4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
4YUVA 3FYDA 4JAJA 3Q32A 3EVFA 5KMLA 3REPA 1KV1A 5F1ZA 2JAMA 3L8XA 4E70A 5EKXA 5AA9A 2VO6A 3P7AA 3Q53A 3HTXA 2HWOA 3JWJA 4O86A 1HCLA 2JDTA 4F7JA 4CKRA 8MHTA 5EYDA 3LCUA 4NTTA 4MQ4A 4RIXB 2PPQA 1JG1A 3FQEA 3QCXA 2I7CA 4ATNA 3CCFA 9MHTA 4QTBA 2PXCA 2QG7A 3SKCA 1ZLTA 4EOLA 1H1DA 2OYRA 2ZB0A 3QRKA 3TCPA 2YERA 4HZSA 2C5YA 2ZM4A 4P4CA 1FMOE 3RALA 3UGCA 3PIXA 2EFJA 3ER9A 1PXMA 1AV6A 3C4WA 4NZWB 5CS6A 3FKNA 3BQCA 1G8SA 4QMNA 2ZW9A 2NXNA 4IMYA 3EVCA 4GOLD 4ER3A 3SG9A 1YHWA 5BP7A 2JG3A 1DAWA 2C69A 2BHEA 2OO8X 3COIA 4K9YA 3SHEA 1EG2A 4C59A 3C5IA 3PY1A 5J95A 4FL3A 1UKIA 4DTBA 3DT1A 3ZSIA 4WHZA 1S9JA 4FSNA 4FG8A 1W84A 4RTOA 5T6BA 3RAKA 4WKQA 4JI9A 2ONZA 4ITHA 5ANGA 1MJFA 2Z6AA 3LDFA 2QLUA 2VWBA 2XS0A 1DUSA 2Q41A 5JUWA 4RBLA 3R9HA 2W1CA 3HL7A 5E92A 3TV7A 4BBFA 2PZ5A 4AXAA 3HA8A 5ICFA 2O57A 3L8VA 1SNXA 4EH6A 1BKXA 2YIXA 4ZS0A 4A9TA 5C4LA 3KVXA 4WNOA 4XV2A 3RKBA 4DGGA 3DKCA 3TUCA 3COHA 5G6VA 5H3QA 3JXWA 4HNFA 3JS2A 3FMKA 4GCJA 5KMJA 5JRSA 1BKYA 1MUOA 3EPPA 1WZNA 4OTRA 3R2YA 4QPPA 5A4TA 2G01A 3OXIA 5AEPA 3A26A 2GNLA 4YBJA 3KHKA 2P3LA 2BFYA 1W98A 2PE0A 2Y6MA 3REOA 5LQKA 4FKWA 3A2CA 1V0PA 3AGLA 3ODYX 3CGGA 4L67A 4AE9A 3BIZA 3FHRA 5EKNA 2BIKB 1BX6A 4XS2A 1Q99A 3ZUVA 4PRJA 4DFZE 2B4SB 3EN7A 1Q62A 2JKQA 4YUYA 2WZJA 2X8DA 5HHWA 3ZLWA 3KY2A 2CKEA 2VTLA 2C68A 1JPAA 4IM0A 2I6LA 3R28A 4FSYA 3O96A 3A8XA 5AP4A 3UG2A 4FKUA 4R6XA 4QMWA 5E1OA 5LQUA 2X7GA 5FHRA 2HWKA 4ZSEA 4OQEA 3E8SA 5HE2A 3AJDA 1Y6AA 2OZVA 3A7HA 2JEDA 5J1WA 4FP9A 2B53A 1HCKA 4U41A 5L2WA 1YOJA 2PVJA 1VIDA 3HP2A 4JG6A 2JFLA 4BCOA 3CGOA 5LVNA 3OOMA 4X1OA 2NRYA 4L7FA 3RK7A 2X2MA 2C1AA 2QNJA 4TRLA 3SOCA 3OCJA 3ATTA 4FSWA 4ZMFA 4FSZA 2BZIB 2WTIA 4ERKA 3ELYA 4C03A 3FZPA 1H25A 4IZAA 2CKPA 4J52A 5BX0A 3LIJA 3QQFA 1O6LA 3F82A 4IVDA 3IW8A 3PSCA 5FXSA 1VYZA 3R04A 4NW6A 3GDHA 3IHTA 1DS5A 3PJCA 2QOKA 2RL5A 4PL3A 4Q5EA 2LD4A 4O38A 4DN5A 5CX9A 4POOA 5GM2A 3B7PA 3TKYA 3HRBA 4YSMA 5DT4A 4V04A 4E73A 2ITQA 1TQPA 4BDHA 4HVHA 1JSXA 4GVJA 4LG1A 3MVHA 2ITNA 2WQNA 5HIBA 1VBFA 5K0NA 4ER5A 1X1AA 5IEXA 4QP2A 4I94A 3RWQA 3U9NA 1SVUA 5ETFA 2VTMA 3O8TA 1TPYA 1VQ1A 2AOVA 4ZTQA 4ZTBA 3EMGA 2W1IA 1UU7A 3OXTA 1WBNA 4ZK5A 5C0OE 5EDRA 3BU5A 3VO3A 1AGWA 3R0QA 4N6ZA 3SXFA 3EQCA 3TNHA 3LJ2A 3K2LA 1DM2A 3C3YA 4JDHA 4EOQA 4CKBA 5E8UA 3CC6A 4K77A 4AUKA 4GEOA 4KS8A 2QOQA 3MFSA 2X7FA 3FRIA 2QC6A 1Y8CA 4FGZA 3POOA 4IACA 3CKXA 1F0QA 5T68A 4QQTA 5CEIA 4I6BA 4A4OA 3UMXA 3A60A 4MQ1A 1BYGA 4C4FA 3BLHA 3QD3A 5CF5A 2Z02A 2CGWA 4KRGA 3FHIA 4XV1A 3MB7A 4FEUA 3A27A 3PXRA 1OL2A 3AY0A 3UJDA 3OZRA 3KQYA 1KHHA 2F7EE 2X81A 3DJ6A 3LFCA 3MH2A 3P78A 4RJ5A 3UPXA 5DX8A 1PRYA 3QZGA 5HZMA 4FYNA 4P7JA 4RWZA 2G2FA 1LP4A 3I6WA 2O05A 1IA8A 1YDSE 4EHGA 1D2HA 3G8AA 5FHQA 1DCTA 3WARA 3D15A 2I6GA 2QY6A 5CEMA 2VAGA 4E4MA 3MH0A 3NX8A 2B2CA 2ZWVA 4Y72A 1TVOA 1RI4A 4U6RA 4KVZA 2VDWA 2CNUA 3FL4A 2J0MB 2XJ1A 4D58A 1RJBA 2WFYA 4RJ8A 2CNVA 4P2KA 3LFNA 5BMSA 2VWYA 1YHSA 2XYUA 4AWIA 4L01A 4AZTA 4BTJA 3GIWA 3KR9A 3EVZA 5E8VA 4TYHB 4KB8A 4O7NA 2I62A 4BGHA 3NW6A 3L9PA 3AC8A 4FTAA 5HEZA 2YXDA 4H39A 2UZLA 4D28A 2XRUA 4I6FA 4IAYA 2SRCA 4NCTA 5LVLA 4DT9A 2PZYA 2RFNA 3ET7A 1QAQA 1STCE 2E5WA 2J2IB 4GS6A 2WXVA 4FIGA 4HYUA 5AUVA 4FBXA 1NW3A 5DWRA 5IQEA 4QMVA 3G6HA 3R6TA 2QYOA 4HCVA 1NW8A 1WBVA 2I40A 5AV3A 4FTKA 3WILA 4YZDA 2VNYA 4HPTE 1XBAA 4RQVA 3ZEWA 2WMXA 4EK8A 2YA9A 5JFXA 1UWHA 4FSTA 4YHJA 3R1QA 2VDUE 5EM5A 4GKIA 4YC8A 3RK9A 3EN6A 1NW1A 4Z2YA 5LQAA 4H1JA 5HIMA 4PWNA 2BM9A 4DC2A 5KMKA 4GQBA 3PE2A 3OUKA 3Q5ZA 4KA3A 2QONA 3EHAA 4L9IA 2HXLA 3NSZA 3CJQA 5GJFA 4G5JA 4GKHA 3D5WA 3GOPA 3BWYA 3F4KA 1OIQA 3CQEA 5AUUA 3K6RA 3A7IA 2HW6A 3ZZWA 1RI5A 3HCEA 1PXJA 4Q9SA 4J8NA 2QE6A 3LM5A 4R3RA 3SX9A 4GFMA 5LCJA 3P2KA 3GU7A 4G3CA 1ZHFA 1DI9A 2UZBA 2Z7RA 4FTOA 5CSHA 3UE4A 5IQHA 2FYTA 3TQSA 4CKCA 4X3FA 5DXAA 3I1AA 2F4JA 3Q60A 3BYVA 5CANA 3I64A 3ODZX 2AOTB 4C3PA 5DR2A 4IX5A 3LCVB 4EOPA 3EEOA 1FPUA 2X2LA 3AMBA 3ZO2A 1UVRA 4GT4A 3NAXA 5EYCA 3QXPA 3PFGA 2P3GX 2JDRA 2QR7A 3EQGA 5J7HA 3JWIA 1NXKA 1GNGA 4LGGA 4ASZA 3FSKA 3QUEA 4WA9A 4XOYA 3FZTA 2C6MA 3KMMA 3Q4CA 4RG0A 4S34A 4ZZOA 1P5EA 5K0EA 4M37A 3VC4A 5KZIA 4IB1A 4BCJA 5C27A 2C7PA 3BU6A 3R1YA 2JHPA 1X8BA 4FNXA 3HVHA 1XHAA 2ETRA 5IMEA 3C51A 3RTPA 2RF9A 3CGFA 3GGFA 2CDZA 1CDKA 3FJQE 3R22A 2QU5A 4E20A 3BYUA 4EHEA 3KULB 1BL7A 1KUTA 3GCQA 4QP3A 2WTKC 3OTUA 4UY9A 3ZLSA 1QANA 1VP9A 1AQIA 4YZMA 1J7LA 4B0GA 2E9OA 5ITAA 1Q0TA 4HH4A 2CLQA 3G89A 3FI4A 1NVRA 2B9IA 4L8MA 4QRCA 4U7ZA 1PJKA 4ZY6A 3PA4A 5TR6A 2IPXA 3SGLA 5KQSA 3CD8A 3CQWA 1ZMUA 4QOXA 5CAUA 5GIOE 2JJQA 1XQZA 2R9SA 2IZSA 3P4KA 3FTEA 2WEIA 5HG8A 3O7LD 4KABA 2XNMA 1VL5A 4EJ7A 3KPUA 4AOTA 5E1DA 3F2RA 4UBAA 1W7HA 4JS8A 4M7IA 3DPKA 3PA5A 5EC8A 3GU4A 2CCIA 2WHBA 4TWNA 4D1XA 4J97A 4FTJA 4C3RA 3GU5A 1ZKDA 5F2KA 3Q9WA 4NT4A 4IE9A 4AE6A 4DFUA 3E7PA 3G2MA 4FG9A 5EZQA 4G3FA 3NUSA 3WZDA 4QDJA 3OT8A 1ORIA 4RTLA 4LECA 2XVDA 3ORNA 1ZZ2A 4RLKA 5IZFA 2HNKA 3GNLA 4YUWA 4X6QC 3UYSA 4OTQA 1YHVA 2YIRA 4F4PA 3NCGA 