4DG1A

Crystal structure of hiv-1 reverse transcriptase (rt) with polymorphism mutation k172a and k173a
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
549
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Reverse Transcriptase (RT) Polymorphism 172K Suppresses the Effect of Clinically Relevant Drug Resistance Mutations to Both Nucleoside and Non-nucleoside RT Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
molecule keywords Reverse Transcriptase P66 subunit
total genus 149
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4dg1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dg1A05
2E6MA 3NGYA 1IKVB 1BIUA 4F4KA 3LZIA 4RUAA 4I2PB 5JUMA 3U3YA 2HHQA 3LZJA 2AX1A 3MTKA 2XY8A 4Q5VA 5D3GA 3HVTB 3KK1B 1JLFA 3C6UA 4QWAA 2IJFA 3ZSYA 3HPOA 4FBUA 1N5YA 1BGXT 3NF7A 3HPGA 4KO0A 1DTQB 1RDCA 1UAXA 4Q0BB 4CJKA 3ZT1A 4CFDA 3OS0A 2V0NA 3JSMB 2KFNA 4MH8A 4EO8A 3SUQA 2E9ZA 4M3RA 5KFXA 3KLGA 3QEPA 1QS4A 3O3GA 1HARA 1REVA 3AVIA 5HRNA 3DRPB 1SH2A 4RW9A 1F21A 5L1KA 3NGIA 3TAMA 1I3AA 4ZTJA 3PW7A 2HNDB 3V4IB 1Q9XA 5KFFA 1KLNA 3PV8A 3PX0A 3VQ7A 2OPSB 4MKAA 1C1BA 4CHPA 1JX4A 1GX6A 2DY4A 1K1QA 4QPXA 3M8PA 5CYMB 2D0AA 4HVJA 5KFDA 4FZXC 4AHSA 3OYCA 1IKWA 5J2MB 3AO5A 3KJVA 4DL2A 4KHWA 5KFMA 3BQ1A 2PYLA 4NCAA 4ICLB 4FJGA 4FLWA 1GOCA 2ZE2B 4NYNA 2IM0A 3OL6A 4F2SA 2JEIA 4I2QB 1B9DA 4OLBA 1KVCA 3D0PA 3QETA 3DOLA 1NKEA 5EWFA 4CF0A 4DTPA 2DTUA 4J2BA 1U48A 1TQLA 1XR6A 4O0IA 5C24A 4GC6A 3PJWA 3TWHA 4CERA 4XIUA 1QSYA 1MU2A 1EKEA 3MR2A 2W9BB 1UWBB 1NK4A 3CDWA 4J9LA 1RDDA 1SKSA 3L2QA 3V6HA 3ZSXA 3S3NA 2XI3A 2VWKA 4CGDA 2FBTA 4DSLA 1Q9YA 3VQPA 1TVRA 1EETA 1TAQA 3ALYA 4DQRA 4KAZA 3MR6A 1KFDA 2W9CA 3I5BA 5JXSA 4NLQA 4CHYA 2YKNB 2IMWP 1S6QB 4NYFA 4M42A 