4DF3A

Crystal structure of aeropyrum pernix fibrillarin in complex with natively bound s-adenosyl-l-methionine at 1.7a
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
230
structure length
230
Chain Sequence
MVEVVSVSRHDRWRGVYVVELEDGSLRIATKNLVPGQRVYGERIFRYNGEEYREWNAYRSKLAAALLKGLIELPVKEGDRILYLGIASGTTASHMSDIIGPRGRIYGVEFAPRVMRDLLTVVRDRRNIFPILGDARFPEKYRHLVEGVDGLYADVAQPEQAAIVVRNARFFLRDGGYMLMAIKARSIDVTTEPSEVYKREIKTLMDGGLEIKDVVHLDPFDRDHAMIYAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase
publication title Structure of Aeropyrum pernix fibrillarin in complex with natively bound S-adenosyl-L-methionine at 1.7 A resolution.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Transferase
total genus 67
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.1.1.-:
pdb deposition date 2012-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01269 Fibrillarin Fibrillarin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4df3A01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 4df3A02
3KR2A 3FXXA 2EJTA 3C4WA 3EYGA 2GNHA 3C7QA 2ONLA 4ZK5A 5AAGA 1KR5A 3A99A 2C3IB 4FX3A 1IRKA 4QP7A 2IW8A 2GS2A 3HL7A 1FPUA 5M09A 1R0EA 1XVAA 4BCFA 5IEVA 4IM0A 4MBJA 4F09A 1KV1A 5J9ZA 1UNLA 3SSOA 3QKKA 1ZOGA 3EKKA 3H10A 3H30A 2XUUA 1DI9A 2HZ0A 5D7AA 1X19A 2BRBA 3V6RA 5CF8A 4KB8A 3K3IA 4E7WA 4DYMA 3HAVA 3AC8A 5F20A 3H4JA 4FICA 5AV3A 3D7TA 3DB8A 4D55A 1YDSE 4Z55A 1R6AA 2NNWB 3NMUF 3P9NA 5JQ5A 5G1XA 4J99A 3DLCA 5EM8A 4UZHA 5FEEA 3BPRA 4BICA 5E8YA 2O5KA 3HA6A 5CVVA 4JT3A 5DTRA 4YUQA 5HU9A 3LXPA 4BYJA 4FZVA 1LUFA 3ZM9A 4ACCA 3GVUA 1EJ0A 3F3TA 4C3PA 1H8FA 3QLGA 4AWIA 3VQUA 5EHIA 3BHVA 2YN8A 1GZKA 5HG9A 3T7RA 1JR4A 4IM2A 4O84A 1YVJA 4YMHA 2QOHA 3RAHA 3UYTA 4EBWA 4TWNA 4H3QA 3QRUA 2N47A 3D4QA 5F1ZA 2VWYA 5DM2A 3BWYA 3HZTA 3PXRA 1FGIA 5LQUA 2WAJA 3VO3A 4AUKA 4MBLA 3TLJA 4CTKA 5K0FA 2X8EA 3LFNA 2PT9A 5DFPA 3SD0A 3OS3A 5H9BA 3SQQA 2VWIA 3LVPA 3ZS5A 3DPKA 4M0YA 4O2ZA 3HA7A 4CKIA 4R6XA 3CD3A 4RWKA 3HKOA 5C8KA 4RLKA 5J1VA 4EKKA 4YMJA 5JFXA 1D2HA 4E32A 2IZRA 3PIYA 4I5CA 4CFVA 4AZEA 3DDPA 4TNBA 2OIDA 3FL5A 2WQMA 4F6SA 4CVAA 2J0IA 1EIZA 4BDEA 4O7RA 5EOLA 4QMQA 2JD5A 2V22A 4D2RA 4EK3A 4JR7A 5IMEA 1S9IA 4FV9A 4X3FB 4QMMA 3R24A 4EVIA 1R74A 4JXJA 5T67A 4K1BA 3R9HA 1V0OA 3QHRA 2C6LA 1JPAA 1Y6AA 4RTSA 2QOFA 2E9NA 5M4UA 4QNYA 1XWSA 1XXLA 2QD9A 1L9KA 3P1AA 2QQ7A 4M3QA 1WZYA 5CD1A 2O63A 2C5NA 2LD4A 3O50A 3G2QA 4O96A 3HMNA 1DS5A 2O3PA 3W8LA 3IPHA 2PWYA 3VC4A 4LOOA 2X8DA 2UVXA 4BLVA 4ACGA 3D2KA 4NCTA 3SXRA 5A6NA 2F7XE 4IWPA 2QE6A 4P7GA 3I1AA 3KXXA 5IEXA 4DCGA 3UJ8A 2ORED 5DEWA 4FL1A 3RZBA 2CMHA 5HX6A 3Q9XA 5E7RA 4AFJA 3LFFA 1WZNA 1PXIA 1XH6A 4RFMA 4XG7A 3QD3A 4NIFB 2OKRA 4RBLA 1DAYA 5L6WL 4F9CA 3UYSA 4RG0A 1M2PA 4GUAA 3LJ1A 4C61A 1PKDA 1RQQA 4CKCA 2VWBA 4CKEA 3SW7A 3IGGA 1Y8GA 4TY1A 4YPDA 4GV1A 4QYEA 3MTFA 1LPUA 4IC8A 1R8XA 3ZEPA 3A4OX 5AFVA 3RMFA 2BH2A 4OTDA 4CWAA 2H8HA 5IUIA 5KNJA 4S34A 2WXVA 4M8TA 3AXSA 3KGAA 2VZ9A 4FSQA 4IJPA 4RWZA 3OW3A 4M84A 3R71A 5D41A 2QVSE 5DT3A 3MCZA 1ZYSA 4RLLA 3SHEA 4RVDA 1FVTA 5BP7A 5ICFA 4PDPA 4XP3A 1YB2A 3FUUA 3AD4A 4GF5A 2IP2A 3KVXA 1YFJA 4FODA 4RJ3A 2VWWA 3RW9A 4O7WA 2ITXA 4O0SA 4BB4A 4JBQA 5E9EA 2P2HA 4PYNA 2NP8A 3G7UA 1RI5A 1JQEA 3MVMA 2FK7A 5HVYA 4GU9A 4QMVA 5M56A 3HECA 2Y6MA 2QOLA 3OMVA 2O57A 5ICEA 2BTSA 4GUEA 4EQZA 5KZIA 4HGZA 4U80A 2FUMA 4X63A 2EXMA 1ATPE 5JFWA 4FS8A 3GDHA 4NFMA 3HCEA 3HLLA 3CQUA 3TCPA 1VQ1A 5GINE 3GNIB 3VIDA 4PNIA 2ZWAA 3VS0A 2R3OA 2X9EA 4RVFA 3QTQA 3UO5A 5HI2A 1I09A 2YHVA 3LFDA 4C35A 4I93A 2XH5A 4PP9A 1OMWA 3B5IA 1KE5A 3NNUA 2XRUA 4M7IA 3U9NA 3SG8A 3KC3A 2WA2A 3BU5A 3SV0A 2XVDA 3WE4A 3ORPA 4UXQA 1ORIA 3BRBA 4YJTA 4OTHA 4EH7A 3PIXA 3R7OA 4ALUA 3HM2A 3FPJA 2OU7A 3NW7A 1AF7A 2NYUA 2GHGA 4D4RA 1H1QA 3ZMMA 3OTUA 2WZJA 5KQSA 3BX5A 2IDJA 1H27A 4RSSA 3RKBA 2JKKA 5A4LA 4OBOA 3PY3A 3IQ7A 2YM6A 2C68A 4LWOA 1KYZA 1HCKA 3R63A 4CMOA 3ORIA 2QOQA 5EW9A 3UJAA 5DI1A 4QMOA 3EN6A 2WEIA 4FIGA 2P4IA 4K77A 2YQZA 3S0OA 3BUSA 4U0IA 2XVMA 3DXPA 1FVRA 1YXTA 1VZOA 4L6QA 4KNBA 4RIWB 3QA0A 3BT7A 4BDDA 3RPYA 2CGXA 3R83A 2CNQA 4KSPA 3R6TA 4GOND 3VUHA 4MXOA 5DT0A 1RDQE 2EXCX 3L8SA 3OUNB 4AW5A 2AOTB 2G70A 3A7DA 1IEPA 4F1TA 4A7CA 4ZTQA 3A25A 3ORNA 4FR0A 2RKUA 2AS0A 5IZFA 2ONLC 3P23A 4FSXA 4MKCA 3KRJA 3QCQA 3Q53A 3MH2A 5EQEA 2GU8A 4YO4A 5CU4A 2W4OA 4L3PA 2AZTA 4U7PB 4D2SA 1EJ6A 3FZPA 3AC1A 4W8DA 4A4LA 2OSCA 4QMZA 1YI4A 1Q8UA 2ZZMA 5FCDA 2O65A 5JT2A 1CKPA 3OCJA 1Z9XA 3EOCA 4YGAA 4CTBA 2VTHA 4DCEA 1JKLA 3DOGA 2GPYA 3NUUA 5DYJA 2H1RA 2CKEA 3G5TA 3I7BA 3MGYA 4QVKA 3MCTA 3ENMA 2GCDA 1XBCA 2R3PA 2AVNA 5CSHA 2UVZA 2G1PA 3R8UA 1M7NA 5EI8A 2R0IA 3W8QA 3CXWA 3GRRA 3R8ZA 4K11A 2ZZNA 3UA4A 1RJFA 4RTKA 2IVSA 3ME5A 5L8KA 3PJ3A 2OH4A 5HD7A 4WT6A 2REIA 3AMAA 3C0GA 3DMGA 5CZHA 4EH4A 4NH1A 4AN2A 3RP9A 4V0GA 5KMLA 3GENA 3OE4A 3E64A 4DEHA 5L2SA 1RJDA 4P4CA 1PXNA 3R7EA 3R8LA 5CF4A 2QM3A 3FMKA 2OJIA 2VD5A 3GRVA 3QCSA 4WG3A 2PT6A 4W4YA 3H9FA 3EN4A 1R3CA 4QMYA 5AUZA 1DL5A 3AMYA 3VBWA 4NM7A 1HCLA 3EGEA 4E2XA 3REPA 5KMOA 1R1WA 4XEYA 2XYRA 3E62A 1NE2A 4Q2AA 3U8WA 2PZYA 5FQNA 4GC5A 5HIIA 5C03A 4CFWA 4D5HA 4DT9A 4UN0C 2OZAB 4II5A 