4AU8A 5DIAA 3W32A 4MWZA 1YXSA 2A14A 4DINA 2C7RA 4FEVA 2H11A 3DLCA 2B78A 4ANLA 2WMBA 2BRBA 4DFNA 2C30A 4F7NA 2GMXA 5ACBC 1B6CB 2UW6A 4FTTA 1KPGA 5M4IA 5LQNA 1DI8A 3D7TB 2Q0BA 4QMPA 3FRHA 2I9KA 1QPCA 2C6OA 1CKIA 5LCKA 4R7BA 2IBTA 5AUXA 1OUKA 2HK5A 4FIIA 4OTGA 5HE1A 3BV3A 3TTJA 1I1NA 2B3TA 4DFXE 3QZIA 1Q41A 3DV3A 1H8FA 3H9RA 4ZY5A 3KVWA 5EOBA 3OW3A 1H1SA 2Z7LA 3UP7A 4UX9A 5KBQA 2IDKA 4R78A 4OW8A 3KXZA 3MI9A 3FPQA 3B2TA 4BY9E 2FSLX 4GL9A 3FPHA 5K0CA 2PVCA 4D0XA 2H00A 2IZUA 3LXLA 4YZBA 1RI3A 3RODA 4IZ7A 2GNJA 4I93A 1PXIA 2W5BA 3QLGA 1NW6A 3SX0A 2VTOA 5HNBA 3V8TA 1YUBA 4RTNA 2OIBA 5BW4A 4YHTA 4CT2A 2PZRA 3ETAA 4XCUA 3AC5A 3LPBA 2HELA 4BLUA 3COKA 5JH6A 4NJ3A 2OFUA 4XUDA 3P9NA 1DAYA 1JSVA 3O71A 5E9JA 1VR2A 3TFWA 4L7SA 5TO8A 2JH8A 1FVRA 3NW5A 2WMUA 2XM9A 1P4FA 3CPCA 3ORIA 5FUTA 4CTCA 3S1HA 2JBPA 1I4WA 1VYWA 4BP1A 5IQAA 1ZOEA 2A0CX 2R3OA 3QQJA 3MW1A 4EL9A 3KQMA 3MWUA 3AXSA 1X1BA 3FEGA 1L9KA 5C8KA 4O6LA 3EQIA 4PDOA 3N51A 3EZVA 4BF2A 4FTQA 3FPJA 2CCHA 4YLLA 1Q8TA 4AFEA 3PS9A 1P2AA 3JY0A 2X6EA 4HNIA 2YM4A 5M06A 1KE9A 2EUFB 3PJ8A 3V6RA 1OITA 4PGGA 4X3FC 4QP1A 4GVAA 3THRA 5EMJA 4PDPA 4L3JA 4ZTRA 3HV4A 5AAEA 4RJ4A 3IOPA 3QKKA 2ZBPA 3BZBA 3GVUA 1XBBA 5K0GA 2WMTA 4G17A 5CF6A 2AYPA 4G3GA 1H1RA 2W17A 3WI6A 1K3AA 4KDCA 4H3QA 3GT8A 3UZRA 2YIYA 5EI2A 2E9NA 2KULA 4BLWA 4PGHA 3CTQA 1XCLA 1ZOGA 3IYLW 3ZONA 5IF1A 1OKZA 1QPDA 4CKIA 3EMDA 3GFEA 4I0RA 4OLIA 4QP8A 3F3ZA 5FQOA 2A2AA 2E9UA 4DEGA 2BR1A 4QQKA 5IDPA 4I22A 4M13A 4JX7A 4QYYA 4EWQA 3CJTA 2AZTA 3EFJA 2B7AA 4DG3E 3NUPA 4HGTA 3UIBA 4M3QA 2XVAA 3VJOA 4I92A 5M55A 3HA7A 4EOIA 4DTAA 1UFKA 2O3PA 3PIZA 5L8JA 3PZHA 2YXEA 4MKCA 5EEHA 4HRAA 4FT9A 4HTFB 4KAOA 2VX0A 4DCEA 4CD0A 3KQTA 5KMOA 1IRKA 3MA6A 2YWVA 3EH9A 4IAAA 4KKGA 5CQWA 5HORA 4FMQA 4O29A 3SW4A 5K03A 3PY0A 5AUWA 4UN0C 3QTQA 5KS2A 4AN9A 2X4ZA 1Q8WA 4L46A 4DH3A 5HOQA 2CL5A 2YISA 4PL4A 3HP7A 4FZVA 3CTJA 3ROCA 5KCVA 2HIWA 3PVWA 1JAMA 2CSNA 2IDJA 2O07A 1KSWA 3ZCLA 3UJ8A 5E2AA 3ORPA 4WIHA 3MY5A 2OLCA 4F7LA 4OBXA 5GIPE 1SG9A 5C01A 4FVPA 3X0DA 2ACXA 2Q0NA 5M44A 3T3UA 4FOBA 4EHZA 5ICCA 2C7OA 4RC4A 4D5KA 5CT0A 1F3LA 10MHA 5HD4A 3UBTA 5D9HA 3E87A 3BGZA 4I24A 3K5UA 4NM0A 4TYGA 1M7QA 5CTPA 2YITA 3F61A 5AUTA 3DDQA 3RNIA 3VVHA 3WE8A 3M6VA 3MERA 3PXYA 4JBQA 3VBQA 3VUHA 3B3JA 5HI2A 4ZLOA 2XCHA 4MXYA 3ZU7A 4YJVA 3II5A 3OFMA 5I0BA 4WNPA 4IAFA 5ANDA 3COMA 4QNAA 4CG9A 3MAGA 3MIAA 2BAKA 3Q9YA 3RVGA 3BWCA 3PB3A 2NPQA 3DU8A 4DFLA 3KXMA 5F2NA 4RTSA 4PCAA 5IG1A 3NYXA 2YM6A 3GWZA 4A9YA 1XKKA 2GFCA 3KCKA 3ZXTA 2PY6A 3IV6A 5HILA 1BLXA 4ZJIA 4YNOA 3UOHA 1V39A 4ONAA 3ORZA 2PT6A 3M33A 5FWDA 3F88A 2JBOA 3OZ6A 2JKOA 3VS0A 5AX9A 1UWVA 4QP7A 4CTBA 4XP2A 5J8IA 4FNZA 4NW5A 1PHKA 2WK1A 2IH4A 2RKUA 5HE3A 4EKKA 4PYKA 3E8NA 2V7AA 4W4YA 4CLIA 3RPRA 4F08A 5T64A 3G6GA 5KE0A 3HYHA 5CIYA 1Y6BA 3C7QA 2J0LA 4FZ7A 3KEXA 4JDIA 3F5GA 2PX8A 2I0VA 4O7ZA 3UNJA 5EHYA 3MESA 5JFWA 3VSEA 4ASDA 3GRVA 3FXWA 1H08A 3QAME 2RG5A 4Y5HA 5C8MA 2G72A 4L45A 4YJOA 4PMSA 3SDJA 1O6KA 3O17A 2OGVA 2V74B 3P86A 1H0WA 3HDMA 4WUNA 1H01A 4ZSLA 3ZRLA 5CSPA 5IA3A 1AF7A 1Z3CA 4GOMD 4GEKA 3NUAA 3ANQA 3LVPA 4ANBA 3SV0A 4BI1A 2J6MA 3ZO1A 3DK3A 3FPMA 1IA9A 2XA4A 5K09A 4GH2A 4NCTC 1SUIA 3BE9A 4CKEA 2A4LA 3NYNA 1E9HA 2V55A 5CT7A 4BCHA 3ER8A 4AOJA 2DYLA 3UTOA 3W1FA 3T7RA 3DXYA 3PVBA 3PJ3A 1YWVA 4IH8A 3PP1A 5TT7A 2B9EA 2J4ZA 4NFMA 4ANMA 2QLQA 1YWRA 3GU6A 3PX3A 2ZDTA 4JXFA 3V5PA 1U54A 3UG1A 3FUWA 2OG8A 2ZSUA 4YJNA 1F5QA 5E1BA 2GNGA 4DCAA 1M6EX 2ZV9A 1MRUA 4FTCA 3OC1A 4XLVA 1QMZA 3VJNA 4N0SA 3E62A 4A7CA 4EI4A 4BCQA 3NW9A 4L7VA 1Z57A 3HAVA 3CPBA 4E93A 5EM6A 4D55A 3QALE 1VE3A 2ZLBA 1XH9A 4E6DA 3WF8A 4A07A 1J7UA 2VRXA 2O5KA 2W1ZA 3CVOA 1SZMA 3FC2A 4JR7A 4BDFA 5HGIA 4YURA 4IWPA 3N4VA 2WEVA 1NW5A 2PGXA 4LOQA 4BLVA 2UZ4A 3ZFXA 4P7EA 3EWHA 3C0IA 4YLJA 1PYEA 3ZM4A 3KXGA 4DH8A 5EHIA 2G1PA 3WF7A 4XUFA 2OXXA 3PYYA 2WQBA 3V3VA 3JY9A 3I5NA 1V1KA 2IBSA 2Z60A 3EYHA 3VULA 3C5UA 2XM8A 4HCUA 4I6QA 3MY0A 2R3PA 4FL2A 3VS3A 2PYWA 3VS2A 4KIPA 1YOLA 5HU9A 4GU6A 4LV5A 2VO0A 3PJ1A 4M7RA 2JHCA 5HZNA 4XYFA 3F2AA 4F6WA 3GO4A 4X2JA 4PYNA 1I09A 4RX8A 3CP9A 3K0BA 4PYLA 5HFJA 5IH4A 1YXTA 3D5VA 3NNUA 4X2FA 1P1CA 3LFAA 2AS0A 4RFZA 3NYVA 4YC6A 3EIDA 2PXAA 5ERGB 3OVVA 1J7IA 2VS1A 2IZRA 4HGLA 4BHZA 2QKRA 2R3HA 4E8AA 5BUJA 3DUWA 3LW0A 3F3VA 4B6LA 3RW9A 3ERKA 4O7TA 2R3NA 2Q83A 4C05A 4EH5A 2P55A 3F69A 4GV1A 2OH0E 4FTNA 4ZY4A 1IAJA 4NFNA 2W7XA 1Z5MA 2V22A 4B8MA 5HTCA 4LOPA 1YB2A 3ZBFA 3NWWA 1KYZA 4YJQA 2R3LA 4IWNA 4NH1A 2ITZA 1GZKA 4BKJA 1KE6A 3MCZA 4V0QA 2NRUA 4LL0A 3PTAA 3R21A 3FMEA 1QPJA 3CEKA 4FKIA 1WS6A 2YCRA 3EQHA 1UNHA 3L9LA 1CSNA 4X3FB 3VN9A 5A4LA 5LVOA 3R7OA 2WA2A 4YMJA 3I9FA 4IIRA 4A4XA 5KMMA 4MX9A 4OGRA 3R8MA 5DG5A 3TJDA 1U2ZA 4XUEA 2ESRA 3ACJA 3ROYA 5K5NA 5CNNA 5EYMA 4FI1A 3IS5A 4ER6A 5DX0A 2REIA 1IM8A 3DOGA 4F64A 2RFSA 3LQ8A 3V5QA 1H26A 3HNGA 4FKVA 2QOCA 3DB6A 1UKHA 5HCZA 4BCKA 1EAMA 2GFSA 3GOKA 5E8XA 3BHUA 1AQ1A 2V5QA 4X3JA 4FTUA 5B0XA 1Q5KA 2CN5A 5JQ5A 4NKSA 5E91A 3DCVA 4P5ZA 5K05A 2B9JA 3DXPA 4KWCA 2VU3A 