3SFUA 4JUZA 4KV8B 4DTUA 2R2RA 4ZP8A 4CEEA 1X1PA 1NK0A 3AVNA 4FLVA 3BGRA 1WAJA 4Q44A 1RT1B 4FVMA 3RAQA 4AH9A 1T05A 2FVQA 2AGQA 3HKWA 2FJVA 3L2WA 1CZBA 2KQ2A 4IG3B 4KTWA 5KFKA 4Q8FA 1S1VA 4O44A 4AILC 4DSKA 4FJHA 2OPQA 1U47A 1LW0B 4OKJA 3IAYA 1TGOA 4GMJB 4DTXA 3CQ8A 1TKXB 3KLEA 3QIOA 3HK2A 1MMLA 1RBSA 3VQEA 3MXIA 4Q45A 5EDWA 4NLWA 1BISA 1QE1B 2OPPA 4HTUA 2NUBA 1LWFA 3U6FA 1CXUA 4DSFA 1S9EB 1XC9A 4RW4B 3OY9A 1RT3B 5F8GA 2FVCA 4B3OA 4Z4FA 1XHXA 3RMDA 5J2PB 1JLQA 2RDIA 4ZPAA 4E7LA 3M8SA 1UOCA 1JLBA 3DLGB 2RPIA 2YV0X 4O4GB 3G6VA 3KMQA 5J2NA 1SKRA 4B9VA 2W8LA 1RTIA 3IG1B 4NCGA 3DMJB 3QIPB 1VSKA 1XWLA 3NE6A 4LSNB 4KKOA 3C6TA 3RB3A 5J2QA 3AV9A 3QIDA 4FLTA 3ICLA 2RF2A 5C25A 4TY9A 1VRTA 3D28A 1GOBA 2HVHA 2IJNA 4CJLA 4CHQA 4NLRA 4I2PA 4BE1A 2Q3SA 3K5NA 1BQNB 5F8HA 5D3GB 3VQ6A 1TL3A 3QGHA 3GIMA 1I6JA 1TL1B 3PW5A 1TKZA 3ISNC 4CJWA 4MFBB 3LP3A 5HP1B 4FS2A 4KO0B 3DRRB 4FJIA 3VQ4A 3TQ1A 3Q8RB 2IAJA 2BRLA 3ZT4A 4DSEA 1S0NA 4U6PA 2IS3A 2D7SA 3N6LA 1GOAA 4ECVA 3OLBA 3OVNA 1S1TA 4KE5A 3NF9A 2ATLA 2J6UA 4IRDA 4FJNA 5KFLA 3ZSVA 5FDLA 3SUNA 4FZZA 4NYZA 3T1AA 3G6YA 2A1SA 2CKWA 4K4YA 3DRSA 3TAQA 4CF8A 4ECXA 1T8EA 4ED1A 3DLEB 4ECQA 3NMAA 2X78A 1L3TA 3OSPA 4IH7A 3AA2A 4HUEA 3M9OB 4LD0A 4EEYA 3KHGA 3SNNA 4WYWA 1RBTA 1RT2A 5KFUA 1IM4A 4NLDA 3OYEA 4IFVB 1ASVA 3VQDA 3WNFA 3FQKA 3SJJA 1HRHA 2JC0A 4FJXA 4WFZA 4IG0B 2O5DA 5L1JA 3LAKA 4H4MA 3T19A 3ISND 1LV5A 3AA5X 1HMVB 2ZE2A 3GV7B 3HO1A 4R8UA 4ED3A 4I2QA 3V9UA 4NLVA 4ECSA 5DK5A 1A5XA 4YQWA 4B9TA 2DFFA 2HNZB 1RDAA 3CFPA 2LSNA 4IR1A 4QWEA 2B43A 3OS2A 1LAWA 1JL2A 4ECRA 3CIZA 4FLXA 2QKKA 2ILZA 1WAFA 1MU2B 2V4QA 1NOYA 4JS5A 1VSIA 2G8UA 3SUOA 2R2UA 1RDBA 3DLKA 1CXQA 3LDSA 1NJYA 4W5RA 1QAIA 3VQQA 2B5JB 4N47A 1Q8IA 