4TYHA 3RVGA 4WRGA 4FV0A 4CTJA 3PRIA 4H05A 4LGHA 1H07A 1KE6A 5E1SA 2JDRA 3UG2A 2XP2A 3DBCA 4QTUB 4AFEA 4GOLD 2ZDUA 2WQNA 3QTRA 4B7TA 3CY2A 3KKVA 4XH6A 4GEOA 4BKJA 4LG1A 5CF6A 2QO9A 3M6XA 4AT5A 4FV7A 4W8EA 3OOMA 4ZJJA 3I5ZA 3SRVA 3L9MA 2IZUA 3C4FA 2PZ5A 4I0SA 4EJ7A 2B9JA 2R3IA 4QP6A 3RODA 4FNXA 3CCFA 2PVKA 2JH9A 2P3GX 4QMLA 2UW9A 2UW4A 4U7TB 4M7RA 2PYWA 4FKPA 3P7BA 2ESRA 4LL5A 4IAZA 3LLTA 3THSA 4DFLA 4D1XA 4MXCA 3KXHA 3P0MA 3ORTA 1VBFA 5EM6A 3GU4A 4CCUA 3V5QA 2X81A 3PA3A 2UVYA 3P2EA 3LFEA 4NCTC 3C4EA 4PDSA 5EKNA 4YTCA 4YJQA 4FE2A 1S9JA 4MXAA 5CVFA 2XEZA 2EFJA 5K0CA 2HZIA 3NCGA 3NUXA 4KRCA 3O23A 3CS9A 2VDVE 5KZ0A 5EDQA 3BLQA 2BAJA 3KQSA 2O06A 3G2MA 2C7RA 3SVVA 2E5WA 4FV1A 1XO2B 3IKAA 2HW6A 2B4SB 2YWVA 3LBYA 5L2WA 5EMMA 5E9JA 1OVEA 5C8MA 3VC2A 3PWYA 2GQRA 2I7CA 3GU7A 1JOWB 1JSVA 4GEKA 5TF9A 3R30A 2Z7RA 2PWPA 4PCLA 2GHLA 4IX4A 1X1DA 5EQJB 4IVDA 2C3KA 1BX6A 1BKXA 4YSMA 4CKBA 2BRHA 1E9HA 3QQHA 4GCJA 4ZEGA 2YDKA 2WMSA 1NW3A 1KHHA 4JBOA 3EVCA 1H08A 4QDKA 2WTKB 4FZFB 4TWOA 5E8JA 1P4OA 3U4UA 3IW4A 3GP0A 1NW8A 1OL5A 4CNHA 2BR4A 3COKA 5E8ZA 4MWHA 2KULA 4C33A 2W1IA 3V8VA 2XJ1A 4IW0A 4LMNA 5LQNA 1SKMA 2WTIA 4XG4A 4B8LA 2OZOA 5AUUA 1VEBA 2CPKE 5EC8A 4MH7A 2NRYA 2GS7A 3R7YA 3FRIA 1WBOA 2EUFB 4GG7A 4BVUA 4DGOA 1YFLA 3C0IA 4IAIA 2AOWA 4U8ZA 4F86A 3P7AA 4WXHA 5EQPA 1JLUE 3W32A 2W4KA 3QA8A 2VTPA 5HQ0A 5M4FA 3ORKA 4QPSA 3GRUA 4ANMA 3DZQA 5AAFA 2C5VA 4GL9A 4RVGA 4G17A 3V01A 2QNJA 4FTQA 2WTDA 3LBFA 5C9ZA 4FL2A 1YF3A 2AOUB 1UFKA 3MGGA 1FGKA 2ZIFA 5M07A 4KBKA 2AYPA 3R8MA 5LMBA 3QCXA 1PXJA 3DY7A 1FP2A 5GIOE 3R22A 3V8TA 3MERA 2WMQA 2G15A 3BBTB 4RIOA 3MVHA 4LV8A 4YNEA 3KQQA 4K9YA 3A7GA 3O8PA 4RJ4A 1P1CA 1XCLA 5BMSA 4TT7A 3IOKA 3P4KA 3ZFXA 1BHJA 1BL6A 3KRXA 4RWJA 5AX9A 4HPUE 2UW0A 4I94A 4EOLA 4MK0A 3QTZA 4RZVA 4BDCA 4IAFA 2PJDA 3PJ2A 3BHHA 3AT4A 3ZFMA 4JL9A 1RJBA 2BTRA 2CKOA 1SZMA 3H9OA 4AZVA 3RINA 5GOZA 2PPQA 5KKRB 2C4GA 4M15A 2G01A 2R9SA 1BL7A 3TUBA 2YWPA 2G9XA 2W5HA 3KFAA 4YJSA 5C01A 4TWCA 5B2MA 3ANQA 5L8LA 5EQYA 3QQLA 2BZJA 3IW8A 5CVJA 5FXQA 2B9HA 3HEGA 3ER8A 3D5UA 3GI3A 2QONA 2P0CA 4CEGA 3VC1A 3FMEA 2GPHA 4F84A 4R05A 1M2QA 3I4BA 2UW3A 3G15A 2PUPA 4FV5A 3PXKA 4YNOA 4F63A 2ZOQA 3FPQA 3TV6A 3TZ8A 1AV6A 4F9BA 3WF7A 3P9IA 4OTQA 2IO6A 2PVRA 4YLLA 5BPYA 4RJ8A 3ELUA 4IBMA 4O7ZA 5F4NA 5DRTA 2H6DA 5HILA 1V1KA 2VNWA 3TUCA 4EZ7A 3ALOA 5KMKA 3PZHA 3V3VA 5L8JA 5DVRA 4C3RA 2CWWA 4ACDA 3BGZA 1M14A 4WKQA 1ZWSA 4EH6A 4FIJA 4FKWA 4WNMA 5LQKA 3UVQA 4X3FA 1OI9A 2ONYA 2QOCA 3O17A 3U51A 5K8VA 4I24A 4EOSA 4E2YA 5KQRA 2QG7A 3OUKA 3M42A 3EVFA 2Z7QA 3A61A 3NNXA 4X7QA 4HCTA 3F3UA 2BUJA 1ZGAA 4ZIMA 2QR7A 3TKHA 2OXYA 4FT5A 3HAMA 4O0TA 1SVUA 3CBGA 3TNQB 4XMOA 3T9IA 2GA9A 3EZRA 3I6WA 2FB8A 1Q41A 3E88A 3TM4A 3FI8A 5HNGA 2EWAA 2OW3A 3OEZA 1LP4A 4KIGA 1IASA 4CQEA 4XV1A 2FK8A 5CSXA 5EM5A 3ORZA 10MHA 2OKCA 3FYCA 5AAEA 3DXXA 2VWUA 3CPBA 4ARKA 2XYUA 3CVOA 3PUPA 2VDWA 3BWJA 1P1BA 3MH1A 4RVTA 4OW8A 3FUXA 4Y72A 1FJXA 2ZBQA 2PGXA 4O27B 4JRVA 5H8BA 3DKFA 4FTUA 4I6HA 3F4KA 3KQOA 5LQJA 3Q3BA 3QTUA 3FWQA 4W4WA 4L7VA 2E9VA 3R28A 3GBZA 3WOWA 4WNPA 1XH5A 2IW6A 3FMNA 1ZMWA 3QL8A 3E93A 4BI2A 1W8CA 4ER3A 1J1BA 1BUHA 3QX4A 5A4EA 4BIBA 3QXOA 4EONA 3LX6A 3GXLA 4BR3A 4BDJA 3F3WA 4R1VA 3FYDA 3OZTA 4LV5A 1M6YA 2C0OA 4FYOA 5AWMA 4AW1A 1VIDA 4C7TA 3GC8A 4DBXA 3ODYX 2W1CA 2WTCA 3CJGA 2F7EE 4TZRA 3CY3A 3Q52A 3REOA 2W1EA 2F2CB 2O0UA 4ATNA 4JG7A 4G3DA 5D10A 4NTSA 5AA9A 1TPYA 3UIUA 3ODZX 3HNGA 3UOHA 2VGOA 2FSMX 4EK6A 3ORHA 5J87A 5DRYA 3A62A 1QL6A 3BLRA 1NVQA 4QP9A 2WQBA 4UX9A 5DM1A 3NRMA 2DUVA 3HX4A 3DQWA 3EVGA 2GMXA 1WVYA 3MTIA 3B3FA 3COMA 2YM5A 3SG9A 4QP4A 3O7LB 5EI6A 1ZMVA 3MY1A 3PPKA 4NK9A 2W5BA 4HVGA 5EOVA 3GRZA 4NL0A 5H3QA 2H00A 3COIA 5CNNA 4LUDA 4EZ5A 3HA8A 3TWJA 1PXOA 2X7FA 4S2ZA 5D1HA 5LVMA 3HDNA 1SQGA 2NXCA 4RTJA 2OJGA 4ITHA 4NECA 5IQIA 3C5UA 4UEUA 1GZNA 2F8LA 4FT9A 3I79A 3TOSA 5JRSA 4APCA 4YUXA 1H0VA 2CL5A 1K2PA 4XRJA 4L42A 4JVGA 2UW7A 4DA4A 5J9YA 1R00A 1PJKA 4E2ZA 3P2KA 4QOXA 3NUYA 5IA0A 1KOBA 1EG2A 3NTVA 4X6RA 4JBPA 3QD2B 3HCBA 3IV6A 3MBLA 2BZGA 1IAJA 4MBIA 5FDXA 3FPHA 2OXDA 3ZRMA 4M38A 2XJ0A 2XEYA 5DH3A 1R39A 4FTNA 5FM2A 5TT7A 5HBEA 1XBAA 5IA4A 1SG9A 2YVLA 3P78A 1KYWA 5LMKA 5CAPA 4GS6A 2IBTA 5AP1A 3D2IA 3PSDA 4XP2A 3V5JA 2LGCA 4ACMA 3TR6A 4E1ZA 3UG1A 4D4YA 4U41A 3CKWA 3HA3A 1GY3A 4P7KA 4FTAA 4BCNA 5E1BA 4IWDA 3LCDA 4ZSEA 4OR5A 4CLIA 3BCEA 4ZSLA 3TUDA 2XM9A 4P5QA 4J96A 3LCVB 3LPMA 2YA9A 3ORMA 4RIWA 4BCKA 2JKMA 2HTEA 1NVRA 4GOOD 4PDYA 2RF9A 3CGGA 5LCKA 4PYJA 3B8RA 1F3MC 2VTMA 2V55A 3WIKA 3FQSA 1EH4A 3FQEA 4FI1A 3VJNA 5E8UA 4I0RA 4KIOA 2JG3A 3GQLA 4QQKA 2I1MA 4E5AX 5CI6A 4EWQA 3JYAA 4FIEA 5HFJA 2YIRA 5I5ZA 3R02A 3KQVA 4J8NA 1CKIA 3T8OA 3KN5A 4H0NA 5HNBA 5BUJA 2BRGA 2IVTA 1YXXA 3BHYA 3KCFA 4F9AA 5E91A 4X41A 3G6HA 1ZYDA 4DINA 3UVPA 2ETRA 5C26A 3QOWA 4RVHA 3A7IA 3D2LA 4FT0A 4D28A 1NV8A 3A4TA 4GC9A 3PX3A 4C4EA 2OJJA 3TNIA 4FSMA 4C3FA 4KRGA 4KSQA 3G8BA 2QOOA 1ZYCA 2J50A 2XKDA 4Y5HA 4FKUA 3VBQA 3MB5A 2WQOA 2NO3A 4IWOA 2WB8A 1SVGA 4BCGA 3KRWA 4H3BA 5EHGA 5DE2A 5BVNA 5HG8A 2DWBA 3EQGA 2NPQA 3I0QA 3C3PA 3G0FA 2GS9A 2XRWA 3ZSHA 3FL4A 3SKCA 2H9VA 4XJ0A 4RPVA 2XCHA 3UQFA 