB 1UPAA 2OKCA 3LMKA 1OPKA 3ET7A 2J3DA 2JC3A 3D0KA 4D46A 2H4FA 4DE4A 3MWKA 1ZIDA 1PV4A 1URPA 1VE3A 1T9ZA 1MZVA 1P9LA 1PMEA 3OOJA 1ID1A 5FNVB 5M44A 4PDYA 3KE9A 1RT9A 2HNKA 1DOZA 1Z07A 3QV1A 1YAHA 2A1UA 4MYSA 3CKMA 5GVRA 2ENUA 3WYCA 1JLKA 5CQWA 4PZ9A 1GFSA 5EESA 2NU7B 3RHXA 2ADMA 3I60A 3IPXA 3G23A 1X8JA 2ZRFA 3QA0A 5TEWA 1ESZA 2W1HA 1YHNA 2R3GA 1O8BA 1RWOA 1E2GA 3N0TA 4TWZA 5CY3A 3BTUA 5J43A 2Q9AA 4CG8A 3OA2A 3WB1A 4AZ3B 4O6VA 4DLWA 4NXNB 2JLSA 4P0PB 4TMYA 4QJBA 2Q4EA 1OE0A 1M34B 1SXHA 2GA8A 5GVSA 5DEYA 4OUKX 2Z6UA 2NUPB 2QENA 5EIFA 1DZ3A 2BRUA 5ILQA 1EDEA 1ZUNA 1OI4A 1TCAA 3LBYA 4JA0A 4RXMA 4C9BA 1E3WA 2ORYA 2V1XA 3D0RA 2YUIA 1WEHA 4MYRA 2ZXUA 1GUBA 4K6CA 3X1WA 2QD5A 4IR7A 1JT9A 2FMFA 3F88A 2XNMA 1KWGA 1O77A 2PUNA 1AGYA 5CDTA 4LXQA 3D4LA 2BHNA 2DCMA 1RQRA 4HDRB 1G8JA 5HYVA 3WIKA 1XALA 2JNWA 4EA8A 3T3OA 4H36A 2I3ZA 2WWRA 2Q83A 2OK1A 3LAWA 1OYWA 5EUCA 4H6XA 4EB3A 1B6SA 4F5YA 1C4XA 2UZBA 1H8HA 3I5AA 4YLGA 2R3QA 1Y3BE 4HPWA 4NIFB 4AP5A 5IVHA 1XN4A 2YVKA 3PLAE 3Q52A 3LX5A 1T8SA 1CLEA 5HIKA 3OZCA 3TQHA 3KETA 4BWGA 3BREA 3CD8A 1LVUA 1B93A 2P2DA 3L8EA 3W3AA 4EGCB 4AX8A 1JFTA 1P1KA 1JYSA 3EUEA 1D2CA 1Q61A 4NU6A 2WD8A 3C5VA 5AM4A 1IPFA 5DYNA 2AX4A 4NJMA 1J8QA 5DI3B 3X2EA 1TT5A 4IGKA 2W90A 3E27A 3PUVA 3CKWA 1WA5A 3FJOA 1YGYA 5HI2A 2QOKA 7ADHA 4AZTA 2CL5A 1L4YA 4AYWA 2B99A 2VAGA 4KSQA 4QU5A 3NTUA 4H6VA 5AVVA 5LQDA 1NW9B 3KXZA 1YBVA 4DGMA 2D1RA 3K53A 3BV3A 3N05A 4FZ7A 3VSBA 2ECFA 3TTTA 4YJDA 1GSAA 1G5IA 1ZYJA 4RIOA 1E2EA 3HVJA 2AOWA 4A2CA 4PC3A 3QU7A 2XMCA 2YFKA 4FIJA 1BDJA 2YXPX 1I4TD 4MYHA 1AKQA 4LSZA 2YIWA 2QTBA 1L5HA 4I3GA 1YB4A 2OP0A