4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
2R64A 4EL9A 3E8NA 4QT1A 5CT7A 1XBAA 1XDZA 3MB7A 3LDGA 2UW6A 1QL6A 4YP8A 5KX8A 4FOBA 1JG1A 2WMQA 5KMNA 3TZ9A 2AS0A 4EZ3A 2XP2A 4HCVA 4OT5A 4PINA 3ELJA 4LOOA 3JR1A 5HIIA 1W0XC 5K0EA 3CJFA 3COHA 5K0JA 3Q3BA 4IJ9A 5IQBA 4C04A 5GNKA 4ASXA 3TUCA 4BDIA 2BZJA 5AUYA 3NUUA 5GP1A 2C3KA 3VJNA 2N47A 1YOJA 3RVGA 3CJTA 3RWPA 3R0TA 2GNFA 3GWZA 3NDIA 5K0GA 2AOXA 5LQKA 3E64A 4YNOA 4F09A 2B9HA 2BRHA 5ANDA 5D7AA 4YLLA 5EQPA 2VV9A 4GT4A 4L53A 4RTSA 5TOZA 3LFSA 5TO8A 2R3LA 4MBIA 3QA8A 4OTRA 4CMUA 1JSVA 3W32A 5ICEA 3HEMA 5GM1A 4GBED 1W7HA 2P33A 4EOPA 2OPBA 4GSBA 5E8XA 4D9UA 2XBMA 3FRHA 3FMJA 3LFFA 2W1HA 2BPMA 2SRCA 2IVSA 4JL9A 3ER9A 2QLUA 4G56A 3DBDA 4O84A 3HCDA 4DTAA 2PUPA 4YTFA 5K9IA 4IWQA 3PVCA 4TYEA 4L6QA 5HIEA 3HNRA 4R7BA 4I6QA 2YWPA 2CNUA 4S32A 3KQ7A 3AC1A 3F3WA 4JRVA 3IHTA 4R3PA 4CKJA 4E2YA 3OCGA 1MP8A 2XZSA 5I9VA 3FI2A 5FULA 2FSTX 3POOA 4PUZA 5DLSA 4C4JA 4IHPA 2PT6A 4QMNA 3K2LA 3D5VA 1Q97A 2VO6A 2B1PA 4PDSA 3HX4A 2WQOA 2GLUA 3FLNC 4CSVA 5JK3A 3WE8A 3IKAA 2LGCA 5CNNA 1IG1A 3KXZA 4DMGA 4ZXTA 4O83A 4F7SA 2XBAA 4YJPA 4RZVA 1E1VA 3LM5A 2V7OA 4NCTC 3II5A 5H9BA 4U8ZA 3PP0A 3ZRMA 5ACKA 4FEWA 3BUSA 3BYOA 5IA0A 1TW2A 1QZZA 3HMNA 1A9UA 3ORLA 4QPAA 3R1SA 3MGYA 3HECA 4H36A 3DLIA 4CFFA 3PUPA 2W4JA 3DJ5A 1NA7A 5L2TA 4W4YA 5DX0A 3PPZA 2B4SB 1J1BA 2YFXA 3P2EA 4I41A 1QAQA 3D0EA 3KHKA 4DFZE 1D2HA 4FT5A 3B5IA 1FP1D 4MH7A 4DITA 2JKKA 4KIOA 5DGZA 4P2KA 1KE5A 3OZSA 4BIEA 3BGDA 2PKWA 4DKJA 3FHIA 4HYHA 1NW8A 2OXYA 2NP6A 2YM6A 3C4EA 4OTWA 3QU0A 4R6VA 3TN8A 1ZMUA 3UP2A 2B0QA 2WMVA 3PWDA 1RQQA 2IBTA 3DLZA 4AN2A 4B9DA 5DX1A 4EKLA 4E2ZA 5DYJA 1YFJA 2YJRA 3TTIA 3IW6A 2ZIEA 4I5CA 3FI8A 3MI9A 2WMBA 5FXRA 4AT4A 1ZMVA 2C6KA 3V5LA 4BI1A 4ZSJA 2BDFA 2XRWA 3VUMA 3N4UA 4JBPA 3VUDA 4DN5A 4FG7A 3LPBA 4KS7A 3UQCA 4WSYA 3PE1A 4FTJA 2K4MA 2G15A 3MQ2A 2BDWA 5E9EA 5LQRA 4V0GB 4RVMA 5HG7A 3TNPC 4ER0A 4PYNA 4MXOA 5FTQA 3HVJA 1NKVA 3TM4A 3HA3A 1ORIA 4RFMA 4ENYA 3JWHA 5EH0A 1ZRZA 3TNQB 2B53A 1JG3A 4JDJA 3TDWA 2VTRA 2YCRA 3GU3A 3PXRA 5E91A 2IW9A 2BDJA 3WZUA 5DEWA 4ZTQA 4E7WA 3ER8A 4QDJA 3AD6A 5E8ZA 3MA3A 2DUVA 4HSGA 4UB7A 2UW7A 3L8XA 2PE1A 2JDRA 2GS7A 2ITXA 1JQ3A 1VJYA 4JVGA 2O64A 4R77A 1VP3A 4QYHA 1P39A 3DS6A 2O63A 2XIRA 3QZGA 2PSQA 3C3PA 1RE8A 3R1QA 2ZM1A 4IAAA 2H96A 1XR1A 1WBNA 3E23A 4EOQA 2ITZA 2PGXA 4AZSA 3IV6A 2QOLA 4PMMA 2BTSA 4EH3A 2YWVA 4XX9A 5DFPA 3LXPA 4QP2A 3OP5A 1KUTA 3W2QA 4HGLA 3I5NA 4OW8A 2C6MA 1I4WA 4X7QA 1WZNA 3PFHA 5BQ0A 3DXPA 4IACA 4ZLZA 1QPCA 4KIPA 3UIUA 3ETAA 3MY5A 1TQPA 4XRJA 4ACMA 2E9OA 4DEDA 1JKSA 5EG3A 2R7BA 3IGGA 4DYMA 4I6BA 3GRZA 4XBRA 3UIMA 3NUSA 5CANA 4FV1A 4NU1A 5J9ZA 2ITPA 4FE2A 4DH5A 3F5UA 2XIZA 3LCUA 5TKDA 4C2VA 4DFYA 4LYNA 1W84A 2P55A 3RPOA 4YV1A 3HA6A 2CLXA 1JSTA 3KR2A 3WZKA 2BH2A 4BZNA 1O54A 3KKZA 1H00A 2ONYA 4FEXA 2GMXA 1H1WA 3W33A 3LLAA 3DOUA 4R5SA 3FPGA 5FDXA 5K01A 3HM2A 3LFDA 4YJUA 3PT9A 3GCQA 3QRTA 3DT1A 4U9AA 5IUHA 1STCE 3ZSIA 2XRUA 2X81A 3R28A 4AUKA 4JI9A 5L6OA 4FKVA 1W82A 3PG1A 4PCAA 1R8XA 3TEIA 4V0GA 3GCZA 2C1BA 7MHTA 4WNMA 3DDPA 4RVGA 2FPOA 2WFYA 1ZGAA 3KPVA 4HGYA 1UKHA 3SAYA 2OGVA 4NCTA 1W98A 2P3LA 2X2MA 4CT2A 4GK2A 3BLHA 3JVRA 4UEUA 2VO0A 2ZB0A 3V8VA 3MDYA 3OE5A 1ZOGA 3UJGA 4AACA 5F4NA 4L52A 5EHOA 4M14A 3BV2A 4RG0A 3E5AA 2BROA 3NAYA 5D1HA 4ACCA 1JVPP 2WELA 4FSUA 3C51A 3ZXTA 3LX6A 5BVNA 5AUTA 4DFLA 1FBNA 3QQFA 4ZOGA 2QOBA 2IW8A 3VNTA 5M09A 2PK9A 5CSPA 4FOCA 1XCLA 1NW3A 3C0KA 3ZS5A 1JKKA 3LGAA 3IDPA 4YC8A 3EKKA 4QYYA 2XNNA 4BBMA 2X8IA 3EVGA 1AV6A 5KVAA 4HGZA 2E5WA 4O7VA 2WMAA 2YABA 3ORNA 5DXJA 3LCTA 2P4IA 3U8WA 3WIGA 4YSMA 5HNGA 4EHGA 4LWPA 4ZTMA 4G2FA 3CTJA 1AF7A 5IQDA 3LMGA 3KR0A 4HZSA 2OH0E 2ZBPA 3MBLA 4BIBA 3RPVA 1Q0SA 4P90A 1P14A 5HIBA 2X7FA 5M4CA 4D55A 3GDHA 2AC5A 5E7RA 3R71A 4JT3A 4DINA 3QQKA 3UJDA 2PXCA 4O7TA 3ZHPC 5AX3A 5K5NA 4E2XA 2R3RA 5HBEA 3OFKA 3MH0A 3OEZA 1OPLA 4O29A 2BTRA 4P4CA 4E31A 4BZDA 4R8RA 4MQ1A 2HTEA 4L44A 1D2CA 2PJDA 3U4UA 2VTTA 3DY7A 5KMLA 1JPAA 3CTQA 4XMOA 2HV9A 1UVRA 3V51A 1Q4LA 2CNQA 3HDMA 3QL8A 4OTGA 4FL2A 4CG8A 4AW2A 3IPHA 5C0OE 3D14A 3V6SA 4NZWB 3E8DA 5DT2A 3DNDA 3OU6A 5LQCA 4I20A 5A4QA 3W55A 1FOTA 5EOVA 1DI8A 4WVLA 4MVFA 3QUEA 4QMWA 1G5SA 2QC6A 5BW4A 3BXOA 5CAPA 3HL7A 2V22A 4GC5A 2J6MA 4OBOA 2O0LA 3HCAA 4O38A 3RZBA 3E93A 1M17A 3QZFA 3RTPA 3HMOA 3VWAA 3TNIA 2GU8A 4E4NA 4BCPA 4JRNA 3C3YA 3IQ7A 2WTKC 2GHGA 4L8MA 4Y46A 2YERA 3Q7EA 2QRVB 3G0FA 1FPUA 5ANKA 4O0TA 4FVRA 3R8LA 4PONA 2XNOA 2C69A 3OPNA 5E9WA 3EJ1A 4UZDA 1F3MC 2BKKA 3PA4A 2DULA 1KYZA 5AUUA 4YR8A 3SXFA 2GFSA 3AMYA 3GXLA 5M06A 3FPEA 4ZTNA 3ZLSA 4IV0A 4ALVA 4NTTA 1VQ1A 1ZYDA 2X9EA 3RGFA 5IMXA 3UYTA 4BDDA 3CS9A 4HG2A 5BUIA 4RWJA 3MYGA 2G2HA 1AGWA 3LMIA 3FPMA 2BHHA 5KMIA 3DKOA 2QI8A 4FR4A 2WOTA 3QQUA 1M52A 3U51A 2AC3A 3EQIA 4RVFA 2VTIA 2NPQA 4FT0A 2BR3A 1QCFA 2P1DA 3Q9XA 1F5QA 4O96A 3U4WA 4FKUA 2RGPA 3K3JA 2NNWB 4XYFA 3C50A 3FQHA 2QD9A 3DV3A 1JSZA 3BEGA 2UZEA 4IIRA 3UE4A 1OL2A 2X8DA 3TV7A 3PYYA 1OPJA 3B89A 4CCBA 3D7ZA 3R8PA 3UFBA 4IMYA 3SDJA 3HMIA 