1ZY5A 5CANA 4CMTA 2QC6A 1FOTA 4TNDA 4TL0A 5EDPA 2Y6OA 2C3LA 3I5NA 3AY0A 2UW8A 1JG1A 4MVFA 2HWKA 5LQCA 1FINA 5HZNA 4R3CA 2OB2A 2PVLA 3GUBA 5D7VA 4GG5A 4JS8A 2HV9A 2YTZA 2R3NA 4EHZA 3UJGA 3CPCA 2PSSA 1YRPA 3W55A 4JXFA 4L46A 3EMDA 4ZTSA 4CG9A 4YZBA 4X2GA 1JVPP 4I6FA 3Q4CA 2X2LA 4O29A 4GRBA 2Z6UA 3QZFA 4EHGA 4FTKA 3UVRA 4QQTA 3C6KA 3NUPA 4RIYB 4QYGA 4V0QA 3DJ7A 4YV2A 3OVVA 5EYKA 3KF4A 2PULA 1BI8A 2OZAA 3FSKA 1N7IA 1YOMA 4NW5A 5DR6A 5EW3A 4BF2A 3HVKA 3MFTA 3AQVA 4FG9A 4XRLA 3SR4A 3FRHA 1SNXA 9MHTA 5CTPA 3R9NA 2VTLA 3EHAA 3QWKA 2LAVA 3M6VA 5EZSA 4FV8A 2F49A 4V05A 2UV2A 3DB6A 3QRKA 4EI4A 3TV7A 3ZLYA 2BRNA 4X3FC 1K3AA 2PUIA 4YURA 4J1RA 2IIPA 1BMKA 4E4NA 3P9JA 4QQCA 3GCSA 4BY9E 1UA2A 5CYIA 4QP1A 3C4CA 5DPMA 4FSUA 4RVLA 4TWPA 2VV9A 3BYOA 1UWJA 3FPMA 4AS0A 2BDFA 2UZDA 4F64A 4QMNA 3LMGA 3BELA 3EQFA 3G2FA 4O22A 2XKCA 5AP7A 2IH2A 2R3LA 3ACJA 1EQAA 4FVQA 5FULA 4NTTA 5AP6A 3MFRA 4XNEA 4C59A 4O82A 3FLYA 2ZM4A 4M36A 5MHTA 1MRVA 4YUVA 3BLHA 4F65A 4KKEA 4EEVA 2YXEA 3NWBA 3EEOA 3ZTXA 2ZZKA 2P35A 3DBFA 2AOVA 5L3AA 4BBMA 5CSWA 5FA8A 3VUGA 1G3NA 2OLCA 2OH0E 3KREA 2CNUA 3PY1A 1NXKA 2OXTA 2W7XA 4CFXA 2BRMA 4FG8A 4Y2HA 2OXXA 4UWCA 1DM2A 2PTKA 5I9WA 4KA3A 4IFCA 2PL0A 2C7OA 3ELYA 2AC5A 3CTQA 3VS3A 5CCXA 1H1PA 1JWHA 5AIKA 3F2AA 3QRTA 2YIXA 3RPVA 4USEA 3JWHA 4YSJA 3EVAA 3T3VA 4D1SA 1NT2A 3EKNA 4N4SA 3FUVA 2CCIA 4M0ZA 5EOBA 1YDTE 3F88A 4F85A 2XK4A 3QTXA 2ZMDA 4ANBA 1QPEA 3UP7A 1QYRA 3KPJA 5JUWA 3O2MA 4DTBA 2VRXA 1UKIA 2X6EA 3II5A 4O21A 5EEGA 4MD8E 4K8AA 3PLAE 3LL7A 3QOXA 2OY0A 2PXXA 4ENYA 5FQDC 3OCBA 3F7ZA 1W84A 3TMAA 4YV0A 1OITA 4F6UA 2FO0A 2Q0NA 1T43A 4Z16A 1OB3A 4EH5A 3L8VA 2C5OA 3OCTA 5FXRA 3LGAA 5TO8A 4BBEA 1IAHA 5FD2A 3R9RA 5CEQA 2BHEA 3OXTA 4LG4A 4GQBA 2AOUA 3DK7A 2HXLA 7MHTA 4NUSA 4QPAA 4ISCA 3MTEA 4YJNA 2VN9A 2IH5A 4PTEA 3GEQA 1G55A 1W0XC 1ZKDA 4RJ5A 3OFKA 1WBNA 2I6LA 1KSWA 3VS2A 2XNBA 1U54B 2ZFUA 3Q5IA 1TQPA 3M70A 4BGHA 2O05A 4DH8A 3VBXA 4CZTA 3EWHA 4O0UA 2O0LA 3OPNA 5HU3A 3FUPA 5LOHA 3CBLA 3TT0A 5LMKC 3NVKI 5HLNA 3W2PA 3JPVA 2GFSA 2Y7JA 4BDKA 4UWYA 2ZWVA 4D58A 3C0KA 4TW9A 4EK9A 3KRRA 3HNRA 3R7UA 3GC0A 5IQFA 2XBAA 3R2BA 3UNJA 2CMGA 3IW5A 4IVCA 4AZSA 3F7WA 4C4IA 5DX1A 3GC7A 1Q8ZA 4DKJA 1PXLA 5H02A 2GDOA 3TN8A 2R2PA 4QDJA 4ALVA 4A9YA 3MYGA 2VTJA 4GFOA 2YACA 3KULB 3D83A 4ZAUA 1NV9A 1WBWA 3MTLA 2BROA 1NVSA 1V0PA 3AT3A 3NAXA 2RFDA 2Z6QA 5JFVA 5AEPA 4TN6A 3BHUA 3FMMA 2BKZA 1JQHA 1HNNA 5KBQA 3P71T 4I5MA 1YOJA 3FV8A 3D14A 4WG4A 4A07A 4JBVA 3UJ9A 1L3BA 5T6BA 3ALNA 3DXZA 1TQMA 2B25A 4IX5A 2BPMA 4AOTA 5FBOA 4YR8A 3FZOA 2CJMA 3K3JA 4ZSJA 3PXZA 4RTQA 4AGUA 5K03A 3R1YA 1HMYA 5KS2A 4N0SA 4DH1A 3GCPA 2WU7A 4KUJA 3SX9A 3KPUA 4R5YA 2WQEA 4F1OA 1WBVA 1ZAOA 4Z2YA 4CZUA 3JVSA 2IN6A 4ZTMA 2IPXA 2BM9A 1RJGA 2ZV7A 5EZQA 3SXJA 4CRSA 3VF9A 3QGYA 3GIWA 1IG1A 4UZDA 2ZCJA 3KN6A 3TTJA 4FTLA 2V5QA 3GC9A 4LQMA 4IVBA 4M69B 2W1DA 1Q24A 4HCUA 3MW1A 3KA0A 4F70A 4WG5A 2JITA 5LMAA 3G6GA 2NXNA 4KWCA 4YC3A 3R21A 1H0WA 3I5UA 4PONA 2JKQA 1RI1A 2BAKA 2B54A 4G9RA 2UZLA 4YPSA 3OWPA 4DH3A 4IHPA 4F1MA 2HY81 3TQSA 1QAMA 3POZA 2BZKB 2JJQA 5IA1A 2ZDTA 4AZWA 3E8CA 2Y9QA 5CENA 4XHKB 4NJDA 1KUTA 3AGLA 4JDIA 1OL7A 2QO7A 2G2IA 4YHTA 3S3IA 2X2KA 5F2OA 5DX8A 4F9YA 2JBOA 1H1WA 4QMWA 4K33A 2JEDA 4IIRA 2GNIA 2ITVA 4D4VA 3DNDA 1OKVA 2UW5A 2ZV2A 3WF6A 4CXMA 3QTWA 4E73A 5AM6A 2H96A 4IV0A 4EYMA 2CHLA 1I9GA 1X1AA 1OL1A 3LCCA 3MWUA 1LEWA 3DFAA 2EG5A 2XF0A 4L7FA 4LECA 4KIPA 4JOAA 5EH0A 3QGWA 4FYNA 4EOOA 3LCUA 3WZUA 1OL6A 3MIYA 3BWBA 4O81A 3MVJA 2B9IA 2WTJA 1IY9A 3FZ1A 4NU1A 3F3VA 3FI3A 5K5XA 3SGCA 3WF5A 5IH3A 3FBVA 4ID7A 4PP7A 2OO3A 4WUAA 5FP5A 3ZOSA 4DITA 3QX2A 4E33A 4WUNA 3E8SA 4NKAA 4N6YA 4P58A 5HHWA 2ITUA 2XMYA 3FZTA 3BXOA 4KINA 4Q9ZA 5IISA 4C36A 4EHEA 3GO4A 3QZIA 5EG3A 3CTHA 3VYWA 1DI8A 5FTGA 3A7HA 4E4XA 4Z7HA 3QQUA 1R8YA 3AC5A 4AG8A 1QZZA 5IQCA 1QPDA 3RM6A 3GFWA 1D2CA 3EEYA 3GT8A 4HYUA 2DPMA 2FPOA 3CEKA 4AA5A 3KHKA 2YUIA 2ESMA 5KMNA 3FLSA 4F0FA 2Y8OA 2YCRA 4O6EA 5AUVA 3ZFYA 3CP9A 4J8MA 5LVPA 5CF5A 3UZTA 2VTAA 4FIHA 4IDVA 2VU3A 4BIEA 5HE2A 3I0OA 3GRYA 2UZ4A 2WFYA 2WPAA 1Y6BA 2XA4A 5GIPE 4R8RA 2JIIA 4HNIA 4Y95A 3AD5A 3G88A 1ZMUA 3FEGA 5KBRA 2I7QA 5ANGA 3TDWA 3MY0A 4CD0A 3WE8A 4A9UA 4DGMA 1M52A 4FMQA 4IAYA 4HC4A 4LOPA 5FHRA 4X2KA 3ULIA 2PMNX 2ITWA 3LDFA 1Y8YA 5I9VA 3CCNA 2ZYBA 2JHAA 4AP7A 1YWNA 3S4QA 2EB2A 2YFXA 5ERGB 2CGVA 3DLIA 4I92A 5AP5A 4OBPA 3BBWA 2I0VA 4ZY6A 3QD4A 5K0GA 2CSNA 2QOBA 4RJ6A 3RALA 2XKFA 5FHQA 5IH4A 1P2AA 3CC8A 2HZ4A 2WTKC 5CLPA 2VGPA 4ZLOA 1ZARA 1YWRA 4D9TA 4DG2E 2SRCA 4QMTA 3NW6A 3CD8A 5B2LA 5IKMA 3UZRA 4U3YA 5BYZA 3PPZA 3V5WA 4DFZE 1OKYA 2HWPA 4R7HA 5DR2A 3CJQA 3C9WA 2UYQA 4OT6A 3V6SA 2C5YA 4IDTA 1GIJA 2E9PA 3ZLXA 2R3FA 3U54A 2P8JA 4FSWA 5A4TA 2XNEA 5FADA 5E8VA 3IDPA 4LGGA 3ZUVA 4B6LA 4ZY4A 5IUGA 3OU6A 3TDVA 4X0MA 1CDKA 2FYSA 1YHVA 3FLNC 3C4ZA 3QZGA 3ZBXA 3CKKA 1JKTA 3PZEA 4FP9A 1H25A 2AN5A 1UNHA 1MQBA 2IDKA 2Q0BA 3RAKA 4M37A 1H1DA 5DXAA 4R3RA 2XYNA 2RG6A 3R9XB 2BR5A 2QYOA 2YITA 3NYOA 2PX5A 3TJDA 4ITJA 4ER5A 4USFA 1P39A 3OBJA 5LJJA 4YTHA 1RI2A 2BDWA 5HO7A 3HCCA 2CKDA 2ZVAA 1ZQ9A 5EMJA 4MQ4A 5K4IA 1BOOA 3THRA 4A6DA 5DIAA 4XX9A 4E30A 4X60A 3CC6A 