4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
2C5OA 5P8WA 1ZQ9A 2RFNA 4GCJA 1WBSA 3LCVB 5EQPA 2G01A 3P08A 2ZWVA 3KRLA 4F6WA 1W7HA 3OCSA 5KKRB 3G2OA 3ZC5A 4WKQA 4DFNA 3M11A 3I5ZA 5HIIA 5A46A 4F65A 4A6DA 2PULA 3E7OA 4X2KA 4YJOA 4CFWA 3NW6A 4UOEA 3MFSA 4CFUA 3UC4A 4EH3A 3F88A 4ER3A 5EOBA 1ATPE 4BP1A 2KW5A 2CMWA 5DA3A 4DM3A 4YZNA 4Z7GA 4F1TA 4EH2A 4K1BA 4P4CA 4YLKA 4AXAA 4DGOA 3HVCA 4TRLA 1VIDA 2R5TA 2WQOA 3BZBA 5HCYA 5IH5A 1U2ZA 3O4FA 3L8PA 3FUPA 2V0DA 1JQDA 3RCDA 3EEOA 5AAFA 4G6OA 3DLCA 4HVDA 3HDMA 4FT0A 3U6JA 4K6MA 4IVDA 2CN8A 4RVKA 3LMHA 4EUUA 3CLYA 4W4VA 4II5A 5DIAA 4B0GA 3DAKA 4AZWA 3LKMA 2BTSA 4EEVA 5C26A 3GGFA 4C03A 2E9UA 3OU2A 4FVQA 2V22A 1X8BA 4G3GA 4GFGA 2AC5A 4QDKA 3ZONA 2BCJA 3WZJA 2BDWA 5E92A 2BKZA 2W1GA 4JRVA 4DFBA 3MH1A 5EMLA 4ER5A 3A4PA 2PZYA 3MI9A 1OL7A 3LLTA 5AP1A 2XK8A 1EG2A 3H10A 3NJRA 3SXRA 5M08A 4AP7A 3A60A 2XKDA 1Q61A 3ZCLA 4E30A 2E9NA 3E8DA 4HSGA 2ZDTA 3EQPA 4EMSA 2GTNA 2GS2A 4G3CA 5T6KA 4WD5A 5L2IA 4ACGA 4ZS0A 2BMCA 4NECA 3FSKA 5A4EA 2VX3A 3KHKA 3DTWA 2PMLX 3UO5A 1XJ5A 3DQWA 3R6XA 4MNEB 1YB2A 4YHFA 2ITPA 3QV2A 3HVIA 2V5QA 1P2AA 5LWNA 3VHKA 5EM6A 5K4JA 3MPAA 4YHTA 4BY9E 5FLFA 5KYGA 1VQ1A 4DA5A 5FQDC 3DCVA 5EYDA 2XEZA 2XJ2A 1OM1A 4GK3A 2BRHA 5I9WA 1H08A 4X21A 2ERZE 2ZOQA 3OROA 5E1MA 4UWYA 3CY2A 4UYNA 2HMYB 3U9CA 3F5UA 2CL5A 5CVHA 2VTLA 3TUBA 3PUPA 1UIRA 2JD5A 3E23A 4ISCA 4EWQA 4CFVA 4FX3A 3LECA 2HNKA 1W0XC 4ANBA 3Q53A 2XYQA 3MB5A 4FR4A 2OXYA 5IUGA 3O23A 4BB4A 1UNHA 2Y6OA 4HOKA 3PS9A 4FTNA 3ZFYA 2B3TA 4EK4A 4QQJA 3DBEA 3VW6A 1YUBA 4DG0E 3REOA 4HPUE 3IK3A 4HZSA 3AT3A 2XNEA 4EH5A 3O0GA 1Y8GA 4JAJA 3D2LA 4F1MA 3GEQA 2XIXA 4HTFB 4QP8A 3A7GA 5KBRA 4D5HA 3ID6C 1ZRZA 3WF7A 4O38A 3B2WA 2YJRA 1RDQE 5HZMA 2WIPA 1X1AA 3G89A 2C6KA 4N6ZA 4DT9A 2YCSA 2H1RA 3COKA 2R7IA 3RWPA 4O83A 4BICA 3PSCA 2PWPA 2A1AB 4FIGA 2AOUB 5J7HA 4F9YA 3AD5A 2XNGA 3MCZA 2YWVA 2X2KA 4LOQA 3VRYA 4FV7A 1RI3A 3GT8A 3GIWA 1W98A 4WBOA 2XEYA 3P2KA 3HX4A 3FC1X 3QWJA 3C51A 4EJNA 5LR6A 3VQUA 4NM5A 5BVFA 2YXEA 5KMKA 4ZJVA 4DAWA 1AV6A 4XG9A 3PTGA 4E32A 5M5BA 1WXXA 3DXXA 2LAVA 4FKIA 4ZZNA 3F7WA 4CXMA 3V5PA 2OB1A 4MQ1A 1EAMA 1B39A 2JKQA 3DB6A 1W84A 1IAHA 1ZOGA 1K2PA 2QD9A 1BKYA 2PVKA 1WVYA 4YUQA 2OJIA 3RVGA 3JUHA 5AUWA 2QRVB 4GT3A 4EUTA 2OWBA 5HBJA 3EFKA 2I0EA 5C27A 4FZ7A 4BBEA 4BCQA 1P91A 5DTQA 2H96A 5FEQA 4EQCA 4FKSA 4K6ZA 4ZEGA 1NW1A 4RIYB 3P79A 2HZIA 3OBJA 4J97A 3CP9A 1F3LA 5E4HA 2R3RA 4IV8A 4JNWA 2NRYA 3F3WA 3IG7A 4ZOGA 4AA0A 3EQIA 2XZSA 4YZDA 5LOHA 3HMMA 3RPYA 3MHTA 3KQQA 3UP2A 4E20A 4M0YA 2OIQA 1H1QA 3QRIA 4Q5HA 4F7LA 3BV3A 3B3GA 3E7VA 2AYPA 3EFWA 2ZWAA 2YAKA 4ZJJA 2YXDA 3FL4A 3R30A 4F9WA 3TXOA 3M1SA 3GU4A 4YUYA 2QHNA 2HELA 1L8TA 3KR2A 5JT2A 5KMMA 1JNKA 2O65A 2Y7JA 3EYHA 1JQ3A 3ZZWA 3NDIA 3KULA 4F08A 4IB3A 2PZRA 1VP3A 2QY6A 3OZRA 1FMOE 3LFSA 4GS6A 4CNHA 5EZQA 5E8WA 2OPBA 3V6SA 4FTUA 1L1EA 3SRVA 5T68A 3L9NA 5BYYA 4BCKA 2YTZA 3BPRA 4YTFA 3NEWA 3GO4A 4FV0A 4IB1A 4C3FA 3EEYA 3IS5A 1QPEA 2EXCX 2ETRA 4LRKA 4JR3A 5D9HA 2V74B 4K0YA 3TZ7A 3F6XA 3RHKA 1ZOHA 1TKIA 3E3PA 3L8SA 1W83A 3THBA 3REPA 5LMAA 2ORED 4L7SA 3KREA 1L9KA 3GOKA 4B8MA 1CTPE 4I6BA 3OU6A 2WO6A 4O0WA 4C4IA 5DEYA 3DA6A 1JSTA 3PPZA 3DP7A 5EKXA 3QQHA 3IQ7A 3CC6A 4DCAA 2Y1XA 3EQRA 4C07A 3I0OA 2BZKB 2XIKA 4L6QA 1MHTA 3R8VA 5A9UA 2WA1A 3ZOSA 3OZTA 5DWQA 1R6AA 3BKBA 1TQMA 4M67A 2QKWB 3A61A 3U6IA 5ETIA 4KBKA 3KXHA 3UO4A 4OTQA 2CNVA 4F70A 2R3KA 3Q3BA 5M4UA 4E4NA 3ZSHA 4QMWA 4X7QA 1VR2A 5JQ5A 4G56A 3IYLW 4FEUA 3VBVA 5HTCA 4DGNA 3HV4A 1BOOA 3NRMA 2VUWA 1M2QA 3NNUA 4C58A 1Y6AA 5DX8A 1PYEA 5EI2A 1XJDA 4FTOA 2WOTA 5AM7A 3EVZA 3FTDA 4EH6A 3AC4A 5K9IA 4O7YA 5F1ZA 3VC1A 1XHAA 5CSWA 4ZMEA 3DOUA 3TG1A 3F3ZA 2PWLA 5AA9A 3ZO4A 4AT4A 5F95A 2AOWA 4CKRA 4TWCA 5GM2A 4AZFA 1SKMA 1I9GA 5HGIA 5BUJA 3BU6A 4AW1A 4BCPA 4FP9A 4ANQA 3Q32A 4QTTB 3IECA 3ORNA 2WMUA 4AWIA 1VBFA 3UC3A 3FYJX 3BYSA 3I64A 4OTDA 4U44A 4X2NA 2PTKA 2BILB 4QMYA 5EG3A 3TR6A 4MXOA 3LJ1A 4YNEA 3A27A 2B1PA 4TYIA 3KPVA 3OT8A 2W17A 5M51A 1L3CA 3Q9XA 5J1VA 1BL7A 4X2JA 3DBCA 3D0EA 4ZSLA 3ZLYA 4XUFA 2UZBA 2UW8A 3KF4A 2R3LA 3LXPA 4JQ8A 1OBDA 2YZAA 3EQDA 1PW2A 5K05A 2B0QA 3ZS5A 3UVQA 2W05A 3A7EA 4RJ8A 3NAYA 4RJ5A 5CEKA 4XX9A 5E90A 1A06A 4A9TA 3GWZA 2CNQA 2J0MB 3N4UA 2W5HA 3T7SA 4HNFA 2P35A 3HA5A 1OKZA 3W33A 2JDVA 1XH5A 3GVUA 3GNIB 3ZDIA 2YCRA 2A14A 3BBTB 3DK6A 4F7SA 5K0GA 3AMYA 4DF3A 2ZZKA 4O86A 3BBWA 4EONA 4AZTA 3PJ8A 4J95A 3ITZA 1SVHA 3NIZA 3QD0A 1MJFA 3HVHA 2UW3A 5KKRC 2QOKA 2NXEA 1Q8YA 3OP5A 5FM3A 2CMHA 1JTFA 4NYEA 2VO3A 2KULA 5J9YA 4FT9A 4O82A 2WIHA 1JQEA 5LVOA 5LARA 3R04A 5IDPA 3A8XA 1KXZA 2BFYA 4BCJA 2CGWA 5CXHA 4LMNA 4C4FA 1NKVA 3QF9A 3C5UA 4AQCA 5A4CA 4XLVA 4E8AA 4ZTQA 4GL9A 3EGEA 4CMUA 4PDYA 3EFLA 2W5BA 4RQVA 4MIKA 1PKDA 5ANOA 3BIZA 1X1CA 1YXSA 2I7QA 4ITIA 2B9JA 3CXWA 3KQ7A 3NYNA 4JBVA 2WTDA 4E4XA 4EQUA 4TYHA 4HGEA 3BLHA 3AG9A 4XG4A 3EVDA 3HZTA 1ZZ2A 2WMTA 4ERWA 3PJ3A 3CBGA 2JFMA 4RVGA 1U5RA 4KVZA 1MRVA 3KMMA 5E8TA 3RWQA 4LWPA 1STCE 1DAWA 4XP2A 5KHWA 4MKCA 5C9ZA 4NJDA 3R2BA 4RTMA 2EXMA 4CLIA 