5FBOA 4OA8A 4ACDA 3W2PA 4N57A 2VWIA 1WVWA 4G5PA 2DQ7X 2WTKB 3NNUA 3PRIA 3LL7A 3DMGA 5CYIA 3LCSA 2CSNA 4IJPA 5AP1A 3KQQA 2IO6A 4ZJJA 3G8BA 3DPKA 3R1NA 2CKEA 3L9LA 3DULA 4M7RA 5EIFA 3BLQA 4U40A 2CN5A 5FTOA 4C08A 3F3VA 4QMPA 3LBFA 4EOJA 4QTTB 5LARA 1KOBA 3G9NA 3GO4A 3V97A 1GOLA 5FP5A 4FT7A 4LG4A 3MB6A 1B42A 2WTCA 3R9HA 1P4OA 4YJTA 3BU5A 4E6DA 4K9YA 3QRUA 3PY0A 4LV5A 5DRBA 4L01A 1R3CA 1CKJA 2QRVA 1L3RE 2VNWA 3DFAA 3DKCA 3RK7A 2ETRA 3CJRA 2ZLBA 4FV3A 1KR5A 4O0YA 4E70A 2A27A 1WY7A 3OT3A 4YZBA 4M0YA 5CCXA 4CFMA 5F9EA 3AXTA 1DAYA 3D5XA 2PVHA 4ZTBA 4MHAA 1IAHA 5HG9A 3CKXA 3FZGA 5GJGA 3UZUA 4J8NA 1SG9A 2C7QA 4U0IA 4E6AA 3P2KA 2PMOX 3SW4A 5FQOA 3U87A 2GS2A 5DNRA 3JUHA 1H1SA 4JOAA 4MWIA 4OLIA 2VTLA 5LWNA 1OKZA 1WXWA 2YQZA 3S4QA 5FADA 4FS8A 5DRDA 3T3VA 2YXEA 3KN5A 4B8MA 1PY5A 1ZWSA 3QD0A 4E20A 3ELYA 4FV4A 5E8WA 4KD1A 3E7VA 3VBWA 3PS9A 3ZSHA 3CCFA 4JIKA 2BMCA 3UZTA 2QOCA 1ZARA 3FDNA 5E92A 5EHLA 3AMBA 3PLSA 2H00A 3G5TA 3HP2A 5F2OA 3TPZA 1OGUA 5IEXA 3EB0A 2ZAZA 4QRCA 3LHDA 2XMYA 4S33A 4X3FC 3P9KA 1VPTA 5ANIA 4DF3A 2ZFUA 5DT0A 2WMXA 2QKWB 3QRKA 4RIWB 3COMA 4IB0A 3V01A 2G70A 2XNGA 4XEYA 2G1TA 3HCBA 4PIMA 3CQUA 1JLUE 4XV2A 3E8CA 1Y57A 1NBIA 4WRGA 2W9ZB 4DCEA 4NJ3A 5ANJA 3TM5A 2WEVA 3BLRA 4I92A 4DEEA 3V5QA 5K5XA 4FKJA 4I6HA 4KAOA 2WK1A 2R0UA 4JLCA 4MEDA 5LCJA 1DCTA 3C4WA 3HP5A 3FPJA 4E5AX 1B38A 2AUHA 2BRBA 1J91A 2WMUA 2W5BA 3DAJA 2ESMA 1OL1A 1JR4A 4KIQA 3RWQA 2W99B 3HV5A 3VRYA 3KL8A 5GHVA 4USEA 3TDVA 1PW2A 2UZBA 4KRGA 4AW1A 4AOIA 2GCDA 4U97A 5T6KA 5LSAA 3B3FA 4HYSA 3M6VA 4D28A 1RW8A 4EC8A 3PE2A 3WF7A 3RK9A 4FKPA 3RM7A 3Q5ZA 2GQGA 2E9UA 3EQGA 1TKIA 4RT7A 1KE8A 2W17A 5C8MA 3QGWA 1H4LA 3UMWA 3Q32A 3SGLA 5FEEA 3PVWA 5H8GA 4C35A 5KZ0A 1OB3A 5HLPA 5HI2A 3SQQA 3RPSA 4TNBA 2XA4A 5JGAA 4O82A 4DC2A 4F0IA 3KPYA 4I4EA 3A4PA 3NVMB 3O7WA 4X3FB 4YMGA 2HR1A 5CU0A 2FRXA 5E8TA 4AZEA 3R9OA 5EZQA 3WF9A 5JEBA 2HENA 4M8TA 4YHJA 4J7BA 4RTMA 2BFYA 4XOZA 4D58A 4GKIA 2UZNA 4HGEA 1HOWA 3OOMA 4U42A 3R30A 3NW7A 5CF5A 4FZ7A 5FUTA 4C02A 4C61A 3THSA 5CM2Z 3GU5A 4AQCA 4QP1A 2WIHA 3ZLWA 2CCHA 3CQWA 3LCDA 3ZZWA 3PWYA 3Q6UA 5CALA 4PQNA 3S3IA 2W96B 1KV2A 4DGMA 5A3XA 3OBJA 4AOTA 2I0YA 5F20A 5E8VA 3UC4A 2UZDA 2AOWA 2C30A 2CMHA 3QCQA 2QG5A 2E9NA 2AN5A 4F99A 3LFCA 3CKWA 1URWA 2AZTA 3TJCA 4TYGA 4BP1A 4O0RA 3DKGA 4IAKA 1XDUA 2XIKA 4F63A 2UYHA 5EHYA 4DH3A 1EIZA 3I79A 1BI7A 1NV9A 4RBLA 4KNBA 2VX1A 2ONZA 4C05A 4GVAA 4NW5A 2ZULA 2E9PA 4IVBA 4ANQA 1K2PA 1L8TA 4HVHA 3UBDA 2ONLC 1YOMA 2PX8A 2W1FA 3MV5A 3BWBA 4ITHA 2Y7JA 4FTAA 3FMLA 3KQWA 5IDPA 4GK4A 1L3CA 1WG8A 3DQWA 4EOMA 4QP3A 2Y4IC 3V6RA 3GFEA 4CMTA 3CY3A 5DIAA 3R7OA 4DGOA 3AOXA 2GHMA 4BGHA 2YTZA 4GUBA 3MAGA 4RX9A 5CVVA 4UXLA 3AC4A 4GG7A 2J0IA 3TT0A 4XG8A 1SZMA 1Q8YA 4RJ3A 2UVZA 3KVWA 1H27A 2J0LA 4XBUA 2BAKA 4C07A 1UU9A 2VUWA 2W7XA 3BKXA 4IFGA 4DGLC 2IVTA 4NL0A 5ICCA 4A07A 4DT9A 3IDCA 3D7TB 4YZMA 3VC2A 1QMZA 3FLWA 3UZPA 4FIFA 4YHFA 3WE4A 5IH6A 3U6JA 3WOWA 3DLSA 3HRFA 2KW5A 1R39A 1OKWA 4A4XA 2VTMA 3P71T 4FSZA 5B1SA 2A19B 3CQEA 3DXXA 1M6YA 4S31A 4WT6A 3TCPA 4X3FA 5L2SA 4EKKA 1KSWA 4FSTA 4H1MA 4E4XA 2W05A 5HHWA 3POZA 4C38A 4OA5A 3FXWA 4EQUA 4OGRA 4ENXA 3NR9A 1Y6BA 4KWCA 3EFJA 3DBEA 5EMJA 4FKRA 4QP4A 2C68A 3Q4CA 2EJTA 5DM0A 4P5ZA 2GAFA 1TPYA 2HZIA 3DAKA 3SVZA 4DA5A 4YBJA 2OXXA 3R2BA 2W5HA 3U6HA 3KY2A 3I9FA 3V5PA 5LMKC 4II5A 2OK1A 4O86A 2R0IA 5FQNA 2VX3A 3PSDA 3C4ZA 2VTHA 5IQGA 2Y4IB 5K4IA 3FI3A 3DK6A 3R9DA 2UW9A 5DTQA 3WF8A 4FNWA 5JT2A 1YI3A 3FXXA 1OVEA 3QLFA 2GHLA 4IWNA 1XWSA 2FVDA 5IQHA 3BWYA 4IB3A 2WTJA 2A14A 3FMKA 1IR3A 2HWOA 2HK5A 4WBBB 3FPQA 4BN1A 4EQMA 3E88A 5M4IA 4XUCA 2OLCA 5IZFA 3LJ0A 5CU6A 2B2CA 3AC2A 4GJ2A 4YUXA 1DS5A 4F08A 1NW7A 1Q62A 4DFXE 4YLJA 3SC1A 4RTQA 2BUJA 1JTFA 1J7UA 1GZNA 3LCKA 2P2IA 3VUHA 3R0QA 4BKJA 3ZO4A 2GPYA 3MH2A 3NW5A 4GC9A 1XH4A 3G9LX 2FGIA 4IADA 4O0VA 4K2RA 2QKRA 4BBFA 3A4TA 3IO7A 1GZ8A 3FEGA 4FKWA 4GFMA 5ETCA 5KUPA 4D4YA 3CC8A 3D7TA 1JSUA 1JWHA 5AAEA 3FYCA 3RINA 5G02A 4LMNA 4BGQA 4TT7A 5FHRA 1D2GA 1YQJA 2PE2A 1PJKA 1YVJA 1Z9XA 3I1AA 4I21A 2WQNA 4GOLD 1APME 4UN0C 5EKOA 3MFRA 2EXMA 3RNIA 2PX4A 5M5BA 3TJDA 3LQ8A 1BMKA 3BX5A 4D0XA 2Y0AA 3TXOA 3TM0A 2CL5A 2YEXA 5IA4A 5BVDA 5CAUA 3JY9A 5HIMA 4A9UA 2VWYA 3KXNA 1OIQA 2VTNA 5CF8A 5CQUA 3KFAA 4S2ZA 2PZRA 3UP7A 3AXSA 3EN7A 3OE4A 3LDFA 3ZC6A 2R4BA 2C5NA 2RFSA 4RVHA 4WXHA 4F0GA 4O0XA 5F1ZA 2WZJA 3G15A 3FY2A 4Z7GA 2ONLA 5E9JA 3E7PA 3UO6A 2QY6A 4CKRA 3EFKA 3UWPA 5DI1A 3V5JA 3FMNA 4HVIA 1RDQE 2GDOA 4MYGA 1XDSA 3M33A 4AGUA 2B54A 3ZEWA 5K4JA 2AN4A 2P40A 5EI2A 2OU7A 3FI4A 3C1XA 4FZAB 4ITJA 3N9XA 4YV0A 1MRUA 5JQ5A 2WU7A 4WNPA 3CY2A 4ZS0A 4E5WA 4BYIA 3UOLA 4RA5A 1QPEA 4ACHA 3I58A 4LV8A 1I9GA 2CDZA 3KULB 2UZVA 2J4ZA 1NE2A 3VSEA 4ZSEA 4RC3A 1H8FA 2JDSA 4LGHA 2HNKA 2WQEA 3EQCA 3OCSA 1P91A 1G38A 4PTCA 3FBVA 2R3FA 1XBBA 4JR3A 2AOTA 3FC2A 3SX9A 3TKIA 5I5ZA 3NWEA 3WZEA 1K3AA 5IKMA 2WTWA 2C47A 2B25A 4FTTA 5FCDA 3C6KA 3VS0A 4QTEA 4C34A 2GTNA 5U4XA 2ZB1A 3NCGA 1ERKA 3EN6A 3NDJA 2RG5A 4RJ8A 4A9YA 4FV6A 4O0SA 1YXUA 3A8XA 3V8WA 1KE7A 