4DFUA

Inhibition of an antibiotic resistance enzyme: crystal structure of aminoglycoside phosphotransferase aph(2")-id/aph(2")-iva in complex with kanamycin inhibited with quercetin
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
296
structure length
296
Chain Sequence
b'TYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APH(2")-Id
publication title A small molecule discrimination map of the antibiotic resistance kinome.
pubmed doi rcsb
source organism Enterococcus casseliflavus
molecule tags Transferase/antibotic/inhibitor
total genus 96
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01636 APH Phosphotransferase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dfuA01
3.90.1200.10 Alpha Beta Alpha-Beta Complex Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2 4dfuA02
4PTGA 4BVUA 4JQ7A 2HW7A 2QOLA 3IDCA 3POZA 4IW0A 4BIBA 4AN9A 1BLXA 1Q97A 2O65A 3RPVA 4F1OA 2A19B 3GT8A 1KE7A 4FGBA 4B6LA 2B4SB 3UIXA 3EFKA 3ROYA 2XNEA 2PVRA 1OPKA 3LFSA 3B8QA 3LMHA 4Z3VA 2OF4A 4FEQA 3QA8A 4USDA 3OOMA 1PYEA 2P55A 2Q0NA 1OKVA 4UWYA 3TV4A 4GKIA 3GOKA 4XP0A 4AN2A 4EL9A 4F9YA 4C4HA 3H0ZA 4ZTHA 2GNGA 5H3QA 2IVTA 3IONA 4IAYA 1W82A 4E4NA 5L2SA 3H30A 4NZWB 3SX9A 3TUDA 3G33A 5EG3A 1SVGA 3ODZX 4YTHA 3IS5A 5EI2A 3ZSHA 3DZQA 3UO6A 4MD7E 3SOCA 4QPSA 1CM8A 3QRKA 4XUFA 3TZMA 4ZMEA 4QP3A 2B9JA 2Y6OA 3QTUA 4YBKA 4BCGA 4GYIA 4AOIA 4O83A 1EH4A 4WBBB 4ZSAA 4M67A 1JNKA 4FVPA 2UZBA 3Q6UA 3PG3A 4GUBA 3DQWA 3K3IA 2XKFA 4KIOA 2PUPA 3MJ1A 1G8AA 3E3BX 4FG9A 4DH7A 3IK3A 4D5KA 3RMFA 1YDTE 4E1ZA 2VO7A 4GYGA 4U98A 3OEFX 2WELA 4O6EA 4N4SA 3VS1A 5CXHA 4ZTSA 5I9VA 3I60A 5K3YA 4V05A 3F3ZA 3FSFA 5J5SA 5KHWA 4EK8A 2PMIA 4HGLA 3QZIA 2PVHA 4FSYA 3TDWA 5IA3A 4G31A 2BIYA 3MPAA 2JFMA 3SG8A 1L8TA 4BCQA 4EJ7A 5EFQA 4UWBA 3E88A 4RLKA 4HVDA 1G8SA 3FPMA 1ZMWA 3HZTA 3Q3BA 4I6FA 1TVOA 5GHVA 3E8DA 4E5BA 4JOAA 4NK9A 5IQDA 5DE2A 1YXUA 1GZOA 3E63A 3IGOA 2UZDA 3OWLA 4OTGA 5IUIA 3ZFYA 4CFWA 2C30A 1H28A 5AV1A 5IMEA 4E93A 3QAME 3ROCA 4DLIA 3WF9A 2XBAA 4FEUA 5AUYA 4D55A 5IDNA 3OW4A 3PJ1A 3W0OA 4GIHA 2HY0A 4QTDA 4IQ6A 2ITWA 5IA0A 3U54A 4ENYA 4F65A 3O71A 4BRXA 3IG7A 3ANRA 3R30A 4EJNA 4RZVA 4DTAA 3AT4A 3ENHA 5FDXA 3S2PA 2J0MB 3II5A 4MCVA 4ZMFA 3GP0A 3JPVA 3LM5A 1WVYA 3DZOA 3I4BA 2HIWA 3TKUA 4I5CA 5E91A 3OWJA 3ZTXA 3HV7A 3DLSA 2WMSA 3EN4A 4QMZA 4OT5A 4RJ6A 5IQBA 1YWVA 5JZNA 3ORKA 4JLCA 3ZO1A 2WQMA 4MD8E 4AAAA 3QUPA 3QU0A 1QCFA 4PWNA 3NYVA 4RJ5A 5KMIA 3PXYA 4QRCA 5JFXA 2VD5A 5EI6A 4BI1A 5HO7A 1UNLA 4NH1A 4FIJA 4HYSA 1Q8WA 4ZSGA 3PVBA 4JDJA 2R2PA 3ZDIA 2Y4IC 2ZYBA 3C5UA 4G9RA 2XKCA 2O2UA 2VTQA 2HOGA 4G3GA 4PMTA 3ZBXA 1TQMA 4PRJA 2X7FA 4D9TA 4E6CA 2RGPA 5F1ZA 5JGAA 4C7TA 4G5JA 4L8MA 2ZV9A 4O81A 4IAAA 3A7GA 3W8LA 4PDYA 3NVMB 4C4GA 3SOAA 3DBQA 4PDSA 3LXPA 3UIBA 3V04A 4HVSA 4IDVA 4U79A 4DT8A 4ZLYA 5BVOA 2XA4A 3AGLA 3RAHA 4I1ZA 4JJRA 4JR3A 3GC8A 1LEZA 1H26A 2XNPA 3AT2A 4G3DA 3OCGA 3BU6A 4K2RA 2ACXA 4R1YA 5CF8A 5K4JA 3BU5A 2WKMA 2JBPA 5M44A 2HZ4A 4G3FA 4FV7A 4TZRA 3GUBA 2WOUA 4GT4A 4UEUA 3KQ7A 2B1PA 3ORZA 4WNKA 5AM7A 5A4EA 1XBAA 4IX6A 1R3CA 3K5VA 4BCOA 3AC2A 3FC2A 3Q4CA 3F3TA 1DI8A 4G3EA 3PUPA 3CQUA 3LFEA 2XBJA 5CENA 3AMYA 3R9RA 3HL7A 5A3XA 5CF6A 4ALWA 2I0VA 3ZLWA 4HPTE 2QO7A 4FTTA 4R1VA 5FTOA 5B2KA 2ONLA 2W4OA 2WTWA 5HU3A 2WTKC 3NVKI 5DWRA 2W17A 4EZ3A 4BKJA 1OITA 2GQSA 4DEAA 5ICPA 3T9IA 3LJ0A 3MIAA 5B2MA 2WTIA 5AFVA 3SXRA 4CCUA 4U94A 3FMEA 4RT7A 3Q2MA 4TKSA 4G17A 3CJFA 4RBLA 5BMSA 3P7CA 3FMLA 1OECA 4ORKA 4JRNA 5FEQA 4W4VA 5HEZA 4C3PA 2BTSA 1K9AA 3RAWA 4O7NA 4XG4A 3ZZWA 3QZGA 3TG1A 4ASDA 3ATTA 3COHA 3D2IA 3S0OA 4HCUA 4TYHB 3VO3A 2BRNA 1J7UA 4FT5A 3R0TA 4QYYA 2VWWA 5EM8A 2XNMA 4FTCA 5BUJA 4JDIA 4AGUA 5FDPA 5AWMA 3DS6A 4BCJA 3V3VA 5CSPA 4FSMA 4ZTRA 4DTKA 3ZDUA 1ZARA 2O64A 4J99A 5CXZA 4F0FA 4EOSA 3GCUA 2B9FA 2FO0A 3HEGA 3Q96A 4NTTA 4QQCA 1QPCA 5HNGA 5K9IA 3KMMA 4C2VA 2IZRA 4TWNA 2F2CB 3E3PA 3VUGA 3OWKA 4TL0A 1F5QA 3UIUA 4WG4A 1MP8A 1FGKA 1RE8A 4NU1A 4C4EA 3UPZA 4G9CA 2CHLA 3KN5A 5AP6A 3VBQA 4U3YA 4YZMA 3AMAA 3Q60A 5FQDC 4MHAA 4IZYA 3UOHA 2IVUA 3UVRA 1OL7A 2WFYA 2XEYA 4BY9E 1HCKA 2YDJA 2UZNA 3PP0A 4GU6A 1YKRA 4JXFA 4DFNA 4ACCA 5DR2A 3ZFMA 1ZY5A 5BNJA 4QMUA 1FOTA 2PVKA 4JT3A 3F2RA 4ASXA 2CCIA 4X7QA 3PXKA 3UYSA 2OFVA 2QO2A 5AJQA 1U5RA 2ZJWA 3POOA 2R3IA 5CEQA 3AOXA 3UJGA 5LMKC 4UY9A 4JBOA 4TT7A 4EHGA 2HZ0A 4HYIA 2VWIA 4NL0A 5ETAA 2GSFA 3FL5A 5CNOA 5CF5A 3ZXTA 3S3IA 2HZIA 1R78A 4EH3A 5L2IA 4IANA 4S2ZA 3CIKA 3F5GA 3RM7A 4RIXA 1W7HA 4DN5A 4DH8A 1PMVA 3O7LB 3D0EA 4DCEA 5EYDA 1W8CA 3TT0A 4C3FA 3CS9A 2X4ZA 4CZTA 1OBGA 5DEWA 5C8MA 4RIYA 3TZ8A 4FIEA 3DY7A 1ZOHA 4HW7A 3AXWA 5I9WA 4MKCA 4Z55A 2V62A 4O84A 2CGXA 2GTNA 1STCE 3FXWA 2XUUA 2R3GA 3SLSA 1JAMA 3GI3A 5LOHA 1NVRA 4FZ6A 4MXOA 4AFJA 3PA3A 1J3HA 3QTRA 5ANEA 4R7IA 4USEA 5CYIA 3AGMA 2JKKA 3GCPA 5H9BA 4J7BA 3AD6A 3JY9A 3I0OA 5EHLA 4IB3A 4F6SA 2CGWA 4I24A 3V51A 3ZEWA 4C4JA 4KABA 4CQEA 3OEZA 4EC8A 5C26A 5CEKA 1WVXA 1YOJA 3OOGA 4QQJA 4S30A 4CRLA 5IF1A 2J0IA 2ZMCA 3LFBA 3QQGA 1GAGA 4TYJA 3FPQA 4FZAB 1KE6A 3F2AA 3O7LD 4LYNA 4FTUA 2FGIA 3GXLA 4KNBA 4AZVA 4GVJA 4K18A 4WBOA 3IGGA 4FA2A 2P2IA 5L3AA 