2WNTA 3E8CA 2OZOA 2FSTX 1G55A 5DM4A 3TIZA 3KQWA 5E7RA 2A19B 3DZOA 3OD6X 4J95A 3ELWA 2G1TA 2WTVA 3AXWA 3MGYA 2GQGA 4J71A 4JLCA 4KKHA 3PWDA 4TXCA 5DFPA 2YCSA 3OTVA 3OHTA 3B5IA 5CVEA 3QTWA 4JBOA 1WVXA 4F09A 4HGSA 3UVQA 4FKQA 3UOKA 3VF8A 1G60A 5G1XA 4ITJA 1SQFA 4ORKA 4BCFA 4FSXA 2BR3A 2OO3A 4XJ0A 3TNIA 4FZAB 5CVJA 5DM2A 4C4AA 4QMZA 1EIZA 3NPCA 1EJ6A 3R00A 3I5ZA 5IA0A 3O51A 5HESA 3VHEA 2OPBA 5CY3A 4UWCA 3QQGA 4MWIA 3SXRA 4C07A 3UPZA 5C9CA 2XKEA 2ZM1A 2B9HA 5LMBA 2QRVA 2YDJA 4RJ6A 3BPRA 1AQJA 2OWBA 3EOCA 4C4EA 3W16A 1JQHA 3LFFA 4IHPA 2PHKA 5ANJA 5FADA 5EIWA 5EZSA 5EG3A 4CV8A 3H2BA 2DQ7X 2QQ7A 3QUDA 4BDKA 3DBEA 3GC7A 4EQUA 2OY0A 4GOND 1H27A 4QMXA 4CTJA 3R9DA 4ZSAA 4UXLA 3KPWA 4IADA 4HOKA 3TZ8A 1FOTA 3P79A 5AX3A 5IA2A 2B1PA 4DGNA 3A4OX 5F4NA 2P41A 2Y1XA 5DX1A 5FA5A 1ZMVA 3LHDA 4WRGA 3BWMA 2GNFA 3O31A 1CKJA 1ATPE 1ERKA 2UZUE 3NZ0A 3PPJA 5JMSA 4FV3A 3AC4A 5GNKA 5KX8A 3OG7A 2XNBA 3GEQA 3QTZA 2QODA 5A4EA 3DP7A 1NV8A 2EU9A 2UZTA 3LXNA 4YTIA 2J90A 2Y1WA 5DBXA 3R9RA 2JIVA 3RINA 1KWPA 2J50A 2F9GA 2ZBQA 4KSQA 2GNIA 2NXCA 4PINA 3H9FA 4FODA 2BZGA 1UU3A 2PVNA 3SLSA 4J99A 2PT9A 3DS6A 5D7AA 2QRVB 7MHTA 3FLZA 4PTEA 2IH2A 5JT2A 2CMGA 3PE1A 1LEZA 1M52A 2WTDA 3L9NA 3JPVA 3VUMA 4AW1A 4B99A 3HP5A 1HMYA 3HM2A 1MHTA 5AJQA 1XTPA 4FUXA 4YTHA 5DR9A 2ESMA 3RAWA 4UZDA 4DA4A 2O8YA 2R0IA 2VO7A 3LFQA 4FT5A 2WMWA 4LFIA 3W55A 4KINA 4C4HA 4CFMA 5LWMA 3EN9A 4EH8A 2ZZNA 3QGWA 2GCDA 5FTOA 4USDA 2HZ0A 5HG5A 5BYZA 3EGIA 2OH4A 1P91A 1OKWA 4HYSA 2XYRA 3SSMA 3CY3A 1QCFA 4EQMA 4DF3A 3VUGA 4Y8DA 5FULA 3A8WA 1FMKA 4RTPA 2BMCA 4AT4A 3NJRA 2YACA 4D4SA 1KOBA 3TV4A 4O96A 5HNIX 5KHXA 3HMNA 1JKSA 4MWHA 1R8YA 4J98A 1M2RA 1OM1A 2XNGA 1JKLA 4DHFA 2YDIA 1FGKA 3NW7A 3ERCA 1W83A 2CGVA 2CGXA 3OXZA 4RLLA 4ALUA 3T8OA 3LGAA 4PP9A 4GUAA 2QOLA 3P23A 4L52A 4MBLA 2IN6A 3ZZEA 4ZZMA 3E5AA 3NNXA 4JJRA 5JEBA 1R39A 1BHJA 3GJYA 3QTSA 1WBWA 3R8PA 1ZZLA 3KC3A 2YDKA 3S00A 3AG9A 4V0RA 4YV0A 2C4GA 2Y6OA 4QYEA 3HUCA 3ZSGA 2BZHB 3UZPA 3ZFMA 2W5HA 5A6OA 4QTAA 3UJAA 4AFJA 2GNHA 3Q7EA 4FT3A 2B52A 3KMWA 3U87A 4M15A 1WVWA 3G90X 4XBUA 3KR0A 4FICA 3ORHA 5BUIA 4M0YA 2ZWAA 4U9AA 3KK9A 4XNEA 2WIHA 3FDNA 5F95A 3TDVA 1L3RE 4FK3A 2YZAA 4O22A 2ETMA 3JUHA 3MVLA 1RJEA 2B25A 4CRSA 2XK9A 4EBWA 5K5XA 4FZFB 1A06A 3NDJA 3KU1A 3V51A 4XV3A 4TNBA 3QGYA 2PE2A 2NXEA 3KR2A 2WTJA 5AUYA 3ZH8A 3GXOA 4RX1A 4XRLA 3U6IA 5AM7A 1TQIA 1XJ5A 2PV0A 3F5XA 4MNEA 4I5PA 2P35A 1O6YA 5FDPA 5FP6A 5M4CA 4BDAA 1NY3A 3AT2A 2QG5A 3FI8A 3BWJA 3FKLA 2BZJA 3OS3A 4IEBA 1FP2A 2XYVA 3ZDIA 4RWKA 2OB2A 5CWZA 5HLPA 2ERCA 3OPNA 2ZVAA 4FR0A 3DA6A 3ZXZA 4E26A 3HA3A 2ONLA 4W8EA 3LKZA 4QMYA 4DEIA 5J5SA 3UOLA 3RGFA 4QTTB 3VNTA 5JK3A 3TKAA 4YV1A 3QU0A 5ETCA 3DMFA 5BMMA 4IZYA 3TZ7A 5D1JA 3AMYA 1URCA 3U4UA 4BZNA 3QWKA 2AN4A 1R1WA 4L68A 3R02A 4RTQA 3MPTA 5DR6A 3RPSA 2PZPA 4EORA 5FRIA 3I6UA 4NM3A 3MFRA 3OWJA 5CVVA 2H34A 1B42A 5DM1A 3UJCA 5HIKA 3E88A 3Q96A 2IVVA 4APPA 5CASA 2XF0A 3KMUA 4IWQA 3UC3A 4E4NA 3AC1A 4KRCA 5E4HA 4DEAA 2NXJA 3LOKA 2FPOA 3AT3A 4UYAA 3QV2A 4MD7E 3E93A 1AD5A 2ZIEA 5M56A 5LSAA 3W33A 4ZOGA 2VWVA 3LXKA 4IB0A 4GF5A 3FPEA 4WT6A 4U7TB 3DZQA 4TWOA 2AVNA 3C13A 4MEDA 3LCOA 3EVGA 3PPZA 2XIXA 4XX9A 3TMAA 3EVBA 4F70A 4FE2A 4MTLA 4JX3A 2YFXA 3S95A 4ACCA 5CF8A 3B3GA 3U81A 1UU8A 2Y4IC 2FYSA 4RMZA 4LWOA 2GTNA 5CENA 4DEBA 3ACKA 4LRJA 3FI3A 4MBJA 3DNEA 2W1EA 2OSCA 3EN5A 3OBJA 4TNDA 2BDWA 5EH0A 5FP5A 3DLSA 3AC2A 4FR4A 4EH7A 2O06A 4BR3A 2X1NA 5HIEA 5EIFA 3B8QA 2EG5A 4ENYA 5HIDA 1XVAA 3RMFA 4DFYA 2UW3A 4EK5A 4JIAA 2QO7A 4G6NA 5KBRA 2VWIA 4FG7A 1KP9A 2WGJA 3KQPA 3NNWA 3GRZA 4E2ZA 3LCSA 5G02A 2YUIA 3VC2A 4AGWA 3KQOA 2HZNA 5EYKA 4HZRA 4I0TA 3DAEA 4IQ6A 2R3QA 4MXZA 5CU2A 2AC5A 4Y85A 4BBEA 4DAWA 5CZHA 1P4OA 3VS4A 3FV8A 4GFGA 4O82A 4B9DA 2ITTA 3PXFA 5DRDA 4EH3A 2CPKE 4XG9A 5IEYA 2FHPA 3BYMA 3UFBA 3HMIA 3LL7A 4EH4A 3D2LA 2EB2A 5FBNC 3PVGA 4EUTA 3WZEA 5E1SA 2Y0AA 3CR0A 2ITYA 1BI8A 2JIUA 4OTWA 4R3CA 1YFJA 1A9UA 3DOUA 3VBYA 4U5JA 3IOKA 4XH6A 4U43A 5IUHA 5T67A 1ND4A 4C7TA 1Y57A 3TKIA 2O65A 4IDVA 5EFQA 3H3CA 3C9WA 4RIOA 3LSTA 3I0OA 2PE1A 1PXLA 3VWAA 4BDIA 3PUPA 4IX4A 2P40A 1GAGA 2GU8A 3LKDA 4PWYA 4BZOA 5HBEA 3RIEA 5BVFA 4JAIA 4Q2AA 4C33A 4GK2A 1SQGA 4NECA 4YO6A 3ZSHA 3NVKI 4TPTA 4IANA 3HVIA 4C35A 1XH7A 2VZ6A 5TKDA 2XK3A 3HX4A 4QO9A 5IPJA 4S31A 2ITWA 4ZAUA 1SKMA 2P2HA 4EK9A 4ID7A 4YJTA 3LX6A 1VEBA 3IONA 4WBBB 4LWPA 2VTPA 3MIYA 5H02A 4YTFA 2VTQA 4X60A 4KSPA 4R3PA 3TKUA 3OCBA 4MF1A 4O7LA 5BVOA 1OR8A 4E1ZA 3KN6A 4IX3A 4ACDA 5ICEA 4G6OA 5A4QA 1YRPA 3GQIA 1GIIA 5L2IA 3Q04A 3R7VA 2JH9A 4GJ2A 1Q97A 4PYJA 2OIQA 4FSRA 3NUUA 4JQEA 4CSVA 4O7WA 1Q8YA 4R5SA 3BGQA 3DXNA 4OTHA 4IVCA 3NR9A 2WD1A 4GIHA 2V7EA 3M6XA 2C6LA 5DYJA 3AMAA 4HG2A 4EOKA 1I9GA 1ZGAA 1RQQA 1WXXA 5D1NA 1IXKA 1R18A 3A4TA 5CM2Z 2W0JA 3OEFX 4RVKA 2JKKA 3R63A 5EMMA 3HCDA 3RI1A 3MGGA 1KE5A 1UWJA 2OKRA 3EQBA 2CKOA 1QAMA 4QPNA 4R1VA 5K8VA 4NM7A 1PMUA 1WMKA 4ZP5A 3HCBA 4RVTA 4FEWA 5GM1A 1ZGJA 4NYEA 4FV5A 4FIEA 5CVGA 4G3EA 5I4NA 2ZZKA 3CBGA 3G51A 1PKGA 4AA5A 5JGBA 4AQCA 4DYMA 4JQ7A 