2HZNA 2GB4A 2B9IA 4M69B 4DT8A 3HCFA 1VYZA 4PYIA 3AC5A 2YACA 3LFEA 5EIWA 4PGGA 5E8UA 1Q8WA 2PULA 4IFCA 3FXZA 3IEIA 2OB2A 4W4WA 3PA3A 4QPSA 2WA2A 4LI5A 4YUWA 2I62A 3CR0A 1X1AA 3EFWA 5LMKA 2GFCA 2ITWA 4QMSA 2W1ZA 3FTEA 1J1CA 3O31A 3EL8A 5IQIA 2R3HA 2VTQA 4QDKA 2PVJA 4IAFA 1U4DA 5C27A 3BBTB 4FA2A 5GJFA 1SNUA 3LCOA 1YHVA 3OCBA 2C6IA 4L68A 5EZSA 4YC3A 4ZMFA 1M14A 2B9EA 2VAGA 4FI1A 3G2MA 4V04A 3KQOA 3OF0A 4EOKA 3NUNA 4AT3A 4BCQA 1NBHA 4ID7A 3MCTA 3SD0A 5DT4A 2WQBA 3CVOA 3LPMA 3L9MA 2VD5A 2YM8A 4KWPA 2UV2A 3MVJA 1SVUA 4JQ8A 3PFQA 3LFQA 3PSCA 3R04A 5B0XA 3KQVA 2XK9A 4XP3A 3EN4A 1LPUA 1WZYA 1UA2A 5C9ZA 4YZDA 3D83A 2QYOA 4I5MA 4LGGA 4EH9A 1IA8A 2Z6QA 4B8LA 3KK8A 1YRPA 3QQHA 3GXOA 3D5WA 5LOHA 3F4KA 1H1DA 3CD8A 3LMHA 3KULA 4LL0A 3W2OA 4LM5A 1XHAA 3T7SA 2XNPA 3AT3A 4CTCA 4C03A 1PXMA 4DG3E 2WKMA 3LFAA 1PHKA 4FV5A 4QMTA 1XVAA 2ZV8A 4ZTHA 3GC9A 3DBFA 2B9JA 1WXXA 4ACGA 3COKA 2CJMA 5HCZA 4K1BA 4ZTLA 3ID6C 3FQEA 4DCAA 5CSXA 5H8BA 3T0IA 3O8UA 5EDPA 3D94A 4C4IA 2BHEA 3Q96A 1XO2B 2BR4A 5EGSA 3VS7A 5IA3A 2HZ4A 1KE6A 4G3DA 5H8EA 3QWJA 3R7IA 4JJRA 4ZLOA 4DEIA 2PWPA 3K3IA 2XH5A 1G8SA 4QPPA 1J7IA 1QAOA 5GINE 1VIDA 1PXLA 3BZ3A 4XUDA 3UJCA 3EGEA 3D2KA 5EM5A 2FSOX 3IK3A 4Q5HA 4TWOA 4RQVA 3KXXA 3VF9A 2QURA 3GGDA 4U81A 5DRTA 3GCSA 4JDIA 3FZTA 3Q6WA 4YMHA 4L46A 1OIYA 2AR0A 4ZEGA 4R6WA 2ZV2A 2V62A 3TFWA 3H9OA 2Z7RA 1GZKA 2OWBA 3ANRA 4FSNA 1YWVA 4M0ZA 4X6QC 4EMSA 5HILA 2AOVA 3OD6X 5HO7A 4U6RA 3M4XA 4O91A 1FVRA 5GM2A 2YCQA 3VQHA 1XCJA 2UW4A 3AGMA 3BGPA 3G89A 4O7YA 3NS9A 4FTCA 5CAQA 3SSOA 3ZH8A 5CD1A 4R05A 4USDA 4H58A 1BHJA 5J9LA 3FYJX 4A06A 3I6UA 3IGOA 5AEPA 3MS9A 3UA3A 1KHHA 4K11A 3ROCA 5CEKA 5CS6A 5TF9A 3NZ0A 3RIEA 1IRKA 3AGLA 3ZEPA 2WXVA 1X1BA 3HA5A 5KMJA 3H30A 5CI6A 5BX0A 5I0BA 3MJ1A 4F6UA 4FL3A 4KRDA 4FTQA 4A4LA 2XVDA 3L8DA 3ZUTA 5EYDA 1O6LA 3H3CA 4FK3A 4W4XA 3GBZA 2FA2A 4WG4A 5IA5A 3FZSA 1OM1A 4ATNA 2UYOA 3A7HA 3PIZA 5A9UA 5E2BA 5ICFA 2P0CA 4L7FA 5M57A 5CEOA 3M42A 3FUPA 3LXLA 4UX9A 2JH9A 2W0JA 5HE0A 1H0VA 3UVRA 3NLBA 3ORHA 3KB7A 4C59A 3PP1A 3GU7A 3PSBA 3D4QA 2VP3A 2XCKA 3DZQA 4YNEA 1IASA 2QU6A 4HYIA 3QTRA 3ZBXA 1R6AA 3TRKA 5AUVA 2QOOA 4PDYA 1G3NA 5D1NA 2PVKA 3V5WA 4U79A 4CV8A 2IBSA 3IW5A 2YHVA 5BYLA 2CKQA 3V8SA 1OMWA 3FZPA 2PY6A 1GIJA 2XCHA 5DR9A 3PJ2A 4C58A 3TIYA 5HE1A 4QTDA 3ORIA 2GNLA 3OG7A 2I7QA 4XG4A 2C5VA 3HDNA 2WO6A 1JBPE 4FT9A 2Q83A 2IZUA 3LSTA 5E8JA 5KE0A 2ITOA 4AA5A 3SGCA 2IG7A 4D2SA 3BKWA 4XG3A 1RJGA 3RM6A 2J5FA 4G3FA 5CZHA 3BIZA 3MY1A 3JY0A 4MD9E 1TQIA 5HX8A 5D41A 3OWPA 5HBJA 4IZAA 4MTLA 2PSSA 3EVZA 3QLGA 2ZZKA 2WA1A 2VGOA 2PXAA 4P7JA 4DH7A 4EKIA 4N6YA 4IC8A 3C4CA 3QTWA 5A4CA 1SQFA 4PTGA 4DH8A 3U81A 3Q9WA 1H24A 3P0MA 4BDBA 4C7TA 3I6WA 3FPFA 2PUUA 4BDHA 1FMKA 5HLNA 2F9GA 2PUNA 3ZO2A 3BYSA 4A6DA 2OXDA 1VP9A 5C01A 3P9IA 3QAME 2PVRA 3UOKA 3LQ5A 3KREA 2HIWA 1XH7A 3EQPA 2YA9A 4G34A 4ERKA 3HYHA 5FRIA 4JIAA 3EFLA 4I0SA 4ZZMA 4MBJA 4EORA 2E2BA 1T45A 4QVKA 1ZLTA 9MHTA 2X2LA 3JYAA 3CGFA 2DPMA 2GH1A 4KA3A 3PVGA 2ORED 1JKTA 5DXAA 1KPHA 1YB2A 2FO0A 1Z5MA 4XLVA 3ZDIA 4GS6A 1UU3A 3R7VA 2Z7LA 2O3PA 3KGAA 3HUCA 2OKRA 2UW8A 4RJ7A 2WMWA 2JKMA 4BCMA 2H8HA 4P5QA 4G17A 5HO8A 4ZJIA 4UY9A 10MHA 4EOOA 3BE9A 2VWUA 3S1HA 3ENHA 1PMUA 2OZOA 3EQBA 5LVMA 4D1ZA 4FTIA 2ZM3A 2BR5A 3PX3A 1PYXA 4BTJA 2WQMA 4WG3A 3O17A 3BBWA 3A7EA 2FUMA 5DT3A 4DEBA 2C0TA 4FG9A 3BGZA 4QMZA 2XK3A 3RAHA 3FLZA 5C26A 5J1VA 4FKQA 1L3BA 1I44A 5E90A 3ITZA 1WS6A 3WI6A 4MWZA 4GCJA 4L3LA 3Q60A 1ZGJA 2W1GA 3ELUA 5IUGA 2NO3A 2VWWA 4O0UA 4XS2A 3NYXA 4KSPA 3DKFA 2XNBA 1R00A 4U43A 4K77A 1AQ1A 3GJYA 4EWHA 3VS4A 1WBVA 3FJQE 4MXXA 2BAJA 4YUVA 3P79A 3WF5A 3UYSA 3KXHA 1EQAA 1V0OA 3Q9ZA 4KIFA 3UJBA 1FGIA 1KYWA 1YDSE 2G8NA 4K6ZA 2VWZA 2JKOA 3FPHA 4U7PB 1O9GA 2ETKA 2H1RA 2VDWA 3AT4A 2CGWA 5EI6A 5B7VA 3VS6A 3LHJA 4JBQA 3EQDA 4YBKA 4FSXA 5IA2A 4FNXA 2W9FB 4O22A 5EYKA 4X3JA 3G5DA 5J95A 2C3IB 1PMNA 5ICPA 2PZ5A 4Y85A 4XJ0A 3UO4A 4GVJA 1MUOA 1VR2A 4ASEA 1DL5A 3D15A 2PVCA 3FMEA 4XP2A 3PFGA 5DX8A 3TWJA 4ANBA 3HV7A 2JAMA 4FGRA 3TV6A 2W1EA 1ZQ9A 2ITTA 4XOYA 2XJ1A 1QAMA 3VBYA 3QX4A 3HCCA 4PMTA 3ALOA 3TKUA 5H3QA 3TIZA 5IQEA 3EIDA 4AG8A 2NXJA 2B55A 3VS3A 2G9XA 2W1DA 4F9WA 4P7FA 4YTHA 2XNMA 5DOSA 3EGVA 5EKXA 3W8QA 5GIPE 2PVLA 4F9CA 2WHBA 4PWNA 5DWRA 1ZYCA 3P23A 1H01A 3WYYA 4RIYB 4E8AA 4MNEB 2R3PA 4RYLA 5K0CA 2VWBA 3DB6A 5H2UA 3Q9YA 3ZOSA 4KSQA 2OIQA 4U3YA 4I0TA 2RFDA 3O7LB 5CVEA 1BC5A 3KRLA 1R8YA 3R21A 2PVFA 5FBNC 3MFSA 3O8PA 1SUSA 4F9YA 1KP9A 5LQAA 3UBTA 4D1XA 3KR9A 4BCFA 5AUXA 2P8JA 1PMVA 1VZOA 5AV4A 4QVGA 4WA9A 5EQYA 4ZJVA 4E6QA 3TLJA 4RIXB 4QMUA 2KULA 2OFUA 2P3QA 1WVXA 1R1WA 2R3SA 3DQXA 3C9WA 3QQJA 2C5YA 4DZRA 5CU2A 2ZVAA 3EVFA 2FK8A 5JFSA 4O6EA 2ZBQA 5GJDA 2ZOQA 3DXYA 3E3BX 3UA4A 2O06A 3HA7A 5A6OA 4Z9LA 4LRMA 1YFLA 2IFTA 4RZWA 3P7BA 4G31A 4ERWA 4NTSA 3NIZA 2OO3A 1MQ4A 1AD5A 1GNGA 1VE3A 1Q8ZA 2CKOA 3NIEA 3C5IA 3NMUF 3GQIA 1ZMWA 3W8LA 4E73A 3AT2A 2Q0NA 3OXTA 1RJEA 4Q2AA 4CZUA 5HQ0A 5LQNA 4PX6A 4GW8A 4L7SA 2VS1A 4XG9A 1Y91A 3OW4A 3I5UA 4GOMD 2CHLA 3R00A 4YUYA 3R02A 1KPGA 