4WA9A 2XIXA 1G5SA 3LCSA 2XRWA 3G15A 2C3KA 5TF9A 1PRYA 4RMZA 4TWCA 3BQCA 1OKYA 2GHLA 4R3RA 3CKWA 4L53A 3VUHA 2I1MA 4APCA 3FLZA 3QC9A 5CT7A 4M8TA 4U3ZA 2QONA 3CE3A 4CLJA 5HNIX 3EFJA 2PTKA 3NUAA 4YJUA 4JAIA 1CSNA 4J95A 3L9LA 1IASA 2EVAA 4MF1A 4AS0A 4EYJA 3R7OA 3UQFA 4YBJA 2CLQA 4KIQA 2X6DA 4Y8DA 3VC4A 4MD9E 2C3LA 2YIQA 2GTMA 5CZHA 2W1EA 2C3IB 1OBDA 2GNFA 1H24A 4BYJA 2JKQA 1JKLA 4F1TA 4R6VA 3CEKA 4RJ7A 4Q9ZA 2BTRA 4TNBA 4IWPA 5B2LA 5JFVA 3DJ6A 3ZM4A 5HX6A 3SC1A 4BCHA 3QGYA 4NT4A 3G2FA 3R1SA 3WF5A 2R7IA 1GZ8A 5HE2A 2I6LA 5M06A 3HV3A 4J1RA 4FSWA 1O6LA 3L8VA 4RVTA 2PY3A 1FVTA 3NCGA 4LMNA 1ZAOA 4U41A 3RK7A 4Z7GA 4QMYA 5M07A 1KE9A 4FL2A 2F57A 3E8EA 5BUEA 1DAYA 4AA4A 2JKOA 3FBVA 5CS6A 1KV2A 2J0LA 2EU9A 4OTDA 3RTPA 1QPDA 1OMWA 2DS1A 3DAJA 3MFUA 4ZS0A 3VBTA 1REKA 4FL3A 4EK4A 3FLQA 4QP2A 3GU6A 3OD6X 3EYHA 3DBCA 4DYMA 5KBQA 4FMQA 1M7QA 3EKKA 4FE2A 4LUDA 5HVYA 4FNWA 2CPKE 1ATPE 4ZSEA 5J9YA 2H6DA 2WXVA 3AD5A 2VX0A 3OTUA 1PKGA 4HOKA 4IAIA 3HV5A 4M0YA 4RJ8A 1M14A 4M84A 3S95A 4D2SA 3OC1A 3FMKA 3L9PA 4B9DA 5BYLA 4K8AA 2VTIA 3ORNA 4I4FA 4DGNA 5C8NA 2YZAA 2FSTX 2J5FA 3R83A 4I21A 3LLAA 4BGQA 1H1WA 2GNLA 3UE4A 3ZM9A 2VWYA 3HUBA 1Y57A 1PJKA 1QMZA 5AP2A 1CKPA 2QOFA 3D83A 4EOOA 5FLFA 4PNKA 2UW0A 4U45A 4AGCA 4CNHA 1Q8YA 5AA8A 5IQCA 5GIOE 4QMPA 2C6IA 4O7VA 4TTHB 3F66A 5G1XA 4AA5A 2Z7QA 2UZOA 3WZKA 4KRCA 3NZ0A 4FEXA 4ANBA 2C1AA 2FB8A 3PY0A 3PWDA 2C6TA 3UPXA 1NVQA 2JDRA 4BBEA 3KC3A 4WRSA 5BVNA 3HMOA 4FSTA 3EQDA 2RFSA 3QCXA 4FTLA 4JQ8A 2QU5A 2UZEA 4NW6A 2UZLA 4QQTA 3OCTA 1IAJA 3MESA 2ITZA 4TPTA 5E1SA 3ZUVA 4E26A 3W0PA 5TKDA 3CY2A 3DGKA 4O7TA 5JRQA 3DKFA 3EQBA 3CD3A 1J7LA 5LMKA 1Y8YA 4MTAA 1Q8ZA 4K33A 2HK5A 3LVPA 4L3PA 3SV0A 4R5YA 3FLYA 4GEOA 4R7BA 4GT5A 1WBTA 1ZRZA 3D7TA 3IECA 4IJPA 2RF9A 4IB5A 4JIKA 2RIOA 3PSCA 5E8UA 3A7FA 3P7AA 2B7AA 2J4ZA 2P0CA 5AMNA 4C35A 2OJGA 2IN6A 2VX3A 3BGPA 3Q6WA 4A9YA 1P4FA 3R9NA 2YCFA 4N6YA 3UP2A 4A4OA 5HE0A 5JSMA 5LWNA 3QTIA 2GNIA 4WKQA 4CKJA 3QQLA 1WAKA 2Z8CA 3QALE 2ITUA 4CXAA 3KXHA 3DAEA 5LVPA 1Q61A 3NNWA 4YJRA 3E8NA 1F0QA 1GJOA 3CTJA 3EQIA 3HA6A 4H36A 4WUNA 4YC6A 5HVJA 3O8PA 4ZTQA 1FVRA 3CC6A 3T3UA 2W99B 3REPA 5C8KA 4K6ZA 4YC3A 1OPJA 4HNFA 3RAKA 2C0IA 3LPBA 1VYWA 2BILB 3MV5A 3R02A 4FIHA 4RX5A 4ZTLA 3TWJA 3NYNA 4FT3A 4S31A 3PYYA 2C6EA 3MA3A 4DGOA 5IG1A 1VJYA 1H1PA 4AOJA 4MQ2A 5DOSA 4S32A 3C13A 3NNVA 4QYGA 3BI6A 3LMIA 2JLDA 4H3PA 1YXTA 2XF0A 4FTRA 4JG6A 3VBVA 4GCJA 3VS2A 4AE6A 4RFZA 5LVMA 3W0SA 4FOCA 4QMLA 3EKNA 2XK3A 2OSCA 2KTYA 3BGQA 3O8UA 3OT3A 4A9RA 2XKEA 2W05A 1UNHA 4YSJA 2XK7A 3C4EA 5DG5A 2PVMA 5IISA 4XG9A 3KKVA 5CAOA 4AWIA 1Y6AA 2R3RA 4W4YA 4ZLZA 4XNEA 3BHTA 1YDSE 4FYNA 1KV1A 3UNZA 5J1VA 4ANSA 2PUUA 3E5AA 4WT6A 3I0QA 3EMGA 4XV2A 4FKSA 4LUEA 1Q3WA 4UYNA 3UDBA 2W1GA 1RDQE 3FSKA 4ACDA 2BRMA 1WBWA 1YHWA 1OPLA 2HYYA 1RJBA 1PXPA 4FK6A 1GZKA 2GQRA 4IAFA 3NGAA 4JAJA 4O0SA 5L6PA 4X2GA 2QG7A 3OROA 3KULA 4FV2A 5IA5A 2RG6A 4FNZA 2IW6A 4FTIA 3BE9A 5EQEA 3R63A 2XM9A 3D5WA 1Q5KA 1KWPA 5HGIA 4QYEA 5HD4A 5AV3A 2YABA 3BWFA 5EYKA 4G6NA 3RALA 4K0YA 4LV5A 4YZDA 5A9UA 2O5KA 3Q5IA 4Q9SA 4EH9A 3QQKA 1Y6BA 2YM8A 4GFGA 1VR2A 3FI2A 2WNTA 4IM3A 3PLSA 2BIKB 2YIRA 2VO3A 1H4LA 4FTMA 3DOGA 3BV3A 3NIEA 3V5LA 1SZMA 4QNAA 3QKMA 4C3RA 2YIYA 3EQCA 3KRRA 3MH1A 2O8YA 4BR3A 4FSUA 3F5PA 5T3QA 5C27A 4GMYA 3PE2A 3FY2A 3W10A 3FZRA 3P7BA 3VJOA 5E9EA 4CSVA 4J8NA 4LOOA 4BGGA 3C4WA 4I6QA 4IZAA 3R8PA 1FQ1B 2HWOA 4K9YA 4UWCA 3NRMA 3H3CA 4DGLC 3ORTA 4O7PA 4CMUA 3DV3A 4FKRA 5EHOA 4AXAA 2B53A 5A4CA 5LMBA 1AQ1A 4U81A 3MTLA 1YHVA 2DYLA 4L45A 3W0RA 2BFYA 4QTEA 1QPEA 2ZOQA 5HG7A 4FEWA 1IRKA 3VS7A 1YWRA 1XR1A 3D14A 2WIHA 4C02A 3QXPA 4JR7A 3W32A 4XV3A 1V0PA 3PG1A 5HBEA 2JEDA 3H0YA 3DAKA 3UZRA 3HA8A 2R3KA 3DK3A 2G2HA 1WZYA 1OUKA 3MW1A 4WG3A 4LV8A 3FZSA 4D1SA 3MFRA 4YJOA 2ETRA 4XG3A 1SVEA 4CFFA 3JVSA 4Y73A 2P2HA 2PPQA 4BCPA 4D4RA 5T6KA 4EORA 4GW8A 1H1RA 4M0ZA 3EOCA 5AM6A 3GC7A 5KUPA 3KL8A 3DXNA 2PSQA 3KB7A 2JBOA 4QYFA 3MVMA 3L8SA 3NLBA 3TTIA 4XHKB 1JPAA 2XEZA 4QMVA 1NW1A 4YJPA 2E9VA 1G3NA 1YW2A 1PXKA 4MXXA 3O23A 4UB7A 5HG8A 3TIZA 4ZOGA 1UWHA 2BCJA 1BYGA 3BYVA 3N4TA 2W5HA 3FMHA 4FKQA 3VWAA 4BDCA 4IVCA 4KBCA 2W4JA 3R7YA 3LCKA 5DT3A 5IQAA 3EFLA 4O0YA 3TKHA 5DYJA 3SQQA 1H0WA 4NFNA 5JQ8A 1U4DA 5EH0A 3Q04A 5AA9A 1NY3A 2X6EA 5LJJA 4KBAA 3LQ5A 4BCMA 4K11A 2C5NA 4WG5A 4QMQA 1L3RE 2CKOA 4U5JA 4ZJVA 4GUEA 5FP5A 5FXQA 4G5PA 1ZYSA 4V0GA 5KHXA 5BVEA 3WZEA 3SXSA 5EM7A 3A8WA 2ITOA 2BMCA 3DTWA 3KXZA 4O6LA 3R1QA 1KE5A 4I92A 5D10A 4K77A 1PW2A 2ERKA 3AC5A 5L8JA 2XRUA 3DBEA 3OMVA 3QBNA 5J9ZA 4W8EA 2UVYA 4RIYB 4D4VA 3ENMA 1BI7A 3E8CA 1GOLA 2HXQA 3A99A 3DDPA 4GRBA 1U54B 4X0MA 5A6NA 3FQEA 4XCUA 4LMUA 4W8DA 3CJGA 2QNJA 1DAWA 2C47A 3JVRA 3NAXA 1E1VA 2J51A 3QYZA 4FIFA 5CU4A 2CNVA 5AUWA 2YA9A 4FTOA 2QC6A 1GNGA 3B2TA 3W33A 2WEIA 3P79A 3HDMA 2GHMA 3P5KA 4FV6A 4YJVA 1CTPE 4C2WA 5A46A 3RPRA 5ETCA 4UX9A 4QOXA 3LMGA 1B39A 2PVFA 3IW4A 4BIEA 3MY0A 5T68A 3NDMA 2YJSA 2WMAA 5CQUA 4PMPA 1M2RA 5M4UA 5M4FA 2LGCA 3F7ZA 4BDIA 4C62A 3CGFA 4L46A 1WBOA 1M2QA 4DEHA 5LVNA 3TN8A 2EB2A 3U9CA 5AIRA 3W2PA 2GU8A 3ZXZA 5AUXA 3VUKA 2VN9A 2R3PA 4IFGA 4MXCA 4NSTA 3BELA 