5CU2A 4GMYA 1JG2A 4UALA 1SQFA 1XDUA 1OIYA 1ZZLA 5GJGA 1T45A 4FKJA 3RGFA 3FZGA 4C4GA 4O0YA 3WF9A 1GZOA 4GT4A 4J53A 3R04A 4FOCA 3P5KA 2YIYA 4U3ZA 3BZ3A 4PGGA 3EL7A 1M6EX 2IWIA 3DTWA 4HZRA 5GM1A 2C5XA 1JSUA 5CQWA 3M6WA 3UJCA 1G38A 3VRZA 4K2RA 2P3QA 1W83A 1GJOA 4R6VA 3GCUA 4XV3A 4PMPA 3BGIA 3FUTA 3F5XA 4AZFA 5LVLA 1M7QA 4KDRA 4AGCA 1QAQA 4U45A 5AIRA 1UU9A 3MA6A 2UW6A 4HGTA 4F7LA 3OY3A 4BIDA 1PKGA 3DS6A 3P9KA 1NBIA 5LVNA 1PMVA 3HP2A 4GVJA 1VP3A 4DH5A 2XIYA 1XR1A 2W1FA 4BYIA 2HAKA 3OFMA 4NWMA 3DOUA 5HG7A 2A2AA 2PY3A 3VNTA 4JLCA 4EQCA 5E8RA 3ELDA 4RIYA 3Q6UA 1V39A 3JWJA 3GWZA 4AZTA 3RNIA 3R1QA 3FLQA 3KRLA 4BTMA 3GOPA 4MF1A 3G9LX 4N57A 1O9GA 3PG3A 1RI4A 4AT3A 4L3JA 4X1OA 4E93A 3OD6X 4QRCA 2R3JA 5CXZA 3G9NA 3UMWA 5KCVA 4YJPA 3QLFA 4FG7A 4BZDA 1Q61A 5EG5A 1A9UA 4O7SA 5HG5A 5CIYA 3GXOA 3G5DA 3SOCA 1INLA 3VN9A 3G0EA 4MAOA 5M06A 2VUWA 3P97A 2W0JA 3RCJA 3PA4A 3LM0A 3KB7A 5CQUA 1ZY4A 3PFGA 4PYKA 4L9IA 4U79A 1Q4LA 3BKXA 3LMIA 4L3LA 5CNOA 4WNKA 3LCTA 4E8AA 4FTTA 2H34A 3I7CA 4G31A 3OC1A 5E1DA 2YCFA 4EH3A 3MA3A 1STCE 1RJEA 3T3UA 3DTCA 3KPWA 5KMMA 4YZNA 3UIXA 3KMUA 4ANSA 3LW0A 3THBA 4OTFA 2WMBA 5EW8A 2OG8A 3E05A 2Z6AA 4XG6A 5HCZA 3JWIA 3LFBA 4FGBA 5AUTA 4AE6A 4IB3A 3B2TA 5HICA 5DOSA 5IQHA 3OFJA 4JI9A 5L2TA 3ZO4A 3DXQA 2FSLX 2GNLA 5K0EA 4QMUA 5K01A 5CEPA 5EMLA 5EEHA 5DTMA 3MI9A 4IMYA 4ZP5A 4FZAB 3LJ2A 4X2JA 3GU5A 2PVYA 3UZPA 1GIIA 1UNGA 5M55A 3UJ6A 4MNEA 3LCOA 2X0GA 3CLYA 3O0GA 4FVPA 4ZLZA 4PYQA 4GUBA 4ALWA 1P5EA 5KMJA 3G2OA 4NKSA 1WY7A 3BEGA 3EZVA 4J97A 2BDJA 3TM0A 4HRAA 4G3EA 4WBOA 4F6WA 1WXXA 1PRYA 3ZRKA 3EQDA 5HCXA 2VX0A 4AW0A 3HMOA 3Q9ZA 3UE4A 3ID6C 3DBDA 3OT8A 4MQ2A 4QVGA 4CRLA 1YXSA 5K0BA 4FTOA 2GLUA 4B17A 2DS1A 2R3QA 3LFQA 4CGAA 1J91A 2HW7A 3Q87B 2DQ7X 2ITTA 3R1NA 4DN5A 1GNGA 2EJUA 1JSTA 5E1MA 1M17A 2JHPA 3AC4A 4O7LA 2VO7A 2QO2A 5EK7A 2UZEA 2ETMA 3KXMA 4A4XA 3AC3A 3BYMA 5DHJA 3KKZA 2WGJA 3HDMA 3CJFA 4IADA 3EN5A 2NP7A 3P2IA 3EMGA 2CKQA 5AMNA 5CVEA 2XNGA 4W4XA 4E26A 2OJ9A 1F5QA 3FSFA 4RRVA 4NM0A 4DZRA 2PX8A 5DSXA 5AUWA 4F0GA 3UA3A 4HSGA 3VBTA 3L8PA 4QYFA 4FK6A 1OPLA 1YZHA 4PMSA 4FT2A 4EK8A 1O6KA 5K09A 5G02A 2BFXA 1NKVA 1PXPA 4ERKA 3Q4TA 3FE3A 2XYVA 2XIXA 2ZB0A 3K0BA 2VNYA 4ZTRA 3KCKA 4V0RA 1OM1A 5C1IA 3UNKA 4QNAA 4MD9E 3DA6A 2UZBA 4C02A 4FEXA 1WBTA 3LHDA 4FKGA 2R5TA 3DT1A 3TL8A 5CY3A 2BHHA 3IDBA 1YUBA 3OY1A 3SXFA 2WMTA 3SC1A 1KP9A 3R8PA 4KW7A 3HP5A 4OLIA 3TEIA 1UU8A 2ZTHA 1P4FA 4EH2A 4OUCA 3KPYA 2XS0A 3ZUUA 4D4SA 4YLKA 4D9UA 5EKOA 5KUPA 4OA8A 3VF8A 2P55A 3QC9A 1Y8CA 3HCAA 3IHTA 2P3OA 3RPRA 5JFSA 4BTJA 4RIXB 4AA4A 4FV4A 3F9NA 3UWPA 4PIPA 3MAGA 2BR1A 3NEWA 3KULA 3SSMA 3P08A 4ER7A 1PY5A 1BLXA 4TRLA 5EVJA 2XBMA 4FGRA 1SM2A 4XCXA 1DAWA 4USDA 3F61A 2H11A 4CXAA 4C4HA 4C62A 3ZZWA 3ZC6A 3FPGA 4FV3A 3O7WA 4RVKA 3WYYA 3D9VA 5H8EA 4MNFA 5HESA 4EQUA 2VZ6A 5HTCA 1OIRA 2X7GA 2R6ZA 3LFCA 4H1MA 4EUUA 1WG8A 4Y46A 3B89A 3ZC5A 5K0JA 1Z5MA 3D5WA 5E9WA 2WK1A 4FEWA 1O9UA 3OZ6A 2BFYA 3UJBA 4FEUA 4KBCA 4QQJA 4ZTLA 3PS9A 5ETIA 3GU6A 4C37A 5BVKA 2UZWE 2B3TA 4GK3A 3NAYA 2PZPA 4KS7A 4CFUA 1M2RA 4EH8A 1JQDA 3O51A 5B1SA 5E92A 1URWA 5HIMA 4RTRA 4BCPA 4E6DA 5A6OA 3EYHA 5EKXA 4F99A 5IQDA 2PUUA 2ITNA 4DCAA 2Y4IB 4Z9LA 4HVDA 4RX8A 3PP0A 4G6OA 1AD5A 3NYNA 4DEIA 3F6XA 4IH8A 2HELA 1JQ3A 4IB0A 3H3CA 2C30A 5A4QA 4ANQA 3W1FA 5CI7A 2Z8CA 4UYAA 3FC2A 3QFVA 3UJDA 3ERKA 4DG3E 2DULA 4F7SA 3CKXA 4BC6A 4EC9A 4RT7A 1V0BA 3RJCA 3ZEWA 3RIEA 5M5BA 3LCSA 2WHBA 1YOLA 5AP3A 3S68A 3FHRA 4QYHA 3NS9A 1OIQA 4IM3A 2QG5A 3W2CA 4AUAA 3KQTA 2A1AB 2UYOA 2VS1A 4K6MA 2GSFA 3HVCA 3BWFA 4PYIA 3O8TA 3LFSA 1H26A 4IB1A 1GAGA 4B4LA 1YDRE 1U4DA 4ZXTA 2C6MA 2BALA 3QUEA 4HTFB 1ORHA 4BCIA 5EHYA 5KHWA 2FYTA 1O6LA 3L1SA 1VLMA 2IH4A 4IZ7A 4IV8A 4C38A 3CJTA 3R3HA 3VS7A 4AXAA 2JDVA 3BIZA 3HGKA 2FCAA 3ZONA 3HRBA 1B39A 2A27A 4R8SA 5IUHA 4TXCA 3TIZA 4FEVA 1VPTA 2UZNA 4E4LA 1F0QA 5JKGA 4GYGA 2VO6A 5M4IA 2ZSUA 3ZLWA 1GOLA 2R64A 4HOKA 2UZOA 5IQGA 2GH1A 3K5VA 2GQSA 5CVHA 5CAUA 3BGDA 2ZV9A 4Z7GA 5IQAA 3VQHA 1UWVA 3EN7A 3MJ1A 4FKTA 3SGLA 4YJRA 4BP1A 2JAVA 3OG7A 3DLZA 3Q32A 2R3GA 2BVAA 3VHEA 3GNLA 5HZMA 5IG1A 3E63A 4ZZOA 1Z3CA 5CVUA 4I21A 5EPEA 3K6RA 4GKHA 4PX6A 3V8WA 4RGJA 4QYYA 1OL2A 1WFCA 2OIQA 4KBAA 2YAKA 3FXZA 4RFZA 4AGWA 3F82A 3S95A 3GCVA 5GHVA 3MPAA 3KK9A 3Q96A 3QD0A 4MX9A 4LMUA 2WNTA 5K4JA 5CEOA 5H2UA 1OGUA 3UIMA 2OI4X 3HMPA 4FSRA 3PSBA 1T46A 4R7BA 1VP9A 2C7QA 3A7JA 2PHKA 2QKRA 4FGZA 5DBXA 3LKZA 3TKAA 3FC1X 2K4MA 2EVAA 4O38A 5BVEA 3R7IA 5FG8A 5HE3A 4FSDA 3C3YA 1OZ1A 4RQKA 1XCJA 2A4LA 4XV2A 5BMMA 1O54A 1Y91A 2FH9A 3NX8A 3X0DA 3V5LA 2V62A 4K6ZA 5KX8A 5EIWA 4ITIA 2QLUA 5JMSA 4PWNA 3VULA 5BVDA 2QY6A 3OEFX 2EU9A 2W9ZB 4C2WA 3E7PA 5IQBA 4O86A 4BDIA 1N2XA 1NW1A 3IW6A 3C13A 3LOKA 4F7JA 3D15A 4PMMA 3ZRLA 3UMXA 2C6IA 3FMDA 1PYXA 4ZS0A 5HIBA 3D5XA 3L8XA 4E6CA 1Q8WA 5C9CA 2OICA 2AR0A 4KWPA 1OBGA 1Y57A 4CV8A 3VS1A 5A9UA 5K9IA 4ASDA 4GOMD 3RHKA 2VAGA 4B0GA 4DTAA 3ET7A 5CVDA 5E8TA 4AX8A 2Q41A 1AQJA 5HX8A 2Y1XA 4U9AA 5HGIA 4C03A 3B3JA 4EH9A 4RWLA 4GKIA 4ZJVA 5FUBA 3PWDA 3EIDA 3BGVA 2QKWB 5ANEA 5E2AA 2PBFA 4ZZMA 2R3SA 4QMPA 3NW9A 4HYHA 2C0TA 3PP1A 2J90A 3Q7EA 4XG9A 4MTAA 4X21A 5E4HA 4EKGA 3I6UA 