4RX9A 2OU7A 4DFLA 2O0LA 4KWCA 1RJEA 2YXLA 4N0SA 3G5TA 5HHWA 3RMFA 3ZZEA 2VS1A 3P7CA 3O8UA 3D83A 4PQNA 1PYXA 3V51A 5AEPA 2YCQA 3SDJA 2BR3A 1PMUA 4I4FA 5HLPA 4P58A 2P33A 4EH8A 1F0QA 1RW8A 5AX3A 3BEAA 4FSZA 4GH2A 4DEDA 4PMPA 2RG6A 4ZY4A 3HV7A 2F2CB 2BRMA 3MTIA 1FJXA 2HCKA 2OSCA 1HNNA 3DQXA 2UVZA 4IWDA 5JGDA 1B38A 2B54A 3ACKA 2Y1WA 1Y57A 3G51A 5GINE 4OT6A 2JAMA 2PLWA 5L6PA 4DEIA 3EMGA 2GFCA 3EVEA 1VL5A 4BDBA 1H4LA 4C05A 4MBLA 3PPKA 4WNOA 3PZEA 2OF2A 3N4VA 3R1YA 2VWUA 3GCZA 1XH8A 1P5EA 1UNLA 3ATTA 3C4CA 2OGVA 5E7RA 3KPUA 2P3LA 1PKGA 4X3JA 2GNLA 4QQKA 2RL5A 4ZSGA 4EOPA 2Y6MA 3CS9A 1R18A 5CEMA 2W1FA 3G2FA 3LXKA 5DEWA 2JJQA 1O6YA 2BAJA 3IV6A 3UZUA 2E5WA 5A6NA 3BWCA 3CD3A 4X2FA 3CC8A 4F1OA 2R2PA 4JQEA 1WBVA 4JDHA 4F64A 5IEYA 4ZTMA 2YAAA 2XVMA 3ZUVA 3RAHA 3RIEA 1ZHFA 5C0OE 2ZULA 4ZTLA 3ORHA 3DXPA 1E9HA 5K4IA 3LCOA 2C7PA 2ETKA 3MERA 3V01A 5HIEA 2BHEA 3PPJA 2RIOA 2OKRA 1YW2A 1Q0TA 2HZ0A 3OOGA 4FA2A 2J5FA 4XV9A 5IQAA 3G6GA 4YJRA 2X6DA 4EKKA 2PVRA 4PP9A 5JFXA 4RG0A 3LIJA 3LQ3A 4KUJA 3Q4TA 1DCTA 4LQMA 1YHSA 5M4CA 4FKWA 3RINA 2P2HA 2DULA 5CX9A 4YO6A 3VUHA 5H9BA 3ZEWA 2WKMA 3H30A 3NX8A 5FG8A 3QKKA 4UZHA 4G34A 2WEIA 3A25A 4F0FA 3GP0A 4LL5A 1RQQA 3VULA 3PWYA 2WQMA 2PL0A 4ZJIA 3FLNC 4M0ZA 5CF5A 1G3NA 2ZZMA 5BMMA 5M09A 3IDCA 4C0TA 5C01A 3W2RA 4MXZA 2ZV2A 5CI6A 3BE9A 2QLQA 2XF0A 1ERKA 4RWZA 3W8QA 4CKIA 2UW5A 5I9UA 2Z7SA 3RAIA 2AOXA 1YF3A 1JR4A 4CG9A 2ETMA 3OC1A 3S2PA 4BDKA 4BDFA 1JSUA 1SQGA 4O6EA 3QC4A 5EQJB 2ONZA 2GA9A 3ZTXA 3R1NA 2DUVA 5HKMA 3GU6A 3LAUA 1H27A 2OK1A 4WNKA 1UVRA 5EC8A 3CQEA 4C37A 1XVAA 3LDGA 2CWWA 2WQEA 4TWNA 5L8JA 4U7PB 3HAMA 2RF9A 4AX8A 2NNWB 4CTCA 2JHAA 5CU2A 2XMYA 2UZLA 1CDKA 2PSSA 3WF8A 4AZEA 4QYHA 3G33A 3FKLA 5HI2A 2AN4A 3RI1A 2FK7A 4AU8A 1YI4A 1A48A 4KIQA 1Y8YA 4FC0A 5IKMA 2GB4A 3VS5A 3QXPA 4M7RA 4FT5A 3QHWA 3EMBA 4IC7A 4MCVA 2J7TA 2HY81 3KMWA 2R64A 2PT9A 3SW4A 3JWHA 4AT3A 2C6MA 1Z3CA 2YERA 3QALE 4BHNA 5DPMA 5CNNA 5L6OA 4R7HA 3EYGA 4FUXA 2ITOA 4C4EA 3R7YA 4DT8A 2FPOA 2PZPA 3F4KA 2YFXA 2CKDA 3GCQA 4NL0A 3TDWA 3ERKA 2HW7A 2OBJA 5M4IA 4FI1A 5FXSA 3P7BA 5CAQA 2EU9A 1Q0SA 2ZVAA 4U43A 1VEBA 2WZJA 4BCGA 1ZG3A 5DLSA 3NSZA 4ZLZA 3BRBA 4PUZA 3PE2A 3E3BX 4WRGA 1KV2A 1OKVA 4RJ3A 4YU2A 5CIYA 4IHPA 3F3TA 3Q9YA 3UZRA 3BUSA 3UJ8A 2O3PA 5I9XA 1KE7A 3EN6A 3ER8A 4I6HA 5DR2A 3MVJA 2W9FB 1AQIA 3E64A 3BHHA 1UU8A 3SXFA 2QOLA 4HYSA 3C5IA 5HIKA 4CEGA 1CKPA 2AVNA 1X1BA 2JDOA 4GC9A 2QG5A 2ZYBA 3MVMA 5M56A 3OFKA 4PL3A 5FQNA 3EQHA 5CU6A 3R8UA 4BLUA 4QQTA 4FG7A 2OBFA 2XIZA 4GK2A 1R1WA 1PXKA 3AY0A 3KU1A 3QLFA 5U4XA 3UPZA 2X8IA 2AS0A 4RTLA 2JKKA 2ERCA 3V3VA 2ZBRA 2YEXA 3UVPA 5K09A 3FQHA 4I6QA 3SGLA 3ZSIA 1SVGA 3MPTA 4OA8A 4FVRA 2CGVA 5HX8A 4POOA 1MQBA 2VDUE 4JQ7A 3GOPA 3ELJA 3G9NA 3P7AA 3FUVA 4DH3A 5EYMA 2PY6A 3LFEA 4CRSA 2Z6UA 1WCCA 2PVHA 1SNXA 3DU8A 2JG3A 5AMNA 3VHEA 4ZTSA 4FTJA 1PMVA 3C0HA 2R7BA 3G0FA 4U42A 3UNZA 4F0GA 3VRZA 1KSWA 5B7VA 3K0BA 3GQIA 1OB3A 3F3VA 5DLYA 5CSVA 2EB3A 2YA9A 3R01A 3THSA 4L9IA 5C4KA 5M44A 2AR0A 4G31A 5C8KA 4OTHA 3VIDA 3KF7A 5FQOA 5CUQA 2OZVA 4FIIA 3E05A 3BLRA 1JKSA 3DTCA 2X81A 4WUAA 2NXJA 2YQZA 5TR6A 4NFNA 2GNGA 4FV4A 3ZFXA 3OOMA 3CKKA 3AXWA 4H3PA 5F2OA 4G9RA 1H28A 3F5PA 1BLXA 1R8XA 5DFPA 4WA9A 4XNEA 3P9CA 4BCOA 5LJJA 3HRCA 3K3JA 1LR4A 1SZMA 3C4WA 1QYRA 1UKIA 2JKOA 3HMNA 3WIKA 3HDNA 5IH3A 3P23A 3LOKA 3D4QA 4ZS4A 1ND4A 4DEHA 3O51A 3VS4A 5GP1A 2XNMA 5EZSA 3NCZA 1ZMVA 4HPTE 4Y85A 3MS9A 2I6LA 3RK7A 3EVGA 4EQMA 1OKWA 4FV6A 2G70A 2XP2A 2XJ1A 4NFMA 3A2CA 1J3HA 5IA2A 3GFWA 3RM7A 3D7ZA 3QD4A 2G9XA 4D4VA 4KINA 1XH9A 4RBLA 3RODA 4DA4A 3QTWA 3KR0A 4O0SA 3DT1A 3OZSA 1URCA 1RJGA 5BVOA 3D7TB 3MA3A 3PDTA 4X3FB 4BRXA 3PFHA 3GC9A 4NM0A 5L2SA 3I7BA 4Y30A 4V0QA 3ER9A 1M6EX 5HILA 4MAOA 1EJ0A 1OL5A 3BKWA 3OW4A 3E88A 2Z2WA 3ZLWA 4FSTA 5HFJA 3ZBXA 1H1WA 4JBOA 5EQYA 3QOWA 1OPKA 4KWPA 1UKHA 5FDPA 4QP6A 4V0GB 4JG7A 2A19B 2GFSA 1GY3A 4JS8A 4AN2A 3ZRKA 4F9AA 3SM3A 4KW7A 5GJGA 4DFYA 3OFMA 1GOLA 4O84A 2OICA 2XNBA 4L8MA 3SX9A 5BX0A 5BNJA 4BDEA 2YISA 4IKPA 2EVAA 4C33A 3HYHA 3UFBA 2JFLA 4CKJA 1QPJA 5HE0A 2JLDA 4FEVA 2C1AA 3MGYA 3CCNA 1D2HA 3VYWA 3FPHA 4D4SA 4D4YA 3MJ2A 5IH4A 2W1CA 5IUHA 4FL1A 3RKBA 5HORA 4FL3A 4O7NA 3P9IA 3IGGA 4EC9A 2BZGA 2HW6A 2XM9A 4J7BA 3H3CA 3DULA 3QGYA 5H8EA 4CTBA 4M69B 3SHEA 2VTNA 5CSHA 5DXAA 3R7UA 5DX1A 2XBJA 4FNXA 4EJ7A 2OFUA 4EORA 2HOGA 1F38A 3OEFX 4PYKA 3SA0A 4R7IA 5DT0A 3L8VA 3A7DA 5BVKA 2P3GX 1VLMA 3IPHA 4RIOA 3UJCA 2FGIA 4S2ZA 5E9JA 4BZNA 5I5ZA 1TQIA 1YWNA 1U54B 2XNOA 5LQCA 3UP7A 2HYYA 5T3QA 4RX7A 3E63A 3SR4A 1XWSA 3W2CA 2XK9A 3UJGA 3NVMB 5D11A 4TYGA 2PVFA 3UOKA 2IZSA 3A99A 4MNEA 5HG7A 4RIWB 1KE6A 2QONA 4RX5A 1XQZA 4HC4A 3OXZA 1UWVA 3WYXA 1FPUA 3QQGA 2CKPA 3ATSA 3CGGA 3VBWA 3ORPA 3UZTA 1X1DA 1ZZLA 1EQAA 1Q97A 4I5CA 3ANRA 4JX7A 4TWOA 4C59A 2F8LA 4QVGA 5ICCA 3WZDA 2YIWA 4CCUA 3FZTA 3R8MA 4QTBA 2BDJA 3EKNA 1GIHA 5CZHA 2C5XA 4EOOA 2BZIB 3Q5IA 4XUEA 1YXTA 3L9LA 2IPXA 4RTRA 1WZYA 5EYCA 3QTZA 3HA6A 4IZAA 1UU3A 3QX2A 2IDJA 4EOSA 4DHFA 3TTJA 4CT1A 3TJDA 3UIXA 2HY0A 1PMEA 2IZTA 