4RSSA 3HA5A 4BDGA 5L8KA 3KULA 3V8WA 4G3DA 4P7FA 2ZCJA 4PUZA 5HBJA 5K0BA 3MVJA 4FV6A 5EEGA 3TOSA 3GGDA 4AZFA 4LV8A 2UW4A 4RA5A 5EDQA 1L3CA 3LCCA 3HCCA 3QX4A 3K5VA 4C36A 1FJXA 2VP3A 2IH5A 2R4BA 3FAAA 2QR8A 4R77A 2GS7A 4DGOA 3GI3A 5HE0A 1TKIA 4F65A 4QTEA 1KR5A 4BCPA 5EI8A 4A4LA 2YM7A 5J9LA 5KO1A 4PYIA 4WG3A 5AP5A 4MYGA 5E8TA 4AACA 3P7BA 3EFLA 3TT0A 3LMIA 2FCAA 3RZBA 3FMDA 3CS9A 3KPYA 2R0UA 3Q4ZA 4AGDA 2ETKA 4CNHA 4K18A 3RHKA 2VTTA 1EJ0A 4QDKA 5CZIA 4EONA 2P7HA 4S33A 5D11A 2FO0A 2QOBA 3PVCA 4MIKA 3QRUA 3P9JA 3Q9ZA 1NVQA 4L3LA 3MB6A 1YXXA 2WTKB 3PTGA 1VP3A 2IG7A 4D1SA 1NA7A 3FMMA 2WQMA 5EW8A 4I23A 3CKKA 2QHNA 5E9WA 2XZSA 2BIYA 3F5UA 3EYGA 2BDFA 1ZG3A 4XHKB 4B4LA 4FNYA 3JVRA 4F0GA 3RAIA 2YWPA 5HLWA 4HTFA 4TN6A 3OP5A 3G88A 3FYKX 1JKTA 4ZTLA 5H8BA 4AUAA 3PSDA 4XG4A 2J5EA 4WOVA 3LJ0A 4RX7A 4GUEA 5AFVA 4IV0A 1V0OA 3QOXA 4AW2A 2R64A 1YI6A 3IW4A 4HGZA 4C08A 2C6EA 1BMKA 2R3FA 3QCSA 3E05A 4RVFA 4DLIA 2YCFA 4YMHA 2JIIA 3R7IA 4C4IA 2UVYA 3FBVA 1RJDA 4FT7A 4PDYA 1REKA 1U59A 3WBLA 4O6EA 5IA1A 4D2SA 3CTHA 2XK7A 3HRCA 4FV8A 5EOLA 3VC1A 4IX6A 4IAKA 4F0FA 4Z3VA 2UYOA 4FTLA 2G2HA 5F20A 4AF3A 5M07A 3TXOA 3HV3A 3CXWA 3WF6A 2YX1A 4GW8A 1UNLA 2WOUA 4GMYA 3IO7A 4J8MA 1E1XA 3O7LB 2XIKA 4P5QA 2BFXA 3NS9A 3G9NA 3LMHA 3CSVA 1NE2A 2XP2A 4PP7A 3ZUTA 3KCFA 1ZARA 2ITPA 3KRLA 3QD4A 4O0YA 2WA1A 3SSOA 1O54A 4QVGA 1SVGA 4RJ3A 1CKPA 4HVSA 2P3OA 4XRJA 5TF9A 5KYGA 3DB8A 4RVLA 1SVHA 4KBCA 4EH2A 2IIPA 3R01A 3HAMA 4AW0A 3EEYA 4OT6A 4EQZA 3UNKA 3QRJA 3W2SA 1IY9A 1WXWA 3OWKA 2N47A 1R78A 1Y8GA 2XNEA 4IDTA 3PX2A 2YIQA 2IO6A 5CVUA 5C9ZA 4FV2A 2EB3A 2UW9A 1D2CA 2DUVA 3MH3A 3U6JA 1B38A 3OWPA 1ZMWA 2GS2A 3PXZA 4WG5A 4GJ3A 3TKHA 4ZLZA 1L8TA 2VWWA 4MXAA 5LARA 1O9GA 2UZOA 3QUPA 1JG2A 1WBPA 2ITXA 4GK3A 3FZRA 1WG8A 2ITVA 4C4GA 3NGAA 4ZJVA 2GTMA 2WAJA 4BTKA 2UYQA 2XIRA 2PSQA 4RIWB 1VZOA 2YAAA 1FQ1B 2HENA 2QKWB 3SM3A 4IVAA 4EZ3A 4UEUA 2AOWA 5FA8A 3S2PA 3PFQA 2BTRA 1PXOA 4AT5A 1OBDA 3OUNB 4AN3A 2OJJA 4Y30A 1G3NA 2W4KA 4BGQA 5KVAA 1JG4A 5IQDA 4G9RA 2C5VA 4YUZA 3R7YA 1BOOA 3Q6UA 4FA2A 3KRJA 2IGTA 4BZDA 3EZRA 3A25A 5E8YA 3DXZA 3HVKA 5D1HA 3THSA 3ZLXA 5LQRA 5CU4A 1PXKA 4RVMA 4EZ7A 3RPVA 2BM8A 3HZTA 4GT3A 4O7SA 4O81A 4HPUE 3DFCB 4R1YA 5FTWA 1H24A 4YJRA 3D5XA 2PY3A 2BVAA 4I4FA 1SUSA 4F99A 3WIKA 3QKLA 2XK4A 4H3BA 5H8GA 3R8ZA 2NNWB 3FWQA 2C5XA 5ANEA 5JRQA 1PW2A 2IW6A 3QQKA 5LXMA 2PULA 4P7KA 1YI3A 3HGKA 2G71A 4OBPA 5HVJA 2YEXA 1ZQ9A 5L8LA 2W99B 2HTEA 3M6UA 2PWYA 4BCMA 4OA8A 2ZMCA 3DFAA 3GCUA 4G34A 5B7VA 3ZBXA 5EGSA 4FKLA 3TLJA 2W4OA 3BHTA 1OL7A 3BRBA 3VS6A 1KPIA 3EFKA 2OFVA 3TDWA 4OT5A 2JDVA 4N6YA 4WNKA 3TNPC 4EWHA 3ENHA 1FINA 4EOOA 1YVJA 3FYJX 4G5PA 3M1SA 4A6DA 4E2YA 1NVSA 4ACMA 1ZXEA 3QQUA 4YPSA 3E7OA 4XG2A 5AP6A 2C1BA 2ZOQA 5I9UA 1OECA 2PMIA 2OU7A 2R3KA 3G2FA 4FTMA 4O27B 3TACA 3NVMB 5CYIA 4YHFA 2ITOA 3LLTA 3F5PA 2PUPA 3NUNA 1CM8A 5AIRA 5DSTA 4IFCA 3Q6WA 4AP7A 4PONA 4FSUA 3G5LA 4Z55A 3BX5A 4M8TA 2GB4A 3CC8A 4K33A 4BDDA 4C2WA 4MVFA 4E4LA 3QCQA 2B54A 3K3JA 5M53A 3CIKA 5A14A 1KYWA 4ACGA 4BYJA 4BP3A 3LBYA 2W9FB 1ZYCA 4OTIA 2VTSA 4FL1A 5CQUA 1ZAOA 3EVAA 5CUQA 3T9IA 4YV2A 4IFGA 4YZ9A 2R3MA 3HECA 2BALA 3FZGA 3KQVA 3QYZA 3TUDA 3MSSA 5HCXA 4DBNA 4LRMA 4MBIA 3RJCA 3G15A 4USEA 5I9YA 2XNOA 5AV1A 3HKOA 5CAOA 4ZJJA 5IQCA 2GSFA 4PCLA 4F84A 4E6CA 1NKVA 1TW3A 3BKWA 3PLSA 3G2OA 2J5FA 3DBQA 3T3VA 4TWCA 1JKKA 4IWOA 2BAQA 5FUBA 1L1EA 2C47A 3ORKA 2PX4A 1OL5A 2GHLA 3KRXA 4KBAA 3GQLA 2ZBRA 4CVAA 5IH5A 2NP7A 4TY1A 4DEHA 5HQ0A 4GC5A 5K4JA 1XDUA 3D5UA 3QD0A 2C5OA 5GJDA 3ULZA 4I41A 3A7DA 4G6LA 2UW0A 3GC0A 3MTIA 5DTRA 3MTEA 2AOUA 1Q61A 2OKCA 1T45A 1T46A 2PWLA 2VD5A 2EX4A 4RWIA 1LR4A 3TPZA 3T9TA 4R8SA 2WB8A 4FSQA 4KKEA 3R2BA 3PZEA 4FIJA 3HV6A 2W5AA 1PMEA 5FXQA 3IGOA 1XH5A 4DQ0A 3ATSA 3A7FA 2CMHA 5T6KA 3EGVA 1NT2A 4U0IA 4FSMA 3R6XA 3PXQA 3BKBA 5BNJA 2BHHA 3ZTXA 2C6IA 4K11A 4IC8A 5H8EA 3O2MA 4I1ZA 4FX3A 2GQSA 3UP2A 3FUVA 3UQFA 4U3ZA 2XBJA 5AUZA 3UO5A 2ORED 4U7PB 3VBWA 4PX6A 2BCJA 4NKAA 3UC4A 1K2PA 1KV2A 4RWJA 4MXCA 5FM3A 3SC1A 4BICA 2LAVA 4DE4A 5HX8A 3KL8A 2XCKA 1H07A 3MA3A 5CVHA 3ZUUA 5FM2A 5AV4A 3UVPA 2GS9A 4OA5A 5CCBA 5I9ZA 3OE5A 1YFLA 3UIXA 3IKAA 5E9EA 2XEYA 1DL5A 4F6SA 3BQRA 1NV9A 2C3LA 3QOWA 4IJPA 3A7JA 4BTMA 4UZHA 3M6WA 3WYXA 1IASA 4QQ5A 2GLUA 3W2CA 3ULIA 5K9IA 4O2PA 2AOXA 4BN1A 3WOWA 4RVHA 3NWBA 4IVBA 3LECA 4L43A 5CD1A 1OPKA 1R8XA 4O0WA 4KRDA 3BCEA 1JR4A 5F2OA 5IEVA 4DG0E 3KQSA 4J7BA 4U45A 3HLLA 4F9BA 3EFWA 2Z8CA 3LPMA 2XBAA 2WPAA 3QCYA 3QL8A 2Y9QA 1SMHA 3V04A 2C5NA 1KOAA 2HXQA 2GA9A 1GOLA 1OIYA 4IB5A 3MVMA 4Z7HA 3ME5A 4DT8A 5CNOA 4L53A 5E1MA 5K0FA 4FOCA 2WQEA 4Y83A 1JLUE 3R1SA 1FP1D 2VUWA 1ZYJA 2Y4IB 3E92A 1SYKA 3V01A 2ZULA 5BYLA 2XK6A 2YR0A 5CAPA 4QQCA 1D2GA 3Q87B 3PG3A 4Z16A 2ERKA 3CE3A 1J91A 3FQSA 3PY3A 4NU1A 5BYYA 4H36A 2WO6A 5JKGA 5DTMA 3FMLA 5DXJA 2YM5A 5DEYA 3KKVA 3A7EA 3KREA 4DTKA 5A9UA 3VBTA 4W4VA 2BR4A 2X4FA 2BRMA 4AAAA 3UDBA 3MDYA 3C0GA 3AT4A 4FKGA 4RIYB 4F63A 3UQGA 3BELA 2WELA 1WY7A 3A7GA 5IQIA 3B8RA 4FV4A 2Z7QA 5D10A 2XIZA 4EOSA 1LPUA 2O64A 