1RTDB 3DLBA 3CYMA 4EO6A 4RW7B 4OPJA 4B9NA 4KHSA 3MEDB 4DF8A 1BCMA 2F8SA 4YR3A 1S10A 4M94A 3LP2B 4FJ8A 1LWEB 4HKQA 4CHNA 3EY1A 1RT1A 5L1LA 2JEFA 4K8XA 4E1MA 3DYAB 2JGUA 1NKBA 2WOMB 3K2PA 1RT5A 2DPIA 5DQHA 1ITGA 3KNAA 4Z4GA 1HQUB 1XHZA 3OYLA 3HL8A 5KT3A 5J1EA 1W9HA 3KK2A 3HT3A 4CGGA 3QO9B 2WONA 3LP1B 5KFSA 2XY6A 3RMAA 3TR8A 4H4OA 4OL8A 4KHMA 4YR2A 1K1SA 1S9FA 2XO7A 2AQ4A 1RTJA 3VQ8A 3V9WA 3PW4A 3NH0A 1LWFB 4TLRA 5KG3A 2VG6A 3EYZA 2KFZA 4KHRA 1S6PA 3NKYA 5KTQA 4B3OB 1LW2A 4BWJA 4DSJA 1NHUA 5SZTA 3V4IA 3CDUA 3H5SA 1RILA 4B08A 1TAUA 3KLFA 5F9LA 4AHTA 1Z26A 1JLEB 4G1QB 4QCLA 3NH2A 3V81A 1B92A 1NOZA 4K4ZA 1RBRA 1RDRA 3C6TB 1S9GA 1WNSA 2YNHB 4RNOA 4CK2A 3EZUA 4DSIA 5KI6A 1BI4A 1VRUA 1WN7A 3RRGA 3QERA 1J54A 4J9QA 3I0SA 1SH3A 3FFIA 2ZD1B 4CJEA 4DEZA 4ED2A 3PW0A 1TL3B 1TK0A 5KT7A 3BSAA 3CWJA 3MEGB 2R8GA 5HP1A 1L3UA 4KPYA 4IFYA 2G8WA 4ECZA 4PUOA 4RNMA 4FW2A 3OYHA 4R5PB 4CJFA 1YVFA 5SWMA 1RA6A 2R8HA 4ED7A 2D0CA 3PX6A 3AVKA 3KLHB 4CJUA 3OS1A 3QESA 3HVAA 3DLEA 1EETB 3DLRA 2PYJA 3ULDA 3CFOA 4AHRA 2GIRA 1Z25A 4DL7A 3GV8B 4LQ3A 3IGVA 4FJLA 2ILYA 3AO4A 1D5AA 2IBKA 4O3PA 3BQ2A 4NLPA 1HYSA 4ZVFA 4KREA 3V6DB 2W7OA 2KZZA 2XWYA 4LSLA 4DLGA 3SQ0A 3NH1A 2WTFA 2EC0A 1TKTB 1JXEA 3DLHA 4O3OA 1HYZA 4DFJA 2PY5A 3RBDA 2ZQBA 1IKYA 1C0TA 4CJSA 2XC9A 3H08A 5KG1A 4CIGA 2HNZA 2AWZA 4ZP7A 3L2VA 1NJXA 4CFBA 1HQEB 5DGBA 2FVRA 4FM2A 3H98A 3OJUA 3ITHA 4OJRA 1RTHA 4KAIA 4ZVGA 5HROB 1S97A 4CGFA 2HHVA 4IH6A 3V6KA 3RMBA 4NRTA 2FBXA 1S48A 4CJTA 4CF1A 2YNIB 1S1UA 4IDKB 2YKMB 3RB0A 4QWCA 3HXMA 2OYQA 4ZHRA 3GILA 4TSXA 3SPYA 2HHUA 3T5LA 1CLQA 1C2PA 4W5TA 1NJZA 3F9KA 1S5JA 3FQLA 3MXMA 3JYTB 5KG0A 2AGOA 3TARA 4Z4IA 2DFEA 2Z1GA 4RU9A 1K6YA 1KVAA 1O1WA 2W8KA 1TV6B 2YNFB 3OYBA 