4HJOA 3K6RA 2YM5A 2UUEA 2PGXA 3EMDA 3HNGA 1OECA 4Y46A 1NW7A 1L3BA 4RPVA 4UXQA 4MYGA 5KZIA 2H00A 4FOCA 3Q4UA 4R3CA 4AGCA 3MYGA 2EJTA 3MW1A 2Z7LA 1J7IA 1KHHA 3UA4A 2VRXA 3LMIA 4HTFA 2DS1A 3FY0A 2XK4A 4X2GA 3EL7A 4GFMA 2QM3A 1UU9A 1LP4A 4NSTA 4U5JA 3LDUA 4FEWA 3P2EA 4QMOA 2PXCA 1JLUE 1REKA 1CKIA 4GU9A 5BW4A 4ZXTA 5EIFA 3KCFA 5CEOA 3A26A 5K0FA 1MUOA 2OJGA 5BXYA 4EHGA 2ZM1A 4FKVA 3QD2B 5EK7A 3FUWA 3KXMA 3OTUA 2AOUA 3L1SA 4UWBA 1NVSA 2OG8A 4JLCA 1RJFA 3PZHA 2BRBA 1APME 4XUCA 4EKGA 4XV2A 4MQ2A 5LXMA 4BIDA 1N2XA 1UA2A 5AADA 2NP7A 3T8OA 2PE1A 5LQRA 4YV0A 1JG3A 3NZ0A 4JOAA 2FSOX 3HRBA 2JIVA 4WG4A 5DRBA 3RM6A 5HG9A 2GNFA 5EM5A 4PY1A 4EL9A 3MH2A 3MGGA 2DWBA 3BYMA 3W8LA 1H07A 4D2SA 3OU7A 2GQRA 4GEKA 4GV1A 1XH7A 5DSXA 3PJ1A 4IV0A 4O7WA 3K5UA 1R39A 2OI4X 3PXRA 2W0JA 5K8VA 5HG5A 4QMMA 4Y73A 3VS2A 2C1BA 2QOCA 2GDOA 1GZOA 4BDGA 2PVYA 2UVXA 2IZRA 5E2BA 2QRVA 5AV0A 2EUFB 3KRRA 5CEIA 4O29A 2X8EA 4QMQA 4KA3A 3MB6A 2ZFUA 5AV2A 3S95A 1QAQA 4S33A 2ZB0A 3PFGA 5B2MA 3QKLA 3GI3A 4BBFA 5HO7A 4DEBA 2HWOA 4QT1A 3TV7A 3GU3A 1CKJA 2FYTA 4RIYA 3M4XA 3AC2A 2Z6AA 1YHVA 4PDPA 3RALA 3Q9ZA 4PINA 3ORXA 3O50A 3EFJA 2VP3A 3LCDA 3QYZA 4MBIA 4BDCA 2BPMA 2ZCJA 5K5NA 4IDVA 4IVCA 3FYDA 3ULIA 4QTDA 4YTIA 3CCFA 3ZU7A 3EOCA 4JVGA 3BXOA 4EK3A 4Q5EA 3SGCA 1V0OA 2FK8A 4QQCA 4YR8A 2PBFA 4L7VA 3PLSA 4IJ9A 2IFTA 4K33A 2G15A 4D0XA 5T67A 3TIYA 3NYVA 3EIDA 1NV8A 4AW5A 3LLAA 3MSSA 3LBFA 3BLQA 5JGBA 3W2QA 5I9VA 1QL6A 4HCUA 3HUBA 1NVQA 3I6WA 3EB0A 4FT4A 4IX3A 4MK0A 3E8SA 1Q3WA 4O22A 3HCFA 3DK7A 3VAPA 3HRFA 4ZSEA 3LMGA 4FTAA 4PX6A 5J8IA 4BR3A 3FEGA 4XP3A 2ONLA 3EH9A 4AS0A 2OZAB 4NW5A 3CBLA 1P4FA 1E1XA 2XS0A 2PMOX 4FGBA 5TO8A 4YO4A 5CAOA 3KXXA 3BWYA 1YHWA 4AN3A 4P5ZA 2YDKA 2I0VA 3VC4A 3NUUA 3W2PA 3NUPA 4AW2A 4FTCA 4Y95A 1IG1A 3VF8A 4WNPA 1PXPA 3UJ6A 2C0OA 4MTAA 2EX4A 4XCXA 5GWXA 3ZFMA 5AUZA 4ZTNA 4ENYA 3R7OA 1I4WA 3FXWA 4EHVA 4DEGA 3FY2A 5TOZA 2CKOA 4USFA 3Q04A 4Y5HA 5D41A 4H58A 3MAGA 4FS8A 5CEQA 5HTBA 4AUAA 3SMQA 1O54A 3S3IA 5CALA 4IAFA 4D55A 2PV0A 5HESA 5L2TA 3C6KA 4IM0A 3B8RA 1QCFA 4BGHA 2XKEA 5CEPA 3NWWA 4H36A 3R9OA 4U41A 4FSWA 3SG8A 1OIUA 3B3FA 3UZPA 1YOJA 4X61A 2Q41A 2P0CA 4BLVA 3FLWA 4NIFB 3QQJA 2WMBA 4YTCA 4FSUA 4LL0A 4ANMA 5DXJA 2VTIA 2GNHA 4LM5A 3I6UA 4DTBA 4C3RA 2J0JA 2Z60A 5HZNA 3BT7A 3H2BA 3AOXA 3CPCA 2C0IA 5GM1A 2B53A 4EH7A 3A7IA 3SVZA 3G0EA 4FV8A 5J9ZA 2I62A 3MB7A 5EGSA 3D2KA 2C3IB 4QMZA 2QR7A 4AGDA 3Q6WA 5JQ8A 5FXQA 4A4OA 1A9UA 2VTHA 4QQNA 4QPPA 4YBJA 3AXSA 4OUCA 4MXYA 3TFWA 3TNIA 2I40A 4GBED 2VWWA 3AQVA 3TN8A 4CTJA 2AOTB 1BI7A 5AJQA 3LFBA 4PYIA 4C04A 1R8YA 4YLJA 4R78A 3FKOA 3CJQA 4QNYA 4DN5A 1HCLA 3QOXA 4OTGA 4R8SA 3FXXA 4L52A 3SKCA 3DXYA 4AUKA 3UJBA 1PXJA 4XHKB 3W2OA 1JSXA 5HU3A 3OY3A 5F20A 4YUVA 4S34A 4Z16A 5ICEA 3AD4A 4FTIA 2P40A 3MA6A 4FNZA 4L7FA 4GG7A 3BGVA 3ROCA 4R3PA 1KR5A 4FTMA 5DHJA 5BUEA 4U7TB 4ZTRA 3ELWA 2B7AA 4FK6A 2CPKE 4WHZA 3AC8A 2X2MA 2OH0E 3FMNA 4F7NA 1D2GA 4U81A 3LGAA 2W1HA 1FBNA 4OQDA 4X3FC 3LX6A 2PVJA 3FPQA 3T0IA 2FH9A 4Z3VA 2ZM3A 3ZHPC 5DI1A 4O7VA 3CKXA 3HCAA 5DRYA 3N9XA 1MRUA 5LVLA 4D1ZA 4YC3A 5AWMA 3ORZA 4GC5A 3LKZA 2ZV7A 2WMSA 2UZOA 4RIXB 1JSVA 5ANJA 1BHJA 2GSFA 2QNJA 2QR8A 1AQJA 3MN3A 5EM8A 1YKRA 1M7QA 4O2ZA 3CKWA 3GC0A 1UU7A 2NPQA 4BBMA 4UBAA 4YLLA 4DITA 2UZEA 3A4TA 2XYVA 3LSTA 4TKSA 3GNLA 3F7ZA 4PCLA 4L45A 4FZFB 3UIMA 5CLPA 5DNRA 2VX0A 2W4OA 1O6LA 4X6QC 4BYIA 2WD1A 3CGOA 4F63A 5IU2A 3KB7A 4MNFA 4B4LA 4FBXA 2JDSA 4I92A 4G3DA 3QRJA 3PXQA 4R6XA 5ICGA 3RW9A 5LVPA 2OO8X 2ESMA 2BZJA 4D4RA 4YPDA 4BGQA 2AN5A 4TTHB 4C34A 4LYNA 2BZHB 4O0TA 3CQUA 4DCMA 4PP7A 3B3JA 2OLCA 3JY9A 5DPVA 3PP1A 4GQBA 3PXZA 3QZGA 1SYKA 3ELDA 4JBPA 2OJJA 2IBSA 2QODA 3TEIA 4FR0A 2W1DA 2PUIA 3C50A 3CVOA 2PUPA 2H34A 4EKIA 4G6LA 3Q2MA 4RVTA 2YUIA 2QYOA 1Q8WA 2JH8A 3C3YA 2WOUA 3UQCA 4KIGA 3MFRA 4GT5A 2R6ZA 5AFVA 4KBAA 5IMXA 2G71A 5GNKA 3DPKA 5E1OA 4F85A 3L8DA 4ZP5A 5CT7A 3HVKA 4XG7A 3NIEA 4EBVA 3WSTA 3AXTA 3PY3A 3QUPA 2PT6A 4N70A 2UYCA 3RPSA 5FUTA 3I5UA 3LBYA 3LFFA 2A4LA 2XBMA 2RFSA 5DM4A 4IJPA 5G1XA 3KN6A 5IQBA 4X63A 5EMKA 4P2KA 3BHUA 2HV9A 2VNYA 2QOFA 2R4BA 5CZIA 2VTPA 5HU9A 5I4NA 1ZARA 5BYLA 5IEVA 4OBPA 2NYUA 3KRXA 1INLA 3OPNA 4FIJA 4LGGA 2QLUA 5AUXA 4DCEA 4YMGA 5JEBA 4YC6A 1R0EA 3HA8A 1XH4A 1YFLA 4YUWA 4BZOA 4FGZA 1M6YA 4QTCA 4I0SA 3ENHA 2X7FA 1RI5A 3D15A 3MH3A 4ONAA 2ZMCA 5FM2A 3D14A 3S4QA 2FUMA 3NS9A 2GS9A 2NO3A 3ORKA 2XA4A 4FKQA 4FTLA 4FNWA 3N51A 3ROYA 4EBWA 1NV9A 4IVBA 4FSRA 3BHVA 4U3ZA 3EL8A 3F3UA 5EKNA 2RFEA 3UA3A 1O9HA 2ITWA 2QURA 4E5AX 3KGAA 2ITVA 1G60A 3QAME 3ORIA 4C2WA 4MD9E 3UOHA 4O0VA 2VD5A 1D2CA 4LWOA 2PU8A 1ZYCA 4DYMA 3PG3A 2CKEA 2FHPA 1YDSE 5JSMA 4DBNA 3UMWA 4FV3A 2WPAA 4IH8A 2FRXA 2VZ6A 3FV8A 5CAVA 4CKBA 1GNGA 4UX9A 1JTEA 4CTKA 4Z2YA 3OVVA 2ERKA 4CKCA 2C6IA 1OI9A 4ARKA 4APCA 4R1YA 4XV1A 3G8AA 2RKUA 2OIBA 4U97A 5EOLA 3DOGA 5F2NA 2HZNA 1YXXA 1P1BA 3WE4A 2PMNX 2C5VA 4BTJA 3SX0A 3G6HA 3FXZA 5C1QB 5IDNA 3HP2A 4M7IA 5EG5A 4FKLA 4TW9A 3PG1A 3DBDA 4ASEA 5AP5A 1SMHA 4BI1A 1PJZA 5ICPA 2UYOA 1AD5A 3F2RA 3F66A 4GOND 