4PQNA 4CV9A 3QYWA 4L43A 4EOKA 5FD2A 3AT3A 3A61A 3I1AA 3OZ6A 4N70A 4R78A 5H8EA 3A62A 4FSRA 5F9EA 5C1QB 4O7ZA 4Z7HA 5AV0A 3LIJA 4EKLA 3NW6A 5GJFA 2VTJA 4O2PA 4AACA 4C0TA 2QLQA 3FV8A 1P14A 3BYSA 5M4IA 3OT8A 3QQJA 2X7OA 4UZHA 4H3BA 3N51A 3OXTA 3KXMA 4ANMA 4QP8A 4Q2AA 3HP5A 4R3PA 5C9CA 5J1WA 3ZFXA 4I93A 2PUIA 5E8WA 1MQ4A 3VRZA 2QOKA 1YDRE 4EOJA 2LAVA 5AP4A 4CVAA 5L2TA 4D1XA 4CRSA 4CD0A 3NYOA 3R8MA 3OCBA 3CQEA 3W2QA 4CFMA 4ZJIA 3ORXA 1K3AA 3R9DA 4FKLA 4D2RA 5M53A 3O0GA 3KF4A 1YQJA 5KO1A 3EN7A 4O7SA 4YO6A 5EKNA 2HELA 4OLIA 1ND4A 4WNPA 5HIBA 4EC9A 4IC8A 3PLAE 2V55A 4QNYA 5DPVA 4AZEA 5FTGA 3PFQA 4FTKA 3RCJA 3DFAA 4G2FA 2R3LA 2VV9A 3MH3A 5HORA 5BVWA 2OJIA 1YRPA 1UKHA 2PZRA 5EQYA 1REJA 5ACBC 5HQ0A 4PP7A 2XP2A 3CTHA 2ETKA 2VWUA 2ZDTA 2X81A 4FKUA 4FSZA 2QOCA 2OI4X 4FR4A 4XEYA 2C6DA 3FI8A 3MH0A 3EZRA 5LVOA 3QHWA 5HE3A 1M2PA 4X21A 4DEIA 1ZYCA 5EI8A 4YHTA 4BGHA 3B8RA 4ZJJA 4NIFB 4MNEA 5C4LA 4EH7A 3COKA 3FZPA 1TKIA 4PTCA 5AUUA 4DAWA 2X0GA 5IQEA 2QURA 4Y85A 3HRBA 1URCA 2QODA 4X3FA 3TUBA 5AP0A 4EH5A 2UZVA 4IE9A 4LG4A 3K54A 4M13A 3OVVA 4GU9A 3NMUF 1JSVA 4KKEA 3RZBA 4UN0C 5D1JA 5H2UA 3FHRA 5GJDA 3BBTB 4FV9A 4EZ7A 4FV0A 4J97A 3ORPA 3PXFA 4H39A 2FUMA 3O2MA 1A48A 3NIZA 3QF9A 4FVQA 3CSVA 4GVAA 4CKRA 3OUKA 1ZOGA 3QWKA 1BL7A 4A4LA 5HD7A 4P7EA 2IVVA 2AYPA 4DEEA 3N9XA 4L3LA 4E4XA 3KGAA 3WYXA 3FI3A 5ITAA 3RGFA 3QLGA 4YTCA 4OGRA 1S9JA 5HTCA 5ACKA 5FGKA 4CFUA 3CPCA 4YURA 2YM6A 5HLWA 1WBNA 2P33A 3Q32A 5EW3A 4QP4A 3FXXA 3UNJA 5L6OA 3LQ8A 4F1MA 3OTVA 3TJCA 3R8VA 2E2BA 2PMOX 3UO4A 3AG9A 3JUHA 4O2ZA 2JFLA 5CZIA 4LGGA 4OTHA 3Q9WA 1XO2B 3U6JA 4E5WA 3E64A 3IQ7A 3TM0A 5HX8A 5GNKA 2ITQA 4CKIA 5CTPA 4W4WA 2A4LA 3W2CA 4DG3E 2PMNX 3R6XA 4U8ZA 2PE0A 3U4UA 3W2RA 4N57A 5HHWA 4AT3A 4H3QA 3D7ZA 4AX8A 2XKDA 3TJDA 4FKTA 4PTEA 3IPHA 5LMAA 3KCKA 4IAZA 3LQ3A 4YNOA 5M56A 3WF7A 4A9UA 4GFMA 4FIIA 3UMXA 4BDBA 4MVFA 3QQUA 3LFDA 5LQFA 3HUCA 3PVUA 5AUZA 5BQ0A 3U9NA 5K5XA 3FE3A 3OP5A 5JGDA 3AC3A 4EUUA 5AP5A 3SD0A 3C4ZA 4FV4A 3FY0A 3DBFA 4KBKA 3E87A 1UNGA 5CVFA 4EH4A 5KZIA 2I40A 3KCFA 3LLTA 3QA0A 4AQCA 3BZ3A 4O91A 5HBJA 1J1CA 3L9MA 3BHYA 1XWSA 2C5OA 3LFAA 1DI9A 5KKRB 4KKHA 4APPA 3FAAA 4YLKA 1BL6A 1OZ1A 1PF8A 4KINA 5D9HA 4XOYA 3BLRA 5CU6A 2X8EA 3VS5A 3QXOA 1H1QA 1V0BA 2OF2A 5CY3A 3I6WA 5FEEA 3LCDA 4CTBA 4J52A 4CZUA 2J0JA 4TNDA 3TZ7A 1AD5A 1VZOA 3HAMA 5D12A 4CMTA 2E9UA 4GKHA 3VW6A 4KRDA 3UYTA 4ZTNA 4B99A 4FKWA 3KA0A 4DLJA 3ZS5A 2YITA 3PPZA 4YZ9A 3RNIA 2VX1A 3VHEA 5KMKA 3F5UA 2Y9QA 3OCSA 1DS5A 1RW8A 4KWPA 5HESA 2QOQA 2NRYA 2QG5A 4FG8A 3T3VA 3TTJA 4C59A 2ZV7A 1ZLTA 4RIWB 4TRLA 3HYHA 5CEOA 4A7CA 2YDKA 3O50A 4WNMA 4BN1A 5CAQA 3HKOA 4C4IA 4UXLA 3ZLSA 4C58A 4E20A 4RFMA 3I79A 5IEVA 1UU8A 1APME 4X6QC 2UW4A 3PP1A 5J7HA 4B4LA 1T45A 3RI1A 3OFMA 1M7NA 3JY0A 2UUEA 3FKOA 3NS9A 4GK4A 2UVXA 4AZFA 1P4OA 1R39A 5M55A 5DNRA 4A07A 4YHFA 1OUYA 3OG7A 3W8QA 2W1DA 3GC0A 1FVVA 3V5WA 3GNIB 4XRJA 2RFDA 4JS8A 1YOMA 3HAVA 2JIUA 5AADA 3TACA 3QRUA 2XNBA 3KRWA 5A4TA 4QP9A 1YXXA 4LOPA 4ZSJA 1LEWA 1R0EA 4YSMA 4DBXA 3Q9YA 1JBPE 4DTBA 3ORIA 4RX9A 2C6MA 2IZUA 4YLLA 3I7BA 5HVKA 3QTXA 3ALNA 3FZOA 3ZUTA 2WQNA 5I5ZA 4FKJA 3FYJX 4F0IA 3HMPA 3QHRA 2HW6A 4YJQA 3F3VA 2W5BA 2XIZA 4NW5A 2CCHA 3MPTA 3CPBA 3DKCA 2IVSA 4PL5A 3ATSA 5DH3A 2IO6A 5AV2A 3ZO2A 3W0MA 1XH7A 2WZJA 1PXLA 3R01A 3V8TA 1Q99A 3DQXA 3H9RA 2R3MA 3KK8A 4YPSA 2RFNA 4FL1A 2WTVA 4BBMA 4DFXE 3NW7A 2C5XA 2YCSA 1PY5A 2H96A 2VO0A 4P5ZA 4CFNA 3ZH8A 4PY1A 4HZSA 4U9AA 5M51A 1OKWA 4XV1A 5JFSA 2EWAA 2QD9A 4DITA 2PVJA 2B52A 4X2KA 4XG7A 2PVNA 2UW7A 3NAYA 3O96A 1ZOEA 3PIYA 4IZ7A 2W1FA 4KSQA 3TNQB 4BDDA 3DBDA 3A7JA 3PA5A 3ITZA 5HI2A 3UQGA 5TR6A 3PIZA 4EONA 1W98A 3BU3A 3GBZA 3U6HA 4PDPA 3QGWA 4M12A 5JRSA 4WSYA 2BAJA 2ZAZA 4IX5A 3G0EA 3D5VA 4MYGA 2HCKA 3RVGA 4DFYA 1OKZA 4JG7A 4KAOA 4IDTA 2YJRA 3IOKA 2QO9A 2BAKA 4DC2A 2XB7A 3WOWA 1PXJA 4ID7A 3R22A 2G2IA 2GFSA 2W9ZB 5G6VA 2IWIA 3G6HA 2AC3A 1MQBA 4YPDA 1HOWA 3AQVA 3EIDA 2JGZA 3ERKA 3RP9A 3NYXA 4JX7A 4IVDA 2GS2A 2YWPA 3HDNA 3ET7A 4FZFB 1WCCA 4IIRA 4LQMA 3VS6A 3ID6C 4FVRA 2R3JA 4F70A 3QX4A 2I7QA 4YTFA 4EQUA 5ANKA 5CU0A 2FYSA 2R3QA 3PJ2A 1CMKE 1KUTA 3MVJA 3ZONA 5JQ5A 2OG8A 4WZYA 5ETFA 1BUHA 3MTFA 3TKIA 3TNPC 3FHIA 3KRXA 3OHTA 1B38A 2BROA 5HG9A 3R8LA 4YR8A 5IA4A 2QKWB 1LR4A 2CLXA 3BPRA 4I0RA 4TYIA 3RK9A 3GQLA 4BHNA 2WTCA 3DCVA 4DHFA 4HVHA 2W9FB 5CF4A 2XK9A 2BUJA 4OTRA 5ANOA 4J96A 3ZSIA 5AP7A 5IH6A 4JBVA 5KZ0A 3EYGA 4AW2A 3SRVB 4Y5QA 5AIKA 3UVPA 2E9NA 3D5UA 3ZLXA 3GENA 3PXRA 2OFUA 1H25A 4LRKA 4ASZA 4V0GB 3ZHPC 3F2NA 4IX4A 3KFAA 1SM2A 3HV6A 1YI4A 3HVCA 4FNXA 4XBUA 3A60A 4ASEA 3V5TA 3M1SA 3DNDA 3ZYAA 4LL5A 5FXRA 2CGVA 2JDVA 2Y8OA 4RJ3A 2WMXA 3I5NA 1WFCA 5CASA 2BKKA 3MWUA 5CLPA 4F9BA 4R77A 2XM8A 3VHKA 3NEWA 3G0FA 5CI6A 4FG7A 3V6RA 4AE9A 2R7BA 3P23A 4F09A 5IDPA 3NUNA 2Y6MA 3OXZA 3EQPA 1M17A 1JSTA 1W84A 3UG1A 2E9PA 1OL2A 4FTNA 4GL9A 4I6BA 1S9IA 4S34A 4F6UA 3MJ2A 3P78A 4HPUE 4XJ0A 4C37A 4U6RA 3FEGA 3CTQA 3C50A 2UV2A 5KCVA 2ITVA 3MBLA 2C6LA 2ZVAA 4F7JA 4D1ZA 2VAGA 2A1AB 3EQHA 4O0XA 4TWOA 3A4OX 2XJ1A 3DK6A 4RJ4A 3LJ2A 4MAOA 3SGCA 5M09A 4FKVA 2C1BA 4CFXA 1FMOE 2QLUA 5DRDA 4BCKA 4QMTA 3C4FA 