3RCJA 4X1OA 5EM8A 3KU1A 4Y72A 3GC8A 3BGIA 4X2KA 2O5KA 4FIJA 3GCUA 1QANA 5BNJA 3EGIA 5AM6A 4OX9Y 2OG8A 4E5BA 2BRNA 4PGHA 5J8IA 4CT1A 3C0HA 3C13A 4MNFA 4APPA 4JNWA 4FTOA 4X0MA 2OJIA 5M44A 2OYRA 2QR7A 4FZ6A 3R24A 5FA5A 5JFVA 2ZMDA 2C0OA 4RIYA 1LEZA 3ZUVA 2XJ2A 4I6FA 4MNEA 3BE2A 2NP8A 2VTJA 4N4SA 4AX8A 2YXDA 2W06A 4RX1A 3LCCA 4O2ZA 3UPXA 3BGQA 4N0SA 3B3JA 4TWCA 3UOHA 3FTCA 3G6GA 4UWCA 4ZSLA 2C6DA 2EX4A 2XJ0A 4X63A 2I0HA 2V0DA 1SUIA 1XBCA 1DI9A 3I7BA 3OROA 4JXFA 3LOKA 4G3GA 4YLKA 3PG3A 4I1ZA 1JAMA 2A1AB 4RLLA 1XJDA 4YUQA 3PIYA 4DEHA 1HCKA 4RWKA 2XK7A 2OBFA 5DM1A 4RIXA 4WKQA 4FSMA 5I9WA 4LUDA 4NFMA 5EMLA 5EOBA 4PWYA 1S9JA 4L43A 1UNHA 4IX5A 4BICA 3E3PA 4I23A 5EK7A 3FUUA 4RVLA 1H1RA 4ZY4A 4RGJA 5AFVA 3ZLYA 2W4OA 2FH9A 2HY0A 2I0EA 5FWAA 2RFEA 4GL9A 4GYGA 3QTIA 4BTFA 3VUKA 4LL5A 3M70A 3I60A 3K54A 5EMMA 4ZTRA 2XK6A 3ROYA 5FM3A 1O9UA 4WIHA 3BWFA 4J8MA 5FTWA 5G6VA 2ZDUA 4CV9A 4K6MA 5E1MA 3FUXA 3UJ6A 4YPDA 4Y73A 3IOPA 2UZUE 2NYUA 3HNGA 5DA3A 3R9NA 4C4EA 1OIUA 3CE3A 3MTIA 5IH5A 4L7VA 2J90A 3A27A 4EZ5A 4IKPA 4NM0A 2PT9A 5HGIA 2F49A 5BUJA 5KHXA 2PX2A 3KCKA 3MFUA 2BFXA 2R3GA 2P3OA 3U9CA 3QQGA 2UW0A 4GUAA 3P5KA 2FSLX 5DSXA 1BUHA 4TYJA 3O2MA 4CCUA 4IW0A 4BCKA 2JIVA 2QODA 3RPYA 3CPBA 4KINA 3VS2A 3S2PA 3FV8A 4GEKA 2BKZA 4V0QA 3EMGA 4E4MA 4L45A 3S0OA 3UVPA 1MJFA 1W8CA 3WSTA 4M36A 3NVKI 2QLQA 5AADA 3KRXA 3NW9A 2XBJA 4J1RA 5IQFA 3R9XB 5HFJA 4BIDA 1NW5A 3FZOA 2UYCA 3HAVA 3OEFX 4YJNA 3H10A 4FT2A 1IM8A 2W4KA 4HGTA 4AT5A 3NGAA 3QRJA 4FV2A 4CRSA 2QOIA 1LR4A 4DFBA 2PHKA 5CQWA 5KBQA 2UUEA 4W4VA 3OXZA 1XH8A 4ALUA 4OQDA 3CGGA 2OIBA 3DXQA 2J50A 3HRCA 2RG6A 4AFEA 4BLUA 5IPJA 2ZWAA 2GQRA 1GAGA 3T9IA 5EM7A 3MHTA 3EVCA 4QMYA 2EWAA 2WMRA 3RAIA 1KOAA 4YHTA 4CTBA 2P3GX 3T7TA 3WIKA 4QQKA 5D7VA 1Q3WA 3PY3A 1NT2A 1O6YA 4BI2A 3PDTA 2ZMCA 3FWQA 2C7PA 3COIA 5J9YA 2B3TA 4RSRA 2UYQA 4M68A 1Q41A 5HTBA 2C6OA 5TT7A 4MBLA 2XKDA 3R1YA 1M0EA 2ERKA 5P8WA 3UGCA 2JDTA 1UKIA 3MCZA 3ELWA 4PYOA 4FSRA 3VIDA 3HAMA 3B3GA 1Z3CA 3NNWA 4EH6A 5BYYA 3ZLXA 1SM2A 3QC9A 3FY0A 4YJOA 2ADMA 1FVVA 4ZSGA 1Y8YA 4FKSA 2QOHA 3MERA 5DM4A 4R7IA 4D1SA 2Y8OA 4YUZA 4MXYA 2OSCA 1ZOEA 4X2FA 2WNTA 3RKBA 4B99A 4GJ3A 3TKAA 2CN8A 1YDTE 4BR3A 5D11A 5LQUA 4FV7A 1OL6A 1BL6A 2GS6A 4KUJA 5HCXA 2P2HA 2Q0BA 5IUIA 3KRRA 2ZSUA 2CNVA 3MVHA 4XV9A 3MPAA 4E6CA 4C0TA 4G5JA 4LWOA 3AC8A 3FMHA 4TYHB 1SVHA 4BP3A 5DH3A 3P9JA 2FYTA 1UNLA 4JDKA 1WAKA 5D12A 3PB3A 4L3PA 3QD4A 4JX3A 3VJOA 3RAKA 1XQZA 2XKEA 4I93A 3DJ7A 3ZDUA 2P7IA 2HCKA 3G7UA 3CKKA 1UU8A 5M53A 3QGYA 4EWQA 3R6TA 1XH5A 3RK5A 3TACA 4EK5A 4A4OA 3UMXA 3BYUA 4FICA 4NKAA 4OBQA 4C4GA 3QTUA 2QHMA 4HPTE 1LUFA 1V1KA 4WBOA 4DEGA 3AMAA 3G0EA 4PYJA 3NUAA 4KBCA 5CWZA 3VC1A 4BDEA 3LZBA 5FEDA 1UWHA 4AS0A 2O57A 4MHTA 2G72A 5CNOA 3M6UA 5D10A 5HORA 5C9CA 2BAQA 1KWPA 3SW7A 4D4SA 2C5OA 3BHTA 1OKYA 4CKBA 3ZO3A 4CZTA 3WZDA 2UZTA 4PRJA 3SR4A 2JDOA 4TWNA 3HMMA 2QO7A 2PVYA 4XRLA 3LAUA 3F9NA 5T68A 3P9NA 5AJQA 4QMOA 4FZFB 4F1MA 2CWWA 2YITA 2PWYA 2BILB 1FGKA 4HPUE 5CXZA 3KK9A 5BMMA 4I5PA 3VBQA 3GGFA 3GOPA 2OB1A 4EUUA 2EUFB 3DK7A 3RW9A 3QCSA 1H25A 4F65A 4DTKA 5CAVA 5L3AA 4WO5A 1WBWA 2HYYA 1JSXA 5IH3A 1WCCA 2VTPA 2YVLA 2FK7A 2WOUA 2XEZA 3OOGA 2QM3A 3IW7A 2J0KA 1NW6A 4R1YA 3TTJA 1KXZA 5DR2A 5I4NA 2WGJA 5JMSA 3JWIA 2KTYA 4BDGA 2OO8X 4ZSAA 5LR6A 4F6WA 5AP6A 5BP7A 3B7PA 4BDJA 4FUYA 4MXAA 4G3CA 4GIIA 4FEVA 2C7OA 3T8OA 3SG9A 2I6LA 3F3UA 3K5VA 4C3PA 1AQIA 5CCBA 3REPA 1BX6A 4JBVA 4TYHA 3DDQA 3OHTA 4F7JA 2ZV7A 4FYOA 2H11A 2VRXA 4FT3A 1H0WA 3HKOA 3VW8A 3VULA 3QKMA 4Y2HA 4YZCA 4JG7A 4LOPA 3BHUA 2JJQA 4OBXA 1U46A 2Y4PA 4F85A 4S34A 1UFKA 4RMZA 3HVKA 3X0DA 3LM0A 3BGVA 1IAJA 1V39A 2R3JA 1MRYA 2JHAA 3H4JA 4ER6A 3OUKA 4ZY6A 2R3MA 5IDNA 3KF7A 4DM3A 4FEUA 1YKRA 3IECA 4H39A 1UV5A 3C7QA 5HG5A 2NP7A 3FLYA 4FBXA 4CXMA 2ITQA 3RPRA 3FUWA 3F2AA 3TZ7A 3H0YA 3QCYA 3FMMA 3DUWA 2CGXA 3G2FA 4R3RA 4YC6A 3MPTA 4QNYA 2WMSA 2XIYA 4XCUA 3RJCA 2BALA 4GMYA 2EFJA 5AAFA 2CGVA 3UODA 4WRSA 2BZGA 1SVEA 1EJ6A 3LFBA 5LMBA 5L6PA 4TY1A 4QP7A 4RTJA 5AIRA 4H3QA 4EKGA 2PL0A 2R6ZA 3A7FA 4XUFA 3M2WA 4UOEA 3KQTA 4EOIA 4B4LA 1F38A 4EI4A 4NM3A 5K05A 3KCFA 5JZJA 3E8EA 1G8AA 4IBMA 5BVWA 3TV4A 2PMIA 3D5UA 4N70A 5K0NA 3SXJA 2VZ6A 4DA4A 4Z3VA 3OWJA 3OU7A 5DWQA 5K8VA 4MCVA 3SRVB 4EYMA 5IQCA 3A26A 5GIOE 3G51A 4AZTA 3MFTA 4ZP5A 4M37A 2B78A 2V55A 3BI6A 3M11A 3P7CA 1M2QA 5EOLA 2CCIA 5M56A 4TRLA 4XV3A 4O6LA 4GFGA 4C4AA 3BU3A 5JUWA 2O07A 3L8VA 5FWDA 3K5UA 5T6BA 2VDUE 4MX9A 4K8AA 4E32A 4J71A 4HVSA 2RL5A 4L3JA 2X1NA 3A8WA 3UNJA 4RRVA 4IAZA 3QUPA 3F66A 3MIAA 2I0VA 4R5YA 3G90X 4APCA 5ANEA 3OWKA 5IEYA 3PRFA 5DVRA 1X1CA 2HOGA 3RALA 3EL7A 3EYGA 2WU6A 5KZIA 5A54A 2PVMA 3HZTA 5ETAA 4CTJA 4GIHA 2YUIA 4HNFA 5IG1A 1Y6AA 4NM5A 1ATPE 2EVAA 4YO4A 1Q61A 1X19A 3CC6A 2GNHA 3IG7A 1R18A 2ESRA 4QYEA 1EJ0A 2IH5A 2PZIA 5JQ8A 1G6Q1 5FTGA 2FCAA 2HY81 3EH9A 4ZZNA 3E7OA 2ZCJA 4HRAA 2QOFA 4EYJA 4J99A 5FM2A 4QMQA 4RSSA 2G1PA 5ACBC 3BV3A 4O7LA 4AGCA 5CSWA 5GOZA 3TKHA 5EFQA 3MH1A 2Z02A 3R22A 2ITNA 3FKOA 4RVDA 1ND4A 3Q04A 3O23A 5DM2A 2B7AA 