4OTWA 2G2FA 4TXCA 3FTCA 1XTPA 5AP6A 4BDJA 3P2IA 1M2PA 5E1EA 4NJ3A 1KE8A 1O9GA 2ZDUA 5FBNC 4QYEA 1YI3A 3MY5A 2A27A 2XUUA 3HL7A 1E1VA 1GIIA 5D10A 5DVRA 2PUNA 3ZO1A 4U8ZA 1XH6A 1PXIA 3BX5A 2C68A 2FYSA 3O17A 1SVEA 3LE6A 5EDPA 2O05A 3GUBA 2FCAA 3HGKA 4EHEA 4JI9A 4RSSA 3EVAA 3HMIA 2R3FA 3EN7A 1N7JA 4IANA 1XBCA 1Y8CA 1AGWA 2UW0A 4PMTA 4PCAA 2DQ7X 3TM0A 5AV1A 5FGKA 4FE2A 4CMTA 5JRSA 3ZYAA 4HGSA 3Q7EA 3COIA 4Z9LA 1JWHA 3SAYA 3C1XA 2UZ4A 3IDBA 4OQEA 4E6AA 5KX8A 2FSMX 5EQEA 3GCVA 4AT5A 4QP3A 3RPVA 3AWIA 4LRJA 5EEGA 4J8NA 2Z7RA 4AA4A 2C6DA 2NP8A 4L3PA 2XBAA 2XKFA 1REJA 3UPXA 1BX6A 3F5XA 5JFSA 3PVCA 4QO9A 4IAAA 4PNIA 3R0QA 4O7TA 4RTOA 4IDTA 4USEA 2HAKA 3JYAA 4CRLA 3HP5A 4BI2A 4PYJA 5AX9A 4LUEA 3ZH8A 2C3JA 4XRLA 3HP7A 4PMMA 4TL0A 4ZMFA 4DG2E 5HNGA 5EW9A 3P5KA 5GIOE 3NW7A 2WTVA 1PXLA 3L9PA 5DSTA 3C6MA 5C03A 3UVRA 3PYYA 4RWIA 2BAQA 4V05A 3DMGA 5EHLA 3NVKI 4YMHA 5HX6A 2CN5A 4WUNA 1TVOA 2JBOA 4WIHA 1AF7A 2XVDA 4EOQA 5GOZA 2VV9A 5JRQA 4M36A 4R6WA 2O06A 2XM8A 4E6CA 2OXXA 2BIYA 4RLLA 1NW3A 2VN9A 2P3QA 4HCTA 3M33A 5LQUA 3Q87B 1ZY4A 3RAWA 5KE0A 4JDKA 5HLNA 2W1EA 1SUIA 5CCBA 4BCMA 2C6OA 1RJBA 4EYMA 2GCDA 4BCFA 4ZZOA 1FOTA 5IQGA 3VN9A 5TF9A 3T3UA 4EOMA 5BW5A 2IJMA 3E5AA 4W4YA 4OTRA 4IX6A 4PV0A 3QTSA 4J98A 3DDPA 4CFMA 4I4EA 5E8ZA 1TPYA 4DFXE 5CVUA 1BL6A 1YZHA 2BR5A 10MHA 4LOPA 4V01A 2P3OA 4UYAA 4RTNA 5CD1A 5AP0A 4QP1A 1Q3DA 3OWPA 2OW3A 4G5PA 1EIZA 3C0GA 5CVEA 5FADA 2ZV8A 3OCGA 4FSNA 3TRKA 4GYIA 4GYGA 2X4FA 3HM2A 3OT3A 3D5XA 1TW3A 4CLJA 4MXCA 5DRDA 5FHQA 4QRCA 2BAKA 3OEZA 4MWZA 3LPMA 4ASZA 3LFAA 3FTFA 3VS6A 1H00A 5DBXA 5A6OA 3FUTA 3MV5A 2Z6QA 3GB2A 4CXAA 3R7VA 4B99A 4YZMA 1J91A 5LWMA 4R5SA 4CV8A 3BKXA 4BC6A 3OG7A 1G5SA 3OCJA 3QA8A 4M3QA 3D5UA 4E4LA 5FDXA 5CAUA 4WXHA 3R73A 5L3AA 2HIWA 4IW0A 3M6UA 4FUYA 4AAAA 4CCBA 4RFYA 5HLWA 1FPQA 2B9HA 2QOHA 4DE4A 4E5BA 3U6HA 3HTXA 3VUGA 3R7IA 4NKAA 3UODA 3D7TA 4P7EA 4X3FA 5CQWA 3OCTA 5JKGA 4FT7A 5IUIA 4P7FA 3BWFA 3FMLA 4CT2A 4OBQA 3MH0A 2YM6A 4FV9A 2GAFA 5A3XA 3NNXA 3RJCA 4XCUA 1ZYSA 4Z55A 3H9FA 5KMLA 3IW5A 4M84A 4CSVA 2CHLA 1JBPE 3KRWA 1FVVA 3LCUA 3PTAA 3PXFA 2Z7QA 2VTSA 2WTWA 4V0RA 2XNPA 3FZRA 4V0GA 3FLZA 3PSBA 2HK5A 3O71A 3NLBA 2ZM4A 3WI6A 3ERCA 5GJDA 4UY9A 3HVJA 2ITNA 4BP3A 3QUDA 2GNJA 2P41A 3BGQA 3DZOA 3TACA 3R1QA 2CMGA 3KK8A 4YUZA 3K5VA 2ZB1A 1WBOA 2WTJA 3WIGA 4RYLA 4ERKA 3VJNA 3GJYA 3KA0A 3WF9A 1M52A 4UB7A 3CE3A 4OW8A 4FT2A 2G2HA 3DR5A 4ASXA 3FMMA 3IKAA 3RNIA 5H8BA 5A4LA 5FBOA 3NUNA 3IONA 3P1AA 2O07A 5JK3A 3I7CA 4R7BA 3LFCA 5HBEA 4PGHA 4KAOA 3V5QA 4UZDA 5AA8A 2O57A 3NTVA 5E2AA 2X39A 5AUVA 4OTIA 4A4LA 2B9IA 4D1XA 4QYFA 3ZMMA 3R63A 5L8KA 3UQFA 4HYHA 3R9RA 2WQBA 1U54A 2VTQA 3VF9A 3I1AA 3LJ2A 3TNWA 1GIJA 3CSVA 3FLSA 4RJ7A 5DYJA 3TM4A 4JR7A 3UBTA 3FC2A 4E6DA 2IW6A 5ANIA 3QZIA 3R71A 2PWYA 3B5IA 3R2YA 4E33A 1KIAA 2R0IA 4GJ2A 3GQLA 1JG1A 2FB8A 1SVUA 3V8WA 4RIWA 5CCXA 4IE9A 5EW3A 3PFQA 2YWPA 3VBQA 3U54A 5JGAA 2GS7A 4I41A 5DX0A 2IGTA 3NUAA 4LGHA 3UG2A 4HGLA 4PF4A 5F2KA 1EJ6A 1JOWB 3JWJA 4FKTA 5JMSA 4WT6A 3PE1A 2FO0A 3R9HA 4D5KA 3IGOA 1SG9A 3HV6A 2BM8A 3BGPA 3PJCA 3R28A 2AUHA 1PF8A 4CFNA 4DG3E 3G8BA 2FSTX 3MY1A 2F4JA 1QPCA 4YSMA 4PTEA 5HVYA 2PKWA 4WRSA 2PX8A 3P0MA 3IW6A 1H01A 3LL7A 3I5NA 2B2CA 5KO1A 4Y72A 3FMKA 1WY7A 4QMVA 1XO2B 2UW6A 3NMUF 1UWJA 2H8HA 4PWNA 2H9VA 3B89A 1XDSA 5JH6A 2QI8A 3TKIA 5IISA 4ASDA 4YBKA 2HWKA 5I0BA 5ANGA 5AV4A 3H0ZA 4PYQA 3R0TA 5A4TA 4FOBA 4NCTC 4HGZA 4HH4A 3KQSA 2WHBA 5IZFA 2IBTA 4O81A 2OB2A 5CY3A 3TT0A 3WBLA 3KKZA 4DLIA 1Q41A 3PX3A 4YJQA 2PXXA 1JKKA 4E7WA 3LM5A 5ETCA 4RJ4A 1L3RE 1NBIA 3WE8A 3TM5A 5K0BA 1BKXA 2YITA 2C7RA 2VTRA 2NRUA 2BR1A 2YDJA 3QFVA 5CF4A 2VZ9A 3FI8A 4QDJA 1ZY5A 4UN0C 4OA5A 3W16A 4E26A 3BEGA 2P7IA 2YIRA 3BYVA 3R7EA 1R74A 4F09A 3TLJA 3BZ3A 4IFGA 1NVRA 1I09A 1JKTA 3MFTA 3WF5A 5FA5A 4DTKA 3EN5A 5BP7A 5LQNA 4KRCA 1OIQA 4FIEA 5DR9A 2BKKA 1P4OA 3M6VA 4KDCA 3Q4CA 5IA1A 3AJDA 4CG8A 5HIJA 1JAMA 4EWHA 3TKHA 3HUCA 1M0EA 3UJ7A 2YVLA 3OCBA 3WOWA 5M53A 5B1SA 2VWBA 4AE6A 4ALWA 2E9OA 3BQCA 3CTQA 5HVKA 4AN9A 4LV5A 2EFJA 4IIRA 3MCTA 3UJDA 4GW8A 3BU3A 2EG5A 4O0RA 2Q0NA 3M2WA 5KCVA 3OTVA 4I0TA 1QANA 3NW5A 3DXQA 2YM4A 4A9YA 2BH2A 3PA5A 3ZXZA 4MX9A 3SSNA 3LVPA 4DFZE 4EZ7A 4P7JA 2JDTA 3TUCA 3R9DA 3UOJA 2WFYA 3POZA 5H02A 4RTPA 5HE2A 1DL5A 4F99A 3VBTA 3WYYA 4YNOA 3FPMA 3TJCA 5M55A 5IA5A 5DH3A 2ZW9A 3ZDUA 3ODYX 4KSPA 4PONA 4BCHA 4MF1A 4U45A 2JEDA 2NXNA 5CF8A 2LD4A 4FTTA 4CZTA 5CASA 4FTKA 4NKSA 1O9UA 4ALUA 2H6DA 4O7RA 4JBQA 2Z02A 3A7JA 5HCZA 2PVCA 3O2MA 4IMYA 2UZTA 3EPPA 1ORIA 4WG5A 2YX1A 5FWAA 2IH5A 3ELUA 5FRIA 4XBRA 2C3KA 1RJDA 3MWUA 4BHZA 2P8JA 5IQFA 4AOIA 3W18A 3A7HA 5CANA 2XK3A 2IG7A 4LFIA 2JKMA 2DYLA 1XR1A 4D58A 1RI2A 2VTTA 5H3QA 4MWHA 1Q8ZA 4CZUA 3OFJA 3F69A 1YXVA 1NXKA 3FZGA 4FKGA 3PXKA 1XCJA 1UFKA 3T9IA 2V7EA 5DM2A 3R8LA 3KL8A 3DGKA 3VUMA 4GJ3A 3VW8A 3OXTA 3GBZA 3KU2A 3OF0A 3ORMA 4C38A 2IVVA 2OZAA 3A7FA 5IQEA 5HCXA 5C9CA 4R1VA 4R6VA 4ID7A 4M68A 4R05A 4MHTA 1GZ8A 3FPEA 4RC4A 2ZMDA 2I0HA 2I7CA 2VO0A 4USDA 3R8ZA 5HICA 1OUYA 3BE2A 3DBFA 