4BRXA 1X1CA 3QHWA 3DK6A 2PLWA 3F2NA 2YIWA 5JRQA 2QLQA 2WD1A 4JG8A 3HV3A 5CCBA 4ENXA 1ZG3A 4YUYA 3MPTA 4BDGA 3LZBA 2IBSA 4XYFA 5K3YA 2Z60A 5M53A 4DFNA 1IXKA 4OTWA 2VTRA 5BXYA 4RV9A 1YQJA 3RM7A 4NW6A 1H24A 5DWQA 1JSZA 3AG9A 3C6MA 4RSRA 3NLBA 4NZWB 3HUBA 2VX3A 4KS8A 5DLYA 2Z7SA 2J7TA 3F5GA 4I6BA 3GCQA 5IDNA 2J2IB 4QTTB 2J5EA 5CU3A 4R78A 2P1DA 3PLSA 1UV5A 1KIAA 1WXWA 3E92A 1Q99A 5CSPA 3DAKA 5HEZA 3QKLA 2VTTA 3ANXA 3DMFA 5J5SA 4IANA 3KXGA 5E8XA 3RWPA 3V97A 4XP0A 4A06A 5F2KA 3TZMA 2V0DA 2YM7A 4I4FA 5D9HA 2R4BA 4TTHB 3I53A 2C47A 3ZLSA 3MHTA 2YM3A 4PF4A 4YZDA 2A0CX 2QI8A 3OF0A 3NDIA 2VTIA 4MIKA 5DM0A 3PB3A 2B9FA 3PA5A 4OX9Y 4GT5A 5K0LA 2VTSA 3NCZA 2ERCA 3JR1A 4OTGA 3SA0A 4ER6A 3LMHA 3VS5A 3AJDA 4FOBA 4MXXA 3VS6A 3Q5ZA 3MVLA 4B99A 3O8UA 2NXJA 1B38A 2XBJA 4F4PA 3EJ1A 1W7HA 4JDKA 4GK4A 3ZYAA 5J95A 4MD7E 3KQYA 4PV0A 4OBQA 5P8WA 3MH0A 5IH6A 4QPPA 3G51A 4BCOA 1KWPA 5GJFA 3MY5A 4EOQA 4G6LA 4GK2A 3UQGA 3ZZEA 3MB7A 4YJOA 1JTEA 4JX7A 3BGQA 5CU0A 5KHXA 2YIQA 5E9QA 3KEXA 3EGIA 2YM4A 2XIZA 2Y1WA 4O7YA 4FKVA 2RL5A 1OUKA 4R5SA 2PVHA 4PL4A 1QMZA 4CSVA 2XK7A 2I40A 4DGLC 3ZUTA 2V7EA 2F57A 5E90A 4EOKA 4EQMA 2RG5A 2X4ZA 4RTNA 4ZSAA 2HIWA 3HV5A 1VE3A 4S31A 3PE2A 2F2UA 4BHZA 3GJYA 2CN5A 4YV1A 5JN2A 8MHTA 5TKDA 2IVVA 4RX7A 4PCAA 3I81A 2UYHA 2AVDA 3R8VA 1G5SA 1O9HA 4IWNA 5L6OA 3PXQA 4FT7A 5LXMA 3EB0A 4LUEA 4ACHA 3EQRA 3OWJA 1KE7A 4GSBA 1E1XA 3D5VA 3L9LA 4MHAA 1QANA 3KF7A 1QAOA 5HBHA 2OFUA 5JEBA 1WAKA 4I5PA 2F9GA 1JG3A 3P86A 3KQ7A 4X6QC 4EWHA 4IVAA 5D1NA 1X8BA 2FSOX 4G5JA 3V5PA 4CCBA 4DC2A 4XLIA 5D12A 4XUFA 4I22A 3ROCA 3EFKA 3EQBA 4EJNA 4IZAA 4E2WA 2GS6A 4DAWA 3SSNA 4CLJA 2KTYA 1X1BA 1MQ4A 4YU2A 3KR9A 4N70A 2HXQA 4WNOA 2P41A 4U97A 1MJFA 3ELWA 4TYGA 1APME 5IA2A 3RHXA 1B42A 2C69A 1U2ZA 1RE8A 3OP5A 4KD1A 4LI5A 4GYIA 4IC7A 2R3MA 5CU6A 3LXLA 3HA5A 2WMWA 3ZO2A 2CN8A 4OQDA 2XK8A 4PY1A 5DR9A 4JG6A 1I44A 4KKHA 1RI3A 1PXMA 3W16A 3PVUA 3TIYA 3WZKA 3CTJA 1MUOA 3G33A 3D94A 2VTQA 3B2WA 2P40A 3M4XA 3LAUA 3UJ7A 1H28A 5FBNC 3F5UA 1OKWA 3M11A 5GP1A 3UODA 3RTPA 5DT2A 4DCMA 5BUIA 1W98A 4G16A 3A8XA 4BCJA 3N4UA 5AP4A 2VWVA 4EOJA 3TXOA 2CLQA 3PJ1A 5EM7A 3U4WA 4P90A 3PJCA 3TNPC 3FMHA 3QQKA 4IFGA 1OR8A 3GB2A 2BIKB 5AP0A 3EGVA 1URCA 4PUZA 4HGSA 4Y8DA 4F7NA 4JRNA 3FLWA 5FLFA 4C06A 2IZSA 5HOQA 3T9TA 4PYLA 3W2QA 3BEAA 2I0YA 2JLDA 3DJ5A 2JIUA 2OK1A 3FKLA 3IYLW 4EC8A 3G8AA 3SVZA 4C34A 5LQFA 3WBLA 2YZLA 2AOTA 1SMHA 3NWWA 4XCUA 3R00A 4YHJA 1KPGA 3DBQA 4FNZA 4ZTHA 4IKPA 1XH8A 4ZMFA 2AN3A 1XH4A 5DRBA 5ANJA 5CT7A 3FI2A 3AWIA 3LHJA 2PKWA 2Z2WA 5DWRA 5KYGA 4LRJA 4DFUA 5JQ8A 3JWGA 5M57A 4RIXA 2FVDA 3M2WA 5FM3A 5A46A 1R0PA 4MEDA 3TI1A 2J4ZA 5F94A 2PVMA 4WHZA 4XOYA 1Q0TA 4JR3A 4U42A 3A60A 4IJ9A 1WS6A 1TKIA 3ZDUA 3F3ZA 3PRFA 4PL5A 2GAFA 3WZJA 4HGEA 1EAMA 4Q5EA 3DFCB 3E87A 2YXDA 4BCHA 5LCJA 1XHAA 2YISA 5DPVA 3QQGA 3A27A 3TKIA 1XJDA 2VTNA 3HV4A 4B9DA 4FC0A 4PL3A 3F2RA 5FDPA 3EVEA 3I58A 2W9FB 3PTGA 4P7EA 1Q97A 3AOXA 4GIIA 4FV2A 5HO8A 4AACA 3BWMA 1VJYA 4P7JA 4M12A 4TKSA 2YZAA 3QF9A 2FHPA 2XM8A 2RFSA 5HLWA 2CGUA 3ZBFA 3UBTA 3LDGA 5ANKA 4BN1A 1G60A 3CE3A 2F4JA 4RQVA 4X2FA 4FNWA 3TPZA 1JBPE 3MN3A 4CT2A 3FYKX 3UQCA 2WIHA 4E5WA 5J9LA 4BBFA 3ZU7A 3MPMA 5BQ0A 1W82A 4D0WA 5B7VA 3PIZA 2OWBA 2ITQA 1JG4A 2PU8A 3A7EA 4KDCA 5DXJA 4C0TA 1WVXA 4OTRA 4C2VA 1SNUA 1ZGJA 4QPNA 4E20A 2G72A 3NR9A 3RK9A 5ICGA 4ORKA 3QTIA 3SXSA 3QUDA 5KMIA 3U6HA 4BGGA 3ELJA 4I23A 3POOA 1PYEA 4HVHA 5DEYA 3COHA 3ZM4A 3CQWA 2JH8A 3ORLA 2PVJA 3R0TA 4LRMA 5FTWA 2XJ2A 3Q9WA 4PIMA 2X1NA 2PVFA 4AGDA 5L6PA 3K2LA 2B55A 2YJSA 1UKHA 1DUSA 5BVOA 4JIKA 1YZ3A 3A8WA 3NYXA 2G1TA 3FHIA 4KAOA 2WMXA 2P33A 4PYMA 2CCHA 4ZS4A 4XUEA 4AOJA 4G2FA 3QV2A 2W1GA 3AD6A 4HTFA 2PWLA 3R73A 4O6LA 3DAJA 3O7LD 2YCSA 3BE9A 4Y73A 4RTMA 2ZW9A 2ITYA 4EYJA 2E2BA 3FYJX 3BQCA 2J0JA 3L9PA 4W4VA 4HYIA 3TACA 3NJRA 4WD5A 4TYIA 1AQ1A 2RFNA 4EKIA 4G56A 4D5KA 1OECA 4EUTA 5FUTA 4G5PA 5E8SA 3HCFA 4H3PA 4CKJA 5JSMA 3IW7A 4RTOA 2VO3A 4G6NA 5AV2A 3PDTA 3UO6A 2HWOA 2FSTX 5I4NA 3E23A 2X8IA 1MRYA 3NNVA 4ZOGA 4EL9A 2NP6A 4HZSA 2X4FA 3RAIA 1WMKA 1Q62A 3QRIA 2AUHA 3SAYA 3VW8A 3ETAA 4A9SA 3LECA 3BYUA 4U40A 5EDRA 3GQIA 4HW7A 4G34A 4F08A 2NXEA 4DFXE 3DR5A 4AAAA 3EVZA 3LFAA 4XG2A 5DG5A 4C4AA 2ITZA 2PE0A 1PMUA 4C08A 2EB3A 2QOIA 4KIFA 4XV9A 4Y83A 2RGPA 3KR1A 4PNKA 5E1EA 1U46A 3MQ2A 2ZB1A 3NSZA 4MXYA 4AOIA 1UU7A 2R7BA 4FIFA 4DG0E 5I9YA 3TNWA 2GNFA 4E6QA 4FIIA 2CMWA 4YO6A 4BHNA 5HIKA 2QODA 3UOKA 2YXLA 3DP7A 2Q83A 5H8GA 3U6JA 3EFWA 3Q2MA 2B0QA 1XJ5A 3PX2A 4M14A 3EQPA 4L45A 2V7AA 1XH9A 3DXNA 4S33A 4UXLA 5CVGA 2EX4A 3FZRA 5JR3A 2DYLA 2XNPA 1TW3A 2B9EA 2VO0A 4M97A 5ACBC 3S1HA 3R9OA 2FGIA 4A4OA 5I9UA 2JDSA 1UIRA 2QCSA 4YLJA 5DLSA 4RA5A 2YERA 3NVMB 5M44A 5JGDA 3PFQA 5FTOA 5CT0A 3WARA 1OIUA 4RTLA 4I6QA 3ZXTA 5T68A 3F5PA 4P2KA 4ERWA 5CALA 4FTMA 4CKRA 3KMWA 2UZVA 5IDPA 2PE2A 3E5AA 4QT1A 4X2NA 4FSTA 3U9CA 1PXKA 3W2OA 4PGHA 3HV6A 4DQ0A 2HR1A 3EPPA 4YBKA 4AF3A 2GQGA 4OBXA 3DKOA 3VWAA 3DUWA 2ZIGA 1NY3A 3DLSA 3HVIA 4DH7A 4DBNA 4BCQA 1D2GA 3QYWA 5HE0A 5A4CA 4YZMA 1J7IA 2YX1A 3PPJA 2OO8X 4RZWA 3V5TA 2XNNA 4DLIA 1L3RE 4EOMA 2PV0A 3FTDA 3UTOA 3KU1A 3L9NA 1A48A 3W10A 4OQEA 5FP6A 2I9KA 