3OY1A 5EOBA 3LAUA 1Q8TA 2X8DA 4XMOA 4ZZNA 1U59A 5DRBA 3UNKA 5DEYA 2QKRA 2A2AA 2XVDA 4CG8A 3VF9A 2YM7A 4ERKA 5CT0A 4O22A 2UW5A 2JDTA 5M4CA 3VJNA 3TYKA 4YZBA 3LCTA 4QP1A 3LFQA 1Q4LA 2HY81 5DGZA 2CMWA 1IA8A 3HX4A 2XJ0A 4NFMA 3R7EA 5KNJA 3F7WA 1GIIA 4KD1A 5FBNC 2OJ9A 2HENA 4ZIMA 3TV7A 1YXSA 1M52A 2FA2A 4C34A 2RFEA 2Y7JA 3OS3A 3COIA 4EH6A 3R7IA 3MI9A 4DA5A 3E62A 3EQFA 3PY1A 4CT1A 2SRCA 5E4HA 3SDJA 4MXZA 4V04A 3ULIA 2J6MA 4TW9A 4C4FA 4TYGA 4AZTA 3D5XA 5AP3A 2XH5A 4C36A 4GH2A 3KVXA 1XH8A 2BZHB 3DTCA 5M57A 3Q9ZA 4XG6A 1JQHA 4Q5EA 3WIKA 5C03A 2W1HA 3G9NA 2Z7SA 4TYHA 4GSBA 4G16A 4XG2A 2WQBA 3EWHA 4FTAA 3ZLYA 2OIBA 3QD3A 3TXOA 3TUCA 3WF8A 3QLFA 2IW8A 3V5QA 4BHZA 3H10A 3QRJA 4RZWA 4JX3A 5IEXA 4AGWA 4AGDA 4U40A 1KOAA 1JKKA 4NM0A 4OT6A 2HAKA 3VQUA 2Z02A 4FUYA 2XK6A 1P2AA 3UC3A 3WARA 4Y95A 5K4IA 3VS3A 4YMJA 2EB3A 5LXMA 3NCZA 2BRHA 2XJ2A 2CKPA 4D4YA 5JKGA 4C33A 5IH5A 3ORLA 5IQHA 5E90A 3RHKA 4EQMA 2R0IA 1J91A 4BDGA 3FDNA 2BPMA 3L8XA 3CY3A 1PKDA 3PSBA 3UVQA 2W4KA 3MDYA 2JDSA 3D2KA 4WUAA 2XNOA 4ZZOA 4OUCA 3DKGA 3LE6A 4X3FB 2B9HA 2C68A 1Q8UA 4RVLA 3Q4TA 4X2FA 4F9WA 3ACJA 4XRLA 3MVHA 5IQGA 4FSQA 1O6YA 4QTBA 5A6OA 2CN5A 2XZSA 5BYZA 4PMSA 1H01A 4FV5A 4KS8A 2XNGA 2WIPA 3MH2A 4F7SA 1LUFA 2ZMDA 2JIVA 4EK3A 4ALUA 3EL8A 3BHHA 4FV1A 2OWBA 3KMWA 4DH1A 3OF0A 4BCFA 3DNEA 2GNHA 2J9MA 3BX5A 4Y72A 2ZB1A 4YO4A 3F6XA 4NJDA 2CKQA 2XIRA 3SG9A 4Z9LA 3BRBA 5E1EA 3U55A 2F9GA 1NA7A 4PF4A 3W0NA 4WOVA 1ZYJA 4HYHA 4U0IA 2PZ5A 3DKOA 4E5AX 4PMMA 4FEVA 3H9OA 4W4XA 3ZSGA 4IX3A 2UW6A 1PMUA 2PMLX 2PVYA 4M69B 4WNOA 2PL0A 2QOBA 1OL5A 3QTZA 4BZOA 5J9LA 4UZDA 5CU3A 3R8UA 4RVKA 1CDKA 1ZMUA 2CDZA 2QQ7A 3OBGA 5A4QA 4YP8A 2WMUA 5HCZA 4C38A 4NKSA 3KF7A 1RQQA 2R3OA 3R2YA 3TI1A 4MWHA 2ESMA 3DLZA 4U80A 4GFOA 4F9AA 4YGAA 1JVPP 2WMBA 3Q52A 2QI8A 4PP9A 4GT3A 4TYEA 2QHMA 3NX8A 2G1TA 2V5QA 3CKXA 1MUOA 3PSDA 4FK3A 4EOQA 3QFVA 2BFXA 4Y46A 3L9NA 3VF8A 5CU2A 2WQOA 3MN3A 2J7TA 5IUGA 3FQSA 4MX9A 1R1WA 4N0SA 4MBIA 3P0MA 4HGSA 4BDJA 3OUNB 5CEMA 3NNUA 5HBHA 3QCSA 3PDTA 3R1YA 3PTGA 3FKNA 4XG8A 5F20A 3MVLA 3C0HA 4D9UA 4NYEA 3BEAA 2V7OA 2VTRA 5BVDA 2GFCA 2CGUA 5E92A 4PV0A 3DFCB 4L01A 3MSSA 3E92A 3H4JA 4YHJA 1URWA 5D7VA 2VTPA 3UG2A 4P90A 3VNTA 1YI3A 2OJJA 2YIWA 3CP9A 2C0TA 3DPKA 3FQHA 3GU7A 3N4UA 4DFLA 3VS0A 2I0HA 4X6RA 4BTMA 2WU6A 3ZBFA 3C7QA 3JR1A 4FT7A 5IMXA 1SYKA 3FL4A 3KN6A 3QKKA 4L6QA 4AT5A 3UO5A 4OR5A 5CI7A 4JBQA 2Z60A 1OL6A 2H9VA 3RINA 3DJ5A 1ZZLA 4YUQA 4BICA 2Y4PA 3E93A 4HNIA 5L8KA 2W5AA 4XH6A 5JMSA 3U51A 5I9UA 5CVGA 3PVWA 4LFIA 4QPAA 3SVVA 1KOBA 4LL0A 2W06A 1H1SA 4U7ZA 3MB6A 4B7TA 4EK6A 4MBLA 3P08A 2ONLC 2WTDA 4RIXB 2WO6A 2Q83A 5B0XA 5ANIA 3BCEA 4BC6A 1VEBA 1XBCA 3COMA 3I81A 3LFNA 4LGHA 4O0UA 5LVLA 2VWZA 1T46A 5JN2A 4GJ2A 3ZO4A 3R71A 2F7EE 2OXDA 2BDJA 1XH9A 2IJMA 1Y8GA 4AA0A 3ULZA 4ZTMA 1NT2A 5EDPA 4J53A 3PE1A 4L00A 2PU8A 4L9IA 2AC5A 5BVKA 2GDOA 3L8PA 4CV8A 5FXSA 4EOPA 1FMKA 5CVHA 4E6DA 5I4NA 2C3JA 4I5MA 2QOOA 4QYHA 5HICA 3M11A 5EKOA 2JITA 2YN8A 1WBSA 4O82A 4BYIA 3BKBA 5IUHA 2IZTA 4DF3A 2OXYA 4A9SA 2Z7RA 3BGZA 3GVUA 4IFCA 3VBXA 4F64A 3PRIA 2ZV8A 4EUTA 1IAHA 3W0QA 1A9UA 2DQ7X 4MXYA 4JL9A 2YFXA 2IG7A 3PXQA 3FXZA 3SA0A 5CEPA 5DFPA 4EI4A 2VZ6A 4NM3A 3C5IA 4JRVA 3UMWA 4E4MA 4B8MA 3UOJA 4BI0A 4I4EA 4R3CA 5L2WA 3CD8A 4CCBA 3K3JA 4BB4A 1K2PA 4TXCA 4EHZA 1NXKA 4NM5A 1FINA 3MY5A 1YVJA 4YNEA 3IW8A 3F82A 1OB3A 3QQHA 3BHVA 2HXLA 3EN6A 3LKMA 5CSXA 2A0CX 3HGKA 3KXNA 3ZRLA 3TNIA 1U46A 4V01A 4QMMA 3KXGA 2Y4IB 3F69A 4XP2A 4O7OA 2OIDA 3S1HA 3HNGA 5J87A 5B7VA 1SVHA 4E6QA 1LPUA 3BIZA 4GV1A 2NP8A 3F61A 3AC1A 2R4BA 4EZ5A 2XS0A 3RM6A 3JXWA 2RG5A 3Q5ZA 3MPMA 1ZMVA 3R21A 5C01A 4A06A 5E8ZA 2ZM4A 4QQ5A 4HZRA 2YZLA 3ZRMA 3RHXA 4BCNA 3DXPA 3ZC5A 4EWQA 2VUWA 3BQRA 3SAYA 2WU7A 3RWQA 4QT1A 5IA1A 1O9UA 4QO9A 5D7AA 5EYCA 3ZCLA 3F88A 4A9TA 3M42A 3GGFA 3AD4A 2OZAA 1NVSA 4U42A 2WMVA 2GNJA 3BHUA 2OW3A 3QQFA 4QMWA 3A8XA 3EFWA 3GQIA 4HVIA 3R73A 4AF3A 4B8LA 3NUXA 4NWMA 4WO5A 5IU2A 4YZCA 3UIMA 5JT2A 2PULA 4L7FA 4BZDA 2OIQA 5K5NA 1IR3A 1TQPA 4D5HA 1XH4A 3ZOSA 4G3CA 4UXQA 1OL1A 2Y0AA 3UOLA 2WTKB 3G5DA 3VUIA 5KMMA 4JBPA 5KX8A 3QUDA 2WMQA 3GU8A 4BDAA 2Z7LA 3HMNA 3TCPA 3EHAA 3ELJA 4FKGA 5FRIA 5HO8A 3WYYA 3NPCA 4JQEA 4MK0A 3D9VA 4EHEA 3K2LA 3UC4A 3WBLA 5DA3A 2A27A 4MWIA 3QCYA 4CFVA 1BX6A 4DFBA 3Q9XA 4P2KA 2C0OA 4RA4A 3QZFA 1YWNA 2OU7A 4Y83A 2OZOA 4O0WA 3RWPA 4FOBA 3W1FA 1JKTA 1BI8A 1WMKA 2FSMX 2W1ZA 1V0OA 3AMBA 4RSSA 5CSHA 1JSUA 1VYZA 4ZP5A 1V1KA 4EOLA 5IA2A 3PY3A 5L8LA 4ALVA 2WOTA 2BR1A 3FWQA 4S33A 4K1BA 3ZMMA 4L3JA 2VTSA 2YAAA 3A7HA 3NUYA 4IACA 4EBVA 3ALOA 3HMIA 2J0KA 4JVGA 4ZLOA 4EEVA 4MQ1A 5GIPE 4YZNA 1JOWB 4E7WA 4AP7A 3GCQA 3ACKA 3AC4A 3BEGA 3RK5A 1H0VA 4O7LA 3THBA 4MBJA 4RGJA 2C6OA 2CJMA 3GU4A 2WMWA 4O96A 2VO6A 2X2KA 5J8IA 4E4LA 2VGOA 4L7SA 5CALA 5IQFA 1UKIA 4O0RA 4KUJA 3IKAA 4OBPA 5D11A 3QTWA 1ZWSA 3WI6A 2P4IA 5TO8A 3GFEA 3BYUA 1Q3DA 2V7AA 4OTIA 3FMDA 4DEDA 3V6SA 1KSWA 3VW8A 3ZU7A 4DEGA 4O21A 3DT1A 3LXLA 2RKUA 2VTTA 4HGEA 3S4QA 3QD0A 3U4WA 2EXMA 4XOZA 2VTHA 3KK9A 3PZHA 4L44A 3LXKA 5H8BA 5TT7A 2JD5A 2HWPA 4ENXA 5IPJA 4RLLA 4ONAA 3LXNA 3NWWA 3I6UA 3NUSA 3QZHA 4M97A 