5E1BA 2X1NA 1SM2A 2CSNA 2I9KA 3WARA 4EHZA 5HOQA 3WZKA 1XCLA 4G5JA 2YZLA 2JITA 3QD3A 5DRTA 1OGUA 2VTMA 3MBLA 2ESRA 3LCTA 4P5QA 3ZM9A 3DJ7A 4O7ZA 4I6FA 4U6RA 5BQ0A 4RVHA 4R5YA 4ER7A 5C8NA 3QTXA 4H1MA 2C6LA 4HYIA 2GPYA 5BMSA 1YDTE 5I9YA 3MESA 5G6VA 3E7PA 2O64A 2J0IA 3UNJA 3FZ1A 2WU7A 2PX5A 2IW8A 2GPHA 5CT0A 3HV3A 4E2WA 4DC2A 2BFXA 4G2FA 4EK6A 2VAGA 3FUUA 2ITXA 2UYQA 3S00A 3FYKX 4EH4A 3X0DA 4P7GA 3EZVA 1ZGJA 2C47A 3VUDA 3E62A 5EHOA 1WXWA 3PB3A 5HVJA 3QHRA 5BVEA 2GS6A 3GU5A 1ZAOA 2CDZA 2SRCA 2A2AA 3KR1A 4EK9A 2J0KA 2VWYA 3QQLA 3UJ9A 5ETAA 4GF5A 3COMA 4WNMA 3QCXA 4PDSA 4IB0A 4ZLYA 5HQ0A 4A9SA 5BVDA 4BI0A 3QTQA 2E9VA 3KPJA 4GFOA 4UXLA 4FZ6A 3M6WA 5AAGA 3QC9A 4AOTA 3W32A 4FG8A 2GH1A 2GU8A 1OVEA 5JR3A 2JAVA 4J96A 3COHA 4NWMA 2R3QA 3KPWA 4G6NA 2B52A 3VNTA 5L2WA 4FZDB 1TW2A 1G8SA 4CWAA 3U87A 5CU3A 1HOWA 2BIKB 5LQJA 2C3LA 3BGZA 1IEPA 2B55A 3HKOA 4DBXA 2BDFA 2F57A 2ZIEA 4U80A 3UWPA 1P1CA 2WMVA 2JDRA 4LG1A 5AP3A 4HNIA 5EDRA 3PA4A 5AM6A 4P7KA 2AOTA 5E9QA 4ITJA 5DTRA 4TT7A 3TV4A 2W06A 3AC1A 2CCIA 3QYWA 1IR3A 3PSDA 4M8TA 2F7XE 4NTTA 5FTOA 4GKHA 3KKVA 4X6RA 3NPCA 1WBTA 4NM3A 3VO3A 3FL5A 2IIPA 4WG3A 3HCEA 3TCPA 4RLKA 1FVRA 2XNNA 3RGFA 5E1DA 1YWRA 3OXIA 4I5MA 3SW7A 4HVHA 3P78A 3DB8A 4JX3A 3BWBA 2RFDA 2XCKA 4JAIA 1FP1D 1IRKA 1PXMA 5CVVA 3NGAA 4KNBA 3PVWA 4RFZA 5EDQA 4EC8A 2HENA 3LDFA 4B8LA 5HIDA 5E8XA 3FSFA 4IAIA 4BDAA 3ETAA 4GIIA 2BUJA 3C0KA 4XLIA 4YTHA 3NDMA 2X2LA 4RIXA 3S1HA 2QO7A 2J2IB 2C7QA 4RT7A 2PPQA 4GIHA 3GRYA 3PIZA 4RVFA 2G1PA 3G90X 4FVPA 4EKLA 4L01A 1WVXA 5CENA 1U46A 3IDPA 1RI4A 4BTFA 4LRMA 3BYUA 4FTQA 5CU4A 4HCVA 3E8EA 4M12A 3GC7A 3A4OX 1IA8A 2JH9A 2QHMA 3SSOA 1J7UA 3QGWA 5E9EA 1LUFA 2CGUA 4IWQA 3OE4A 2IVUA 4WBBB 2IW9A 3DZQA 1YOMA 2QOOA 1OMWA 2WK1A 2HWPA 3ODZX 4J52A 5CNOA 4FV2A 4XG6A 5C4LA 5CXZA 2AVDA 1KPHA 4DGMA 1AQ1A 3JY0A 3FLYA 4PYLA 5E8JA 3KXZA 2X6EA 4NW6A 3OD6X 4KRDA 3G9LX 2P1DA 2C6TA 3GCPA 4DH5A 4KB8A 5EKUA 3V8VA 1H1PA 1Y91A 4W4XA 3VSEA 1O6KA 5DWRA 3H9OA 3KN5A 4Q9ZA 4MTLA 3VUIA 1L3IA 5EH0A 1H26A 2IH2A 5HO8A 1NY3A 3DMHA 2JIIA 3C13A 2ZIGA 2B9FA 1DUSA 5EI8A 4U40A 2CCHA 2XIRA 2HXQA 4EOIA 4BN1A 4B17A 2Y9QA 2HTEA 2VNWA 3DAEA 4XH6A 4FSXA 3E87A 4XOYA 4EK8A 4PL5A 4F0IA 2PYWA 4FKRA 1XDZA 1BYGA 3DKCA 2YIYA 4UV0A 4BDIA 4L46A 1HMYA 3VQHA 4GOLD 3QXOA 4LECA 1GJOA 2F9GA 5E8RA 4H0NA 3Q4ZA 2WAJA 5FWDA 4JL9A 5HNIX 4QMXA 5HBHA 4FODA 4ZY5A 4ALVA 4XUDA 4O7LA 2WMAA 3UOLA 3MTLA 4A4XA 4TY1A 3VUKA 3PT9A 5LMBA 4WOVA 1WBWA 4YZCA 4PYOA 2WMXA 4F4PA 4DINA 2PVMA 4C06A 4KIFA 1JKLA 3E8CA 3FHRA 4NCTA 4RX8A 3ZLXA 1U5QA 3HMOA 4OT5A 5D7VA 1U4DA 2XRWA 4JXJA 3C3PA 4DTAA 2EB2A 2O8YA 2JIUA 3DS6A 4PL4A 4DEAA 2OY0A 4MEDA 5CQUA 4D1SA 4RTJA 1MQ4A 3M70A 2WB8A 1G38A 2XVAA 4WO5A 5TKDA 4HVIA 3EQGA 3WZUA 4Y8DA 4CMOA 4MBJA 3GC8A 4RVLA 3VJOA 2I1MA 3KMUA 2X0GA 2XK6A 3PVUA 4L3LA 1FVTA 4L53A 4O21A 2PMIA 3U55A 4KKGA 5EOVA 5LCKA 2I6GA 3P9KA 3QA0A 3H4JA 4XEYA 3JS2A 1VP9A 4TZRA 3FQSA 4E70A 4MVFA 1URWA 4EYJA 1BI8A 4TNDA 1OUKA 3SC1A 4RTSA 4W8EA 2ZAZA 3BGDA 3U4UA 5F4NA 5ANEA 4AE9A 2VU3A 4ZAUA 3GRUA 3CJRA 2O0UA 1JVPP 1K9AA 5IH6A 2WTKB 2JHCA 2OKCA 3P97A 4N57A 4DQ0A 2XCHA 4MWIA 3ZUTA 3IOPA 1QMZA 4C2VA 3FTEA 3P4KA 2X8DA 1P39A 2UYHA 4ACCA 3C7QA 2R0UA 4F6UA 3TQSA 4AFJA 3HNRA 5FEEA 3L8XA 1K3AA 3NWEA 3E8NA 2OXTA 3NYXA 4KS8A 2X7GA 1HCKA 3V5LA 2NXCA 2J0LA 4MXAA 4FSYA 4RVDA 2X4ZA 1ZYJA 2QO2A 5DT3A 2AC3A 4I94A 4RSRA 2YM8A 4AA5A 1VZOA 4O0UA 3GU8A 4HVGA 4OBOA 4L00A 1ZKDA 4PIMA 4H1JA 4IFCA 4XJ0A 3V8TA 3PWDA 4GUAA 3FZPA 5FTWA 1IA9A 1WAKA 2Y0AA 3GENA 2WTCA 1GZNA 4TWPA 3DXZA 3VBYA 4K8AA 3I81A 1OIRA 1CMKE 2R3GA 2YABA 2IDKA 3P9JA 4QP9A 5EIWA 5JN2A 3R00A 5IEXA 3FWQA 4ACMA 3DBQA 3W1FA 4NTSA 3ANXA 3PXYA 4YHJA 2ZIFA 1DI9A 1PMNA 4FK3A 2WA2A 3RPRA 1JPAA 2C30A 5AIRA 2ZBQA 1KV1A 2YJSA 4RQKA 2VDVE 3QL8A 3GDHA 3B8QA 2WGJA 1OBGA 3GXLA 4U3YA 1VPTA 5K0LA 3JPVA 3ORLA 1H1RA 3W55A 4DGLC 1QPDA 4KRGA 4XOZA 2GMXA 2W99B 3F2AA 2QE6A 3Q6UA 1YXUA 3BGIA 3QRKA 3WF6A 5ERGB 3NR9A 4C3PA 5BVWA 5IQIA 2B4SB 3HAVA 3IW8A 5C1IA 3CGFA 4ANLA 4QMTA 4MHAA 3DLSA 4RC2A 2IP2A 4HGYA 5HNBA 3LZBA 4MD8E 3V5JA 3UIUA 3IO7A 2OXDA 4I93A 3RP9A 2O2UA 4E31A 3LXNA 4JG6A 2YIXA 4YJTA 3HMPA 3P86A 1EH4A 3THRA 3OE5A 4IX4A 3AD6A 4PMSA 4U79A 3HV5A 1P14A 2NP6A 2PVLA 3DV3A 5FD2A 1BUHA 1Q5KA 1ZYDA 5CTPA 3TUDA 2EJUA 4M38A 2J90A 3NNWA 2FVDA 2OIDA 2VX1A 2W5AA 4AGUA 4QPSA 5FEDA 1W82A 3GRRA 5BPYA 4ACDA 2P7HA 3NNVA 4BIBA 4O2PA 1OPLA 4IZ7A 3FE3A 5FP6A 4WVLA 4IBMA 5K3YA 2R3PA 5KZ0A 2ZJWA 3EGIA 3TNQB 1WVWA 2C6EA 4EOKA 3QRTA 2J51A 4J99A 1ZXEA 8MHTA 2PK9A 4PNEA 5KMNA 4FIHA 4YZ9A 3R22A 4G3EA 1OPJA 5D1NA 4OGRA 4QP4A 4ENXA 4BCIA 2J6MA 3FI4A 1WBPA 1NW8A 3DJ5A 2BVAA 4GRBA 2XKCA 3QCSA 3EVCA 4OBXA 1WMKA 3H9RA 4DH8A 3EQCA 5EKOA 3O8TA 2VDWA 3JWGA 5FCDA 1XBAA 4W8DA 2RG5A 3FI3A 3B7PA 2OJFE 3UTOA 4WSYA 5DOSA 4QP7A 1KPGA 3MVHA 4FZAB 5ACKA 5AP2A 2J50A 2F49A 4RZWA 2C7OA 5KUPA 1B6CB 3W2SA 3FRHA 4H39A 3U51A 5EI6A 2XJ0A 1YQJA 4S30A 3G7UA 5IQDA 2BHHA 3CY3A 1FP2A 3CIKA 4XG8A 2YM3A 4C4GA 4RA5A 1IY9A 3TL8A 4XYFA 4TN6A 4FYNA 1OL1A 3VVHA 3NCGA 