1J5OA 4F3TA 1VSHA 4B9LA 3I0RA 4ID5A 3MR3A 1LAVA 2ASJA 5KFRA 3M9NB 3M8QB 5C42B 4JV0A 1RT6A 5FRMA 3C95A 1FK9B 5KG5A 5HLFA 1JKHB 3F73A 1JLCB 4JS4A 5KFEA 1RCHA 2F96A 1RT4B 2PZSA 5J1EB 1JLAA 4TY8B 3KIOA 3NAEA 1SL1A 2XGPA 5EWEA 2P5GA 4PWDA 1D9FA 2R2TA 2G8KA 4CJPA 1S1XB 3IRXB 2RKIB 4EBDA 2XHBA 3S3MA 1NKCA 3NGDA 2HHWA 1C1CA 2VG7B 3DOKA 4I7FA 3AVAA 1BQMA 3HHKA 3TVKA 3K58A 3HP9A 4QWDA 4OPKA 3MECA 3AVJA 4MK7A 1S1TB 3H2LA 3SYZA 3KHHA 3KK1A 3V1OA 3L8BA 2VG6B 3B6PA 3SQ1A 4CIEA 3QLHB 4HCBA 1HJRA 2KTQA 1GX5A 1N5YB 3NAIA 3NDKA 3AVMA 3CDEA 1KTQA 4J2AA 5KFIA 4Q8EA 3P5JA 5KFZA 1JLEA 4G1QA 4PA1A 4I9QA 4EBCA 4K4UA 1VSEA 4K4XA 4PQUA 4DTRA 2QK9A 2RDJA 3OHAA 4FLYA 4IFVA 5HBMB 3V9SA 3V1QA 3OYKA 3AA4A 5KG7A 3RB6A 3G6XA 3PX4A 4Q43A 2ZD1A 3BSNA 4M3ZA 1U04A 5EUHA 3U3GA 5KFOA 3TAEA 3ZT0A 2D3ZA 2C2EA 1C1BB 3G0ZA 3QYYA 4K4SA 3PO4A 3E01A 2XCAA 3H4DA 4HHTA 4W5NA 2GBZA 1QSSA 1HPZA 3P1GA 3QGGA 4Z4CA 4N41A 3OYGA 1Z4UA 2F8TA 4BDPA 3KJVB 1IO2A 4PUOB 4DG1B 4DQSA 4R5PA 3M8RA 3BREA 1Y97A 3IN5A 3KLIA 4JRQA 4NLTA 2G8HA 4WZMA 1KLMA 3QINA 4DTMA 2FVSA 3H59A 2E9RX 2OZSA 5DGAA 3TABA 1ZYQA 3L3VA 3GIKA 1YTAA 4RW7A 2AX0A 4MK8A 3SV4A 3KD1E 1VSMA 3QNOA 3NL0A 5HRSA 3HM9A 4KFBB 4KBIA 4BDYA 1IG9A 4FYDA 2OH2A 2HMIA 1QAJA 2FBYA 3KK3A 4KHYA 2BE2A 4YNQA 4QW9A 2XGQA 2EX3A 3NBPB 2Y1JA 1N48A 2W9CB 1XR5A 1NJWA 2O4IA 1TKTA 4YMEA 3WNGA 2J6TA 2ZKUA 3V9ZA 2HB5A 2E4LA 4B9UA 3DM2A 4NZ0A 3MAQA 1DLOA 5HRRA 1FKOB 4ED6A 2ETJA 4DL6A 2R2SA 3HPHA 4IG3A 4IRKA 3LWMA 3OL7A 3LAMA 1D8YA 2WHOA 4LY7A 4Z0UA 4CF2A 4ZHRB 3Q8QB 2DFHA 4O3QA 1S4FA 5I42B 2OPQB 1LWCB 3CJ2A 3T3FA 4IKAA 2VWJA 1FKPB 5T14A 1B9FA 3VA0A 4KSEB 1S49A 1EXQA 2O4GA 3H5YA 4J9PA 5KFJA 1J5OB 2IDOA 3AVCA 3ZSOA 4C8NA 3I0RB 3VQSA 1S0OA 2UVWA 1DTTA 