5CSVA 5HZNA 3BWCA 2F7XE 1E9HA 3RMFA 3IDBA 3UTOA 4EK9A 3ZFMA 1FINA 3LW0A 4OTDA 3QBNA 3R8VA 4XV1A 5CX9A 3TZMA 4GKHA 5AX9A 4I5HA 4RTLA 2QU5A 3F88A 3G33A 3EPPA 1GZOA 3CXWA 4M84A 4LRJA 3SRVA 4AF3A 5HU9A 4AN9A 5IA1A 4BC6A 5DG5A 4C36A 2Y1WA 4RVKA 4MWHA 2WPAA 4F86A 1ZYJA 2X7OA 3OZ6A 2PPQA 4G3EA 3PPJA 2XYUA 5IU2A 2HXQA 3KC3A 4MF1A 3ANXA 2X0GA 3F7ZA 3CBGA 2PY3A 2XYQA 4AP7A 3ZXZA 3O4FA 1YI6A 2IDJA 1CMKE 4MTAA 4F4PA 4OTFA 2IZTA 2B9FA 4KDCA 5BW5A 4DFNA 3P4KA 2YM5A 3ORPA 5JGDA 2V7EA 4QQJA 3QOWA 2I9KA 5I9YA 3PZEA 4FZVA 4BTKA 3LCVB 5DN3A 3BRBA 4FTNA 5F94A 2EXCX 4DG2E 4FSWA 4EK4A 2H34A 2VNYA 1NV8A 1H26A 3OY1A 3VUIA 1IEPA 1Q99A 2JITA 4FNYA 1OI9A 1PXIA 1O6KA 4FP9A 5CEPA 2JD5A 2Z7SA 4RJ5A 3R7EA 4EK8A 3VYWA 2EJUA 3PTAA 5CEMA 3SXSA 1HMYA 4E30A 4RPVA 4O81A 3DR5A 4RLKA 3P1AA 3I7CA 3DLCA 2QO2A 4IX4A 5DTRA 1HNNA 2OF4A 5CXHA 3W2SA 3NTVA 2OICA 4FGBA 5CU3A 5F2NA 2B52A 1DAWA 3R73A 1REJA 4YTIA 3S95A 4IB5A 2ZV9A 3JWGA 3KEXA 4EZ7A 5ETFA 3QX2A 4AA4A 5KNJA 1VBFA 3NYVA 4YZ9A 3GRYA 2QHNA 5KKRC 3P08A 1WBSA 5KHWA 5I9XA 3PY1A 3GT8A 5J1WA 4M7IA 3O50A 4ZZOA 1P1BA 3PJ3A 2HELA 5FEQA 1YXTA 3E63A 2QE6A 4BCOA 4U5JA 4RTPA 3MVMA 4QMLA 4K33A 5L8JA 2J7TA 4GQBA 5EVJA 2IJMA 5EHGA 4XCXA 3ZFYA 5CF4A 1N2XA 3F82A 3F5XA 4AXAA 4RWLA 5TR6A 4IDVA 4RA4A 1PKGA 5BMSA 4CFNA 1B6CB 3EMDA 2OXTA 4LMUA 5FG8A 4DLIA 1T43A 3PVUA 3U9NA 1RJDA 2PV0A 1T46A 4PDPA 5EMKA 1N7IA 1PXJA 3F5GA 3RP9A 3VBVA 2HXLA 2ITVA 1OBDA 3DMFA 1PRYA 3FSKA 4O7SA 1PMEA 4AFJA 3DXNA 4IQ6A 4L9IA 5HOQA 4AZFA 2F57A 4JQEA 4JG8A 3QZHA 5M07A 4HNIA 3ODYX 3FC1X 4P7GA 2DS1A 5LXMA 3ZO1A 1H1QA 4ZS4A 2QOKA 4BBEA 3F3TA 5HCYA 4ASDA 4EVIA 4TNDA 4K0YA 4RIOA 5I9ZA 4FZDB 4NK9A 2GNIA 4UALA 2JG3A 1RI1A 4LRKA 2YIWA 4FV8A 4IWOA 4GUEA 2YAKA 2FHPA 2ZZMA 4OBPA 1NW1A 1R0PA 4LUEA 2EG5A 5KKRB 1ZZLA 3HRBA 4I22A 2C5XA 3QRIA 5M08A 3BHHA 3O8TA 1R0EA 2HW6A 5FXQA 1TVOA 4UYNA 3GP0A 4BHZA 5C1IA 3FKLA 4NH1A 2YZAA 5EDQA 4AZVA 3C0GA 4D5KA 5A4EA 5HEZA 2YCSA 4X2GA 4EH5A 4M15A 2F2UA 3QFVA 1J7LA 2JGZA 2OFVA 2OBJA 1ZZ2A 3MY0A 5EQJB 3LKZA 4HVDA 4PP7A 3Q4TA 4JAIA 3LKDA 3QD2B 2RFNA 4FKLA 5BVOA 3R8MA 4D4VA 1XJ5A 4P58A 3ULIA 3SM3A 4GH2A 3TZ8A 5I9UA 2Z6UA 4A9RA 4BDFA 5L8KA 5EPEA 3R01A 4BCNA 2AOTB 4DLJA 5KMKA 4R8SA 3LDUA 2O8YA 4PNKA 4Q9ZA 3V04A 5CVHA 5L2IA 4BLWA 5CSHA 2AOUB 4QMVA 2Q41A 2YISA 5A6NA 3DZOA 3ORTA 1WBTA 1MQBA 4NSTA 4NW6A 4H05A 4PNEA 4O7ZA 4CKCA 1NVRA 5KYGA 3P9CA 2A4LA 5FHQA 2NRUA 3MPMA 4KBAA 2JLDA 4OT6A 1MHTA 3RCDA 3R9RA 4QP6A 4LFIA 2OZAB 1YWNA 4ALWA 2PU8A 2YX1A 3JXWA 3CIKA 4TN6A 2LAVA 4U3ZA 2OZVA 4MIKA 3E8SA 5CT0A 3OS3A 2C6EA 3EQFA 4BYJA 3A25A 3NX8A 4LQMA 1SKMA 3OMVA 4PL5A 3DTNA 1KE9A 2EB2A 4ZLYA 1GJOA 2P7HA 3DGKA 4M97A 5EC8A 1YHSA 3ZMMA 2VWXA 2NXCA 3PXKA 3FL4A 4C33A 2O65A 2O0UA 1A48A 4UYAA 2PZYA 2FSMX 5ERGB 1E1XA 2R3KA 1SNXA 3ENMA 3B8QA 4ONAA 3G88A 1Y8CA 4KKEA 3HV4A 3PPKA 5HZMA 2UZLA 4CQEA 4H0NA 3CSVA 4MXCA 5AP0A 3A2CA 3OVVA 1WFCA 1GIHA 5LVNA 2XYRA 3Q2MA 3R63A 4EH4A 1SQGA 3BU6A 3IW4A 2AYPA 4NYEA 3A7JA 3W1FA 3PJ1A 3JPVA 1QPJA 3OTVA 4RQKA 4Y5QA 3A7GA 5A14A 4FK6A 3NYNA 4FEQA 5H02A 5C4LA 5KQSA 3PVBA 3ELDA 1L1EA 4BTMA 4V05A 2PX5A 4XHKB 1N7JA 4R3CA 1PXKA 3ZC5A 3R7YA 5IMEA 5CVGA 4A9TA 2QONA 2G2IA 5DTMA 2BIYA 4NFNA 4X2JA 2R2PA 3HEGA 2Z6AA 3HLLA 4M3QA 3EQRA 4FX3A 4RFZA 3HGKA 4TTHB 3HVCA 3NNVA 5FD2A 4FG8A 4F70A 2HMYB 2JAVA 2AOUA 4HOKA 3UNZA 4YPSA 1KV1A 1OPKA 3KPUA 5HIKA 4FL1A 4ER5A 3QHRA 3I53A 4DCMA 4F7NA 3FYKX 3HA8A 2X6EA 1YHWA 2GA9A 5HG8A 5CTPA 4CLIA 2OZAA 3KA0A 3OBGA 3DA6A 4YJQA 3ZCLA 5HVJA 4FKGA 3GVUA 2X39A 4P7KA 4GFOA 5C1QB 1IXKA 4RC2A 1BL7A 4AA0A 3V8TA 5AP3A 2PUIA 2A2AA 2BVAA 2VO3A 4HYUA 4AZWA 1IA9A 4NKSA 3AD5A 4FVPA 4R1VA 4MXZA 3MN3A 2J0JA 4FSDA 2R3OA 4O2PA 2XKFA 2IH4A 1UWJA 3ZSGA 1YXXA 3ZU7A 4XG6A 2PXXA 1OL5A 3F2NA 2HZ0A 4WD5A 3FHRA 1ZG3A 5CASA 2ITYA 1U5QA 1RI5A 3FAAA 3K6RA 4KBKA 1VL5A 3UC3A 4YJSA 4Y5HA 3KQPA 3UJ9A 4BF2A 1OKVA 3SLSA 1OL7A 4B6LA 4AGWA 4KW7A 5K09A 3OFJA 3PXFA 2QNJA 3GIWA 4RX8A 2WTVA 4WNKA 2JFLA 5EW9A 4GOOD 1TW3A 3G5LA 4EHEA 1BYGA 4FTRA 4IZ5A 1ZY4A 1JKLA 2HWPA 4Z16A 3CJGA 4QTAA 3FZRA 4PYQA 4QP8A 5DRYA 2QQ7A 3BEAA 5HIDA 3NYOA 5E1EA 4MD8E 4WHZA 3DTCA 5J7HA 2YDKA 3W2CA 4C3RA 3DTWA 4BDKA 4C2WA 4LOQA 3TQSA 3GNIB 4KIGA 3I0OA 4GT3A 1NVSA 3AQVA 4LG1A 4F9BA 5ANOA 5D9HA 5AA8A 2Z60A 1F0QA 3D2IA 5KBRA 4IAIA 4QMXA 3CTHA 4B7TA 2FYSA 2Z7QA 2ZVJA 2X2KA 5KO1A 5C8KA 3PX2A 4E33A 3UNKA 4NM7A 4FUXA 2C0IA 3LLTA 2RKUA 2YDJA 4FKOA 4CFVA 3DBQA 3UQGA 5L2WA 1XKKA 3GRVA 3GNLA 5E1SA 3W10A 1ZOHA 4D4RA 4IVDA 2JIIA 3HVHA 2XYNA 5IEVA 4PNIA 3A7DA 1Z57A 3FSFA 2JHCA 4E4LA 5DR6A 3U6IA 2HAKA 3A61A 3VN9A 2ACXA 2IW6A 5HLWA 2BRMA 3CCNA 3QF9A 4IX6A 5E8SA 2V5QA 2QCSA 2X7GA 3TG1A 1Q3DA 4Y95A 2W1IA 3VHKA 3O71A 2PLWA 1UWVA 4Q9SA 1OUKA 5E8YA 5LMAA 5AP2A 5JH6A 4FVQA 4IWPA 4ZY5A 2VDVE 4CFUA 5FXSA 3ZTXA 1H28A 3ORXA 3Q4UA 3GUBA 3KPJA 5C03A 3ERCA 4EJNA 3P78A 2I7CA 4GF5A 3GRUA 3Q52A 4FT4A 1AQJA 2BZKB 4DEAA 4C62A 5BUEA 1NXKA 5JFXA 3GCPA 4KVZA 4I3ZA 3GRRA 4F6SA 3E92A 5HBHA 3KR1A 4ORKA 4F1OA 4EBVA 4BDAA 1JG4A 5K0LA 2C1AA 5CVDA 4R7HA 3GQLA 3KN6A 