3SVVA 4DGGA 4Z7HA 3E92A 4RRVA 3ACJA 4XMOA 5FXRA 4FEXA 3DFAA 4O6LA 4K18A 1Z9XA 3DJ6A 2P55A 4C35A 4XV3A 3K3IA 4B9DA 2P4IA 4JDIA 5DN3A 3SQQA 4F9BA 3OW3A 5K5XA 1N7IA 3VC2A 3LHDA 4KKEA 2CKQA 4GG5A 3FPFA 1ZGAA 3I58A 1LEZA 3RPOA 4LV8A 4BYJA 5BUIA 1KE9A 1Z5MA 3F82A 4KIOA 2OYRA 4DH7A 5ICFA 1OIYA 4FICA 1WG8A 1V0PA 1ZOEA 1BMKA 2UZUE 3RCJA 4AACA 3R21A 4E5WA 1RI1A 4ITHA 2QO9A 5K01A 4AOJA 4HZRA 3FZOA 4DZRA 1TQPA 4O7SA 3Q9WA 7MHTA 2G72A 5AP7A 2G1TA 2G8NA 4C61A 4OLIA 2QCSA 4YV1A 4HGTA 4F7JA 5KMIA 4FT3A 4FV1A 2W7XA 4BTKA 2W4KA 4M97A 4KS7A 4YMJA 1G8AA 5B0XA 3R3HA 3AMBA 1DM2A 4L67A 4AZSA 5J5SA 2VWVA 4PGGA 3V04A 5J95A 5AP4A 4G16A 1PXOA 4YJVA 2XH5A 4EH9A 3C4EA 4CGAA 3FLQA 3ZM4A 3U4WA 4IX5A 3FMJA 3NDJA 4L44A 2W1ZA 3FDNA 4Q2AA 2XYRA 3KQPA 3UYTA 5KQSA 5CVDA 2CJMA 4EZ5A 1S9IA 2PZIA 1MRYA 1Y6BA 4ACHA 4PIPA 2P2IA 4CKEA 4BTMA 2YDIA 1WBNA 5IG1A 2A0CX 3KEXA 2Y8OA 3CTHA 1LEWA 5A14A 2W9ZB 4JIAA 1DAYA 4E73A 3QRUA 3R9NA 1ZWSA 3R83A 3ALNA 3TPZA 5EPEA 2VWZA 4QMPA 4F9CA 3Q2JA 3Q60A 3DTNA 3OWLA 1KWPA 2ITTA 4O91A 4KDRA 3FJQE 3ELYA 4KABA 4JRNA 5D1JA 2I0YA 2JGZA 5I9ZA 4HRAA 4KIPA 1PXNA 2OFVA 5A54A 3OWJA 3MIYA 4O96A 3GCUA 3QU0A 2GHMA 3UDBA 5EVJA 3AC3A 2PSQA 3OBGA 2ONLC 1NW5A 4QTUB 4D2RA 2ZBPA 5AUUA 1I1NA 2X7OA 1Q99A 3GRVA 4FYOA 4RA4A 4CFXA 2J5EA 2JHPA 3ENMA 4E2YA 2O63A 2ITYA 4JDJA 3DUWA 1FGKA 5L6WL 4QMLA 5G02A 2ADMA 3BELA 1DS5A 4X41A 1VE3A 5EMJA 4M15A 4GVJA 4AGWA 3HCDA 4AZVA 4YJNA 4NH1A 2F7ZE 5FTQA 1XDUA 3O7WA 5KMJA 3KQWA 4CD0A 5D12A 3MY0A 1S9JA 2XIYA 3U81A 3QWKA 2YACA 1NW6A 2PE2A 1IXKA 2GQGA 3PY1A 4YJPA 3NUXA 1UWHA 4RMZA 2YHVA 3PRFA 4IB5A 2ITUA 3RZBA 4YURA 3MIAA 1YZ3A 5LSAA 1YI6A 4LUDA 3QKMA 1H0WA 2BR4A 5J87A 4FSDA 3LFDA 3KQTA 3DXNA 4FV5A 3BV2A 5H8GA 2FA2A 1M17A 4QP2A 3TKYA 3GU7A 5H2UA 4X60A 5CS6A 3FPGA 3KC3A 4G17A 3KQVA 2G2IA 5AV3A 2HZ4A 1KOBA 5JFWA 3UBDA 4GOOD 5EM7A 4C36A 5E91A 4FKUA 5BYZA 4E2ZA 1JQHA 1T45A 4U0IA 2WELA 2PVNA 3T3VA 4EI4A 3KULB 4XRJA 2Q0BA 4S32A 4ATNA 4QYYA 4IADA 3K2LA 4OTFA 4DEEA 3IOKA 3QQUA 3VS0A 3R9XB 3NYOA 4OBWA 3TZMA 3HEGA 3D5VA 3II5A 5E8UA 5EMMA 1YRPA 5CSXA 2IZUA 3C9WA 3HECA 4G3FA 3SRVB 3PVBA 4W4WA 4RVMA 5CF6A 5IA0A 1PY5A 2UW7A 3O7LB 5FHRA 5AAEA 2R3MA 3V97A 2ZVJA 4QPAA 5F94A 3UYSA 4H3QA 3M42A 5K0NA 2WTKC 5TT7A 4MD7E 3KRJA 4IVAA 1UNGA 4I24A 4XS2A 3I0QA 4FMQA 4YGAA 4X1OA 5HE1A 1H0VA 1B42A 5IA3A 5BVNA 1KPIA 2BROA 2R9SA 1Q8TA 5HEKA 3GRZA 3VBXA 4FIFA 2IO6A 5DM0A 4DLJA 4B6LA 1NT2A 4I20A 3O31A 3EZRA 1X19A 2ONYA 3ZO2A 3BWMA 5DG5A 4A9UA 4CV9A 4A7CA 5M06A 5K0CA 1Q4LA 1F5QA 4GU6A 5LQFA 3OHTA 3ORTA 3O96A 3G2PA 4K2RA 4R3RA 3O8PA 1OITA 2VGPA 1KYWA 3BHYA 4ZTHA 5K03A 1KP9A 4HG2A 2W4JA 2GQSA 4QTEA 2IWIA 3PLAE 4HVSA 3TDVA 2GTMA 3TNPC 1NBHA 3PVGA 3SD0A 3FQEA 3KPYA 3FUXA 2YCFA 4V04A 1SQFA 3FMHA 2PJDA 4F84A 1MP8A 2C0TA 2C5YA 1SUSA 4JT3A 3MJ1A 2GHGA 4ZZMA 4I3ZA 4FGRA 4OR5A 4PTGA 3C0IA 3QCYA 1V39A 1FINA 4L43A 4BGGA 1F3MC 3D94A 3OY1A 3ULZA 4NUSA 5EHYA 3QUEA 5CWZA 1Q8UA 3BQRA 4BLWA 4XG2A 5FA8A 1NE2A 2ZTHA 3MTFA 3EVFA 2F2UA 4M13A 4HYUA 1J1BA 4PYNA 3TZ8A 1KOAA 2BRNA 5HG8A 3IHTA 3OWKA 3D5WA 2VO7A 4Q9SA 4P90A 5C8MA 3AMAA 2UZWE 4NT4A 2C69A 2Y4IB 3LFQA 2IVTA 3MQ2A 3MTEA 3JR1A 4C4JA 1H1SA 3CD8A 2ITZA 4JIKA 1WS6A 5LMKC 3G2MA 3SXSA 3ZC6A 4ER6A 2IVSA 5D1HA 3R24A 5LVMA 3S68A 4UWCA 3EQBA 5JZNA 3KFAA 2GNIA 3LCSA 2RGPA 4E4MA 3LFNA 2YIQA 3HCCA 3WZEA 2B78A 1CSNA 5CI7A 2UZNA 5F9EA 4EVIA 4K9YA 5E1SA 4I0RA 3C4ZA 4ORKA 3T7RA 3U8WA 3FAAA 2ZSUA 2AZTA 4BCNA 3AT2A 3AC5A 5CM2Z 1H8FA 3E93A 3F9NA 1YFJA 5CAPA 5KMOA 3KCKA 4EOJA 5KBQA 5L8LA 1M7NA 1NA7A 3LCCA 3RK5A 3EGVA 4FSMA 3IW4A 3FHIA 3UNKA 3FMDA 3BYOA 3LQ5A 3OMVA 1KE5A 4C7TA 4IAZA 2QU6A 3DLIA 4U7ZA 4LG4A 4E6QA 3N4TA 3LJ0A 5FULA 4RWLA 4PYMA 3LKDA 4GUBA 5JFVA 4BVUA 4EK5A 1I44A 1KYZA 3QBNA 3AGLA 1YOLA 2PUUA 4A6EA 3R8PA 1LPUA 3NUSA 4MQ4A 1JG2A 2YR0A 1OKYA 2AOVA 4H05A 9MHTA 2VWIA 2AN3A 1FGIA 2UW9A 4RWJA 4TYHB 4PRJA 3A8WA 3QX4A 2WQNA 4D0WA 3FZSA 4H3BA 1PJKA 4IACA 3LCKA 4RGJA 2BALA 2CLQA 3FBVA 2PZ5A 4UALA 2OH4A 2QG7A 3NAXA 3ZBFA 1KUTA 2CGXA 4QTAA 2C4GA 4GMYA 3JWIA 2CNUA 4BZDA 1XBBA 5JUWA 3LHJA 1UV5A 2Y4PA 2PXAA 4IM2A 2ZZNA 5IA4A 5HD7A 5FP5A 3CPBA 4DMGA 5EEHA 5JZJA 2X9FA 3BHTA 4ZIMA 3VS7A 5AUTA 2VTAA 5GHVA 3DFCB 3PY0A 3A62A 2OO3A 1V1KA 1IAJA 4YPSA 5E8VA 3AT4A 4Y83A 5LQAA 5K0EA 3EKKA 4K77A 4HW7A 4R77A 4G9CA 2PHKA 2VGOA 4F86A 2WU6A 1R3CA 1PHKA 3QTUA 3R02A 4RV9A 4BKJA 4KSQA 2UVYA 3IEIA 2R3IA 2R3JA 2OZOA 5EFQA 5E9WA 4CFFA 4YP8A 3UE4A 3KQMA 3EN4A 4C4AA 5AUYA 1FMKA 3ZSGA 5DE2A 5CVJA 4ANSA 5HEZA 3LXLA 4GSBA 3TWJA 3KVWA 4D9TA 4EZ3A 2WXVA 3UGCA 1WZNA 2QOBA 3F2NA 3UG1A 4K11A 2UZVA 3PRIA 4EQZA 2IN6A 3G15A 3G5DA 4A9RA 2REIA 2LGCA 3DKOA 4CQEA 2E9PA 4NM7A 2VWXA 4GUEA 5DT4A 4YC8A 3WILA 2XYUA 3TKUA 4LOOA 4PNKA 3UMXA 3OUKA 4IC8A 4N6YA 3CQWA 2XRUA 3GCSA 5EW8A 1H24A 3RK9A 2PX4A 2HR1A 1G6Q1 3ZUUA 2R3NA 5B2KA 3TNHA 5LQKA 4PDOA 4IZ5A 3FKNA 4I22A 3Q96A 3TKAA 2ZV9A 4IWPA 5IQCA 2WMRA 3R1SA 3ANQA 3EHAA 5J9LA 4MH7A 3TV6A 2N47A 2YM7A 2JC6A 3P9NA 1ZMWA 4BDDA 3F5GA 3QZFA 1Q24A 3TIZA 3MFUA 4QOXA 5A4QA 2H11A 3DKGA 3DH0A 