4M68A 4FVRA 4ANLA 1FVVA 3U6IA 4UB7A 4AA0A 5KE0A 3N4VA 4BTKA 4P5ZA 4S32A 5EYDA 3SOAA 4O7TA 3UPXA 5A14A 5I0BA 3FY0A 3HTXA 4XG8A 4WVLA 4IX3A 4OT5A 2G8NA 4E4MA 4PNEA 3Q04A 3L8DA 4EMSA 2CDZA 2ZBRA 5CX9A 2GNGA 1OUYA 2I6GA 4PQNA 3KXNA 4RFYA 3EMBA 4U7ZA 4UBAA 2J0MB 1VYZA 5F2NA 5IQEA 1PMNA 3C4XA 1IM8A 3IOPA 3AT2A 4HG2A 5IMXA 3EQHA 5DT4A 4FNYA 3R01A 4OA5A 3W2RA 3PSCA 4YP8A 4I3ZA 2JKOA 2QOKA 2J51A 4O91A 3O4FA 4BZOA 3K5UA 1VL5A 4BDHA 2UZTA 2WELA 4L01A 3T0IA 2J0KA 4KVZA 2O64A 3R9DA 2J6MA 4MCVA 3WSTA 2OBJA 4YHFA 4IZ5A 3UNZA 5CZIA 4QQ5A 3SLSA 3ZSGA 3DH0A 4FKSA 3ROYA 3N9XA 3HVHA 2PK9A 2OPBA 3QQFA 4I0TA 4BP3A 4HH4A 3UFBA 4XBRA 3DBEA 4FT3A 3KR0A 2YDIA 3R1SA 4RWIA 4WOVA 3PVBA 4QTEA 4RC4A 2BZHB 4L8MA 5ANDA 3LKMA 3UIBA 4GBED 4MXZA 5JZNA 5C0OE 3HRFA 4O7NA 1JKSA 2C6OA 2B53A 2Y0AA 1H1RA 1YI3A 1H00A 3QUPA 5ANOA 3DAEA 1G6Q1 3LE6A 1CMKE 3DKGA 2QRVB 3WIGA 2IJMA 2W99B 1QCFA 2WU6A 4NM3A 1Q0SA 4DFYA 2OBFA 3VHKA 2R7IA 3VAPA 3OU2A 3GU8A 3LQ8A 1KPIA 3NDMA 4QTCA 3TV4A 4V01A 4Q9SA 2ZMCA 3A7FA 4OBWA 4RVMA 3BV3A 3VRYA 2XKEA 4HYSA 3UBDA 3VUDA 5TOZA 3MDYA 3OCSA 2R3RA 3MESA 4FTCA 1Q8YA 4YMGA 1XDSA 3PVCA 4D1ZA 5HIJA 4RTPA 3IS5A 2YEXA 5HEKA 3IK3A 5HKMA 4RA4A 5T3QA 2BR3A 2C1AA 5IF1A 5HNIX 4A9RA 4ZTBA 3GGFA 3W33A 4I20A 1ZXEA 5ITAA 1F38A 4MHTA 2BIYA 1XBBA 5I9XA 2Z02A 5LWNA 3HRCA 3IDCA 1O6YA 3DCVA 4H36A 4AW2A 2Y4IC 5IU2A 4RX9A 5AJQA 3Q2JA 4CTCA 2W96B 1JSXA 4FKOA 5IH5A 3HEMA 5AM7A 3A26A 4HNFA 4DA5A 2X2MA 2B2CA 2G71A 2PXAA 3P7CA 1Q3WA 2C0IA 3ULZA 2B78A 1MRUA 3EL8A 3BQRA 3MS9A 1YXVA 2O07A 1U59A 2VWZA 2VWXA 3W18A 2O8YA 1FP1D 5CSVA 2B1PA 2PMLX 2PZIA 4CFNA 5EKUA 3C5IA 2JHCA 5CXHA 5BVWA 3MFSA 5ETAA 4G1WA 4R77A 2O2UA 2W05A 3QQJA 4F9WA 4U6RA 2RFEA 1GIHA 1ZYJA 5I9ZA 1UWHA 3WILA 3A4PA 3SX0A 2J0LA 5EFQA 5BNJA 4ER0A 3NIZA 3HCDA 3UO4A 5EHLA 1L1EA 3IEIA 2R3HA 3OHTA 2IGTA 2R3KA 4NFNA 3ENHA 5AX3A 4QMSA 4GVAA 2XVAA 4MTLA 3PVWA 2XYQA 1Q8TA 5F9EA 3TZ7A 4JDHA 4XOZA 3FAAA 3OTVA 5CUQA 5EHOA 4GH2A 4PTCA 3E8EA 1ZZ2A 5EI2A 4C04A 2HENA 4RC2A 4JQ7A 2VX1A 2HCKA 4XUDA 5EYCA 4JQEA 1A06A 3UGCA 2WMVA 3KXZA 3VBVA 2J9MA 3ZHPC 3HP7A 5JGBA 3Q6WA 5KVAA 2WIPA 5EGSA 5TR6A 1E1VA 1PHKA 2WTWA 3AXWA 2ITPA 4U44A 5FRIA 5L2IA 3SM3A 2AN4A 1LR4A 3QTSA 2WOTA 4RC3A 1B6CB 5M51A 5C4KA 5FGKA 5M4CA 2QHMA 3QKMA 1ND4A 3QCYA 4DT8A 3PE1A 4MQ1A 2VP3A 3BI6A 1TQIA 5AV0A 3OOGA 2CNVA 4QP8A 5EYMA 2X6DA 2XCKA 2HNKA 3PXFA 3CQEA 4YJVA 3B7PA 4C05A 4A6EA 3TNHA 3EQIA 4U5JA 3DDQA 3GFEA 4M67A 3R2YA 5AADA 2GTMA 3FDNA 3KU2A 2PY6A 2V7OA 4PRJA 3VVHA 4QP2A 5BUEA 1KPHA 4AN9A 1SUSA 1XKKA 4WO5A 4U43A 1KOAA 3F66A 5U4XA 4IAAA 5JH6A 1WCCA 3I9FA 3FTCA 1AGWA 3LDUA 5AV1A 5CEKA 1I1NA 3V8SA 3OXIA 4YBJA 3TRKA 4R3PA 3VUMA 3TKYA 2ZM1A 1L8TA 3AMBA 3PTAA 1GZ8A 3AGMA 3DMHA 2OGVA 4DLJA 3SDJA 5HVKA 1Z57A 2XK9A 3D0EA 1J1CA 2IZTA 4WBBB 1NBHA 4UYNA 4IEBA 4ZMEA 1N7JA 3D7TB 3E8DA 2C6TA 5LWMA 3JUHA 4TYJA 2ZLBA 4ASXA 3IO7A 4LWPA 3G5LA 3TFWA 1WBSA 3ZCLA 2CKPA 4H1JA 2PXCA 4L00A 4GU6A 1Q5KA 2GFCA 4D0XA 5C1QB 4LYNA 3FY2A 3F69A 5AUXA 3PJ8A 2BILB 1KE9A 3NUNA 5C27A 1P91A 2ZVJA 3DU8A 3G89A 3P79A 4GFGA 3FI4A 4DM3A 2GNJA 3QU0A 5DX0A 2PVCA 2JIVA 2WMRA 3A2CA 5G6VA 5JGAA 2QU6A 4HGLA 4XG3A 3LCKA 1J7LA 1ZOHA 3MFUA 4JQ8A 3JXWA 3VUIA 4XBUA 1FMOE 2F7ZE 3E3BX 3NGAA 3EN9A 5LQAA 3PXYA 3DZOA 5DNRA 5CWZA 5FQOA 2C3JA 3KMMA 4BDAA 3RWQA 5FWDA 4LOQA 3BKWA 5FXSA 3DV3A 3QC4A 3QAME 2VDUE 2BZIB 4IZYA 3G90X 4FKIA 4B8MA 3BGPA 3OXZA 4AQCA 5BW4A 5IA5A 2V74B 3TKUA 5KKRC 5DSTA 3DK3A 4Q5HA 2HZNA 3BWCA 4QQNA 3UZUA 3Q60A 3NZ0A 5GNKA 3NDJA 4YC8A 2OF2A 4DGGA 4O7VA 1YXUA 4QTBA 5HCYA 2XNOA 3QALE 2G2HA 5BYYA 4YTFA 3NPCA 5DA3A 4TYEA 3LSTA 5JZJA 2P7IA 3NIEA 4KIQA 4MYGA 3HMIA 2A14A 1PMEA 4ZSGA 3OZSA 4FA2A 4JX3A 3IECA 4A9TA 4CFMA 4POOA 3RAWA 5GWXA 5HBJA 3T7SA 1F3LA 3FPFA 3W2SA 3ATSA 2G2FA 2PMIA 3G2PA 2JC6A 3H0ZA 2OF4A 3T7TA 5F95A 3BU6A 3DTNA 1BYGA 3LKDA 3U55A 2W4JA 2QHNA 4FKRA 4MWIA 5LVOA 1FMKA 3C0HA 3FPEA 3JY9A 4DGNA 1NW5A 3B3GA 3TG1A 3H9RA 3EVBA 4M13A 4NSTA 5ICCA 4IACA 4FTRA 1YHWA 5LQRA 1OPKA 2XK3A 3FUWA 5C4LA 4FK3A 2HY0A 3EQCA 4GIHA 4DMGA 2ETKA 2ZULA 4O0RA 4J95A 2JFLA 2NRUA 4BI0A 5LARA 1YWVA 4O0WA 5HE1A 3R0QA 1IA8A 4RJ7A 5CASA 4FZDB 3EFJA 2YJRA 2BKKA 2QR8A 4PWYA 3LM5A 5HD4A 1CKJA 4LRKA 4GFMA 1MHTA 3ER9A 4C4FA 2B52A 3M6UA 1JNKA 4BDFA 4JIAA 4I41A 5ACKA 3HV7A 1U5RA 2R0UA 4L53A 4EOPA 2JDTA 5EMKA 4YJUA 3VW6A 4ZTNA 3OU7A 2OIBA 2YR0A 2UUEA 4J98A 4UY9A 3NW5A 4LFIA 5HLPA 3PVGA 1REJA 2XNMA 4FUXA 5CEMA 2JDOA 3KPVA 1KV2A 3V51A 4L43A 4PTGA 4EHVA 5CAVA 3RK7A 4K0YA 4MWZA 4KRDA 1U5QA 3NNWA 1HOWA 3SMQA 3MH3A 2PZRA 2VTOA 5T64A 5FWAA 1AQIA 3FMJA 4CG8A 5A3XA 3OE5A 3QRJA 3QZHA 3AXTA 3TJCA 4YUZA 4V04A 4EK4A 3TM5A 1ZOEA 3DQXA 5FA5A 4MNEB 2X9FA 4IB5A 4JDJA 1H1SA 2P3LA 5BX0A 5HTBA 1WVWA 3FZSA 2AC3A 1SVHA 2CLXA 3HVJA 2UYCA 2WA1A 1J7UA 5AUYA 1R78A 3U81A 2QURA 4RYLA 4LM5A 4X3JA 1XDZA 4ZLYA 4F0IA 2P2IA 3FXWA 5E1OA 3DNEA 3FLZA 3ZO3A 3BYSA 1G8AA 4RX5A 3GOKA 4PYOA 3E8NA 3PT9A 4TPTA 1SYKA 3KQPA 2WTVA 2OJFE 2PMOX 4S30A 2P7HA 1QPJA 4DHFA 3UC4A 4FZ6A 4O0VA 5J8IA 2PUNA 4FT4A 4BGQA 3IGOA 4FSZA 4DEDA 4BLUA 3P9CA 2JAMA 2W17A 3V04A 2I0HA 1FQ1B 4FZ7A 4PDOA 1TW2A 3WYXA 1XH7A 2QU5A 1NW6A 3OWLA 2OB1A 5DRDA 5LR6A 