2XM9A 3TOSA 2ZYBA 1NVQA 1U54B 1CM8A 4GRBA 4RTNA 3DBCA 4BB4A 1JQDA 4ER7A 3KQMA 3BQCA 2YM7A 5JRSA 3EVAA 3UJ7A 4IVAA 4H3PA 2YR0A 4GU9A 5FLFA 4K18A 4BY9E 2C6LA 1PKDA 5KS2A 1FVTA 5JN2A 5K3YA 4GOND 3ZRLA 4EHZA 5KMMA 5M51A 1IY9A 1RI3A 4FKIA 4Y83A 2VTAA 2JKQA 5CEQA 5ANGA 3EHAA 1ZY5A 4JG6A 4RX7A 5A4LA 4YZNA 3E62A 4YTCA 3BZBA 3ATSA 4TW9A 1RI4A 3EVBA 4WUAA 2IIPA 4F9AA 3H9RA 3QUDA 2Z8CA 1WVYA 3VS1A 4RTOA 3PA5A 1CSNA 4FIIA 4C37A 4W8DA 4PMSA 3PLAE 3ORMA 1Q8TA 3OCTA 2GPHA 4EH7A 4RV9A 3L8PA 2DYLA 2C6TA 3REOA 1R78A 4L42A 4MAOA 3NSZA 5BVFA 1EAMA 3G2PA 5EQEA 4QO9A 3P8ZA 2VZ9A 2ZM4A 5CI7A 2IZRA 3UZRA 2Y6OA 2QO9A 5CENA 3ERKA 2J0MB 2GNJA 4XUEA 2OH4A 5AA9A 2JIUA 1YWRA 4GT5A 5IH4A 1XH6A 3VAPA 1DUSA 5HE2A 4J52A 5EM6A 2EB3A 2JEDA 5DEYA 3LXKA 3FTFA 3F6XA 1J3HA 2BM9A 1RJBA 4BCIA 5AMNA 3F69A 2JBOA 3OZTA 3T7RA 1EH4A 3NWBA 4YO6A 3UPZA 2VGPA 3VQUA 5C8NA 4U7ZA 3K0BA 4TPTA 4EK3A 4J97A 1OIRA 2ZIGA 3GU8A 4UWBA 3TI1A 4POOA 4IZ7A 3HV6A 4AN3A 3OXIA 3T3UA 2VN9A 4C4FA 4CG9A 4MQ4A 2OF2A 1P5EA 4JS8A 2I1MA 3NUYA 4NUSA 4MD7E 3W18A 4KS8A 4LECA 2F4JA 3MTLA 3KMWA 5DPMA 4RIWA 5BYZA 4I0RA 4IEBA 4PDOA 3DJ6A 3NW6A 4UZHA 5F2KA 1U54A 4KKGA 3PJCA 4FIGA 2QR8A 4EBWA 2OW3A 3N51A 4G6NA 2GSFA 3FRIA 1K9AA 4RTKA 3BWMA 2PMLX 4OTQA 1LEWA 4HW7A 1Q8UA 3KVXA 4DTBA 5DPVA 1BLXA 4GEOA 4WUNA 2PYWA 3KQSA 1BI8A 3EYHA 3LXNA 3TL8A 4QTCA 5AV1A 4BDCA 4DG0E 3Q2JA 5M4FA 3O96A 2WTDA 3R83A 4G1WA 3JWJA 2IP2A 2REIA 3BYVA 4QQ5A 4OTHA 4TKSA 4IZYA 2R5TA 1UIRA 1I09A 4OUCA 4M38A 4GK3A 3NCZA 2OJJA 3OY3A 3FYDA 3PZHA 1U5RA 3ANQA 1YI4A 4YSJA 3TKYA 3SKCA 2XKCA 3MTEA 4BCGA 4CXAA 4X6RA 3WBLA 3QALE 5B2LA 3OC1A 4WOVA 4CWAA 5BPYA 3PTGA 3IONA 4CKEA 1GIIA 2IWIA 1JQHA 2X9FA 4HJOA 5CLPA 3QTSA 2OJ9A 3PJ8A 4AGDA 1PJZA 4O7RA 3WYXA 2JBPA 3EVEA 1YW2A 5CVFA 4KRCA 2CKDA 5FUBA 3H2BA 3FUVA 3D2LA 2VU3A 2YAAA 5HD7A 2V74B 2NXNA 2UVXA 2X4FA 4FYNA 2BZHB 4QPNA 4U45A 2ETMA 3KU2A 5LJJA 2E9VA 3VW6A 2JC6A 4U80A 5LVLA 1L3IA 4AUAA 5E9QA 4AOJA 1YXVA 2UZOA 4EHVA 2QVSE 3LJ1A 4CRLA 4E1ZA 5E1OA 1URCA 3KKVA 4JX7A 4MK0A 3UIXA 4TXCA 4CLJA 4AE9A 4DE4A 4M13A 8MHTA 2PE0A 3C6MA 3LIJA 3LECA 3F3ZA 3VF8A 4P7EA 5K03A 5LVOA 3GC0A 4J53A 3DP7A 4A7CA 3ZRKA 5CZIA 4ZK5A 5AIKA 2IZSA 2XK8A 5DLYA 1CTPE 4XP0A 2G01A 3BHVA 5AAGA 2JHPA 2RF9A 2R3IA 2XVAA 3R6XA 2NXEA 3NEWA 3G8AA 4G6OA 5M55A 3BT7A 4F1TA 4ITIA 3UQFA 4FIEA 4KB8A 4FTMA 4QYFA 5J87A 4DH1A 1VEBA 1CDKA 5LVPA 4RWIA 3NRMA 3DCVA 5CVJA 3V3VA 3FE3A 2WEIA 3QYWA 1ZYSA 4KABA 4DBNA 3NNXA 3EWHA 3ALNA 4OBWA 2WTIA 2O05A 1YZ3A 5T64A 2BZIB 4FR0A 5HKMA 2BIKB 1P2AA 4EOSA 4ASZA 4D2RA 3VUGA 5E2AA 3QC4A 5K0BA 2F7ZE 2UZ4A 5A4TA 4IDTA 4PTEA 4EONA 2JFMA 5DHJA 4RWZA 4BZOA 1QYRA 3L9NA 3KRJA 4EH2A 2YM3A 3A62A 2BRGA 2OY0A 4XG7A 3HP7A 3ET7A 5GWXA 3ZFXA 3U54A 3GC7A 3C5UA 2X4ZA 3N4TA 4PYKA 4TWPA 4NWMA 5E1DA 2W1CA 1WBPA 3F5PA 4PP9A 2ZW9A 5F95A 4YJRA 2CMGA 3OFMA 3OZRA 2GTMA 4YV2A 3F61A 4N6ZA 2XNEA 5EYMA 3Q5IA 4EC9A 3UIBA 3TNHA 3BELA 3DOGA 3I64A 1REKA 1I1NA 4QQNA 3ACKA 4G9RA 5FP6A 3QOXA 5HEKA 5G1XA 5K0FA 4V0RA 3NPCA 3HMPA 2VTSA 5C4KA 2PZPA 4F7LA 1XTPA 4DAWA 5CF6A 2ZWVA 4QTBA 2P41A 1JTEA 2YXLA 3GU6A 4A6EA 3JS2A 1YUBA 3ODZX 5E1BA 1SVGA 4RJ6A 3BHYA 5EKNA 2G71A 3ME5A 4OQEA 5CIYA 4D9TA 2P35A 4EEVA 4ISCA 3ZYAA 1G60A 4AW0A 5AWMA 5IF1A 5T67A 4CTKA 4HCTA 3EN9A 3MIYA 4KKHA 1OBGA 1MRVA 3MB5A 3CBLA 3UG1A 2Y6MA 4PIPA 3NJRA 2IH2A 3E87A 4JAJA 1PXPA 3MA6A 3P86A 4CD0A 2YCFA 4KDRA 3THBA 4GG5A 5HVYA 4B17A 3GU4A 1LP4A 1YXSA 3HCEA 2PBFA 4QOXA 5LQJA 2AN3A 4HTFB 2ZZNA 2XS0A 4JQ7A 2I40A 3KXGA 1OR8A 2ITUA 4QQCA 3THRA 4R78A 3A60A 2F2CB 3I4BA 3H9FA 4ZAUA 4RFYA 3RI1A 4XNEA 4YMJA 4PYMA 3AJDA 1CKPA 3GB2A 1M7NA 1X1DA 4EQCA 5HICA 2YIRA 5JRQA 1PXOA 4RTRA 3EQHA 2GS9A 1GY3A 3AXWA 2ZBRA 3AG9A 3Q53A 3SG8A 5HNIX 4B0GA 4S30A 1S9IA 2VWVA 4DQ0A 4FV0A 3UVQA 1DM2A 5JR3A 4I94A 1EG2A 4QTUB 4BHNA 3HVIA 2PVNA 4IVCA 5LCKA 5HIJA 5JFWA 4IAYA 4RVTA 1YDRE 3ULZA 2IGTA 3DU8A 3M1SA 1ZAOA 3RHKA 5BVKA 2HW7A 2V7AA 3U55A 4O7NA 1OECA 2JH8A 3LQ3A 3P2IA 2WIPA 4CEGA 5JZNA 5HTCA 3TUBA 1SMHA 3FMDA 4U44A 4X61A 5A46A 4TYIA 2VX0A 4BGGA 3ZBFA 3OT8A 3QD3A 4JR7A 2BR1A 4H3BA 2WAJA 3LJ2A 4ANMA 2HWKA 4PL4A 5AV2A 3QXOA 1PYEA 4CVAA 3FUTA 3IOKA 5AM7A 3ATTA 2QOQA 2UZWE 3MESA 4DBXA 3SOAA 4D5HA 5EW8A 4PY1A 4IC7A 3UOJA 3DAEA 3L1SA 3S68A 4AE6A 3UDBA 2DWBA 4BRXA 3TMAA 1W83A 4BCJA 3VVHA 4O21A 4IANA 2VO7A 3IYLW 3T9TA 5E4HA 1F3LA 2CKPA 4PYLA 3MJ2A 4Y8DA 3RHXA 5M4UA 4L00A 2BM8A 4O7WA 3D9VA 3DFCB 3JVSA 3DB8A 3OWLA 4IX3A 3R2YA 1A06A 5BXYA 4GU6A 4E26A 2X6DA 3A99A 4IWDA 2XEYA 3L9PA 4HTFA 5CY3A 4QP9A 3HTXA 3QTXA 5CUQA 3QKLA 4RX5A 3SV0A 4BLVA 3QQLA 3UJAA 5KMOA 5MHTA 4UXQA 3N4VA 2JDVA 3FL5A 1V0BA 4I4FA 5HVKA 4OTIA 5LQFA 4XLIA 2YM4A 4ANLA 4PCLA 3G6HA 4XG2A 3F7WA 1H1PA 3MVLA 4EOLA 1ZXEA 4RJ4A 1SYKA 5D1JA 3QHWA 3P7AA 5HNBA 5B2MA 3CJQA 5EDRA 4IM2A 4W8EA 4X60A 2XUUA 3NWWA 2BCJA 3SSMA 4FV9A 3QKKA 5DBXA 1FQ1B 4USFA 3LVPA 3GFWA 3H0ZA 5EYCA 4C4HA 4U7TB 4QYGA 4HH4A 3GI3A 1P4FA 4Y30A 5CEIA 3KMUA 3KMMA 1WBOA 3KQYA 3VHEA 5EG5A 5AV3A 3MGGA 3QTQA 3LBYA 1FMOE 4AWIA 4X2NA 2RIOA 1VLMA 2C4GA 1BOOA 