2OH0E 3NUUA 5E8XA 3QCQA 5EW9A 4FKIA 3SW4A 3VUDA 4CGAA 5LWMA 2X9FA 3KEXA 1CKJA 1W83A 5KMLA 4QMOA 4ANLA 3PA4A 4M68A 4D0XA 1ERKA 2FH9A 3D7TB 4RQVA 4IM0A 5HZNA 3A7IA 5AUVA 2P3GX 3V01A 4BTJA 3F9NA 2YISA 4PNIA 3OY3A 2GHGA 4AU8A 3R8ZA 4O0TA 4RC4A 2ZB0A 2YAKA 2CNUA 1X8BA 5AX3A 4ZY5A 1HCLA 4RX8A 3JYAA 1MRYA 3O51A 3R9HA 5KBRA 4GIIA 5AAEA 3R28A 1SNXA 3IW5A 4USFA 3C4CA 4J71A 3A4PA 1Q41A 2OXXA 5F94A 3QD4A 4L52A 3GCVA 4EKKA 2Q0BA 2PZIA 4RIOA 3MB7A 3RJCA 4IB1A 2J90A 1Z9XA 4LRMA 2UZWE 3FLNC 2WMRA 5E8SA 3KREA 4FKOA 2X2MA 2ERZE 3G6GA 5IZFA 5ETIA 4ACHA 5GJGA 2W1CA 4NJ3A 5E8TA 5HLPA 3FLSA 4E8AA 1XH6A 4WHZA 2ZV2A 3UODA 1AGWA 5IQIA 4WRGA 5HLNA 5CAUA 2VRXA 2DWBA 3HRFA 3EH9A 1UWJA 3U87A 4EOIA 2GMXA 4ZSLA 1UVRA 3R9OA 2VGPA 2V0DA 3OXIA 3BBWA 3VRYA 4PL3A 3OBJA 5I9XA 4D58A 4MXAA 4RWKA 4FT9A 2ZM3A 5EM6A 4NM7A 4L42A 3QL8A 4YJNA 4ZK5A 2QHNA 2YCQA 3BWJA 4I20A 3WZDA 4CTCA 5AEPA 3AC8A 4R7HA 2F2UA 1J1BA 3ZUUA 5A54A 4EYMA 2PE1A 4KB8A 2QU6A 1OGUA 4ITJA 4ARKA 3HV4A 2VWVA 2JC6A 3QTQA 1TQIA 1DM2A 3RPOA 4BZNA 4N6ZA 4UALA 1BMKA 2IPXA 3FKLA 2FSOX 2YM4A 3P1AA 2JDOA 2ZM1A 1QPJA 1YXVA 2PK9A 3ORMA 3Q53A 4O7RA 4IM2A 1IG1A 4O86A 4EBWA 4I22A 5DVRA 4CG9A 2BKZA 2WB8A 4U44A 5BVFA 3WF6A 2QOIA 3WZJA 3PJCA 1OM1A 1W0XC 3BE2A 2R3HA 4R5SA 4F6WA 3QD2B 2R0UA 4DEBA 3KULB 2XIKA 2VU3A 4IJ9A 1A06A 1E9HA 4PDOA 4X2NA 4DH3A 4E73A 1XHAA 5DI1A 3C0GA 1CKIA 2FVDA 2YIXA 3FMMA 3F3UA 1PYXA 1ZXEA 4AT4A 2G9XA 5F4NA 3TZ9A 4I6HA 3C4XA 1SMHA 3RCDA 4BBFA 4F9CA 4ZZMA 2JIIA 2OLCA 1PXIA 1U54A 5J95A 1KE8A 2G2FA 2ITPA 5FUTA 5KKRC 2RL5A 4OTQA 4AG8A 2WTJA 1MRVA 3JS2A 4D28A 4D0WA 2WMTA 3HLLA 4DG2E 5HCYA 5JK3A 3PXZA 3VIDA 1H00A 4E6AA 3GC9A 3R1NA 4L68A 4XBRA 5EK7A 4XLIA 2CSNA 4GJ3A 5AUTA 1Q62A 3IDBA 3KRJA 3VBYA 3PVGA 3NNXA 4DCAA 2QR8A 4MH7A 3TEIA 2CNQA 2CN8A 5BX0A 3EN5A 5KMJA 2PZYA 3T9TA 3R04A 3CR0A 1PXNA 1XH5A 3BLQA 3QC4A 4BDEA 1UA2A 3K5UA 3NSZA 4HGTA 3ETAA 2ITTA 4H58A 3PJ3A 3RAIA 4ZY4A 4IC7A 2IW9A 4FT0A 2OK1A 4F0GA 4H1JA 4FTJA 2GPHA 3IDPA 4BDFA 4EH2A 2J2IB 4EWHA 2X39A 5BYYA 5JFWA 2X2LA 3BLHA 3DK7A 5FEDA 3SXFA 3Q4UA 5D41A 5CAPA 5BMMA 2BZKB 3DXQA 3MIYA 3PWYA 5EQPA 4ANQA 2YWVA 4LI5A 3UP7A 4IMYA 4ACGA 4BDHA 1I09A 4PX6A 5EDQA 3ZO3A 3FJQE 3SW7A 2B0QA 1FGIA 4RG0A 4F99A 5DN3A 1ZYDA 1GZNA 3C9WA 4TWPA 3VVHA 4FI1A 5BPYA 5CSWA 5DBXA 4O27B 2BALA 3Q2JA 3Q4ZA 3G51A 3NW5A 5DR6A 4J8MA 4DFUA 2OKRA 4ITIA 3LCOA 1P5EA 2PHKA 2QCSA 3EL7A 4FYOA 1YOLA 4IWOA 3HMMA 2VWBA 5IEYA 3O17A 3P4KA 5F95A 2EXCX 4RX7A 4GG5A 2O63A 4IAKA 5HNBA 4XS2A 3NR9A 2BDFA 2GS6A 4CLIA 2UZUE 3CGOA 2XCHA 4DGGA 5HKMA 3EQRA 2PYWA 5ANGA 2WGJA 5ANJA 5JZJA 4JNWA 2YHVA 3C51A 4JG8A 3UOKA 2XNNA 5AAFA 5C4KA 3I7CA 2FSLX 2VWXA 2BAQA 4O0VA 2BHEA 3DJ7A 3KXXA 4XV9A 5DLSA 2QOHA 4FC0A 4QMXA 4DGMA 2BRGA 3B2WA 3C0IA 4G34A 2OJFE 3ZRKA 4IEBA 5BUIA 5AP1A 2C5VA 3LOKA 4RA5A 5HIDA 1PXMA 3QUEA 4HVGA 4ITHA 5GINE 4RVMA 1UV5A 1J7IA 1JKSA 5KMNA 3IOPA 3CQWA 3V5JA 5I9ZA 4OTFA 4RWJA 2H34A 4BTFA 4IBMA 3HECA 4I3ZA 2GQGA 3QTSA 1FBNA 4M3QA 3EN9A 2G01A 4MEDA 3U6IA 2NRUA 3IW7A 1WBVA 4MNFA 4O38A 4ERWA 1JLUE 3TDVA 2C5YA 2VTOA 2OBJA 1OVEA 4RPVA 4TY1A 4G6OA 3VAPA 4B0GA 2W1IA 4FTQA 2R64A 5ANDA 5L6WL 4FNYA 4NUSA 4I5HA 1SNUA 1YI6A 3FLWA 3L1SA 4NTSA 3UGCA 3EZVA 4U97A 3WE4A 2O3PA 5KMOA 4FX3A 4KS7A 4O7YA 3WILA 4I41A 4EK5A 4QMNA 3D15A 4IH8A 4KIPA 2F49A 4ZEGA 2I0YA 2YCRA 3MYGA 3W55A 1UU9A 2PZPA 3MFSA 4RWIA 1Q24A 3TNWA 2XIYA 4X3JA 5CQWA 5DT4A 4A4XA 4FODA 2IZSA 2VTNA 5DIAA 3BV2A 3D94A 3E7VA 3ODYX 3KVWA 3ANQA 4GK3A 2BZIB 1B6CB 4JDHA 2W7XA 2UW8A 3CLYA 1GIHA 2I0EA 5HU9A 2WPAA 3E7OA 4H1MA 3FZ1A 3RPYA 2BVAA 3MFTA 4BIDA 4M7IA 5A4LA 3WZUA 3LFFA 4QTAA 4HCTA 4HCVA 3UZPA 2DUVA 4NCTC 5FBOA 4BDKA 3QRTA 3FI4A 2E9OA 2J5EA 2ETMA 3GFWA 3LW0A 1PMNA 3LZBA 3MA6A 5HTBA 4DE4A 1BKXA 4OBOA 2C6KA 3TL8A 4JI9A 3P9JA 4ZXTA 4RFYA 3FUPA 4P4CA 2OH4A 3TIYA 3HRCA 5HE1A 1YHSA 2OZAB 1OIUA 2R3FA 2X7GA 4D4SA 4G6LA 4ACMA 4II5A 4AZWA 4I0TA 4EOMA 3D4QA 4F63A 1ZY4A 5HIEA 5HCXA 5M08A 5I9YA 5JEBA 2YM5A 2ITNA 3F5XA 4RWLA 4ZY6A 4I0SA 2REIA 1OIRA 3FC1X 4Q5HA 4DH5A 1IEPA 3VS4A 1MRUA 3UBDA 3VUMA 2UW9A 4EHVA 2WQEA 4CT2A 3IO7A 2CKEA 2WAJA 2C69A 1E1XA 3ZZEA 1PMEA 1PXOA 4H05A 2VNWA 1PHKA 5LARA 3W16A 4BTKA 1F3MC 4MNEB 1JWHA 2ZDUA 1UU7A 5E8VA 4IADA 2XMYA 1WBPA 4AOTA 3FMJA 5FP6A 3R7VA 2AUHA 2QVSE 2VTAA 4BF2A 3WE8A 4CMOA 4UV0A 2HZNA 4RRVA 2BHHA 3C1XA 2B55A 3LFCA 3A2CA 4M15A 2ITYA 2VTLA 4NKAA 4I94A 4XLVA 4F08A 3MS9A 3TNHA 3CCNA 2QR7A 3PRFA 4UYAA 5KE0A 3N4VA 3V5PA 2OGVA 3PZEA 3R7UA 3GU5A 5CAVA 4DBNA 3EJ1A 3W2SA 4QP6A 2PVLA 4J98A 4RIWA 3QWJA 2XYUA 4M14A 4Y5HA 3VN9A 4IZ5A 2XK8A 5CEIA 2VTMA 4U43A 2GS7A 3GOPA 2XK4A 3CBLA 3PJ8A 5AX9A 4YLJA 4UBAA 4IB0A 4AN3A 5LCJA 2XYNA 3EQGA 3PPJA 4OW8A 5TOZA 3VULA 4HJOA 2O0UA 4WIHA 3R00A 2JKMA 2GCDA 5CWZA 4FIGA 5FG8A 3SKCA 4L67A 4QP7A 4AUAA 3IW6A 1XJDA 5EOLA 5DR9A 1ZZ2A 1XBBA 2R9SA 2YACA 5EW8A 5IH4A 2R3NA 3DB6A 5FTQA 1XQZA 4HYUA 4AW5A 2WHBA 1OIYA 4I5PA 4QMSA 5FM3A 3UQCA 2EUFB 4IWDA 2NNWB 2H8HA 4IVAA 5DT0A 4FKPA 3T8OA 4FSNA 2Z2WA 3KMUA 4FGRA 1LP4A 1GIJA 2W0JA 3DDQA 2G15A 4AZSA 3G90X 3GB2A 3LM0A 4FZDB 2ITXA 4WD5A 4YC8A 2PE2A 1Y91A 3GEQA 5FM2A 3VBWA 3R2BA 2V22A 3QKLA 5E7RA 5CNNA 