1QAOA 1RE8A 4YZBA 3OZ6A 1VYZA 1GZKA 3KK9A 3SLSA 3C4XA 3ME5A 1R0PA 3HEMA 3VWAA 4RWKA 3V5TA 3CR0A 3ZO3A 4QMSA 3M6XA 3CJGA 3BCEA 2GLUA 1QZZA 3G88A 2VTJA 4FEQA 3UJAA 4E93A 5DTMA 3P8ZA 5M07A 4TYEA 3OS3A 4DCGA 3G2QA 3BU5A 4RTQA 3QCQA 3O7LD 3KXGA 2KTYA 3RHXA 4QMUA 1ZMUA 1R00A 2ZLBA 3VS1A 4KBCA 4XG3A 4FNYA 3V5WA 4MXXA 5LCJA 3CJTA 2OJ9A 4Y5QA 2XK7A 1XKKA 2IH4A 5CSPA 4DKJA 4E1ZA 3ZLSA 2ITQA 3NW9A 4ZTBA 4ZSJA 4GK4A 1Z57A 2B25A 3DDQA 3R6TA 3ZRLA 5B2LA 5CU0A 4FKOA 4X0MA 2Q83A 3RTPA 1YDRE 4JG8A 2XYNA 3LM0A 4FKJA 4YJSA 1CM8A 3SOAA 3OUNB 4IWOA 5CVFA 2C5NA 4YUXA 3I79A 3EWHA 4QYGA 3JVSA 4LI5A 3SG9A 4G1WA 1J7LA 3BWJA 4KKHA 4I21A 3KXNA 1FQ1B 4RC3A 2UW4A 4OX9Y 1SNUA 4JXFA 5CYIA 3JXWA 4U9AA 4ZK5A 1VYWA 4R8RA 3EJ1A 3SSMA 3LQ8A 1OR8A 3FPJA 5HE3A 2ACXA 1H1DA 5KNJA 4FL2A 5DT2A 4BIEA 5D7AA 4O0XA 5EHIA 3W10A 1DI8A 4XBUA 4ER0A 3RAKA 3PP0A 5HD4A 4QPNA 5KVAA 2VTOA 3QQFA 3I60A 2JBPA 3EVBA 5ETFA 2R3SA 1G55A 1U59A 3TMAA 3DLZA 3JVRA 4TYJA 2WEVA 4JJRA 2BRGA 3ZXTA 2PY3A 3QLGA 1QAMA 4F6SA 2UZDA 1YWVA 3D2IA 4NK9A 3S0OA 4YSJA 1OZ1A 3PIYA 5IF1A 3PA3A 4J53A 2XB7A 3D9VA 4ZSAA 4XP0A 4C08A 1YVJA 4C02A 2E2BA 3UIBA 1H25A 4D28A 4PTCA 4L68A 4I5HA 3Q5ZA 2PE0A 3QZHA 4FZVA 2GHLA 4AF3A 1IASA 4FG9A 5EHGA 3FRIA 2QOQA 4ZLOA 2F7EE 4J71A 2B9EA 1ZLTA 5FTGA 2J9MA 4QQ5A 3EN9A 3UQGA 4GOMD 2J4ZA 3B2TA 4QNAA 3V6RA 4IM3A 5LVNA 3I53A 3DNDA 1Q62A 4L3JA 3DMFA 5K0JA 3TZ9A 3LPBA 1PRYA 3GXOA 3DY7A 3NWBA 5AIKA 3SV0A 3DNEA 2R3OA 4O0YA 4BF2A 3H0YA 4IAYA 4M37A 4APPA 5HIMA 5GJFA 4L42A 3QTIA 3MDYA 3ZEPA 4FKPA 5J1WA 5MHTA 5E8YA 4DFUA 2R3HA 3POOA 3TOSA 1IM8A 1M2RA 2K4MA 4A07A 3KQOA 5M57A 2CLXA 2BM9A 2W1IA 3UO6A 3PX2A 4S31A 5KHXA 3ALOA 3FI2A 3KY2A 3SXJA 4NZWB 2WNTA 3L9MA 3CJFA 4GT4A 3C4FA 3IW7A 1JSZA 2QC6A 3PIXA 3DK3A 5FUBA 1WFCA 2V62A 3HA7A 4Y2HA 2WMQA 3AGMA 4BDHA 5IQHA 3MPMA 4IWNA 3V8SA 3LW0A 3SOCA 1T43A 4GEOA 2V7OA 4ZY6A 5GIPE 3I4BA 4GKIA 4RZVA 4E2XA 2HXLA 1M14A 2W96B 4IEBA 1OL2A 4RTKA 1XXLA 3EQFA 5ACBC 4I5PA 4NU1A 2QQ7A 4A06A 2V55A 4YJUA 2OF4A 3QTRA 2WMWA 4RJ6A 3HLLA 3T9TA 2EWAA 4O27B 2DPMA 5DM1A 3T7TA 1OL6A 3U9NA 4TPTA 4AW0A 4I1ZA 3ZRMA 2X9EA 4RFMA 4J8MA 2O5KA 4GVAA 3P71T 4QMNA 1BC5A 3TI1A 3KR9A 3Q52A 1J1CA 3FMEA 3QQKA 4IZYA 4EOLA 4C4HA 3G5LA 3HA3A 4AG8A 5CVGA 4FTRA 3CEKA 3HCBA 3DKFA 3KQYA 2QU5A 5KQRA 4CVAA 4B7TA 3F61A 1V0BA 2UV2A 5ANKA 2WTIA 4LMUA 1R78A 4AFEA 2QOIA 2BTRA 2PX2A 5M4FA 1ORHA 4RX1A 1W8CA 5DGZA 3PJ2A 3GFEA 2QKRA 4FSQA 3I9FA 1GAGA 3KVXA 1T46A 3BI6A 5KS2A 4N4SA 5HIBA 4M14A 4DH1A 4IAKA 2VO6A 5E8SA 2FSLX 1VJYA 5EYKA 3MVLA 5IPJA 4IQ6A 5LMKA 4UEUA 2V7AA 3K54A 4I23A 4C62A 4PWYA 3FYCA 4QVKA 3GGDA 2Y4IC 4J1RA 3TTIA 5IMEA 5ITAA 4YV2A 4D9UA 3CTJA 2QVSE 2Z8CA 5T64A 3DAJA 3VS3A 5ANDA 2YN8A 4KD1A 5T6BA 3NUYA 5DR6A 1JG4A 3ET7A 4TNBA
chains in the Genus database with same CATH superfamily
4B0OA 2C5OA 1ZQ9A 2RFNA 3ANYB 3RRMA 2AG8A 2C9YA 4GMGA 3LAWA 5KU7A 5KKRB 3HKCB 1E2PA 3I5ZA 5HIIA 4KN6A 3K1AA 2GF0A 4YJOA 2PA3A 2F90A 4CFUA 4R1PA 4YEDA 1CY0A 3LVBA 3LV8A 4YZNA 4F1TA 3LD9A 4P4CA 2VIIA 4M8SA 5IN5A 4P38A 2R5TA 1GUAA 2WQOA 1ACLA 1BHQ1 5IH5A 3WB0A 3MCVA 3JQAA 4XVUA 3PXXA 1TM1E 3INNA 4F5DA 3O4GA 1J9EA 4HVDA 3R5FA 1GAWA 1H5UA 3AR9A 5CDYA 4BLTA 1UAYA 4TUYA 4YCMA 3WDLA 2AWOA 1JIXA 2ODNA 4II5A 3JSAA 1ZRHA 2C54A 5D3QA 5L4NA 3LKMA 4A0RA 3O3NB 2BTSA 5C26A 1VA5A 1O4WA 2JANA 5CK4A 3GNSA 1XL1A 4I14A 3QVUA 3IJRA 4NZZA 2V22A 2ZSBA 2XRFA 4MZXA 1ZSNA 3OTIA 5K4AA 1B14A 3M0EA 2AC5A 4QDKA 1ODSA 2BCJA 4IIYA 3SX4A 4XD2A 3F5MA 4ER5A 2J3IA 3A4PA 2VJPA 2VPXA 2HDHA 3MI9A 4L8GA 1H94A 3LLTA 2ZXEA 2VBGA 3KZKA 2XK8A 4HB4A 3B6KA 3UJNA 2QG9A 2QWXA 4IIXA 4AP7A 4E30A 3P20A 4L07A 4HSGA 4A27A 1GZ4A 2BBSA 3ILVA 5CT6A 3TTXA 4EMSA 4A6XA 2GTNA 4NDNE 4G3CA 4YPOA 5L2IA 3IR7A 3EASA 1W85B 5BNTA 1GL9B 2JGFA 4NECA 3TUIC 3UDZA 3I0NA 5A3JA 1X74A 1LF0A 3B3QA 3M5CA 4E5NA 3UO5A 1FQJA 4V24A 2QMYA 4BNDB 3DE6X 2LCFA 3I4LA 1ORVA 1N2CE 5ALXA 4RAOA 4G0UA 1P2AA 5LWNA 1IAVA 4JENA 3AJAA 3M82A 5K4JA 3R7DA 1VQ1A 4DA5A 4GPBA 5FQDC 3KOUA 1ZLXA 3MWDB 2R60A 2XWPA 4DJTA 5C53B 3GT0A 1TI7A 4IJ6A 1ZJWA 4RVUA 2G5PA 1T0BA 1OM1A 2BRHA 1VG1A 5I9WA 4HQOA 1H08A 4X21A 2G04A 2CBGA 3QOFA 3T1HB 4KHPB 1DO0A 1XMQB 5E1MA 3CPJB 3CY2A 5JDCC 4UYNA 3F5UA 4ZHQA 3TUBA 4E13A 1UIRA 3K1JA 5DH9A 2P6PA 4ISCA 4TZ6A 3VKWA 4G0OA 3FAKA 2HNKA 4ANBA 1J8QA 2XYQA 3TAHA 1OPRA 4B81A 3FDXA 3DGFC 2QNBA 4RMIA 3CSSA 4TKUB 4BB4A 3ZOKA 3PK0A 5B12A 4FHFA 2VQSA 1AMUA 2B3TA 4XB1A 2X1LA 1MB0A 3ZVKA 1VI6A 3KDAA 3DBEA 2JIZA 2CLKB 4HPUE 4HZSA 1DFGA 2DR2A 2ADFA 3U4IA 3D2LA 2HMAA 2G9UA 2VCEA 3USCS 1SQ5A 4B84A 4X1IB 5DTJA 4WT7A 3SLKA 5KBRA 4D5HA 3W3AH 3WF7A 2PTGA 3CUUA 3WQHA 4CG1A 1NNLA 4Q00A 3K9LA 1C9EA 2UZ3A 1RYZA 1B0AA 5D85A 1YRHA 4UDYX 2QAGC 1J07A 3COKA 3FTQA 5DGDA 1WDKA 5DYYA 4X6YA 2I6SA 2A1AB 2AOUB 3CG0A 3RVOA 1A4RA 1A9OA 1VI5A 2FW1A 1G6KA 4LOQA 4N8EA 2WJWA 4ED9A 4M9QA 4NZOA 4Q3AA 3C5HA 2QP9X 4C9BA 4PFKA 1ZO8A 2V4MA 3MMPA 1MGPA 3HX4A 4W5TA 3QWJA 1ZJ5A 4EJNA 1G5PA 1JDSA 1JU4A 3L7JA 4XG9A 4E32A 5M5BA 5JQGA 4EG0A 2LAVA 1Q2XA 4R1UA 3BOSA 1HETA 1Z39A 4CXMA 3V5PA 