1GZ8A 3ALNA 2GHGA 4RZVA 4Y95A 3TIYA 4C58A 2YZLA 4K0YA 1LEWA 1YDTE 4OBOA 4FT0A 4M67A 4QVKA 4WBOA 1FBNA 4FNWA 5M5BA 4L3PA 3SVVA 3W2OA 3M2WA 2AOUB 3R9NA 4BIDA 3DBCA 5CU0A 4EC9A 5KUPA 2AUHA 3P2EA 4R05A 3IEIA 4J96A 2C3KA 5FCDA 3BU3A 5EQEA 3WSTA 1RJFA 3MCTA 3UO4A 4EYJA 4G1WA 3F66A 1INLA 4X0MA 4F1TA 3QC4A 4E33A 2W4JA 2XK8A 2FSMX 1Y8YA 1H1QA 3G8BA 4HGYA 4FIFA 5CCXA 3KRWA 2XJ0A 3FSFA 4NL0A 2UV2A 4CEGA 4M68A 2OZAB 4GC9A 4YBKA 4XG8A 5IUGA 4XUCA 2J51A 5DVRA 2HAKA 2IVSA 3TZMA 4DLJA 3NDMA 4YTCA 4DA5A 2JDOA 4LOOA 5DRYA 4EH9A 2X7OA 1B39A 2HYYA 2X8IA 4KNBA 3KRRA 2UZDA 4TKSA 4OQDA 2CKQA 2QHMA 2BRNA 4HYHA 5CEOA 5DRTA 3SXJA 3KN5A 4KBKA 4K2RA 2IVUA 4PTGA 4A6EA 3Q52A 3DKGA 3DLIA 5AAFA 2OXDA 5K01A 4KUJA 5JSMA 3PXKA 4C04A 4CXMA 2Z6UA 4QP6A 3FMHA 3NAYA 2JITA 3FQHA 1VJYA 3QQLA 2GQRA 4YZCA 1PMNA 2C0TA 3NYOA 3W18A 4QMOA 4A9RA 4CFFA 5EOVA 3DQXA 5KNJA 3U54A 3HCAA 3ZC6A 4O84A 2IFTA 4E2XA 4C02A 3FTDA 3HA6A 4KWPA 1Q8UA 4F9YA 3AWIA 4CT1A 4CQEA 2W9ZB 4OBQA 4RIWA 5E90A 4BVUA 2VTRA 3LJ1A 3MS9A 3P1AA 4MD9E 2BKKA 2HOGA 4K1BA 3C0KA 3UBDA 3V5WA 5FEEA 2PX5A 4XV9A 4XOZA 4BIEA 1H00A 3MB5A 4YU2A 2ZAZA 3G7UA 3O4FA 2PVHA 4IV8A 3GB2A 1Q3DA 5E9QA 3FLWA 4PNKA 5M51A 3CQUA 4MHAA 3BXOA 4ZTSA 3KF4A 5DGZA 2H96A 3D83A 2I1MA 3DLZA 2P7IA 4O0RA 3LKMA 3BGVA 4EJNA 5DE2A 2KW5A 3FUXA 2ITUA 4ZS4A 4AA4A 5FQDC 3BWFA 3PDTA 3PG1A 3EMBA 3B3FA 2OICA 4Q5HA 3OU2A 5D12A 5DOSA 4IBMA 4S32A 3ZHPC 4CWAA 3FTFA 2YM3A 3JWHA 4IWDA 3TWJA 3QTIA 3R71A 3LM0A 4EKLA 5HBHA 4EZ5A 1P1BA 3ID6C 3MQ2A 2XUUA 5HIIA 1MQ4A 4AW5A 5CEPA 3GFWA 4RV9A 2BH2A 5HVKA 2R7IA 3U4WA 4B7TA 4CG8A 4CFWA 2G70A 5KQRA 3PA3A 4EC8A 5BXYA 5ETAA 4YLKA 3LQ3A 4QMUA 3EQFA 4XMOA 3FLSA 3DH0A 1OVEA 3BHVA 5DHJA 3T7TA 3S4QA 3V5LA 3F7WA 1YZ3A 2X9FA 3ALOA 3SXSA 5CSVA 5LJJA 4ER0A 4F6UA 1M2PA 3GUBA 3LZBA 4TT7A 4B8LA 4G2FA 3QTRA 4H3PA 4WD5A 2J0IA 5CSXA 3CKWA 4EEVA 3C4XA 4QMQA 4V0GB 1U5QA 4TL0A 1NBHA 3Q4UA 1PF8A 5DM0A 1FVTA 3D7ZA 1G8AA 4XP3A 4QQNA 2QOHA 2VTJA 1MRYA 4IAIA 2YN8A 4V0GA 4P58A 1YDRE 3VS7A 3TUBA 1M7NA 5AV2A 4K6MA 2NP6A 4F85A 3PRIA 3SAYA 4MCVA 3UZUA 1REJA 4IM2A 3EQRA 4AN2A 1WVYA 2FSOX 2Y7JA 4NM5A 3VUDA 3LQ5A 2PWPA 3OFJA 1WCCA 2Y4PA 3W8QA 5C4KA 4QYFA 4OBWA 1JTEA 2Z2WA 3FE3A 2X39A 2C6KA 2Z6QA 2X9EA 3QTUA 3FMNA 2JDSA 1YXUA 1BUHA 4S2ZA 2QURA 5E8SA 3SMQA 1H1WA 2XNPA 3G0EA 4QT1A 4ANSA 5FXRA 5IU2A 4O0XA 5AIKA 3TTIA 4CFVA 2XIYA 4EK3A 4ALVA 4NSTA 3ELJA 5L2SA 1BC5A 3Q3BA 4XLIA 5DPMA 3OFKA 2PX2A 3SOAA 3RHXA 1U5RA 2EXMA 3FY0A 3QXOA 2XKDA 4FT2A 3FYCA 4E31A 5CXZA 2ZVJA 3QZHA 3QQHA 3FXZA 2C0OA 4GK4A 3RM6A 3HRFA 3P0MA 4EOJA 1VPTA 2PJDA 4DCMA 4UXQA 3G9LX 5JR3A 3EGEA 4OUCA 4R8RA 5IA5A 2WMQA 3U51A 2UZNA 4EQCA 3VHKA 3VIDA 3UQCA 3GRRA 4HW7A 3C6MA 4GRBA 3QKMA 3RK5A 5F94A 3D2IA 3ZC5A 3ELUA 5EMLA 2I0HA 3TR6A 5B1SA 3UA4A 3NRMA 2C3IB 4TYJA 4LQMA 1M6YA 5J9ZA 1L3BA 3FZ1A 5KHWA 2P33A 1X1CA 2VWUA 3LHJA 3ANRA 1GY3A 4QYHA 4I4EA 5LMKA 2QM3A 3DK6A 3FLNC 4ZSJA 4AT3A 4XG7A 3OMVA 2UZVA 4G16A 3V8VA 4NK9A 4CTKA 2OJ9A 3R9XB 3CD3A 3VYWA 3OBGA 1H1PA 5IISA 1P39A 2X8EA 4J1RA 4JL9A 2JKMA 4NWMA 5DLSA 4AA0A 3VUIA 4ENXA 3ZRMA 4CCBA 3GCSA 4M36A 2PSSA 4ZTMA 3DBFA 3LE6A 4M0ZA 3NIEA 4N57A 3E7VA 3N9XA 4YNEA 2F7XE 3LXPA 4I0SA 5GJGA 4BCIA 4CZTA 5KMNA 2B55A 3UJGA 2FK8A 1PMVA 3R1NA 3KGAA 2C3JA 3LFSA 3VW8A 4BHNA 2VV9A 4C3FA 3SG8A 3IPHA 3KKZA 3P2IA 2VTHA 5MHTA 3MJ2A 3V6SA 5E8ZA 4MTAA 1QPEA 4DH7A 4GG5A 4R7IA 5EHOA 4JOAA 2QVSE 5GP1A 4HGEA 4PYOA 3OT3A 4ZMEA 5FTQA 3NUXA 3R73A 4RRVA 3BBWA 5L6PA 3LCDA 2YQZA 1Q3WA 3IG7A 3MBLA 5IQBA 3UIMA 4CFXA 4MNEB 4FS8A 2WTCA 5DT2A 2J7TA 2RG6A 4D9UA 5HICA 1JQDA 1UIRA 2PLWA 3KU2A 4X21A 5IH6A 3A62A 2PU8A 4NUSA 2WMAA 2HWPA 3S0OA 2OZAA 4L44A 2UW7A 1JOWB 1GZOA 2PVFA 3FXXA 5CU3A 4WRSA 2R6ZA 4BDJA 5CEKA 3K54A 3HCFA 3BBTB 4CFUA 4QP4A 3IW7A 3KPJA 1YQJA 2PVYA 5FD2A 3D0EA 5EQJB 4GYGA 1MRVA 2YIWA 3FZSA 4EK6A 3E64A 1OKYA 3PRFA 3BKXA 5GHVA 3F2NA 3DULA 4IM3A 3WZKA 1RI2A 3ZOSA 4DCGA 2YHVA 3O0GA 4TW9A 2CN8A 3EKNA 1WBOA 2PMNX 4UALA 4XBRA 3UO6A 4AGUA 4EBVA 2AVDA 2W1FA 3TV6A 4E6AA 4PIMA 3M42A 4O83A 4DFBA 1OKVA 1WAKA 3L8SA 3AXTA 1R3CA 5DLYA 2DS1A 2R3GA 1XH8A 4C37A 3BV2A 4G9CA 4QTCA 5FGKA 2O63A 3C4ZA 2XH5A 1I44A 2NO3A 2QCSA 5LVMA 3BE2A 2NP8A 4QPAA 3VBVA 4HC4A 2VWXA 5LVPA 5IQFA 3BEGA 4I5HA 5L6WL 4LUDA 3DTCA 1N7IA 1U54B 3CJRA 4O0UA 3EVEA 2PVLA 2XMYA 3PT9A 3OW4A 3QC9A 2ZB1A 4L42A 3D14A 2H9VA 3H10A 3KA0A 3BGPA 3N4UA 4RC3A 5M4UA 1U4DA 4BRXA 1P14A 3PP0A 4PNIA 4TTHB 1PYXA 4GG7A 4PIPA 4YGAA 2JHAA 1IR3A 3I7CA 2ZTHA 4EUUA 2PUNA 5HVYA 3H4JA 4F9WA 3R7EA 3P9CA 5EPEA 4FKOA 2V0DA 4M69B 3KF7A 2R2PA 5DA3A 4BIBA 2H6DA 5IUIA 3RP9A 2W1HA 4AGCA 4KIQA 2OIDA 3I81A 3O23A 3WYYA 1J1BA 3MPMA 3ZDUA 3R8UA 3D4QA 4DBXA 1XCJA 4C62A 4ZLYA 3I58A 1RI1A 4R5YA 2GPHA 3C3PA 4KIGA 2XNNA 3TG1A 4ACHA 4RJ7A 1JSZA 5KKRC 2HY81 3DJ7A 4OTFA 3D9VA 4E30A 3QWJA 4FZDB 2QO2A 3ORXA 4JDKA 4JRNA 4FGBA 4PL5A 1BI7A 5DH3A 2QI8A 3Q2JA 4CLJA 4Z7GA 5FEDA 4R7HA 3P97A 3AD6A 3OCGA 4GFOA 4ISCA 3MFUA 5HIJA 3R30A 3HMMA 1V0BA 1X1DA 1OGUA 4FYOA 4DH5A 2VTNA 3E8DA 3BEAA 2PVRA 4V05A 3EJ1A 4Y5QA 4BB4A 5CSWA 