3S00A 4XX9A 4RC3A 2X4FA 3BYOA 5JH6A 2OICA 4DINA 4DFZE 3TV6A 4P5QA 4BI2A 4JIAA 5DHJA 3ZC6A 1OIQA 4QTCA 4IVBA 2PUNA 2NO3A 2JAVA 5HG5A 5EHYA 1FPUA 4OTWA 3I5ZA 3RPSA 4GG7A 4X3FC 4EH8A 3UZTA 2YM3A 4YJTA 3VQHA 2R5TA 3FZTA 2BZJA 3DB8A 4FV8A 5JGBA 5CSVA 5CANA 2WEVA 4IHPA 1UU3A 3DU8A 3UTOA 1OI9A 2X8IA 3OWPA 4XYFA 4OBQA 3MGYA 1H27A 3QRIA 3MY1A 4C61A 2UW3A 2F7ZE 2KULA 3KRLA 2NPQA 4FZ7A 4G1WA 3G9LX 4X2JA 2BDWA 4PL4A 3SHEA 4YU2A 3PIXA 4XP3A 5EM5A 1XKKA 5EDRA 3CXWA 2YEXA 4KKGA 3KY2A 3PPKA 2BRBA 4F7LA 4KSPA 4LRJA 4JDKA 3FMNA 3LJ1A 4I23A 4F7NA 2OO8X 4GK2A 3W18A 5AV4A 3M2WA 5I0BA 2F7XE 3WIGA 3HP2A 4CEGA 3GCSA 2J50A 2B9IA 3F3WA 4TN6A 5E8YA 2X1NA 4PUZA 1Z5MA 1I44A 4FBXA 1U5QA 4O7WA 2VNYA 2PWLA 2JAMA 1H08A 3H9FA 4FUXA 2XCKA 3EB0A 4RQKA 3U8WA 4BCIA 1H8FA 2B54A 4F4PA 4RC2A 3FYKX 3LHJA 4DG0E 3V8WA 4Z16A 5CX9A 2C4GA 4AW0A 3ZEPA 1WVWA 2YDIA 3OW3A 3O8TA 3QX2A 4GS6A 1H07A 3NUPA 3BYMA 1QL6A 2X9EA 3DA6A 1Z57A 4KA3A 5LCKA 2F4JA 4EQCA 4FICA 4YJSA 4FV3A 1R0PA 3W2OA 4AW1A 1O6KA 4NCTA 4IWQA 3P86A 4LM5A 4AFEA 4DT9A 3KU2A 3V8SA 4ZAUA 2YERA 3SRVA 5H8GA 2UVZA 4LOQA 4ZS4A 3RKBA 5EYMA 4YTIA 1GY3A 5AAGA 1IA9A 2WD1A 5A14A 2W96B 2UZTA
chains in the Genus database with same CATH superfamily
4PTGA 4BVUA 4JQ7A 2HW7A 2QOLA 3IDCA 3POZA 4IW0A 4BIBA 4AN9A 1BLXA 1Q97A 2O65A 3RPVA 4F1OA 2A19B 3GT8A 1KE7A 4FGBA 4B6LA 2B4SB 3UIXA 3EFKA 3ROYA 2XNEA 2PVRA 1OPKA 3LFSA 3B8QA 3LMHA 4Z3VA 2OF4A 4FEQA 3QA8A 4USDA 3OOMA 1PYEA 2P55A 2Q0NA 1OKVA 4UWYA 3TV4A 4GKIA 3GOKA 4XP0A 4AN2A 4EL9A 4F9YA 4C4HA 3H0ZA 4ZTHA 2GNGA 5H3QA 2IVTA 3IONA 4IAYA 1W82A 4E4NA 5L2SA 3H30A 4NZWB 3SX9A 3TUDA 3G33A 5EG3A 1SVGA 3ODZX 4YTHA 3IS5A 5EI2A 3ZSHA 3DZQA 3UO6A 4MD7E 3SOCA 4QPSA 1CM8A 3QRKA 4XUFA 3TZMA 4ZMEA 4QP3A 2B9JA 2Y6OA 3QTUA 4YBKA 4BCGA 4GYIA 4AOIA 4O83A 1EH4A 4WBBB 4ZSAA 4M67A 1JNKA 4FVPA 2UZBA 3Q6UA 3PG3A 4GUBA 3DQWA 3K3IA 2XKFA 4KIOA 2PUPA 3MJ1A 1G8AA 3E3BX 4FG9A 4DH7A 3IK3A 4D5KA 3RMFA 1YDTE 4E1ZA 2VO7A 4GYGA 4U98A 3OEFX 2WELA 4O6EA 3BL9A 4N4SA 5CXHA 4ZTSA 3VS1A 3I60A 5I9VA 5K3YA 4V05A 3F3ZA 3FSFA 5J5SA 5KHWA 4EK8A 2PMIA 4HGLA 3QZIA 2PVHA 4FSYA 3TDWA 5IA3A 4G31A 2BIYA 3MPAA 2JFMA 3SG8A 1L8TA 3AKKA 4BCQA 4EJ7A 4QDVA 5EFQA 4UWBA 3E88A 4RLKA 4HVDA 1G8SA 3FPMA 1ZMWA 3HZTA 3Q3BA 4I6FA 1TVOA 5GHVA 3E8DA 4JMQA 4E5BA 4JOAA 4NK9A 1XMLA 5IQDA 5DE2A 1YXUA 1GZOA 3E63A 3IGOA 2UZDA 3OWLA 4OTGA 5IUIA 3ZFYA 4CFWA 2C30A 1H28A 5AV1A 5IMEA 4E93A 3QAME 3ROCA 4DLIA 3WF9A 2XBAA 4FEUA 5AUYA 3W0OA 4D55A 3OW4A 3PJ1A 5IDNA 4GIHA 2HY0A 4QTDA 4IQ6A 2ITWA 5IA0A 3U54A 4ENYA 4F65A 3O71A 4BRXA 3IG7A 3ANRA 3R30A 4EJNA 4RZVA 4DTAA 3AT4A 3ENHA 5FDXA 3S2PA 2J0MB 3II5A 4MCVA 4ZMFA 3GP0A 3JPVA 3LM5A 1WVYA 3DZOA 3I4BA 2HIWA 3TKUA 4I5CA 5E91A 3OWJA 3ZTXA 3HV7A 3DLSA 2WMSA 3EN4A 4QMZA 4OT5A 4RJ6A 5IQBA 1YWVA 5JZNA 3ORKA 4JLCA 3ZO1A 2WQMA 4MD8E 4AAAA 3QUPA 3QU0A 1QCFA 4PWNA 3NYVA 4RJ5A 5KMIA 3PXYA 4QRCA 5JFXA 2VD5A 5EI6A 4BI1A 5HO7A 1UNLA 4NH1A 4FIJA 4HYSA 1Q8WA 4ZSGA 3PVBA 4JDJA 2R2PA 4LV7A 3ZDIA 2Y4IC 2ZYBA 3C5UA 4G9RA 2XKCA 2O2UA 2VTQA 2HOGA 4G3GA 4PMTA 3ZBXA 1TQMA 4PRJA 2X7FA 4D9TA 4E6CA 2RGPA 5F1ZA 5JGAA 4C7TA 4G5JA 4L8MA 2ZV9A 4O81A 4IAAA 3A7GA 3W8LA 4PDYA 3NVMB 4C4GA 3SOAA 3DBQA 4PDSA 3LXPA 3UIBA 3V04A 4HVSA 4IDVA 4U79A 4DT8A 4ZLYA 5BVOA 2XA4A 3AGLA 3RAHA 4I1ZA 4JJRA 4JR3A 3GC8A 1LEZA 1H26A 2XNPA 3AT2A 4G3DA 3OCGA 3BU6A 4K2RA 2ACXA 4R1YA 5CF8A 5K4JA 3BU5A 2WKMA 2JBPA 5M44A 2HZ4A 4G3FA 4FV7A 4TZRA 3GUBA 2WOUA 4GT4A 4UEUA 3KQ7A 2B1PA 3ORZA 4WNKA 5AM7A 5A4EA 1XBAA 4IX6A 1R3CA 3K5VA 4BCOA 3AC2A 3FC2A 3Q4CA 3F3TA 1DI8A 4G3EA 3NFFB 3PUPA 3CQUA 3LFEA 2XBJA 5CENA 3AMYA 3R9RA 3HL7A 5A3XA 5CF6A 4ALWA 2I0VA 3ZLWA 4HPTE 2QO7A 4FTTA 4R1VA 5FTOA 5B2KA 2ONLA 2W4OA 2WTWA 5HU3A 2WTKC 3NVKI 5DWRA 2W17A 4EZ3A 4BKJA 1OITA 2GQSA 4DEAA 5ICPA 3T9IA 3LJ0A 3MIAA 5B2MA 2WTIA 5AFVA 3SXRA 4CCUA 4U94A 3FMEA 4RT7A 3Q2MA 4TKSA 4G17A 3CJFA 4RBLA 5BMSA 3P7CA 3FMLA 1OECA 4ORKA 4JRNA 5FEQA 4W4VA 5HEZA 4C3PA 2BTSA 1K9AA 3RAWA 4O7NA 4XG4A 3ZZWA 3QZGA 3TG1A 4ASDA 3ATTA 3COHA 3D2IA 3S0OA 4HCUA 4TYHB 3VO3A 2BRNA 1J7UA 4FT5A 3R0TA 4QYYA 2VWWA 5EM8A 2XNMA 4FTCA 5BUJA 4JDIA 4AGUA 5FDPA 5AWMA 3DS6A 4BCJA 3V3VA 5CSPA 4FSMA 4ZTRA 4DTKA 3ZDUA 1ZARA 2O64A 4J99A 5CXZA 4F0FA 4EOSA 3GCUA 2B9FA 2FO0A 3HEGA 3Q96A 4NTTA 4QQCA 1QPCA 5HNGA 5K9IA 3KMMA 4C2VA 2IZRA 4TWNA 2F2CB 3E3PA 3VUGA 3OWKA 4TL0A 1F5QA 3UIUA 4WG4A 1MP8A 1FGKA 1RE8A 4NU1A 4C4EA 3UPZA 4G9CA 2CHLA 3KN5A 5AP6A 3VBQA 4U3YA 4YZMA 3AMAA 3Q60A 5FQDC 4MHAA 4IZYA 3UOHA 2IVUA 3UVRA 1OL7A 2WFYA 2XEYA 4BY9E 1HCKA 2YDJA 2UZNA 3PP0A 4GU6A 1YKRA 4JXFA 4DFNA 4ACCA 5DR2A 3ZFMA 1ZY5A 5BNJA 4QMUA 1FOTA 2PVKA 4JT3A 3F2RA 4ASXA 2CCIA 4X7QA 3PXKA 3UYSA 2OFVA 2QO2A 5AJQA 1U5RA 2ZJWA 3POOA 2R3IA 5CEQA 3AOXA 3UJGA 5LMKC 4UY9A 4JBOA 4TT7A 4EHGA 2HZ0A 4HYIA 2VWIA 4NL0A 5ETAA 2GSFA 3FL5A 5CNOA 5CF5A 3ZXTA 3S3IA 2HZIA 1R78A 4EH3A 5L2IA 4IANA 4S2ZA 3CIKA 3F5GA 3RM7A 4RIXA 1W7HA 4DN5A 4DH8A 1PMVA 3O7LB 3D0EA 4DCEA 5EYDA 1W8CA 3TT0A 4C3FA 3CS9A 2X4ZA 4CZTA 1OBGA 5DEWA 5C8MA 4RIYA 3TZ8A 4FIEA 3DY7A 1ZOHA 4HW7A 3AXWA 5I9WA 4MKCA 4Z55A 2V62A 4O84A 2CGXA 2GTNA 1STCE 3FXWA 2XUUA 2R3GA 