3HUBA 1XXLA 3A7IA 3TUDA 2ZJWA 4M67A 4Z2YA 4QMMA 3ORZA 3KF4A 2PWLA 3OTUA 3GEQA 5T3QA 3ORKA 3BWJA 5AP4A 3GENA 3KPWA 2XF0A 1PXNA 2YJSA 2EU9A 2R7IA 3EN5A 5LWMA 2IVUA 1JNKA 4C3FA 5HU3A 2W5AA 1NY3A 3G2QA 3R8UA 3B2TA 4NIFB 4PMPA 3EZVA 2Y1XA 4IM3A 3V5TA 4TZRA 1O9HA 2IDKA 3AC3A 2XK4A 5IQAA 3M6XA 3AD4A 2VTOA 4HC4A 2F8LA 4CGAA 2R9SA 3TNWA 1Q24A 5L8LA 3MSSA 4U41A 4CFXA 1Q0TA 1V0PA 3LE6A 1M2PA 4FKTA 2YIQA 3FTDA 1JG2A 4OR5A 3E05A 2XIXA 4YGAA 4FGZA 4M12A 3I5ZA 4IB1A 4PF4A 4GYIA 5KQRA 2GNGA 4DHFA 4J98A 3RAWA 1R74A 3ZM9A 1UNGA 2XM8A 4UWYA 3QYZA 3LFNA 4CMOA 3UG2A 1YF3A 4JBOA 4AAAA 5JKGA 5AP5A 3C4XA 4FIHA 4AW5A 2XB7A 3WF6A 4FC0A 3HV3A 2GQSA 3CEKA 3O7LD 3PXYA 1INLA 2NRYA 1M7QA 3FLSA 3SX0A 2XYVA 5FA8A 5EHIA 1M2RA 3ZM4A 3ZUUA 4ZIMA 3VO3A 5L6WL 1TQMA 3SMQA 4IM0A 3ACJA 4EUTA 5EEHA 2J2IB 2J9MA 3EVDA 5DE2A 2F7EE 4ZMEA 1L9KA 2OIDA 4CNHA 3L8SA 4NT4A 2C3LA 3BPRA 4I24A 5J5SA 4UV0A 5BVEA 1CKIA 3O51A 1HCLA 2XVMA 5JGBA 4IE9A 3PIXA 3LKMA 3EMBA 2I6GA 2PMNX 2C7RA 2ERCA 3FLQA 3EEOA 1G55A 3R3HA 2O2UA 3BYMA 3GOKA 4FNZA 2OI4X 3BKBA 3CP9A 4F64A 3CPCA 5EEGA 4JDHA 3DMHA 2YIYA 2G2FA 4J96A 4CFWA 3MWUA 3NUXA 3VRZA 1QPDA 2LD4A 1H08A 5KCVA 2UW3A 1YZHA 1WMKA 4ANSA 3OU2A 2WD1A 4EJ7A 2R3QA 4BI0A 1FPQA 4PV0A 4ZTSA 2H6DA 5AP7A 2YDIA 4QNAA 3MTFA 3EZRA 1ZHFA 2WMTA 4IH8A 3M6WA 3CGOA 3NUPA 3S00A 4MQ2A 2CMWA 3QV2A 1FJXA 2Z2WA 5FQDC 2ZTHA 4GV1A 5ETIA 4DGGA 3OW3A 3MH3A 3ZZEA 3W16A 3SSNA 3W2RA 2ERZE 4ER3A 5HESA 1RI2A 4X41A 3RODA 4FODA 1H07A 4Z55A 1M6EX 3I81A 1U59A 4FTLA 2IVVA 2OJGA 4WG5A 5E8RA 2YIXA 5FDPA 3F2RA 4IV8A 3QCXA 4NJDA 3SOCA 2AVNA 3R8ZA 5HD4A 3B8RA 1RJFA 4G9CA 1XH9A 5FGKA 4JXJA 5CU4A 3VBTA 3UJ8A 3Q4ZA 1P1CA 3WILA 2OKCA 3QXPA 4EK6A 1BKYA 3IS5A 1UU7A 3I0QA 2QG7A 4MKCA 4EH8A 2R3NA 3DH0A 3EOCA 4HGSA 3B2WA 1OZ1A 4FTUA 1BKXA 4BVUA 4YU2A 2ZIFA 4FMQA 4YURA 4EQZA 3GCVA 4DCGA 4J95A 4A9SA 3FZ1A 3DK3A 4WNOA 2J5EA 5B2KA 3SA0A 5CVUA 1KIAA 3QZIA 4PL3A 1U2ZA 3VBXA 1X8BA 5EW3A 4BCHA 5AUZA 5ITAA 3C4FA 3BCEA 4O27B 2H9VA 4H1JA 5CAOA 4R6XA 4DFUA 4V01A 3FKNA 3CD3A 4HZRA 4Z7HA 2CPKE 3O0GA 3UO5A 4X21A 1KPIA 3EEYA 4Q5EA 3QA0A 3Q87B 1B39A 3G2OA 2AVDA 3P97A 4XH6A 2ZDTA 4D0WA 2YN8A 3IW8A 5EI8A 1FP2A 5AUWA 4F84A 3PXQA 5IISA 2C3JA 4HCUA 3PXZA 1Y8GA 3NDMA 3EKNA 2IN6A 1ZKDA 3OCJA 3TR6A 3AY0A 4O0WA 3DXZA 2YZLA 4UBAA 5EKUA 1OUYA 3KXMA 4L67A 2Y9QA 4F0FA 3NAXA 1PF8A 1OITA 3VC4A 3MW1A 2UW5A 1YOLA 4FSYA 5HE3A 3SXRA 3AWIA 1VYWA 3SHEA 5AV0A 4ARKA 3BQRA 3KRWA 4CKIA 5DSTA 3ZONA 4G16A 2A0CX 3CLYA 4QQTA 4AU8A 3A4OX 4NECA 4G6LA 3R7UA 1ORHA 2UVYA 3VS5A 3OUNB 3QTZA 4E93A 4HVGA 3WARA 1Q5KA 2X8EA 2J51A 1JOWB 2IPXA 5HX6A 4RC4A 4FTKA 4C06A 2OJFE 4FSQA 3DNEA 2PTKA 3FQSA 4DGNA 3QWKA 2WB8A 4TL0A 3SVVA 5JSMA 2FB8A 1JQEA 3WZJA 3C0IA 4E2WA 5ICGA 2CGUA 2CLQA 4YJVA
chains in the Genus database with same CATH superfamily
3CV3A 3E8NA 2Q45A 3AETB 4IXNA 1XSEA 4Y2RA 1J0BA 3AUUA 1ZINA 5E3IA 3MB7A 3B1VA 5FLEX 4XM1A 4HCVA 1FP4B 3ELJA 1W0XC 1K5DA 4FFMA 5K0EA 3COHA 4BQIA 5FPSA 2IYSA 2HIGA 3A6FA 1AUOA 3UQZA 2IDMA 3TUCA 4BDIA 5AUYA 1XZNA 4NY1A 2VR1A 3NUUA 4MQMA 1U7XA 4FGSA 1Q20A 4Z1OA 3RVGA 1EZ4A 3K5HA 1IN7A 2QVZX 4NE7A 2OR3A 1JR3E 3MTQA 4ML3A 1BDBA 5K0GA 1CEYA 1PFVA 1DI0A 3HVUA 5LQKA 3V8BA 3DNPA 2BRHA 3K9FC 2GLTA 1QRSA 4BX9A 1LW7A 3CVUA 4KREA 1NWCA 3ZWYA 2OMKA 2R47A 4V2IA 1U1CA 1M8GA 4II3A 4YFYA 4CT5A 4GQAA 4TV9A 4ZO4A 2WYHA 1R6XA 3STWA 1A5TA 3V4LA 5EQTA 5TO8A 2R3LA 3EC7A 2JJ2A 4ZMBA 2QK4A 2H1HA 4HR7A 1NJSA 2OYCA 4GBED 1W7HA 2P33A 2GK7A 4WIAA 2FG6C 5E8XA 4MPPA 2XBMA 1A1SA 1M2GA 1Z0DA 3LFFA 4G0WA 2ODQA 2HBQA 2Q7DA 3ER9A 2R6JA 3ZE8A 2BJVA 3N3BC 4G56A 3EF0A 4FI3F 4O84A 5TY0A 2Q8QA 1XXHA 4U4AA 3IP6A 4IWQA 5CVCA 1Z82A 2XB2A 4TYEA 4RGYA 4TRRA 4DHZA 3FGNA 2FPSA 5GONF 2CNUA 1TJ3A 3IT2A 4CG0A 2WF6A 2AC2A 1XMMA 4R3PA 3QELB 1DC4A 4QXPA 1ZRSA 5BNIA 1D7OA 5EJ6A 1JHXA 3AJ9A 1MP8A 2BUAA 2VZ8A 5I9VA 3FCSB 3JQGB 4PUZA 3ER6A 1MRNA 3M6IA 2PT6A 4HWRA 2HU8A 1XPJA 1H1LB 3D5VA 5CFLA 1PG2A 1O4WA 3CUSA 3CIOA 2B1PA 1ARZA 2WQOA 4CSVA 1KDTA 5EIBC 1G16A 3IKAA 4WOPA 1Q6YA 2OCYC 2ZJ5A 1G5PA 3KXZA 2GJ4A 3W78A 4O83A 4F7SA 1URPA 2QN3A 5DM60 3ZE9A 4YJPA 4H15A 4IQ0A 2V7OA 4NCTC 5H9BA 1RRKA 3WV5A 5JS8A 3ZJVA 2FN9A 3VSCA 2J3QA 1ZEJA 4CI9A 5IA0A 1TW2A 1QZZA 4TLAA 4E5YA 3HMNA 4LF9B 4AKIA 3E53A 2QX4A 3OURA 1C8LA 3DLIA 1NVFA 1RXYA 3AWDA 5L2TA 4NAVA 3TEFA 1CVLA 4G67A 4MPRA 4ZEXA 3A1VA 4Q9LA 2H54A 4DQLA 3P2EA 3DMRA 4I41A 1QAQA 2O5CA 3BLAA 4LDRA 4WNYA 4DFZE 2QTNA 3TZBA 3C48A 4KIOA 5E6RA 5DGZA 4UU7A 4P2KA 5JPIA 1C41A 2OHXA 3BULA 1SD1A 5CA0B 3ENNA 4BIEA 1ZN2A 2PKWA 2WQZA 3FPKA 3L46A 4BYMA 3BE5A 2NP6A 1BVRA 2LRHA 1FE8A 4MQLA 4OTWA 2IV7A 1N25A 1N6HA 3UP2A 2B0QA 1SCAA 4MUKA 5DYJA 2CB9A 3GFGA 4OPMA 5G0VA 3ADOA 4UUNA 1KAMA 2ZIEA 2WMBA 2RCNA 1LS1A 4LRYA 5JXJA 1VIYA 1YFZA 2D7DA 2DUMA 5KNDA 1C3EA 1PSDA 2BDFA 1JZSA 3ZHYA 3RVKA 4ZZIA 4HRVA 5ESWA 2WFMA 4FTJA 4FHZA 1BDHA 1HYHA 3KAQA 2ROQA 1YU6A 2WVHA 5HWSA 1TYCA 4PYNA 1MV5A 3GLGB 2BFMA 1L6IA 2VI5A 4MXOA 2QLNA 5ED0A 2QY9A 1X9GA 4X8OA 1NKTA 3TM4A 4GE0A 4RFMA 3EDQA 1CZHA 2ZSIA 5EH0A 1HNXB 1ZRZA 