3G0FA 1R0PA 3E3BX 4RX5A 4CFNA 4EKGA 2BAJA 3LMGA 3LCTA 4YPDA 5AMNA 2ZIFA 1OPJA 4FVQA 2I0YA 3GP0A 3PWYA 4Y46A 3M11A 3HVCA 3E8EA 2AN5A 2H1RA 5E8JA 3UODA 3FUUA 1ORHA 5P8WA 5K4IA 2YTZA 3I5UA 5M08A 5HG7A 2FK7A 5ANKA 4E7WA 2ZFUA 3WIGA 5FQNA 1XR1A 4C34A 5A54A 4GBED 3QHWA 4R6VA 5EQPA 3GCVA 3SSNA 5HD7A 2QO9A 5CI7A 1GIJA 5IDNA 4BI2A 5I9XA 2XKCA 2P4IA 5IQGA 4YUQA 5HO7A 3QFVA 3QLFA 2ONLC 4FKPA 2ZV2A 4DZRA 1YZHA 4F9CA 2OJFE 4UOEA 4CRLA 1O9HA 2I7QA 3F3WA 3I4BA 4ZEGA 3OCTA 3DTNA 1CTPE 1G38A 3RM7A 5EW9A 5LQCA 1FVVA 1ZY5A 3T0IA 4Q9ZA 2RFEA 2OBJA 5CU6A 3IK3A 4BDEA 3D7TA 1JQ3A 1Y91A 1QZZA 2B0QA 4APCA 2LGCA 2UZEA 4RT7A 4AZWA 4F1OA 2OB1A 3UVRA 4FKJA 4IW0A 5H2UA 5FBOA 4JIKA 5FWAA 2EVAA 4O2ZA 2R3SA 4C06A 3JR1A 3RCJA 4AZSA 4WXHA 4UV0A 4QYGA 5AP1A 3UJ7A 1N7JA 4UB7A 1ZOHA 4LI5A 2X0GA 4D2RA 2UW8A 3IGGA 4E5BA 1WBTA 3NDIA 3R83A 3FPFA 1XWSA 1QL6A 4V01A 1H0VA 1M17A 2YCQA 3TRKA 2AOTA 3LDUA 4YUXA 2AN3A 2BRHA 1SNUA 1YOMA 4I6HA 4Z9LA 3ZO3A 3DTWA 3KXHA 4QTUB 4DM3A 4BTFA 2R3JA 3KQ7A 4M84A 3BUSA 4XCXA 2JC6A 1UA2A 4DEDA 1TW2A 3VQUA 3QTXA 2OW3A 4MXXA 5H9BA 1W8CA 2PMLX 5B2KA 1G5SA 4YMGA 3C4FA 3RPYA 1RW8A 3OCSA 3KR1A 4IC7A 3SW7A 1LUFA 3DKOA 4E4XA 2EWAA 5LOHA 2PZIA 4O7YA 3I60A 4U97A 5JFSA 3DJ5A 3BHHA 4DGLC 2J9MA 4C0TA 1OUYA 2K4MA 5AM6A 1GJOA 1OZ1A 3Q5IA 3U55A 3FPGA 1XH6A 3ORMA 2IJMA 5EVJA 1IG1A 5AP7A 1JSTA 4ASEA 4CCUA 3UJ9A 2BZKB 1IAHA 2PVMA 3UNZA 3DQWA 3G5DA 5B2LA 5J1VA 1XDZA 2HW7A 4FKTA 5A4CA 4Y73A 3JVSA 3CJGA 3C4CA 4CZUA 3MTFA 4FV1A 2UUEA 3WE4A 5LWNA 3OY1A 5D41A 5EDPA 2P1DA 4P7GA 3TI1A 5AA8A 2F8LA 4RTRA 2HV9A 4YC3A 3AGMA 2QD9A 2E9VA 5L2TA 3NWEA 4C61A 4FKSA 2WU6A 5ANIA 2AR0A 2O0LA 5DWQA 5C26A 3OU6A 2V7OA 4HJOA 2W06A 2WTWA 4LMUA 4DMGA 4I20A 4MH7A 3GXLA 4M97A 4QMLA 3W8LA 3NLBA 5BQ0A 5E2BA 3GBZA 3FTCA 5DI1A 5JGAA 3FUPA 4C38A 3RWPA 2ONYA 5CEQA 4BDBA 5HX6A 1UV5A 4WO5A 2O2UA 4WSYA 5EKOA 3GRYA 1OIUA 3F7ZA 5CXHA 5DT0A 1O9UA 3QZFA 1CMKE 4BC6A 4YO4A 4FC0A 3W2RA 2FUMA 5CF4A 4YR8A 2DWBA 4K8AA 2ZMDA 4U79A 3H30A 3R7UA 5JFVA 5I9VA 1SVEA 3ELDA 4X2GA 2G15A 3C50A 2F2CB 2G2IA 3IQ7A 3F6XA 1Z9XA 3OROA 3PPKA 2PBFA 3AQVA 4J53A 4PY1A 4U44A 4H58A 4XEYA 4HVGA 3QF9A 3MTLA 2VWZA 3O50A 4ZTHA 5AV0A 3BWBA 4HVDA 4AZEA 3EQPA 4OR5A 5JN2A 4X61A 4PV0A 4D5HA 4BDCA 1T43A 4LYNA 2EJUA 1OBGA 2X2KA 3MFTA 4PYMA 4RVGA 4L00A 2A27A 3TNQB 3F3UA 3H9OA 5EI6A 3LFEA 3L8PA 3TM5A 4GYIA 1ZY4A 5L3AA 1Q0SA 3R8VA 4O0SA 2GH1A 3P71T 3DNDA 4LG4A 4X41A 3FI2A 5JZJA 1K9AA 4II5A 3IW5A 4H0NA 4MD8E 4ALWA 5C03A 2C7QA 2CNQA 5GINE 3MJ1A 4U3YA 1NW7A 4BI0A 3PSBA 4JG7A 4S30A 2VO3A 2UVXA 1UU9A 4F9AA 3KPVA 1J1CA 2J0KA 2JAVA 4KIOA 2VGOA 3QRIA 3ZYAA 2E9PA 1QAOA 4D1ZA 2YM8A 3WZJA 4QMSA 2YJSA 2VNWA 5DPVA 1KXZA 1R6AA 3G33A 3L8DA 3DMGA 4W4XA 5LMAA 2HY0A 3OZTA 3EL8A 5HLNA 5L6OA 4TYHA 2W1DA 3L9MA 2ADMA 3OEZA 2VDVE 4ITIA 1EQAA 3R9OA 5EG5A 4CGAA 3NUYA 4FZ6A 4P90A 2CGUA 1FPQA 5I9WA 5JQ8A 3KFAA 4PNEA 4HSGA 3QA0A 4ZXTA 4JQ8A 3R8LA 3HEMA 5CVDA 3EQDA 4O0TA 2P2IA 1S9IA 3AC3A 4M14A 2XRWA 2XB7A 3AOXA 5K3YA 3VF9A 3C6KA 1JNKA 4FV0A 3QBNA 4IZ5A 3W2QA 1Q4LA 4JRVA 3ORLA 4G56A 3SA0A 5J9YA 3TZ9A 1PJZA 2YXLA 1KPHA 2GPYA 3P7CA 4PMTA 3P08A 2QOOA 5KKRB 2B9FA 4FIHA 1ZYDA 4GU9A 3JWGA 2BTSA 3H0ZA 4ER7A 5M09A 3E3PA 3M4XA 5GOZA 3AD4A 4RTMA 3LAUA 4D9TA 2WIPA 4UWYA 1OMWA 2VX1A 3E63A 2XYNA 1Q8ZA 3FMJA 4FV9A 3JYAA 4RQKA 2WU7A 2VZ9A 2Z7SA 2P8JA 3UWPA 4GOOD 4EYMA 4JBVA 3NIZA 4LGHA 4I3ZA 3LBFA 3I0QA 3VRYA 4DG2E 2BROA 3MH1A 3EVDA 4PDSA 1PKDA 5FDXA 5CAVA 4M38A 3FY2A 1YI4A 2OI4X 4FVRA 2VTAA 4IB3A 4QTDA 5EQYA 2G8NA 2JD5A 4I5CA 5KMIA 1RDQE 4A06A 2UYHA 4A9SA 5D7VA 3DXQA 3S3IA 2W1GA 3FL5A 3DDPA 2PVKA 2QOFA 2WQOA 2RFDA 3RCDA 4BGGA 3HEGA 3KQQA 2A1AB 3RPOA 5LQFA 5IKMA 3NNVA 3ZMMA 4WUAA 4F86A 2WMSA 3TEIA 3MY1A 1KE8A 3BHYA 3HVJA 1J3HA 2OJGA 4EHVA 4TYIA 4MXOA 2E2BA 3KXNA 3VRZA 4FT4A 1X19A 2CJMA 4TWPA 2R7BA 4RGJA 4CKJA 3U9CA 5JGDA 4LM5A 4RX9A 3TM0A 2IW8A 2HZIA 1UNGA 3I7BA 2F57A 3SD0A 3ENMA 5K0JA 1U46A 1YXVA 3BT7A 1E1VA 3DKFA 4WNMA 3NMUF 3UJBA 2V62A 5E8WA 4WG4A 5EM8A 4E6QA 1EH4A 5DRBA 4RZWA 3U8WA 3SR4A 3C4EA 4RSRA 2I0EA 4A9UA 2C6TA 3FLQA 1ZRZA 3KB7A 3F3TA 4W4WA 4X2NA 3DAJA 3P5KA 4GUBA 5AP3A 3EKKA 1MP8A 5BVKA 2JFMA 5ACKA 3SGCA 4F1MA 3QD2B 2BUJA 1NBIA 2HMYB 3I53A 5BW5A 4DKJA 3RAHA 4NIFB 2QU6A 4RIYA 5I5ZA 5CALA 4JG8A 4U80A 1MQBA 2VN9A 3WF9A 5BUEA 5DN3A 3R3HA 4FEXA 5AAGA 1ZWSA 4XP0A 2W96B 2OF2A 4N70A 5AP2A 4QMTA 4ZSGA 5ICPA 2ZV7A 4CMTA 4RC2A 4TYEA 4CMOA 3VW6A 5FLFA 2XJ2A 5HNGA 3GENA 4NJDA 4BCGA 4EVIA 2C6DA 3P9IA 4EK4A 3BLRA 2HR1A 1PXNA 3B2WA 4I5MA 4RTJA 4RIXA 3Q2MA 4JDJA 3SRVA 3V8SA 1JWHA 4D0WA 3PLAE 2VGPA 5CAQA 3R0TA 3KK8A 5EMKA 5F9EA 4O7RA 1YWNA 2RGPA 4DGMA 4JBPA 2BILB 3ZO4A 3CBLA 1ZYSA 3UYTA 1XXLA 2BPMA 2DPMA 5BVEA 4R6WA 2C0IA 3C1XA 2XBMA 5C8NA 3OZSA 2EXCX 1TQMA 3BGIA 2X6DA 5C1IA 2GS6A 2PTKA 2R3IA 3DK7A 4PF4A 5T3QA 2BR5A 3T7SA 3V5JA 1XO2B 4F0IA 5A46A 3U6HA 2PUIA 3VAPA 4RVDA 4GT5A 5J87A 4O21A 1N2XA 1OPLA 3D2KA 3BZ3A 2FH9A 3NEWA 1OIRA 5M4FA 5FEQA 3GU3A 2PKWA 3BGDA 4WVLA 3UMWA 3O8UA 5AP0A 1F3MC 1HOWA 3HDNA 4GSBA 3MYGA 3TN8A 4YJPA 5TOZA 