5K14B 4RW4A 1JLGA 3DRPA 4R0EA 4ID1A 4FCYA 1JLQB 3GQCA 4C8KA 5HLFB 3AVGA 3TAMB 1JKHA 3BSOA 2FLPA 3O4QA 2XI2A 1IKVA 4J9OA 3KHLA 3OYFA 1TKDA 5F8IA 5DQIA 3VA3A 3CVKA 4TY8A 3TAFA 3DMJA 3HVTA 5E41A 3AVFA 3MFHA 3PZPA 4AHCA 2RKIA 3M8PB 3Q8PB 5CYMA 1X9SA 1C1AA 2V9WA 4M45A 4QWBA 3CJ4A 3EPIA 1I39A 4N56A 1XI1A 4NLXA 3S3OA 4FJ7A 1NHVA 4LH4A 1ASUA 2BANA 3T5HA 3OL9A 4OGEA 1TL1A 2HHXA 4F3OA 3OSNA 2BQUA 3KLHA 3QLHA 4E89A 1VSJA 4CJQA 4TXSA 4MFBA 2BQRA 1KCFA 4ZPCA 3V6JA 1RYRA 4I9LA 3RTVA 4ECYA 1A5VA 3N6MA 3HSTB 4EP5A 1NK9A 1ZTWA 1JL1A 2C28A 4WE1B 4M3XA 2C22A 3ZT3A 1HYSB 5KT2A 5HBMA 3AA3A 2RN2A 3AO1A 2G8IA 3AO2A 2CJQA 3A2FA 4HUGA 4WYLA 1NK7A 4ELTA 2OPRB 1KHVA 1BL3A 4G3IA 4KV8A 3CJ5A 1FXXA 4K8ZA 4B8AB 3BGRB 4B9MA 1SKWA 3FRZA 3OJSA 4KI6A 3ZCMA 5F8JA 1TK8A 4ZMMA 4DG1A 2XRIA 4J2EA 3FDSA 1EX4A 3SPZA 4URQU 4QAGA 4KHNA 1S1VB 4O44B 3PUFA 1T03B 1LW0A 4DWIA 3JYTA 1L3SA 5KRTA 4Z4EA 4FJ5A 4DS5A 4M3YA 1TV6A 2I5JA 4CEAA 4DL5A 3PJXA 2B6AB 1R0AA 1VSFA 3B6OA 2Z1JA 2YKNA 3K57A 1S6QA 2W42A 3HP6A 1QE1A 2OA8A 4RW6A 3TI0A 3K5MA 4CGHA 2YNGB 4DQPA 3P83D 3KK3B 5F8MA 1N4LA 2UVRA 2BE2B 4OKEA 1RT7A 1RYSA 4K4TA 3ZT2A 4CGJA 5KGWA 3RR8A 4MK9A 2W9AA 5J2NB 4E7KA 1RTIB 1KRPA 3H5XA 4F4YA 4LSNA 4IKFA 1A5WA 2XCPA 2IC3B 1BQMB 1VSDA 1DTQA 2WOMA 4Q0BA 2WB4A 2E6LA 3NAHA 4CJ3A 4C8OA 5KFHA 3RB4A 3N6NA 4KI4A 3KLGB 5I42A 3LP1A 2BGGA 3NCIA 2YHAA 2QE5A 3OYDA 1ZBFA 1JIHA 3BQ0A 1N6QA 5F8LA 3RRHA 4KB1A 4CEBA 3DLGA 3KLVA 4RW8A 4O4GA 3UIQA 2OPSA 5HRPA 5CYQA 3IG1A 4FW1A 3OYMA 3K5LA 1TP7A 2ITGA 4CEDA 4FM1A 1WSGA 4RNNA 5J2QB 4M41A 5F9NA 4FS1A 1D9DA 4IRCA 1QUVA 5FRNA 1IKWB 1JXLA 4EYIB 4DTNA 3KLFB 3H5UA 4X2BA 4FK4A 2WK4A 3PY8A 1T7PA 3FSIA 4CEZA 3ASMA 4C8MA 2J6SA 2UVVA 1S9GB 3ZSRA 2D5RA 2YNHA 3HYFA 1HPZB 