1SA0A 3TNQB 3UC9A 1JG3A 4C1NA 4JFRA 4JDJA 3RRMA 3PXRA 2IW9A 2F3TA 3KVOA 3KX2A 3WKCA 3BRCA 3AD6A 5E4JA 4OQYA 4MUIA 2UW7A 4FFBB 4JT9A 1Y5IA 3HQ4O 3RYCA 3Q9UA 1RW4A 3E22B 5GZ3A 2O63A 2RI0A 1OH6A 2XIRA 4ZI5A 3J81A 3NC0C 3R1QA 1JIKA 2H96A 3NR2A 1C7RA 4RV4A 1WPGA 3RLIA 4L9RA 2PUEA 1COZA 2XWJI 3S2ZA 1KMMA 4QFCA 2YNMD 2NW6A 2O5EA 4EARA 2PMFA 2OHVA 1A72A 2H4FA 3P4YA 3I0ZA 4AXDA 5HG0A 4I6JA 4FBGA 4A36A 1AG9A 2ZITA 3LVRE 3I23A 1WZNA 2CLEB 4IACA 2RGEA 5J1SB 3DOFA 4KIPA 3BK2A 3VKHA 3IR5A 1TQPA 2ZCVA 4RZSA 1II8A 5A3RA 1QHIA 5CPBA 2G76A 4NESA 1JKSA 3OEHD 1PJRA 3GRZA 3O74A 1JEQA 4XBRA 5CANA 3NUSA 4NU1A 2P9YA 3ZD7A 2PLNA 4FE2A 4DH5A 3F5UA 4MAAA 4C2VA 5M7EA 4PSUA 4YLEA 3MBIA 2CD7A 4R1OA 1XNRB 3HXMA 2G40A 4RM3A 5AI5A 4F2PA 4F7WA 1S89A 2Q1SA 3GLIE 4BZNA 3LIIA 1F8XA 1H00A 4TKVB 2GMXA 4MVJF 4UQPA 1R6UA 3W33A 1JHDA 1DRVA 4QG3A 1TB4A 5FDXA 3LFDA 2X42A 3PT9A 1D5WA 3RHFA 3R41A 4Z8YA 2XRUA 4WOJA 4JI9A 2TSYB 3H1AA 1UFRA 4FKVA 4KK4A 1W82A 3COJA 1N2GA 4BGUA 3TN7A 4PCAA 2QUIA 5LA6A 3ETGA 1R8XA 4RIHA 2FPIB 2NT3A 4EA8A 5LFAA 1XQXA 1QQTA 4B2IA 3B3QA 1P5RA 1PT9A 3QMMA 3OX2A 2FPOA 4ZCPA 1ZGAA 4HGYA 2OGVA 2C5AA 4FMCB 2OORC 1XU9A 1F8YA 1FRZA 4J1SA 2ZB0A 2BEJA 4NPAA 5JC1A 4XWKA 3JD2A 1LW6E 3K96A 1SBIA 3ISTA 1D1PA 1U7TA 2ECKA 2JVIA 2B1GA 4M14A 1YDFA 3E5AA 4NCJA 4R5MA 2BROA 4ACCA 4LXUA 2ONJA 4G2NA 1SN7A 2WELA 3QVOA 5LZ5A 4PSDA 1KK3A 4DFLA 4A0HA 3DHYA 1GPMA 1L7QA 4ZOGA 3VNTA 1XZIA 5BN4B 3H11A 4KHZA 4RLQA 4BBMA 4YJ3B 4UVIA 2H2FA 2WV9A 3A6HA 4BJJA 1SXGA 1BZYA 4O7VA 5EJ7A 3WBJA 1SCUB 3O8LA 4YMVA 2Q9AA 2EKPA 5B3KA 2P4IA 3U8WA 3NHUA 4P53A 3IEXA 3CTJA 4JEUA 1NBOA 2R00C 3LC1O 3GYBA 2OH0E 2QVBA 1C9MA 1TZKA 3UHPA 5AM5A 3H0EA 4W1SA 5FR1A 3UC5A 3RPVA 4WMLA 1DAIA 1RYEA 5M4CA 1ESMA 4K86A 1RJ9B 4BUCA 1A5ZA 3S2FA 2EHJA 4FMBB 2VDLB 1NI5A 4DINA 3UJDA 2PXCA 3LP8A 5K0SA 1JDSA 4AROA 1ZMOA 3FUCA 1K89A 3HGMA 2RBEA 3OFKA 4PHCA 3OEZA 4O29A 4DPMA 1XDGA 4F5YA 4AF7A 4E31A 1AS3A 4UPVA 2H7YA 1ACJA 1W47A 1PNVA 5EJEA 3OTIA 3N8DA 2PJDA 2BFFA 4Q34A 4ZFNA 2VTTA 3DY7A 1LTQA 1C30B 3DMPA 4H7EA 4XMOA 5AXAA 1KSFX 1SPXA 1F5NA 3G2LA 1HE1C 3V51A 3EQ7A 2CNQA 5F9MA 1XK7A 1E1MA 4OTGA 4E5SA 4EY4A 4CG8A 3OPVA 4OHUA 4AW2A 4IW3B 3D14A 1ZI9A 2ZROA 3QYAA 5A4QA 5BV7A 3PXUA 4MVFA 4F0JA 1G5SA 1A7JA 3PCXA 3QWFA 2PLAA 4MIOA 4IX9A 3PI6A 2V22A 1OY1A 2RAFA 5IEJA 1T4GA 2J6MA 3RZBA 3QZFA 5JJCA 4DCJA 2OXIA 4JSYA 4OP1A 3O3NB 2GU8A 2WTKC 3K09C 4LV5B 1G8PA 2O2EA 2DLNA 1VSQA 3G0FA 4FVRA 3A70A 2JJ1D 1VYTA 4GW3A 5F2EA 4DRZA 1RMQA 1SVOA 1UJ4A 5TT0A 4UZDA 1MIOA 2BKKA 2CXQA 3EUWA 3GD7A 3SXFA 1NFQA 1JDBB 4KMRA 3L4SO 4GZ6A 3GJ4A 4WLNA 3K0AB 4HRYA 4LJ4A 4ALVA 5B58T 1PQWA 4MX8A 3QUCA 1VQ1A 3AGPA 1U8UA 3L40A 3A04A 5DYIA 4JI4B 1ZYDA 4BVJA 1TUBB 2XPCA 3EGOA 4MVJA 1YKFA 5KWSA 2VP9A 1QK3A 5DLPA 2BUBA 5CGZA 1QTRA 2I1VB 3NNSA 1E4VA 5LQMA 2CFCA 4UAUA 2QOEA 2GMWA 3U51A 3EQIA 3KVNA 3KYDB 1T4MA 2CLOB 1QCFA 2P1DA 3Q9XA 1OV6A 3OWOA 5DYGA 2ZM5A 5LNK6 1F5QA 4O96A 2G4CA 4FKUA 2GUGA 4LJLA 1OE0A 3FQHA 2P62A 5FH9A 4YBZA 2Q3LA 3H5WA 2UZEA 2O19A 1NSYA 1OL2A 4GLOA 2BMEA 3TV7A 4MV5A 1RZUA 2I99A 3A9TA 3B89A 4CCBA 3D7ZA 2RHHA 4CG3A 4YJ2B 3I9NA 1OFGA 5WRFA 3KOMA 1ADCA 4WCFA 4OA8A 3QTBA 3HO6A 4N57A 1Z5OA 2DQ7X 3OBBA 2H9IA 2QRKA 3LCSA 4IJPA 3KQQA 3ZWBA 4V03A 2W6OA 3R1NA 1KKLA 1Q7BA 1N2IA 4DDUA 1R4ZA 4V1CB 4BFLA 1T1IA 4U40A 2V5VA 1RWWA 2CN5A 5LZ4A 3F3VA 1EFRA 2JLUA 2VTVA 4RNDB 3LBFA 4HXEB 4CDGA 4BMCA 5L7TA 3G9NA 3BGSA 2LUOA 2AGVA 4H0FA 3IURA 4IJUA 4AYWA 3N0TA 5G0WA 1MC4A 4AD8A 3ZZ1A 3R9HA 3D81A 1P4OA 4Q4DA 3KEOA 1U2SA 2EW8A 3PY0A 5FWXA 3OA2A 4DVJA 3K5PA 3PFBA 1DBPA 4IH9A 1PJQA 4EI7A 3E2PA 4FV3A 3VH1A 4XDYA 2QW1A 3MVEA 1THMA 3PDIB 1XP5A 2FKNA 2I2WA 3U7RA 4WINA 5CCXA 3WHLA 1MO4A 2D0DA 4M1YA 2Q3DA 5F9EA 4KXWA 1DAYA 3D5XA 4BLQA 3QPBA 4N9WA 1IAHA 4O5AA 3CKXA 3WLKX 2CDNA 3AY7A 1DSSG 2AF4C 3U1TA 3UZUA 2F64A 2C2WA 4U0IA 3GFBA 4PC1A 4WADA 2ZU0C 3KWMA 3BCHA 2PMOX 3SW4A 3KTFA 1HMPA 1OPXA 2A1UB 2C4MA 4D4IA 2GS2A 4JU9A 1H1SA 1DKNA 3BC1A 5FBKA 3CT4A 4JK3A 5LWNA 5IVIA 1XX6A 4DC0A 1YS2X 1UQRA 3PHLA 3VFDA 1PY5A 4LDPA 5IUKC 4NBUA 3ELYA 4KD1A 3E7VA 4Q7MB 3VBWA 4WKBA 4DLZA 2GPWA 3AOEA 2PUVA 4BFSA 3CCFA 2DHQA 2JFOA 1J21A 3GNTA 4RHXA 4YH1A 1YE5A 3K0CC 2PR2A 4U6NA 4BZWA 5E92A 5EHLA 4MV1A 4RK6A 5F2OA 4NYIQ 2CNDA 2GEUA 5D3MA 1MNAA 5IEBA 4ESVA 2IXFA 4N7JA 4PR3A 1CS0A 2DETA 4X3FC 3P9KA 1VPTA 2VVTA 5ANIA 5A3VA 3HWX1 3ONWA 4FHEA 5DT0A 2WMXA 5DHTA 3DFUA 3V01A 2PRYA 2XNGA 4CIAA 4XEYA 1VB3A 4KFTA 4PIMA 4EFKA 1BROA 4OHOA 3HSSA 3PYLA 3JRXA 1JLUE 4XV2A 2FH5B 5ANRB 2VP4A 2DVMA 4MVXA 4YJHB 2NO9A 4NJ3A 3BLRA 4N6GA 1KJWA 4DEEA 5FJJA 3V5QA 4HLDA 2WWFA 1IZ7A 5EWJA 2WT4A 2O3TA 2C3UA 3C4WA 1T5HX 1NI4B 4GXTA 1LK0A 2AF3C 2O54A 1J91A 2WMUA 3D64A 1YL5A 2BONA 4HMQA 3VO1A 3DAJA 3GJ6A 2ERYA 2ESMA 3NKVA 3OFVA 4CUJA 2JLZA 1Q5PA 3VRYA 5JVDF 3KL8A 2HK8A 5GHVA 3UV7A 1EWYA 3CN7A 3TDVA 1PW2A 1P6QA 2QG9A 4AW1A 4U0KA 4U97A 4B75A 2RC5A 1JR3D 1RW8A 2NT4A 4EC8A 3G8DA 3PGMA 3WIVA 2EF0A 1GY8A 1AK9A 4IIJF 4ADSG 3ZDDA 4ZD6A 3B6EA 4FKPA 4L8YA 4IDPA 2Q4BA 2Y9MB 2PSFA 2Y0EA