3V5TA 2UVZA 4NTSA 4W8DA 4AS0A 5DSXA 5ICGA 3TJCA 1JTFA 3SQQA 4HCTA 2KTYA 3QYWA 3ZRKA 2IWIA 3OE4A 1QYRA 2FB8A 3THBA 2GHMA 4B17A 4AX8A 5HU3A 3P8ZA 2WOTA 2FGIA 3A4PA 3EB0A 3GC9A 3HMOA 3ITZA 4YJUA 4LUEA 2PMOX 4PTCA 1BL6A 2IVTA 2GAFA 3OWLA 5HKMA 5IA4A 3UOJA 3DXXA 4YZNA 3SVZA 1RE8A 4CV9A 4H1MA 3HV5A 5A3XA 3IW6A 1FGIA 5EK7A 3ZLYA 4UYNA 1VLMA 2CKDA 2F7ZE 3DR5A 2IP2A 4MHTA 1R00A 3B89A 2PL0A 3VS1A 3ANXA 4FKRA 2BRGA 2W05A 1YW2A 2CLXA 2UZWE 2VX3A 3IDBA 5DT3A 4OX9Y 2P3QA 3QRTA 3MV5A 4FUYA 3GCZA 1SM2A 2NYUA 5BPYA 5LR6A 2F49A 3O8PA 4RFMA 3GC8A 3CY2A 3VBXA 4E5WA 3FUTA 3EN4A 3BI6A 1L3IA 4QPSA 1GZNA 2ZYBA 2WKMA 1KE7A 2PK9A 3QA8A 3BYOA 4KD1A 2OK1A 4QNYA 5AWMA 5BVDA 4E32A 5AADA 5DTQA 2OXYA 4EMSA 4O7VA 5LQJA 2YABA 3ORTA 4FK6A 4RPVA 4MK0A 3ZS5A 3G5TA 4ZZNA 1M2QA 4G31A 3AD5A 4PQNA 1PY5A 4QP9A 2UW5A 1APME 5FTGA 4IKPA 4PMPA 5IH3A 3W10A 4D4YA 3G2QA 1W0XC 2FA2A 2ZJWA 4JVGA 4O0VA 4C4JA 2IZTA 5BVWA 2ZZMA 3H0YA 3SRVB 4JR3A 4RTKA 1WZYA 3LFBA 3OOGA 4MQ2A 4USFA 2FRXA 4LL5A 5ETIA 4GIIA 2F2UA 4X6RA 5CLPA 1PXPA 2FVDA 4RFYA 2IW9A 3FC1X 1XJDA 4D4RA 5JZNA 3O7WA 3ZFYA 1M14A 3A61A 4ERWA 4FTRA 4RA4A 2HCKA 3MPAA 1JQEA 3OF0A 2WMRA 3UA3A 1OL1A 2DULA 3UIUA 3DBDA 3F9NA 5EHGA 4EKIA 3DGKA 2AC3A 3L1SA 4QQJA 4X2KA 4ZTNA 4Y2HA 4ANQA 4JXJA 2HZ4A 3CJFA 3QX2A 4KW7A 1H4LA 5LMKC 3LFDA 2JGZA 2Y8OA 3BLQA 3VS5A 5B2MA 4K6ZA 2VTIA 4F7SA 4L6QA 1KIAA 2EJTA 3LDGA 1JVPP 3PVUA 3MN3A 5A6NA 4U42A 4FV7A 2OJIA 1R0EA 4IAZA 4FSDA 4OTDA 1W82A 3CCNA 4AZVA 4LRKA 4BBMA 3DY7A 4JNWA 3GNIB 4HYIA 4X63A 1G6Q1 4ZIMA 4YJSA 4RWLA 3IECA 5DNRA 2GDOA 3TL8A 3ZEPA 4YP8A 3POZA 4DH1A 3OU7A 3P9KA 2OBFA 4AG8A 5CI6A 3CLYA 4FEQA 5DEWA 4I21A 1JSUA 3Q9XA 1XH4A 2O0UA 3NCZA 2CWWA 5GWXA 5IMXA 3HV7A 4U81A 4X7QA 2RIOA 3R24A 4FGRA 2CHLA 2ZM3A 1H28A 4N4SA 1OI9A 2CMWA 5ANOA 1OL6A 2YAKA 3K3IA 3VUKA 2XEZA 2XKFA 3V97A 2ZIGA 1M0EA 3FZOA 3BYSA 3PIYA 4H05A 4FTIA 3Q4TA 3QHRA 5KZ0A 5EHLA 4CXAA 1JG3A 2PUUA 3GCPA 1WFCA 2R3RA 4KS7A 3M70A 4E2WA 3I79A 3HMPA 3PFHA 3IDPA 4QMMA 4M12A 5HCYA 4BCNA 1RJGA 3FKOA 3E23A 5FG8A 3HNRA 2G9XA 2ZDUA 3D94A 3WF5A 5CVFA 2BDJA 5E8RA 5E1EA 5K0LA 1XBCA 1OB3A 4DITA 1WBSA 2ERZE 4XG3A 5HO8A 1GIHA 4YSJA 5U4XA 2R5TA 3WZUA 5M57A 2J0JA 3PJ2A 4MNFA 4CMUA 4KDRA 2BKZA 4ASXA 3UZTA 3TNWA 3LCKA 2WMVA 4U8ZA 2ZV8A 3VQHA 3S68A 3UJ6A 1JBPE 1XDSA 3GU8A 5C1QB 1URWA 4UWBA 3G2PA 4IJ9A 1IEPA 4HVIA 4BYIA 2P0CA 1R74A 1Q24A 4U40A 5HG9A 2XYQA 4TZRA 3OY3A 4EOMA 3ZM9A 5HTBA 5EKUA 3FLYA 2OXTA 4XG6A 2PXXA 1A48A 4E5AX 2YVLA 3MHTA 3A99A 4DEEA 3N4TA 4LMNA 3LLAA 3C0HA 3EL7A 1F38A 2YJRA 2UYCA 5EM7A 2H8HA 4RYLA 3GRUA 3TM4A 2XVMA 1YKRA 3W2PA 1HNNA 4PMMA 1YF3A 4C2VA 3DAKA 4MAOA 5EW3A 3NTVA 4D4VA 5BVNA 4ARKA 4KIFA 3IDCA 2JLDA 4PYQA 3HUBA 5HEKA 2QOIA 3KXXA 4AOIA 4O91A 2OF4A 4JT3A 3DMHA
chains in the Genus database with same CATH superfamily
2G82A 3WC4A 4F93B 4GPBA 4EKNB 4UTZA 5JXGA 4HBZA 2QG7A 2EKZA 4O08A 3X3HA 2PUCA 3EVCA 1Z2PX 4OQPA 3OZGA 3UDZA 2OO8X 1PL6A 4FEEA 3TAXA 3PY1A 1EQ2A 1U8FO 3GUUA 1IZ8A 2ONZA 3ECAA 2H48A 3HFSA 2H8KA 2OWDA 3X1DA 4AMGA 4EH6A 5KNCH 4GCJA 4P80A 4O4JB 3NBAA 2VJBA 3ZJUA 1HZJA 3PI6A 5HRCA 4F2HA 2IP1A 3DDSA 4JB3A 2SNIE 4IGAA 4FKWA 4KQWA 1ZUD1 3R3WA 1XHLA 3ZLWA 3OJXA 4PWZA 2I6LA 1OF1A 2HB6A 2V65A 1TQDA 5L51A 3K0KA 2G5TA 1Y6AA 1ZZEA 4U41A 3MM4A 1QS0A 5F35A 1DGQA 2ZDQA 3HWWA 1TIPA 16PKA 1LDNA 2WYOA 2CKPA 5LIRA 2EQBA 3R04A 1NQVA 2I3GA 3TKYA 2ITQA 4ZO4A 1TQPA 4G85A 2EDCA 2WQNA 2YVQA 5FADA 4I94A 3O8TA 3TLGB 4AROA 5EDRA 1MC1A 3PKJA 3EQCA 3I45A 5AUNB 1PWEA 1V9SA 5B6IA 1RD4A 4OHUA 5TPWA 3A60A 4PU0A 4CT0A 3A27A 1XMLA 3W79A 1YJCA 1KHHA 1SC3A 3UPXA 1PRYA 4P7JA 3G8AA 4EHGA 1KZYC 2IUEA 4KRYA 3NCHA 2MHCA 1RI4A 3I8XA 3L4BA 4IDFA 4AWIA 1ZISA 4KB8A 3RC1A 2YXDA 2NU7A 3FPKA 3DTVD 2HU7A 5DWRA 3QW2A 4P0PB 4B2IA 3WK5A 3WILA 1TB4A 4YZDA 2QL7A 4Z2YA 1NW1A 3L1UA 4EENA 5TMPA 1C4WA 4GKHA 1DCMA 4B4OA 1OYVA 3E53A 2IZZA 1HYHA 3BYVA 5CANA 5DR2A 1RYFA 3QXPA 2ISCA 3QUEA 1Z4NA 4HLNA 4MA5A 5K0EA 3G6WA 3MGCA 3K9QO 4X66B 2GZSA 2NTNA 3EBOA 3CGFA 2B6NA 1EU1A 3EDCA 1YBVA 1Q0TA 2OFOA 2J41A 4ZVVA 3DAFA 3KIPA 3L8FA 4HGQA 1PJKA 2XE6A 3OIYA 4B40A 3WJAA 1GLNA 2AUMA 3RU3A 3HBJA 3KPUA 1W7HA 5KKNB 3GU4A 3GU5A 4NT4A 1ZNZA 1SC6A 4DNQA 2H11A 2WMBA 2DTDA 2C30A 1I3NA 1KPGA 1P3JA 1SC4A 3KZNA 3ZJVA 1M10A 5AUXA 1FFEA 1XDDA 3RFTA 3ROXA 1AQYA 1BEZA 1KMQA 4CL0A 4I93A 4B0PA 3SX0A 4G3XA 1XQ9A 5J4KA 5CXSA 3VJRA 2OFUA 3P9NA 1DAYA 1HPLA 5AW6A 4CTCA 1JIUA 3T7CA 1CUEA 4QJIA 4WA7A 2DUMA 2O1EA 3ZQUA 4YJ3B 3EZVA 1W9HA 1P2AA 3PS9A 2VRNA 1OITA 4QP1A 4GVAA 2Y1FA 4GWLA 1CUAA 3HV4A 4UVDA 3QKKA 3GCGA 1ZD4A 3BOSA 4G17A 3WI6A 4QXOA 2GNOA 1YB5A 3ADDA 2BBWA 1G5PA 1T2NA 4NBSA 2LKCA 2JA1A 2F62A 3KLNA 3BFJA 3UIBA 3IP9A 3GARA 3FCCA 3DZGA 3IEUA 2YXEA 2AFHA 2VX0A 3QFHA 5CTAA 4QDTA 1GL6A 3DGFC 3EH9A 5HORA 5CQWA 2V6GA 1GJRA 1KSGA 2YFYA 3S8EA 5HOQA 4DH3A 5EJ9A 2O07A 1KSWA 5CB6A 3K0EA 1BDBA 3HR4A 4P5EA 2Q0NA 4KLZA 5C31A 4U39A 4BS9A 1O0BA 1VTKA 3VUHA 1S3FA 2WJZB 4CG9A 2BAKA 5BUCA 1IJEA 1Q5PA 2QTVA 1RACA 1KORA 5DM70 1UOQA 4X44A 1CEQA 5F9FA 1UPUA 1VE5A 3OZ6A 4CTBA 