1SL0A 1BI4B 1VRUB 2X6SA 2IM1A 4ZPBA 5L9XA 4GW6A 1S1WA 4DL4A 5C24B 4URGA 3NFAA 3SUPA 1QTMA 3UQSA 3S9HA 2F8EX 1HMVA 2HW3A 4O3NA 3QZ7A 3KHRA 5KFBA 1IKXA 4FJKA 2VG5B 3Q8SB 3MEEA 3AO3A 3MEGA 5FDLB 3UPFA 3CJ3A 4TQSA 4O0JA 4ZVEA 2UUWA 2P1JA 1X9WA 4CEOA 2HNYB 3WNHA 2AGPA 4Y2CA 4XPCA 2IOCA 3QEXA 4NCBA 4IOBA 3CG7A 4CF9A 4HCCA 5L1IA 1KSPA 4O55A 4CK3A 3LP0A 3PO5A 5DLGA 1WSFA 2GC8A 4WE1A 3DLKB 4Y2AA 3CM6A 1SUQB 1UA0A 3G86A 1EP4B 4KB0A 3PVXA 3RWUA 1HNIA 2HWIA 3OLAA 1RNHA 1TK5A 3LPTA 4JV1A 4QW8A 4MQ3A 4DS4A 2HVIA 4RNHA 2OPRA 3AVLA 4W5QA 4O4RA 4DQIA 4HYKA 3LP2A 3PR4A 2GIQA 5KT6A 1J9AA 1RBVA 1KHWA 1WSJA 4DLEA 3RBEA 1TKXA 4ZP9A 3AVBA 1VSLA 3SI8A 2VA2A 3KOAA 4DU4A 4DTSA 1HQUA 3GIJA 4F8RA 4KTQA 4M3WA 2FLNA 1D1UA 3KK2B 5KG6A 2BQ3A 3KTQA 1S9EA 1IKYB 1C0TB 3QO9A 5DLFA 4DF4A 4IH5A 4EBEA 3TAPA 3AVHA 4CHOA 3DDKA 4IBNA 3QNNA 4CHZA 1HQEA 4FZYA 4J2DA 5J2PA 5KFVA 2A1RA 3ITHB 2B5JA 1RAJA 5JS1A 3NF8A 3O3HA 5HROA 4JRPA 5DG8A 4OLAA 1NNDA 2OZMA 1J53A 3SV3A 3MEDA 4RW6B 4EYHB 3VQ5A 2FJWA 1DTTB 5K14A 1YT3A 3L2RA 1HYVA 1JLGB 1S6PB 4E19A 3HVWA 5KFNA 4CE9A 4EP4A 4KHQA 4Z4HA 5CZ1A 4CK1A 1RT7B 1T94A 3QEIA 3NGZA 3T5JA 5KGXA 1RT5B 1D0EA 3CM5A 2FJXA 3E51A 4DFKA 3DI6A 5KT4A 5KG4A 1QQCA 2I1RA 1ZBLA 2WONB 1HNVB 3ZSZA 4CJRA 2AJQA 4CEQA 1C0UB 1U49A 1FK9A 3DRRA 2X74A 2IC3A 2QV6A 4B8CA 5KRSA 1RTJB 3QGIA 1XR7A 2ALZA 4L8RB 5KFGA 2UUTA 4IQXA 4Y34A 3PHEA 2R8IA 3IS9B 1X9MA 5KFQA 2IA6A 1JLFB 4YFUA 4DL3A 3C6UB 4PWDB 4B9SA 4FXDA 4Y3CA 3UDLA 2X6NA 2AU0A 2VG7A 3DOKB 1SV5A 4I7FB 2R8KA 3M9MB 1JXBA 4J9SA 3OYIA 3LPUA 1ZBUA 4CFAA 4WFXA 4BE2A 3KMSA 2ATQA 4LH5A 4MKBA 3JSMA 4F50A 1S0MA 5F8NA 1RT2B 3V81B 4OKKA 4O3SA 4PY5A 1REVB 5CY4A 3TAGA 4NRUA 3D45A 3SCXA 4CJ5A 4IG0A 3BJYA 3FFIB 5KFAA 4LQ9A 