3SLSA 1JAMA 3GI3A 5LOHA 1NVRA 4FZ6A 4MXOA 4AFJA 3PA3A 1J3HA 3QTRA 5ANEA 4R7IA 4USEA 5CYIA 3AGMA 2JKKA 3GCPA 5H9BA 4J7BA 3AD6A 3JY9A 3I0OA 5EHLA 4IB3A 2AEGA 4F6SA 2CGWA 4I24A 3V51A 3ZEWA 4C4JA 4KABA 4CQEA 3OEZA 4EC8A 5C26A 5CEKA 1WVXA 1YOJA 3OOGA 4QQJA 4S30A 4CRLA 5IF1A 2J0IA 2ZMCA 3LFBA 3QQGA 1GAGA 4TYJA 3FPQA 4FZAB 1KE6A 3F2AA 3O7LD 4LYNA 4FTUA 2FGIA 3GXLA 4KNBA 4AZVA 4GVJA 4K18A 4WBOA 3IGGA 4FA2A 2P2IA 5L3AA 4WA9A 2XIXA 1G5SA 3LCSA 2XRWA 3G15A 2C3KA 5TF9A 1PRYA 4RMZA 4TWCA 1OKYA 2GHLA 3BQCA 4R3RA 3CKWA 4L53A 3VUHA 2I1MA 4APCA 3FLZA 3QC9A 5CT7A 4M8TA 4U3ZA 2QONA 3CE3A 4CLJA 5HNIX 3EFJA 2PTKA 3NUAA 4YJUA 4JAIA 1CSNA 4J95A 3L9LA 1IASA 2EVAA 4MF1A 4AS0A 4EYJA 3R7OA 3UQFA 4YBJA 2CLQA 4KIQA 2X6DA 4Y8DA 3VC4A 4MD9E 2C3LA 2YIQA 2GTMA 5CZHA 5BV3A 4QDEA 2W1EA 2C3IB 1OBDA 2GNFA 1H24A 4BYJA 2JKQA 1JKLA 4F1TA 4R6VA 3CEKA 4RJ7A 4Q9ZA 2BTRA 4TNBA 4IWPA 5B2LA 5JFVA 3DJ6A 3ZM4A 5HX6A 3SC1A 4BCHA 3QGYA 4NT4A 3G2FA 3R1SA 3WF5A 2R7IA 1GZ8A 5HE2A 2I6LA 5M06A 3HV3A 4J1RA 4FSWA 1O6LA 3L8VA 4RVTA 2PY3A 1FVTA 3NCGA 4LMNA 1ZAOA 4U41A 3RK7A 4Z7GA 4QMYA 5M07A 1KE9A 4FL2A 2F57A 3E8EA 5BUEA 1DAYA 4AA4A 2JKOA 3FBVA 5CS6A 1KV2A 2J0LA 2EU9A 4OTDA 3RTPA 1QPDA 1OMWA 2DS1A 3DAJA 3MFUA 4ZS0A 3VBTA 1REKA 4FL3A 4EK4A 3FLQA 4QP2A 3GU6A 3OD6X 3EYHA 3DBCA 4DYMA 5KBQA 4FMQA 1M7QA 3EKKA 4FE2A 4LUDA 5HVYA 4FNWA 2CPKE 1ATPE 4ZSEA 5J9YA 2H6DA 2WXVA 3AD5A 2VX0A 3OTUA 1PKGA 4HOKA 4IAIA 3HV5A 4M0YA 4RJ8A 1M14A 4M84A 3S95A 4D2SA 3OC1A 3FMKA 3L9PA 4B9DA 5BYLA 4K8AA 2VTIA 3ORNA 4I4FA 4DGNA 5C8NA 2YZAA 2FSTX 2J5FA 3R83A 4I21A 3LLAA 4BGQA 1H1WA 2GNLA 3UE4A 3ZM9A 2VWYA 3HUBA 1Y57A 1PJKA 1QMZA 5AP2A 1CKPA 2QOFA 3D83A 4EOOA 5FLFA 3W0NA 2UW0A 4U45A 4AGCA 4CNHA 1Q8YA 4PNKA 5AA8A 5IQCA 4QMPA 5GIOE 2C6IA 4O7VA 4TTHB 3F66A 5G1XA 4AA5A 2Z7QA 2UZOA 3WZKA 4KRCA 3NZ0A 4FEXA 4ANBA 2C1AA 2FB8A 3PY0A 3PWDA 4AXCA 2C6TA 3UPXA 1NVQA 2JDRA 4BBEA 3KC3A 4WRSA 5BVNA 3HMOA 4FSTA 3EQDA 2RFSA 3QCXA 4FTLA 4JQ8A 2QU5A 2UZEA 4NW6A 2UZLA 4QQTA 3OCTA 1IAJA 3MESA 2ITZA 4TPTA 5E1SA 3W0PA 3ZUVA 4E26A 5TKDA 3CY2A 3DGKA 4O7TA 5JRQA 3DKFA 1G8KA 3CD3A 1J7LA 3EQBA 1Y8YA 4MTAA 1Q8ZA 5LMKA 4K33A 2HK5A 3LVPA 4L3PA 3SV0A 4R5YA 3FLYA 1ST4A 4GEOA 4R7BA 4GT5A 1WBTA 1ZRZA 3D7TA 3IECA 4IJPA 2RF9A 4IB5A 4JIKA 2RIOA 3PSCA 5E8UA 3A7FA 3UDSA 3P7AA 2B7AA 2J4ZA 2P0CA 5AMNA 4C35A 2OJGA 2IN6A 2VX3A 3BGPA 3Q6WA 4A9YA 1P4FA 3R9NA 2YCFA 4N6YA 3UP2A 4A4OA 5HE0A 5JSMA 5LWNA 3QTIA 2GNIA 4WKQA 4CKJA 3QQLA 1WAKA 2Z8CA 3QALE 2ITUA 4CXAA 3KXHA 3UDZA 3DAEA 5LVPA 1Q61A 3NNWA 4YJRA 3E8NA 1F0QA 1GJOA 3CTJA 3EQIA 3HA6A 4H36A 4WUNA 4YC6A 5HVJA 3O8PA 4ZTQA 1FVRA 3CC6A 3T3UA 2W99B 3REPA 5C8KA 4K6ZA 4YC3A 1OPJA 4HNFA 3RAKA 2C0IA 3LPBA 1VYWA 2BILB 3MV5A 3R02A 4FIHA 4RX5A 4ZTLA 3TWJA 3NYNA 4FT3A 4S31A 3PYYA 2C6EA 3MA3A 4BJJB 4DGOA 1VJYA 1H1PA 5IG1A 4AOJA 4MQ2A 5DOSA 4S32A 3C13A 3NNVA 4QYGA 3BI6A 3LMIA 2JLDA 4H3PA 1YXTA 2XF0A 4FTRA 4JG6A 3VBVA 4GCJA 3VS2A 4AE6A 4RFZA 5LVMA 3W0SA 2XAOA 4FOCA 4QMLA 3EKNA 2XK3A 2OSCA 2KTYA 3BGQA 3O8UA 3OT3A 4A9RA 2XKEA 2W05A 1UNHA 4YSJA 2XK7A 3C4EA 5DG5A 2PVMA 5IISA 4XG9A 3KKVA 5CAOA 4AWIA 1Y6AA 2R3RA 4W4YA 4ZLZA 4XNEA 3BHTA 1YDSE 4FYNA 1KV1A 3UNZA 5J1VA 4ANSA 2PUUA 3E5AA 4WT6A 3I0QA 3EMGA 4XV2A 4FKSA 4LUEA 1Q3WA 4UYNA 3UDBA 2W1GA 1RDQE 3FSKA 4ACDA 2BRMA 1WBWA 1YHWA 1OPLA 2HYYA 1RJBA 1PXPA 4FK6A 1GZKA 2GQRA 4IAFA 3NGAA 4JAJA 4O0SA 5L6PA 4X2GA 2QG7A 3OROA 3KULA 4FV2A 5IA5A 2RG6A 4FNZA 2IW6A 4FTIA 3BE9A 5EQEA 3R63A 2XM9A 3D5WA 1Q5KA 3O5AA 1KWPA 5HGIA 4QYEA 5HD4A 5AV3A 2YABA 3BWFA 5EYKA 4G6NA 3RALA 4K0YA 4LV5A 4YZDA 5A9UA 2O5KA 3Q5IA 4Q9SA 4EH9A 3QQKA 1Y6BA 2YM8A 4GFGA 1VR2A 3FI2A 2WNTA 4IM3A 3PLSA 2BIKB 2YIRA 2VO3A 1H4LA 4FTMA 3DOGA 3BV3A 3NIEA 3V5LA 1SZMA 4QNAA 3QKMA 4C3RA 2YIYA 3EQCA 3KRRA 3MH1A 2O8YA 4BR3A 4FSUA 3F5PA 5T3QA 5C27A 4GMYA 3PE2A 3FY2A 3W10A 3FZRA 3P7BA 3VJOA 5E9EA 4CSVA 4J8NA 4LOOA 4BGGA 3C4WA 4I6QA 4IZAA 3R8PA 1FQ1B 2HWOA 4K9YA 4UWCA 3NRMA 3H3CA 4DGLC 3ORTA 4DDGA 4O7PA 4CMUA 3DV3A 4FKRA 5EHOA 4AXAA 2B53A 5A4CA 5LMBA 1AQ1A 4U81A 3MTLA 1YHVA 2DYLA 4L45A 2BFYA 4QTEA 1QPEA 2ZOQA 5HG7A 4FEWA 1IRKA 3VS7A 1YWRA 1XR1A 3D14A 2WIHA 4C02A 3QXPA 4JR7A 3W32A 4XV3A 1V0PA 3PG1A 5HBEA 2JEDA 3H0YA 3DAKA 3UZRA 3HA8A 2R3KA 3DK3A 2G2HA 1WZYA 1OUKA 3MW1A 4WG3A 4LV8A 3FZSA 4D1SA 3MFRA 4YJOA 2ETRA 4XG3A 1SVEA 4CFFA 4DDIA 3JVSA 4Y73A 2P2HA 2PPQA 4BCPA 4D4RA 5T6KA 4EORA 4GW8A 1H1RA 4M0ZA 3EOCA 5AM6A 3GC7A 5KUPA 3KL8A 3DXNA 2PSQA 3KB7A 2JBOA 4QYFA 3MVMA 3L8SA 3NLBA 3TTIA 4XHKB 1JPAA 2XEZA 4QMVA 1NW1A 4YJPA 2E9VA 1G3NA 1YW2A 1PXKA 4MXXA 3O23A 4UB7A 5HG8A 3TIZA 4ZOGA 1UWHA 2BCJA 1BYGA 3BYVA 3N4TA 2W5HA 3FMHA 4FKQA 3VWAA 4BDCA 4IVCA 4KBCA 2W4JA 3R7YA 3LCKA 5DT3A 5IQAA 3EFLA 4O0YA 3TKHA 5DYJA 3SQQA 1H0WA 4NFNA 5JQ8A 1U4DA 5EH0A 3Q04A 5AA9A 1NY3A 2X6EA 5LJJA 4KBAA 3LQ5A 4BCMA 4K11A 2C5NA 4WG5A 4QMQA 1L3RE 2CKOA 4U5JA 4ZJVA 4GUEA 5FP5A 3AKLA 5FXQA 4G5PA 1ZYSA 4V0GA 5KHXA 5BVEA 3WZEA 3SXSA 5EM7A 3A8WA 2ITOA 2BMCA 3DTWA 3KXZA 4O6LA 3R1QA 1KE5A 4I92A 5D10A 4K77A 1PW2A 2ERKA 3AC5A 5L8JA 2XRUA 3DBEA 3OMVA 3QBNA 5J9ZA 4W8EA 2UVYA 4RIYB 4D4VA 3ENMA 1BI7A 3E8CA 1GOLA 2HXQA 3A99A 