3HYHA 3QBNA 1R18A 3DGKA 5CAOA 3BU3A 4YUWA 3OWKA 4DEEA 2AOXA 4QMXA 4R6WA 2W1HA 2C1BA 1SUIA 4L7SA 3FJQE 5K5NA 4DFBA 4BI1A 3S2PA 5GJDA 4AE9A 2ZBPA 4FKLA 4DEGA 4YZ9A 1ERKA 4C07A 1FBNA 1FPQA 4FKQA 3WZDA 1WBPA 2RIOA 4XS2A 1CTPE 4ASZA 4J71A 3FQHA 2JFMA 4ZY5A 4NM5A 2OFVA 4FUYA 1K9AA 4IWQA 4FSYA 4UOEA 2C6KA 3VJOA 1YW2A 3RK5A 3KVWA 5AA8A 3BYVA 1M0EA 1DCTA 3CR0A 3GCZA 2B7AA 5FEQA 5ICPA 4GT3A 4GJ3A 4JJRA 5D11A 5D1JA 2FA2A 2BMCA 4L68A 1TVOA 1U54A 1REKA 1PF8A 3KQWA 4P7FA 5A54A 3VS4A 4FSNA 4R1YA 3S00A 5IPJA 1CM8A 5J7HA 3LPBA 3NWEA 3PY0A 3QYZA 4BLWA 4GW8A 3OT3A 3UPZA 2GB4A 1L3IA 3GGDA 3KQMA 4FTIA 2KW5A 2C6EA 3D7ZA 3OZRA 1NA7A 1IA9A 3VBYA 5BVFA 2BAQA 2PSQA 2W5AA 3OCGA 3C50A 4HVSA 3LQ5A 2X7OA 3RI1A 3M33A 1JAMA 1VR2A 3FKNA 1NW7A 1KE8A 2PVNA 3Q9YA 2J5FA 5JK3A 4EZ3A 1VYWA 1YI6A 2ADMA 1JTFA 4L52A 4PINA 4QTDA 2IG7A 5AP2A 4WRSA 2CGWA 3P8ZA 4CV9A 2X39A 3BE2A 4J7BA 4NT4A 4CMUA 4DEAA 3UDBA 4E6AA 5ANIA 2YABA 3UC3A 1SVEA 5CM2Z 1YKRA 4UWBA 2E9UA 4JAIA 4R7IA 2FRXA 3UOJA 3H0YA 3MB6A 4PMTA 4KKGA 4YC6A 4KABA 4DE4A 4BDBA 4Y5QA 3ERCA 4FL3A 4APPA 3C1XA 4HCVA 4C4JA 3EFLA 3LQ3A 4RMZA 2QRVA 4QO9A 3ZO1A 3DULA 3ORXA 4C58A 5B2KA 4I1ZA 3B8QA 3IG7A 4DTKA 4I5HA 3OW4A 2PX2A 1JKKA 1OKZA 4Y30A 3QWJA 4Z3VA 2WKMA 4OTIA 4V0GB 3ACKA 4CT1A 3LXNA 3ZXZA 4YTIA 3ZDIA 3FTEA 1MP8A 3QXPA 4G3CA 3NUSA 5DN3A 3LXKA 3LJ0A 4EOIA 2IW9A 1Q3DA 2WEVA 1H01A 3HUCA 1I4WA 1ZHFA 5LSAA 3BKBA 3MIAA 2ERZE 5HIDA 4EBVA 4ZJIA 3ZSIA 5B0XA 3BHTA 2ONZA 1L3CA 3MJ2A 3CGFA 2OZVA 4H39A 3MSSA 4EKLA 2IVUA 3TTIA 3GU3A 3Q4UA 1XTPA 4E5BA 3LIJA 4FBXA 3Q4ZA 4O2PA 1ZLTA 5M08A 1J3HA 3RCDA 3NYVA 3LLAA 2C7PA 1PJZA 3BV2A 3CJRA 5ETFA 3OROA 4XLVA 4LL0A 5HVJA 4TYHB 3DXYA 5J1WA 3R6XA 1UVRA 4HVIA 2ERKA 1XQZA 2WMUA 2WMAA 2E9OA 4WA9A 2HYYA 4IAKA 2YCQA 4JAJA 5CEIA 3DKCA 4AN3A 5FTQA 2ITOA 3CGOA 3N4TA 2XIKA 4I4EA 5DGZA 2YM8A 3JY0A 5IA3A 2Z7LA 4Y85A 2UZUE 3RPSA 4L44A 3E3PA 3VUKA 4UV0A 4NYEA 3ITZA 4ASEA 3EH9A 1BC5A 4RX1A 4CFFA 4IE9A 4WIHA 3E7OA 4G9CA 3H2BA 5DTQA 3SRVB 4E70A 3KL8A 3SW4A 5GM2A 4J52A 3JS2A 3JVRA 4HPTE 2PE1A 1RW8A 2WO6A 2GTNA 4O83A 1PW2A 4HGYA 2HOGA 1IR3A 2JBPA 3UOLA 5HORA 1BI7A 1LEZA 1UU3A 1H4LA 5K05A 3MV5A 2XZSA 5CS6A 4G3GA 2W1ZA 2YDJA 4NJ3A 3KY2A 4GJ2A 4DEBA 2PX4A 5BW5A 5FEDA 2ACXA 4BCMA 3KK8A 3I64A 1OBDA 4FTJA 5BYLA 2Y4PA 3N51A 4U81A 4H58A 2ZIEA 4QTAA 1OPJA 1CSNA 2HK5A 1G8SA 3VSEA 2GHMA 3FMLA 2I62A 4O0XA 4BZNA 4WSYA 3RPOA 4ZZNA 4EK5A 2XB7A 2BCJA 4XUCA 4FR4A 2ZJWA 4OGRA 3O96A 5ETCA 5K0NA 3O71A 3OBGA 2OYRA 2C6DA 2ZAZA 4G3FA 1YHSA 3CSVA 4HJOA 2JGZA 4N6ZA 4EORA 3R7VA 3ATTA 4X61A 5EIFA 3HMMA 3WZEA 4IX6A 4BTFA 2YAAA 5IEYA 5CAQA 1QPCA 3M1SA 3PG1A 2XK6A 4FEQA 5DM4A 4K18A 5HIEA 3K54A 3WI6A 5AV4A 3EVDA 3IONA 4AU8A 2I0EA 2HMYB 4E31A 1KXZA 2XIRA 3UP2A 1P14A 4L67A 4JNWA 4IQ6A 3FTFA 3TZ9A 3U87A 3WF8A 3ZH8A 1BKYA 4ONAA 5T6KA 3C51A 5KO1A 3BZBA 4AT4A 4FV6A 5E2BA 2IFTA 2WOUA 3CIKA 2BM8A 3FKOA 4DF3A 3O31A 3I60A 2A19B 2ZM3A 3PFHA 4QP3A 5C8NA 3E7VA 3AC2A 3NUAA 3DJ6A 1ZRZA 2W06A 2ZV8A 5E8WA 3ANRA 3PYYA 4YZCA
chains in the Genus database with same CATH superfamily
1QKJA 1NIJA 3FXXA 3C4WA 2GNHA 2ONLA 2HSGA 4ZK5A 4W9NC 3CWCA 1EJBA 1KR5A 3A99A 3N8GA 2E4YA 4BO4A 4DSUA 3TOCA 4A03A 2OFWA 2ODNA 3N6RA 1TVKB 2WJVA 5IEVA 4EO9A 4MBJA 3R75A 3SSOA 3F0TA 4GZMA 5HPYB 2WAYA 3H10A 1UKZA 2WUFA 5TY0A 3N3BC 5D7AA 1Z5NA 1X19A 3ECSA 1W85B 2BRBA 4JJIA 4XLTA 3G13A 5K8UA 3K3IA 4H7JA 3A3KA 3IUPA 3RVMA 4IDPA 5F20A 4R1QA 2EWWA 4FICA 3DB8A 2BFEA 1LJ8A 1YDSE 1R6AA 2IY8A 3K15A 4B2YA 3AM1A 3RV4A 1L0BA 2ZI7A 3GT7A 5AK6A 5EM8A 4HKTA 4Z3KA 1M10A 4UZHA 5FEEA 4Q03A 3BPRA 1M2VA 1DWQA 2O5KA 5C3MA 1F2TA 3QYJA 4YUQA 5HU9A 4FZVA 4KPYA 3ZM9A 1V3VA 4OEHA 1WCIB 1C4XA 2WWVD 1G2OA 1TLFA 3L9XA 5EHIA 2BM0A 2XMBA 4RD2A 2YN8A 2ZAOA 5A1JA 1QX4A 3NEYA 3WGKA 2GQ0A 3GUHA 3KT6A 3TK1A 4YMHA 4XPZA 2BHRA 4DUYB 4X1KB 4TWNA 2H7XA 4FC6A 3OZCA 5C51B 5FOVA 1SXJD 2DFTA 1ABBA 2NZWA 3EDOA 4H1HA 1V5WA 4I4LA 3Q98A 4B48A 1FGIA 5LQUA 3F2VA 1VL1A 4KI7A 3VFDA 4X44A 3GLQA 4MBLA 4TMFA 3NGLA 3L0PA 3SKXA 2PYZA 3EW9A 3E35A 1XLTC 1HTWA 3DPKA 2UXBB 4O2ZA 4O5AA 4CKIA 1QMGA 2MIIA 1Y5IA 3AWDA 1PDVA 4X93A 3KTAA 2W2KB 4IIGA 1OB5A 2PA3A 4JDUA 4I5CA 4B3BA 3F6PA 4OVKA 4AZEA 2WHRA 2Q2QA 2JLYA 4QBIA 4CVAA 2J0IA 4ZGWA 1EIZA 1QO7A 5EOLA 2VBCA 1E9CA 3WS7A 4QMQA 4H59A 5F1PA 4H1TA 1S9IA 4B6SA 2DECA 3HLYA 5CHEA 4IQ4A 4EVIA 4PG6A 3UT5A 1NUSA 4JXJA 1PDWA 4KZPA 4U0JA 2XZTA 1ESZA 1QFSA 1V0OA 2XR1A 3BOSA 3U48A 4L74A 4TXHA 3TRHA 1WDTA 1Y6AA 4AG6A 2LV8A 2J67A 1CB0A 2DJIA 1XXLA 1AA6A 3NWPA 1L9KA 1N2OA 5HUJA 4M3QA 1B6SA 3HMNA 3QV1A 1OLUB 3E8MA 3N0TA 3HUDA 3VC4A 4W8GA 1EFPB 2X8DA 4QGHA 3DTYA 3TD2A 4BLVA 3H6HA 2AKYA 4LGVA 1P7ZA 5A06A 4AMVA 2CUKA 3D2KA 1NU8A 4RPKA 4OP1A 5A6NA 4IILA 1CVLA 4FOTA 2PMCA 4YMUA 1OLSB 4P7GA 3L1UA 4E4RA 1K66A 2ORED 3D6UA 1Y5NA 4UMVA 5E7RA 4A26A 1WZNA 4B4DA 4V02A 1LK0A 1U8ZA 3CO5A 4X7MA 3QMVA 3LBIA 4OI4A 4FC7A 1N3BA 3L5KA 4WESA 4NOKA 2FSPA 2E6KA 1WV1A 3UKDA 3A1NA 3I42A 5FNVA 2J6BA 2BBTA 3AR6A 3KTDA 2AH5A 1Y8GA 1NN1A 3RJ5A 2GJKA 5B4TA 4YPDA 5DGXA 3JYPA 3OZ7A 1QZUA 1T2EA 3RMFA 2JDID 4UAVA 4BBPA 2Q5IA 5KNJA 4M8TA 1IXYA 3AXSA 3KGAA 2VZ9A 3BICA 4IJPA 4W5JA 4MAMA 3R71A 1U5BB 5DT3A 1XFAA 