4C4TA 2OB1A 2XF8A 3TNLA 3GOHA 1DI0A 3PR2B 3EPLA 2I1QA 2QD9A 3GFGA 1ZK1A 2PVKA 1W36C 2IUSA 2ZAYA 2HFKA 4CU5A 2BCGY 1J0DA 3MC1A 4IIGA 1TX4B 4EUTA 1E7RA 1XYYA 4MEAA 2AUTA 2WP0A 2IHZA 3ZCTA 2Z98A 2Q7XA 4WGFA 2H4JA 4K9RA 4G01B 3FMVA 4XAQA 2QMUA 3N0WA 4L4UA 1JBKA 5DTQA 2IHUA 4A2QA 2CXXA 4FKSA 3HU3A 4U39A 4ZEGA 4RIYB 5IM4A 3ICCA 1E4EA 1XMPA 3U16A 4A36A 1L5QA 3OBJA 3CP9A 3AVUA 2DTDA 1MO6A 3DBOB 4WSOA 1G8MA 3F3WA 3IG7A 1A5AB 2HU7A 5CXQA 1RZVA 4O4HB 3CNBA 2XZSA 5LOHA 2W58A 1OLUA 1PZNA 3QRIA 4Q5HA 4F7LA 2CFRA 3EFWA 2B98A 4AJPA 5CX4A 2YXDA 5KKCA 2J0UB 1U2PA 1DO2A 1UMBA 4QFBA 1KK0A 3KR2A 5ENZA 1N3BA 3GW8A 1EWYA 2J9ZB 4JBXA 4IB3A 2PZRA 1N25A 4ZI5A 1RPAA 2J31A 3I2FA 1FMOE 3R9XA 5IC5A 1F1JA 4L4SA 1OB5A 2PRZA 4CLEA 2OPBA 4C7JA 2H4HA 1EXMA 3V6SA 1DUIA 4RPKA 4FTUA 1DHRA 2H92A 4B5LA 1A1SA 2HCRA 3O4HA 1AKYA 5T68A 3D81A 1D1SA 2PRIA 1A95A 2QLMA 1DIGA 4PRZA 3GUVA 5F77A 4URFA 2EXCX 4IFIA 5A5EA 2B7CA 1UC5B 2ETRA 2XNKA 4JR3A 1JQJC 3ANSA 2H1HA 5KNBD 1W83A 3SD7A 4L7SA 1QDLB 3KZNA 3VM6A 4FDLA 4LDTA 3GOKA 1L9KA 4I6BA 3DNMA 3FGPA 3ZX5A 2ZIXA 4RESA 3G7NA 3WNCA 1U2GA 1Y1QA 5ESRA 5DEYA 1XVLA 1M1YA 1GGJA 4JGBA 1R37A 7AT1A 4D0NA 5JJ5A 3B38A 3PPZA 3DP7A 1VSUA 3O8LA 3L46A 1W0KA 4FOOA 3IQ7A 1BRMA 3CC6A 2L17A 2R5FA 1RAGA 1U5BA 4C07A 3I0OA 2XIKA 3BHMA 2X5KO 5A9UA 4X71A 1QFJA 1VJDA 1H4TA 1Y3BE 2JLQA 3BKBA 3KFXA 1TQMA 4CTOA 5ETIA 3UO4A 3ABIA 2R3KA 3N5KA 3Q3BA 5M4UA 2WFLB 4HRYA 3ABOB 3GELA 3FYHA 1XTQA 2ZSEA 3ETHA 4KGZA 4R69A 3RFCA 4KACA 2WWIA 1XAIA 4EY3A 3I42A 3DO5A 1G7SA 4ZO7A 1BOOA 2PD3A 3WXBA 1IPFA 2VUWA 1M2QA 3F3YA 2LP4Y 2VCYA 5EI2A 2OD2A 3MWEA 4FTOA 1S0UA 4DUPA 4EH6A 4XGNA 2EG9A 1GZ3A 4L0DA 1YNSA 5F1ZA 3VC1A 4JY7A 1XHAA 4NCIA 4TZ0A 3GROA 4A2CA 5KNDD 3DOUA 4DM7A 3LIPA 5IH7A 4Q05A 4FEGA 1E4OA 1ZGBA 3ENNA 2QR3A 4YDQA 2F59A 2AOWA 4BFUA 3EY4A 5MGNA 4TWCA 4J0DA 1SKMA 2NM0A 3PFBA 5BUJA 4J1SA 2FPLA 4ANQA 5ALGA 1PT7A 3IECA 1IOWA 2WWHA 3UC3A 3WB9A 2G4VA 3L04A 4PF1A 4YFYA 1T6XA 3WJ7A 2XUDA 4X2NA 4IJ5A 2AV6A 1R5BA 5CJPA 2C5SA 1DUVG 1NBMA 2PYIA 3QA9A 3QMPA 3SS8A 4H35A 4TYIA 3FVQA 4ALIA 3ND6A 2W17A 3AVWA 1USKA 2R0QC 5KAPA 5KVSA 3I30X 5C81A 3D0EA 4KU4A 2UZBA 5I5GA 1OBDA 5J4KA 1S8AA 4OMDA 3VHXA 3NAYA 2YHIB 4XX9A 5E90A 1A06A 3HFJA 4O4LF 3HLKA 3GWZA 2CNQA 2BMFA 2NVUB 1XQVA 2PFGA 4O2LA 5TMDA 1SU8A 3HA5A 3LRPA 3RRFA 5LQDA 5KREA 4B74A 3LP8A 1OKZA 3Q2KA 3W33A 3G9UA 1P61B 4OSOA 5CMLA 3L8YA 1E1MA 3VX3A 3ZU6A 4F7SA 2F4VB 4RD3A 4B5KA 1QO7A 4F06A 4DF3A 1COWD 2FZ5A 5HJ7A 4DR5B 4HDRA 2HRQA 1EZ1A 1G8KA 2G9ZA 4GI7A 1R27A 3HVHA 5K2OA 1W1IA 2UW3A 2QOKA 3CRNA 1Q8YA 1XZPA 4YRMA 4A4DA 4NPCA 3A2MA 4WCFA 2IIBA 1GU0A 4ZALA 1FMCA 5I9LA 2A35A 1C3VA 1JQEA 2JLZA 2BVNA 3OI7A 4NS1A 4C0BA 4M86A 2BFYA 2C2YA 3BXHA 4BCJA 5CXHA 2VF7A 4NSNA 1QH9A 2D3TA 4RLQA 4CMEC 1KMHB 2PNFA 1C0IA 1R50A 3WKCA 3EGEA 1AQLA 4D3YA 3ZDCA 3WWYA 2DCUA 3U6KA 1G16A 5CCDA 1FUYB 3IX7A 2W5BA 2GUWA 4QUKA 3QFTA 1PKDA 4Q9JA 2I7QA 4MV0A 4WUTA 1GVHA 1QOQB 5JSFA 1FS6A 3U80A 4EW1A 2GSDA 2H5EA 2P5TB 3V2HA 3EHEA 3GARA 1CNEA 4CIXA 4HGEA 3D6AA 3PTZA 4MVJH 4XG4A 2X42A 1M8PA 5JRZA 5FTKA 2YWHA 2FFAA 3AU9A 3C1TA 1FS4A 1J23A 3CBGA 4KVZA 2Y0DA 1YDEA 4BVKA 4OG2A 1HUQA 1O1YA 4LWPA 1QP0A 1DAWA 2Z8YM 3PQ7A 1G8PA 1NZDA 5DNUA 1B6TA 4CLIA 4N0SA 3G5TA 4M1KA 2Y1KA 5HHWA 3WGOA 4G0PA 1RPTA 4PQNA 3GPDG 2B1RA 1PYXA 1RWMA 5DFAA 4MP6A 4WHMA 4Y2PA 4D9CA 4YCSA 4I4FA 3O26A 2P33A 3EYWA 2HKIA 1F0QA 1RW8A 4O08A 5GJBA 4BEVA 1RRKA 3A4IA 2POQX 1ZN9A 2VJNA 5TR9A 4BVJA 3N0TA 1SKYE 4NHOA 1AMNA 2VAVA 1XO1A 1GFZA 4KLRA 2GJSA 4GGOA 5REQB 2UVZA 1KJQA 1JT2A 4J1QA 2NT4A 3ACKA 2Y1WA 4EL5A 4Z0HO 1ODKA 3G51A 1TKRA 2XI4A 5HFAA 1IE3A 2PLWA 4BBJA 4DEIA 2ZRNA 2H48A 3ZGVA 4MK4A 4RZHA 1NN1A 4BDBA 3NHJA 3M1IA 2X0RA 2OM6A 3PPKA 1IBSA 3PZEA 2OF2A 3DDWA 1NOJA 3QLUA 3R1YA 3ZDRA 3V1NA 1ZIDA 1NN0A 3H84A 3LK7A 5IPFA 4WOKA 4MEBA 2P3LA 3T6KA 3HM9A 2H5IA 1PKGA 3PC7A 2CVHA 1K7YA 4EOPA 2Y6MA 4LV7A 3I5XA 3ZWBA 3RS0A 2W1FA 1ULBA 1H4SA 5DEWA 2JF0A 4JUBA 1HTBA 4BX3A 3UZUA 5FV4A 2VSFA 3PXDA 4L72A 3MT9A 1XMJA 3HN7A 3PE3A 3UK1A 2RONA 4UZSA 1GRNA 2R2PA 1GTG1 4BB6A 2I4TA 3Q9UA 5IEJA 4B83A 3EF1A 4R0NA 3L8MA 1VL8A 3K8OE 3RSHA 2XVMA 4V0NA 3ZUVA 4OM7A 1MW8X 3RAHA 5C5IA 3N8HA 1OCEA 5DDIP 3ORHA 1L7XA 4GX1A 2C7PA 4BBAA 4MPPA 3V01A 5HIEA 2BHEA 3PPJA 1U0RA 3WMXA 2HZ0A 3OOGA 3RC2A 1Y8QB 2J5FA 2ZANA 3G6GA 4YJRA 3WYDA 2X6DA 3O03A 4EKKA 3M81A 4PP9A 2BTOA 3HJNA 4KUJA 1S8NA 4DS3A 4MW6A 4Y2XA 3Q4TA 1KO4A 3PCTA 1DCMA 2QRJA 1JKFA 1YHSA 5IDWA 1YTLA 5E7QA 1MG0A 4LK3A 1WZ2A 2O2EA 4YO6A 4TMVA 1YIDA 3ZEWA 5KJ1A 2WKMA 1PWYE 3GLIB 3NX8A 4JJEA 3GGCA 3K4PA 4CKBB 3DXFA 4DQDA 1RQQA 3HBJA 3AUSA 2WQMA 4KXLA 5HQJA 4ZI7F 5B1YA 1JLLB 4M0ZA 2BZ1A 3UF0A 4WLVA 4O02B 3T34A 4RENA 2ANCA 2XVXA 2ZV2A 3OX4A 1QHHA 2G40A 4DV7B 2QLQA 1GN9A 1ZICA 4CKIA 1AU9A 5J2UB 4MGHA 3CZ5A 1CS4C 2VYQA 1XMMA 2NU8A 1JR4A 1YRYE 4CG9A 4GR5A 2XH8A 3JR7A 4DTIA 1DOZA 4BDFA 4KH0A 1VLLA 1TCVA 4O6EA 5J2TB 5K99A 2FPUA 2Z2IA 2ZIAA 5ELXA 3R1NA 4E3ZA 2KI5A 4M0DA 4BVFA 2GNAA 1CKEA 4IZIA 3AHJA 1U94A 5EC8A 4BV2A 1NVBA 1XVAA 3V4FA 1BN7A