3DDPA 4GRBA 1U54B 4X0MA 5A6NA 3FQEA 4XCUA 4LMUA 4W8DA 3CJGA 2QNJA 1DAWA 2C47A 3JVRA 3NAXA 1E1VA 2J51A 3QYZA 4FIFA 5CU4A 2CNVA 5AUWA 2YA9A 4FTOA 2QC6A 1GNGA 3B2TA 3W33A 2WEIA 3P79A 3HDMA 2GHMA 3P5KA 4FV6A 4YJVA 1CTPE 4C2WA 5A46A 3RPRA 5ETCA 4UX9A 4QOXA 3LMGA 1B39A 2PVFA 3IW4A 4BIEA 3MY0A 5T68A 3NDMA 2YJSA 2WMAA 5CQUA 4PMPA 1M2RA 5M4UA 5M4FA 2LGCA 3F7ZA 4BDIA 4C62A 3CGFA 4L46A 1WBOA 1M2QA 4DEHA 5LVNA 3TN8A 2EB2A 3U9CA 5AIRA 3W2PA 2GU8A 3ZXZA 5AUXA 3VUKA 2VN9A 2R3PA 4IFGA 4MXCA 4NSTA 3BELA 4PQNA 4CV9A 3QYWA 4L43A 4EOKA 5FD2A 3AT3A 3A61A 3I1AA 3OZ6A 4N70A 4R78A 5H8EA 3A62A 4FSRA 5F9EA 5C1QB 4O7ZA 4Z7HA 5AV0A 3LIJA 4EKLA 3NW6A 5GJFA 2VTJA 4O2PA 4AACA 4C0TA 2QLQA 3FV8A 1P14A 3BYSA 5M4IA 3OT8A 3QQJA 2X7OA 4UZHA 4H3BA 3N51A 3OXTA 3KXMA 4ANMA 4QP8A 4Q2AA 3HP5A 4R3PA 5C9CA 5J1WA 3ZFXA 4I93A 2PUIA 5E8WA 1MQ4A 3VRZA 2QOKA 1YDRE 4AQKA 2LAVA 4EOJA 5AP4A 4CVAA 5L2TA 4D1XA 4CRSA 4CD0A 3NYOA 3R8MA 3OCBA 3CQEA 3W2QA 4CFMA 4ZJIA 3ORXA 1K3AA 3R9DA 4FKLA 4D2RA 5M53A 3O0GA 3KF4A 1YQJA 5KO1A 3EN7A 4O7SA 4YO6A 5EKNA 2HELA 4OLIA 1ND4A 4WNPA 5HIBA 4EC9A 4IC8A 3PLAE 2V55A 4QNYA 5DPVA 4AZEA 5FTGA 3PFQA 4FTKA 3RCJA 3DFAA 4G2FA 2R3LA 2VV9A 3MH3A 5HORA 5BVWA 2OJIA 1YRPA 1UKHA 2PZRA 5EQYA 1REJA 5ACBC 5HQ0A 4PP7A 2XP2A 3CTHA 2ETKA 2VWUA 2ZDTA 2X81A 4FKUA 4FSZA 2QOCA 2OI4X 4FR4A 4XEYA 2C6DA 3FI8A 3MH0A 3EZRA 5LVOA 3QHWA 5HE3A 1M2PA 4X21A 4DEIA 1ZYCA 5EI8A 4YHTA 4BGHA 3B8RA 4ZJJA 4NIFB 4MNEA 5C4LA 4EH7A 3COKA 3FZPA 1TKIA 4PTCA 5AUUA 4DAWA 2X0GA 5IQEA 2QURA 4Y85A 3HRBA 1URCA 2QODA 4X3FA 3TUBA 5AP0A 4EH5A 2UZVA 4IE9A 4LG4A 3K54A 4M13A 3OVVA 4GU9A 3NMUF 1JSVA 4KKEA 3RZBA 4UN0C 5D1JA 5H2UA 3FHRA 5GJDA 3BBTB 4FV9A 4EZ7A 4FV0A 4J97A 3ORPA 3PXFA 4H39A 2FUMA 3O2MA 1A48A 3NIZA 3QF9A 4FVQA 3CSVA 4GVAA 4CKRA 3OUKA 1ZOGA 3QWKA 1BL7A 4A4LA 5HD7A 4P7EA 2IVVA 2AYPA 4DEEA 3N9XA 4L3LA 4E4XA 3KGAA 3WYXA 3FI3A 5ITAA 3RGFA 3QLGA 4YTCA 4OGRA 1S9JA 5HTCA 5ACKA 5FGKA 4CFUA 3CPCA 4YURA 2YM6A 5HLWA 1WBNA 2P33A 3Q32A 5EW3A 4QP4A 3FXXA 3UNJA 5L6OA 3LQ8A 4F1MA 3OTVA 3TJCA 3R8VA 2E2BA 2PMOX 3UO4A 3AG9A 3JUHA 4O2ZA 2JFLA 5CZIA 4LGGA 4OTHA 3Q9WA 1XO2B 3U6JA 4E5WA 1ST0A 3E64A 3IQ7A 3TM0A 5HX8A 1XMMA 5GNKA 2ITQA 4CKIA 5CTPA 4W4WA 2A4LA 3W2CA 4DG3E 2PMNX 3R6XA 4U8ZA 2PE0A 3U4UA 3W2RA 4N57A 5HHWA 4AT3A 4H3QA 3D7ZA 4AX8A 2XKDA 3TJDA 4FKTA 4PTEA 3IPHA 5LMAA 3KCKA 4IAZA 3LQ3A 4YNOA 5M56A 3WF7A 4A9UA 4GFMA 4FIIA 3UMXA 4BDBA 4MVFA 3QQUA 3LFDA 5LQFA 3HUCA 3PVUA 5AUZA 5BQ0A 3U9NA 5K5XA 3FE3A 3OP5A 5JGDA 3AC3A 4EUUA 5AP5A 3SD0A 3C4ZA 4FV4A 3FY0A 3DBFA 4KBKA 3E87A 1UNGA 5CVFA 4EH4A 5KZIA 2I40A 3KCFA 3LLTA 3QA0A 4AQCA 3BZ3A 4O91A 5HBJA 1J1CA 3L9MA 3BHYA 1XWSA 2C5OA 3LFAA 1DI9A 5KKRB 4KKHA 4APPA 3FAAA 4YLKA 1BL6A 1OZ1A 1PF8A 4KINA 5D9HA 4XOYA 3BLRA 5CU6A 2X8EA 3VS5A 3QXOA 1H1QA 1V0BA 2OF2A 5CY3A 3I6WA 5FEEA 3LCDA 4CTBA 4J52A 4CZUA 2J0JA 4TNDA 3TZ7A 1AD5A 1VZOA 3HAMA 5D12A 3UDTA 4CMTA 2E9UA 4GKHA 3VW6A 4KRDA 3UYTA 4ZTNA 4B99A 4FKWA 3KA0A 4DLJA 3ZS5A 2YITA 3PPZA 4YZ9A 3RNIA 2VX1A 3VHEA 5KMKA 3F5UA 2Y9QA 3OCSA 1DS5A 1RW8A 4KWPA 5HESA 2QOQA 2NRYA 2QG5A 4FG8A 3T3VA 3TTJA 4C59A 2ZV7A 1ZLTA 4RIWB 4TRLA 3HYHA 5CEOA 4A7CA 2YDKA 3O50A 4WNMA 4BN1A 5CAQA 3HKOA 4C4IA 4UXLA 3ZLSA 4C58A 4E20A 4RFMA 3I79A 5IEVA 1UU8A 1APME 4X6QC 2UW4A 3PP1A 5J7HA 4B4LA 1T45A 3RI1A 3OFMA 1M7NA 3JY0A 2UUEA 3FKOA 3NS9A 4GK4A 3RNYA 2UVXA 4AZFA 1P4OA 1R39A 5M55A 5DNRA 4A07A 4YHFA 1OUYA 3OG7A 3W8QA 2W1DA 3GC0A 1FVVA 3V5WA 3GNIB 4XRJA 2RFDA 4JS8A 1YOMA 3HAVA 2JIUA 5AADA 3TACA 3QRUA 2XNBA 3KRWA 5A4TA 4QP9A 1YXXA 4LOPA 4ZSJA 1LEWA 1R0EA 4YSMA 4DBXA 3Q9YA 1JBPE 4DTBA 3ORIA 4RX9A 2C6MA 2IZUA 4YLLA 3I7BA 5HVKA 3QTXA 3ALNA 3FZOA 3ZUTA 2WQNA 5I5ZA 4FKJA 3FYJX 4F0IA 3HMPA 3QHRA 2HW6A 4YJQA 3F3VA 2W5BA 2XIZA 4NW5A 2CCHA 3MPTA 3CPBA 3DKCA 2IVSA 4PL5A 3ATSA 5DH3A 2IO6A 5AV2A 3W0MA 3ZO2A 1XH7A 2WZJA 1PXLA 3R01A 3V8TA 1Q99A 3DQXA 3H9RA 2R3MA 3KK8A 4YPSA 2RFNA 4FL1A 2WTVA 4BBMA 4DFXE 3NW7A 2C5XA 2YCSA 1PY5A 2H96A 2VO0A 4P5ZA 4CFNA 3ZH8A 4PY1A 4HZSA 4U9AA 5M51A 1OKWA 4XV1A 5JFSA 2EWAA 2QD9A 4DITA 2PVJA 2B52A 4X2KA 4XG7A 2PVNA 2UW7A 3NAYA 3O96A 1ZOEA 3PIYA 4IZ7A 2W1FA 4KSQA 3TNQB 4BDDA 3DBDA 3A7JA 3PA5A 3ITZA 5HI2A 3UQGA 5TR6A 3PIZA 4EONA 1W98A 3BU3A 3GBZA 3U6HA 4PDPA 3QGWA 4M12A 5JRSA 4WSYA 2BAJA 2ZAZA 4IX5A 3G0EA 3D5VA 4MYGA 2HCKA 3RVGA 4DFYA 1OKZA 4JG7A 4KAOA 3PFYA 2YJRA 3IOKA 4IDTA 2QO9A 2BAKA 4DC2A 2XB7A 3WOWA 1PXJA 4ID7A 3R22A 2G2IA 4DHZA 2GFSA 2W9ZB 5G6VA 3BLAA 2IWIA 3G6HA 3VONA 2AC3A 1MQBA 4YPDA 1HOWA 3AQVA 3EIDA 2JGZA 3ERKA 3RP9A 3NYXA 4JX7A 4IVDA 2GS2A 2YWPA 3HDNA 3ET7A 4FZFB 1WCCA 4IIRA 4LQMA 3VS6A 3ID6C 4FVRA 2R3JA 4F70A 3QX4A 4AXEA 2I7QA 4YTFA 4EQUA 5ANKA 5CU0A 2FYSA 2R3QA 3PJ2A 1CMKE 1KUTA 3MVJA 3ZONA 5JQ5A 2OG8A 4WZYA 5ETFA 1BUHA 3MTFA 3TKIA 3TNPC 3FHIA 3KRXA 3OHTA 1B38A 2BROA 5HG9A 3R8LA 4YR8A 5IA4A 2QKWB 1LR4A 2CLXA 3BPRA 4I0RA 4TYIA 3RK9A 1TFFA 3GQLA 4BHNA 2WTCA 3DCVA 4DHFA 4HVHA 2W9FB 5CF4A 2XK9A 2BUJA 4OTRA 5ANOA 4J96A 3ZSIA 5AP7A 5IH6A 4JBVA 5KZ0A 3EYGA 4AW2A 3SRVB 4Y5QA 5AIKA 3UVPA 2E9NA 3D5UA 3ZLXA 3GENA 3PXRA 2OFUA 1H25A 4LRKA 4ASZA 4V0GB 3ZHPC 3F2NA 4IX4A 3KFAA 1SM2A