1OTYA 1M5TA 4ENQA 3MCZA 1OC2A 4LRQA 4RLLA 3NDPA 1BX0A 4RVDA 1FVTA 5YASA 5CD9A 3SKYA 1YB2A 4HJXA 3DD5A 1KJQA 4Y9RA 4EYGA 2NYRA 1ZD1A 3WMWA 3KVXA 1ZVKA 3RW9A 1MJHA 3RU9A 3DL0A 3T0FA 5KSWB 1O9BA 4JBQA 4XWOA 5E9EA 2P2HA 2NP8A 1PNQA 1JQEA 5CPFA 3MVMA 1W4LA 4GU9A 4CIBA 3QG1A 4ZVPA 2O50A 2DHEA 4PX3A 3L7JA 3DWFA 5ICEA 3LX8A 2KLBA 3BJMA 4DWVA 2ZQZA 2AK3A 2XUAA 4X63A 4FHDA 3WLRA 1LZLA 2DHDA 4LSZA 4PNZA 5PNTA 1ACJA 5JAQA 1PLKA 4FS8A 1FDVA 3D3QA 4WFQA 4WFKA 3HLLA 3CQUA 3SF8A 5KX5B 4M8IA 1DJMA 1E9RA 3GNIB 1S2NA 4H3VA 3KRTA 1VPLA 2GTPA 2LTAA 3QTQA 3UO5A 5CT9A 3U1TA 3BIXA 1Q14A 5B6IA 1LNQA 2R8BA 3DTVD 4CKYA 1OMWA 4TQAA 1KE5A 1QYWA 2XW6A 3IGFA 3SG8A 4MGIR 4MQFB 3KC3A 4WVFA 2XVDA 5B55A 5J1TB 1ORIA 4OTHA 2JVJA 2Q29A 1U1GA 3R7OA 4B83A 4FKMA 3ETLA 4EX7A 4AF8A 1Z6QA 1LU9A 2YIDA 1NN0A 2VQEB 2NYUA 2WFLB 4RORA 3ZMMA 4PC3A 2P1ZA 5KQSA 4RSSA 3ONNA 1IWPB 2P77A 3W6UA 4OBOA 3HSKA 3N2NA 5HW0A 1V2HE 3IQ7A 3QVJA 1K75A 5FWXA 1KYZA 1GAXA 2GK4A 2QOQA 3C3AA 2BTQB 2B69A 1U0TA 4FIGA 3ODGA 2P4IA 4E5MA 4K77A 4MMZB 4P1ZA 1FX1A 3NOVA 4YP0A 4U0IA 3NO4A 4Z7QB 1VZOA 1A8UA 3QHAA 5LB2A 3ZJ5A 4KK4A 3RSFA 3QX8A 5L7TA 5JNLA 1YD7A 3RPYA 2Z5GA 1D7OA 1NNI1 3VUHA 3F5DA 2EXCX 3L8SA 3RYHA 2G70A 3L0OA 2GAOA 4A7CA 4ITRC 3AIIA 5TVGA 2V55B 5DBEX 3HBFA 4MDHA 3ORNA 3LC7O 3GEPA 5IZFA 2ONLC 4Y2XA 5IK2A 4MKCA 3O3MB 5A5VA 3D4BA 3S27A 1HDIA 4L3PA 2PS0A 2RG7A 4D2SA 1L2TA 2NO1A 4YDRA 4Z3DA 3PIRA 2CNOA 2FLVA 2O65A 5JT2A 2WWXA 5FCDA 2RAFA 1IWBB 1Z9XA 4YGAA 2E1RA 4E21A 3KT0A 3NUUA 3U9SA 5DYJA 4BJJB 4EAAA 3VU9B 4QVKA 3JQAD 4MULA 2GCDA 2R3PA 5TJHA 5AMXA 1RQ7A 2G1PA 3LC2O 4BIIA 4GLLA 1P7YA 2FMTA 1V8DA 1AC5A 3W8QA 2M9MA 3FW1A 1U7XA 3R8ZA 2EAUA 1RXCA 4OK3A 3TW8A 1P81A 5L8KA 4XLZA 3PJ3A 3RYTC 2R6HA 4TQGA 4ENUA 3VX4A 3W0RA 4AN2A 1DQYA 3DEZA 2I91A 2VDOB 3L7IA 4MV9A 4P0PB 3USCS 3RVRA 3BEDA 1QDEA 3GENA 1X7HA 4ZYVA 5C52B 1QRUA 2H16A 4QSMA 4TXMA 5L2SA 2AQKA 3FVQA 3MT7A 4DIDA 1A5ZA 4AJ4A 3R7EA 1FQWA 2OJIA 2VD5A 3QCSA 2PQ0A 4E7OA 5B1EA 3H9FA 3KUUA 4XRGA 4QMYA 3A1FA 2KB0A 3FHCB 4A15A 3EIHA 4ABTA 2W71A 2XSZD 2G82A 2ZS8A 3SEQA 3PP8A 4ALIA 3GVHA 1GCGA 3E62A 1FVXA 4NMHA 1QBGA 4LQ4A 3JALB 3BXGA 3DHEA 3LIPA 4EZIA 2YH2A 1VLHA 3A1UA 5ALRA 1QGZA 3IR5A 1ML3A 3JS5A 4UVHA 3CG4A 4WRGA 1WQ1R 1LF0A 1RHJA 4A8PA 2ZDUA 1POWA 5IVIA 2QMYA 5TX7A 1MG5A 2Q6LA 2RK6A 4IIXA 2NSJA 3HABA 2WHEA 4BKJA 5JJIA 1V6AA 3QX9A 3V1UA 3VTKA 1QE5A 2VLBA 3MCUA 2C8JA 4EDHA 4WXPA 3ZDXB 3M6XA 1W8IA 3OX3A 1Z4NA 3S2YA 3VISA 4RVUA 1UJ6A 4IO1A 1JG6A 1X8JA 4URXR 3D8TA 1C7FA 2YCBA 3SRVA 3FBGA 2OAGA 3MJFA 2IZUA 4JLBA 4Q34A 4F06A 5HJ7A 2OZLB 2R3IA 4QP6A 1NONA 3NHYA 1SBNE 1CZUA 2JH9A 1LV8A 3SZRA 3EFBA 2UW9A 3OJWA 4PSUA 2FI1A 4M7RA 3Q3GE 3JD2A 3TB6A 2JKVA 3MJEA 8ADHA 3ITEA 3RLFA 1ZU4A 4QULA 4KQ2A 4GMGA 3THSA 4J3FA 2BI4A 4DQXA 2GN9A 4MXCA 3RIMA 1T5BA 1NLZA 3CR8A 4CCUA 3E5HA 2UVYA 1SKUA 5DP2A 1RCUA 4PDSA 1E9AA 5IDYA 3A4IA 4FE2A 2A30A 3LY8A 5CVFA 3BBLA 3RREA 4DHEA 1GNVA 1EM8B 3NCGA 2OHJA 2X2OA 3QPDA 1DDIA 4KRCA 3E4DA 3CS9A 2DCMA 2BN4A 5KZ0A 3BLQA 2QL7A 3G2MA 4AM8A 1AKUA 3IKAA 3WYCA 5L2WA 1SIUA 2QN7A 4S35A 2WFZA 5C8MA 2VHXA 3VC2A 5JPIA 3PWYA 3V2HA 3FSEA 3ABRB 2J31A 1O5TA 2FJPA 4GEKA 4E08A 5TF9A 5JQWA 1I2BA 1SO8A 4PCLA 2J0EA 1VOTA 1PGOA 4IVDA 2W42A 4RPIA 4CF4A 1GPJA 3ZGYA 3EN0A 4C7OA 3QQHA 1JLKA 4GCJA 2FWAA 1JQAA 5BV2P 4I81A 4TWOA 2KYRA 1JB1A 3D7RA 1OL5A 1J39A 4NBTA 4RD0A 3NYIA 3U7HB 2H3HA 1P2VA 5JHGB 3ZH2A 4Z8XA 4M54A 1YDHA 4IW0A 3F1LA 2QGNA 3OETA 1VHJA 2JIZA 1OA1A 4MV5A 5AKKA 2XQJA 2CPKE 4MVJE 5EC8A 2GS7A 3R7YA 4TGLA 4LMRA 2QV0A 2FFBA 1CERA 4W63A 4EYEA 1WBOA 2EUFB 4ZYLA 1ZCZA 4AKEA 3LTEA 4WXHA 5TGTA 4K03A 3PQ8A 5EQPA 1JLUE 1LQ2A 1TE2A 3GBVA 4C2UA 2OD9A 4M0LA 2P62A 1KRHA 2HF7A 2W4KA 4PS1A 3QA8A 3UMRA 2VTPA 5HQ0A 1OAAA 2JFQA 4EHKA 3JYHA 5B7GA 1FXWF 4G2TA 2C5VA 1MTZA 1IJFA 4HQNA 1W36C 2IYTA 2AFHB 3B6EA 3K71B 2A9OA 2WTDA 3D6HA 5C9ZA 1U8XX 1RTTA 2ZIFA 3AFMA 3E7FA 2W2OA 4OP2A 2ECKA 2Z95A 4BQRA 2AYPA 4TXLA 1H3EA 3NHBA 4WEQA 3QCXA 2X9LA 2PMEA 3TNJA 4KSCA 3V8TA 2G15A 3BBTB 5BOSA 1KAMA 4RIOA 3I3SR 1K4YA 4JC4A 5FDFA 3O8PA 5ALDA 4E1BA 3BB4A 1N5IA 3G2KA 4TT7A 3I1YA 1YRLA 3IX7A 1V8OA 1XMJA 4IHKA 4Y7CA 3ZFXA 3CLHA 4O4LF 2FF7A 1CQIB 1XDGA 3BCUA 3VPCA 4RWJA 5CBKA 3EEFA 4EOLA 4YJDA 4JFAA 1TEZA 2HOQA 3PQEA 2QMQA 4RZVA 2G0AA 4AP5A 1Z0AA 2V5UA 4X6XA 2PJDA 1FXWA 4LZWA 1LLQA 1RJBA 2BTRA 1I7NA 4DPKA 1TOAA 1GUYA 1R0YA 3ZHOA 4EEXA 4AZVA 5TVKA 5GOZA 2PPQA 1W5FA 5KKRB 2B6NA 1QO0A 5CCEA 2R9SA 3R3YA 1QB7A 3ZOKA 4GYJA 3TUBA 2YWPA 1XEFA 1QYXA 1W73A 4I2NA 5B2MA 3ANQA 2QHXA 5E4JA 2BZJA 1E61A 1YE8A 2WTEA 3F7MA 1QONA 2QOEA 4M8KA 4XDHA 3ER8A 1N6IA 3AIMA 4ND3A 4F84A 5B7NA 1NWHA 4ISBA 1M2QA 1BRMA 2NN3C 4M9CA 3IAAA 1GRNA 4F63A 1XBTA 4LNAA 5CT4A 4ZVTA 3R7NA 3P9IA 3LKVA 2PVRA 1TVEA 3IOMA 5IBPA 4IBMA 4BCDA 3VHRA 1V1KA 3TUCA 4MRPA 3ALOA 3SIXA 4HI0E 2DFVA 2X5OA 4L08A 3S44A 1BYIA 3CB2A 3OBIA 2EFEB 3CT6A 3TLYA 4C3RA 2OMKA 2HAEA 3WWYA 2IDZA 1XD8A 1ZWSA 4O4JF 4FIJA 4QXRA 1BHSA 5LYYA 4X3FA 4TKVA 1OI9A 2QOCA 1Q77A 4WNCA 3DKVA 1R66A 2VJNA 1YMVA 4M21A 4TRNA 2F1RA 1N1EA 4E7PA 3ABOB 1X7GA 3H04A 4X7QA 2QTMA 3R2JA 3RTAA 1ZGAA 1YVRA 1YQGA 1LVHA 4U8HA 1WP4A 3O93A 2ZR9A 3TNQB 1SGWA