3F49S 5G1NA 4PYKA 4CLIA 2XZLA 1VXRA 4F08A 5L4NA 5CIYA 2LNDA 1QF6A 3KWFA 1PUIA 2QZ4A 3W6NA 4KFTA 3WYEA 1XP8A 2CDCA 4O59O 1ITZA 4D3SA 3ZCVA 3HSYA 2XCQA 3HUUA 5HR5A 2QRLA 3PVBA 2JCXA 1QRDA 1XP5A 4FTCA 3OC1A 3NO4A 1PD0A 5KCZA 2DCUA 4YR7A 4A07A 3QLVC 1H5NA 2WZDA 5EHIA 1GPKA 3MGKA 4WLFA 3RVMA 1SVWA 1C9YA 3UK0A 2DUWA 1LV7A 5JYBA 1A76A 1NBAA 4JL5A 3FWPA 3IELA 4YC6A 5BUJA 1YWGO 3F3VA 5IG2A 2IXFA 3AMVA 1CUIA 3MT0A 1E3LA 4IWNA 1F2UA 2Z6VA 3ZHXA 1WS6A 3L9LA 4RK7A 1ZMBA 2QKYA 5DX0A 4RIHA 1QOQB 5CA1F 2R5WA 1AQ1A 2X4LA 2CN5A 4IH4A 2AYXA 1PL0A 2VU3A 2ZTLA 4D43A 1G55A 3C6XA 4H3SA 1LD3A 5JNVA 1DRUA 2Z09A 1N5JA 4CLOA 1WVXA 2I54A 5G1XA 3ED5A 3KHSA 2A5FA 3GT7A 3X1JA 4C4AA 4QMZA 2WEKA 3I5ZA 5B30A 4UWCA 4J0HA 1MUUA 2XKEA 1E5TA 1E94E 2PCLA 2F48A 3DBEA 3G2JA 4ZCTA 2EC5A 2PZGA 3OF5A 3O31A 4ZRDA 4YQFA 5A7GA 5GV7A 3MUNA 2QODA 1MLDA 1OGJA 2B5VA 1NV8A 1JSCA 4O5AA 5DBXA 3RINA 2NXCA 3D7NA 4HFRA 2IH2A 2WV9A 2EFDB 5AJQA 5L3QB 4LFIA 1RBMA 3A0RB 2VJQA 4CM6A 4AG6A 2OH4A 5L6LB 4KR9A 1ECJA 4GE3A 5JV5A 1O08A 3K0AB 3FNEA 3W77A 3HHPA 2FFHA 1M2RA 4DHFA 3LHIA 1OC4A 3LGAA 4D96A 2J3HA 3AVQA 3ZZEA 1BHJA 4NIMA 2HRRA 3S00A 2BW0A 3TNJA 3MS2A 3PF9A 4QUKA 3COVA 3Q7EA 3R8XA 4W99A 3ZK8A 1WVWA 5BUIA 4U9AA 3KK9A 3K8YA 4BNTA 1A06A 2HQBA 3KR2A 3GXOA 1BX3A 3U6IA 1VBMA 2O0MA 1TQIA 4FQ5A 4MOWA 3I9LA 3R76A 3UDSA 3BWJA 3CKMA 2V7XA 1M2JA 3H1AA 1VZ2A 4K9QA 3KNZA 3SC3A 4YV1A 4DSUA 3C3EA 3ITDA 5G0VA 4EYKA 2TMGA 4LK3A 3AMYA 3MTBA 3IAM1 3NFRA 2BDTA 3TYXA 4C43A 2WFAA 3K6SB 2A0YA 1UJ6A 4LJ5A 3GZ4A 1L7EA 4YAGA 3T3IA 4MJXA 4D98A 1FLDA 2C4KA 1UU8A 5ESXA 3UK7A 3DB2A 2GTNA 1PFGA 3CNEA 1AN9A 1CUGA 5HIEA 3ONDA 4UU0A 4EK5A 1LS6A 5BQOA 4AGWA 2R3QA 5LMZA 3BORA 4XRGA 2QN6A 2GPAA 1XD8A 3TXYA 1A9UA 3IOKA 1Z4KA 2HLPA 5EFQA 1Q7BA 5LLSA 2ONKA 3HHEA 3PDCA 1V7PC 1DOAA 3T1VA 1PF7E 4G0OA 4BIMA 4JAIA 4C33A 3X44A 2A0UA 2F43A 3AUXA 2VZ6A 1NMEA 4ZAUA 3N2ZB 3W2IA 1G8FA 4R3PA 4EY3A 3T34A 1T4GA 5L2IA 5HBRA 2E5FA 2R1TB 4RADA 3E35A 2GO7A 3F8SA 4QBGB 1AKRA 4HG2A 2XEXA 4JBYA 3GRPA 3TTWA 1KE5A 3IB3A 2XCLA 2QX8A 1LPSA 1I0IA 4KNVA 1Z0UA 4GGMX 4FV5A 1E2JA 4DYMA 5HQ3B 3V8QA 5JZ9A 2JAQA 2WF7A 4FV6A 1L5VA 3NRBA 1RWQA 1GAWA 3KJXA 2YXBA 2ZE7A 4AMBA 4ESOA 3W8RA 1DXHA 4RIGA 1HE5A 4XJTA 3P7BA 4BQRA 4NU8X 1NVQA 4F06A 2F1OA 1G17A 4KPUB 3N0WA 4FGJA 3HU3A 1K5GA 3A1VA 3OP5A 1T10A 1HE1C 4IHAA 4AUAA 3MELA 1JILA 2QI9C 1SCQA 3IW4A 4PSVA 4LHZA 2IE0A 1GSOA 4GMGA 3UWSA 4PDYA 1HT0A 1KI8A 1G3MA 1SCDA 4Q3KA 2YN0A 1M2GA 4O4JF 4C7OB 3PEYA 1UNLA 5KINB 4GMYA 4D0NA 1WBBA 3ND6A 3CSVA 2FR8C 2A9PA 5ILQA 2PUTA 3KCFA 2ZEJA 1GZHB 4LNUB 4XDGA 2WHYA 1U4OA 3G2NA 3VKVA 1M6NA 4FV2A 3AF1A 3TKHA 3I6YA 1DT3A 1JAHA 3D6NB 1JG2A 1ZD3A 2BFFA 4RCYA 3QOYA 1T1EA 1IG0A 3COJA 1FQ1B 2QKWB 4NF2A 1UXKA 2C96A 5LQRA 4YRJA 3UUEA 2OT3B 2LTAA 3C39A 3KOWA 4LQDA 2CLFB 2IW6A 2PULA 4BXOA 3EY4A 4BCMA 3DFAA 4LZNA 3CINA 2EP7A 4NYMQ 2LRHA 4YGXB 2IYEA 2JDVA 1NSTA 1VKOA 4ACMA 2XDAA 1DVRA 2XGOA 1D2AA 1JG7A 3LLTA 4M9QA 4XIGS 1AK9A 3QCQA 1GAXA 2C2GA 1P7VA 5CUQA 1GYRA 4D9FA 1HE8B 1YU6A 3KQVA 5BMVB 3PC4A 1TYCA 2Q1UA 1BGXT 4EL5A 2XIQA 4RAOA 1N2SA 1IZZA 2XLBA 1B73A 3FMIA 3ASYA 2HRCA 5EJMA 1N25A 1I3CA 4JXZA 1NT2A 2RGNA 2V7PA 3B52X 4OP1A 1C7JA 1YB1A 4K11A 3PXXA 1BCSB 2RC6A 4Y98A 1RM0A 4TTRA 1HE4A 2VTEA 3IAS1 3MUFA 1IZ7A 1YBAA 4Z2AA 2VQSA 4KLAA 3WIEA 4KX3A 3EZNA 1R8XA 1NBEA 1X8JA 2WPAA 3O94A 4K7JA 2W2TA 5E1MA 4Y83A 3WGQA 3C3BA 1H94A 3K9HA 3HKCB 5JI2E 1IQPA 1OROA 4DTKA 4AAAA 3AI3A 2WELA 3O03A 4C58A 4RZVA 2WKPA 3GDGA 3MTAA 3ZPXA 3K96A 3I83A 2FOIA 4R05A 3TQIA 2AUHA 3BU3A 5B3AA 4X0MA 3QC4A 3AU9A 3B6EA 1N6HA 4M86A 1JFSA 1T6ZA 3NDMA 2X7OA 2R8OA 3P4YA 3KHUA 4ABYA 4A36A 3E3OA 3KC2A 3OO0A 4DAEA 2CCJA 2QXYA 3G6KA 3FSGD 1EK6A 1Q8UA 1G5IA 2EYQA 4YO7A 4CT5A 1EX9A 4P38A 2PX5A 1MU0A 1G2QA 3TB6A 5AHKA 5FWYA 1VJCA 1YZYA 4QVIA 3LLVA 2P7IA 4B6JA 1FVOA 4NX2A 3WK8A 4P98A 2R7LA 4GVXA 3AP2A 2Z95A 1YTUA 5EI5A 3STTA 3ID6C 3EDOA 2X7XA 1BX0A 4DCVA 2WSYB 3DH0A 4CIVA 1RWWA 4N76A 1QGZA 1U3GA 4F6UA 3KYJB 1ISHA 5CXXA 5LXTA 3VR6A 5BNZA 1IAVA 5E3HA 3D7ZA 2PU5A 4YQYA 4ARBA 2V6FA 3TUBA 2HEIA 2RHBA 1PJ3A 5KNCD 3B6KA 1J00A 2H2DA 3W05A 2H5IA 3FMNA 4A8HA 2P6OA 2W93A 2FUCA 4ODIA 4CFVA 2ASEA 2XEDA 4B48A 4IXNA 3H9EO 4X7MA 1Y34E 2F9MA 1C3XA 1NP6A 1T24A 4JSYA 3CT6A 3WDLA 3O3CA 3ZC5A 4MYUA 5CM9C 1RE1A 1FDVA 5LMKA 3NEAA 4CTKA 4AT3A 1YONA 3A9SA 5CYFA 2JKMA 3QI2A 1YR9A 3ZRMA 1D4ZA 4M0ZA 4N57A 4QBHA 2B55A 4E5KA 2UDPA 4C3FA 3SG8A 5FIUA 2HU5A 4TQGA 1WZEA 4HGEA 4FC6A 3OIGA 1NG1A 3R9KA 3DCNA 4IBOA 2BI8A 1V2GA 4W5QA 1W36D 2OUIA 1GA4A 2YIWA 5JCZA 3FZSA 5D3MA 4M87A 4YJFB 4EQ6B 5AVXA 1RI2A 2NACA 4TW9A 4XBRA 3LF1A 3MINB 2BUBA 3M42A 1QR2A 5B58T 1YS4A 3CUEF 3QH4A 1TGVA 1U7TA 4QPAA 4F9FA 3SZLA 3BEGA 4YUAA 3EVEA 3PT9A 3DF9A 2FPGA 2VUIB 1JIIA 3SOZA 1P14A 4PNIA 4MB6A 2QQ0A 3AW9A 4XFKA 3P0IA 1OAOA 3WYYA 3N39C 4NBKA 4ED9A 3AVUA 3DZBA 2ZI6A 3QWJA 4QU8A 1KETA 2DLDA 1B74A 2QI8A 1GFWA 3R30A 1YT5A 2VTNA 4GOND 3PD7A 3IJPA 2BAJA 4YPDA 1M2NA 4Y46A 5HG7A 4RABA 5E4JA 1C8KA 3VGPA 2SICE 4DTCA 2JLYA 4PLCA 1NVXQ 3RM7A 4AICA