4GVMA 3VQCA 3VN5A 3L2UA 4H4MB 1W25A 4F2RA 4RZRA 1NK5A 4R8UB 4PQUB 1QSLA 5I3UA 3RR7A 2QKBA 4KHUA 4KTZA 4DTOA 1C0MA 4ELVA 3VQ9A 2HHTA 3ZSQA 1OS5A 4M3TA 3RMCA 4FK0A 4ICLA 4ECTA 4FJ9A 4CIFA 3GV5B 4H54A 2FVPA 4NLOA 4K50A 4F4WA 3PR5B 4OVLA 1T03A 1IKXB 5DG9A 1CZ9A 3E01B 2VG5A 3MEEB 3K59A 3QEVA 5C5JA 4CJVA 4O3RA 3EZ5A 2XY5A 4N76A 2I5JB 4E1NA 1RTDA 4URSA 2B6AA 1R0AB 4NLUA 4DTJA 1S1UB 4N5SA 2YKMA 3LALA 5EWGA 2W9BA 3RAXA 2Y1IA 3NF6A 4ED8A 1LWEA 3V6DA 1SUQA 2IM2A 1WSEA 4K4WA 4CEFA 3OYNA 4LSLB 5DQGA 4Y1CA 4CECA 2IM3A 1IH7A 3DYAA 4KB7A 4ECWA 3TANA 4J9KA 3VQBA 1SH0A 3L3UA 3MF5A 2W7PA 2KZMA 4KFBA 5DMRA 1QHTA 1G15A 1SL2A 3M8QA 5CZ2A 1UA1A 1T3NA 4H4OB 1WLJA 1KFSA 3NBPA 1RTHB 4H8KA 2FBVA 1WNEA 4J9RA 3OYJA 1BCOA 3MXJA 5KFYA 2GV9A 4E0DA 3BDPA 2YNIA 3ZSWA 2R8JA 1JLAB 3KD5E 3LANA 3QZ8A 2D41A 3H40A 4F4ZA 4NLYA 3EPGA 1S1XA 3IRXA 1LW2B 3I5AA 1N6QB 4DU3A 4KRFA 4ELUA 2ASDA 2FC0A 3MFIA 2YNFA 4RW8B 3GYNA 3MECB 5KT5A 4C8LA 4TYAA 2Z1IA 4NLSA 2VA3A 5CYQB 2OPPB 4AHUA 1NK6A 1ZBHA 4RG8A 4ID5B 2QXFA 2HWHA 2D3UA 3GIIA 1LWCA 3CFRA 4DFPA 4FJMA 1FKPA 1RT6B 1ZETA 2JLEA 4EZ6A 4RW9B 2R7YA 3K5OA 4CGIA 1CSJA 3VQAA 2HHSA 2HNDA 1ZBIA 3I0SB 3KKRA 2DPJA 3T5KA 1U4BA 3WNEA 3SQ2A 2BRKA 4K4VA 4BDZA 5JS2A 5KFWA 4FBTA 2C2RA 2KW4A 4KKOB 3I5CA 1HNVA 4J9MA 4UQGA 2B4JA 4WXWA 1C0UA 4TYBA 1L3VA 2RF2B 5C25B 4IFYB 5J2MA 4E7IA 1S1WB 1VRTB 2WCXA 1YVUA 1WSHA 1U45A 2JEGA 2ASLA 3OL8A 1BQNA 3I8DA 3IS9A 1N56A 2E9TA 4YR0A 2V4RA 1ZTTA 3V9XA 3DOLB 1TKZB 4DFMA 4CCHA 2JEJA 1SV5B 3D5MA 2WRMA 4TN2A 2IAJB 2BR0A 1VK0A 4NLGA 4BWMA 2HNYA 5KG2A 4W5OA 3HJFA 4FM0A 4TQRA 4JV2A 4ECUA 4DU1A 4FJJA 3LP0B 4DQQA 3BSCA 2XY7A 1UWBA 2BANB 4WFYA 5T7BA 3BR9A 3C94A 1EP4A 3CO9A 4OGCA 1C6VA 2GUIA 1HNIB 1W0HA 2P51A 2YHBA 4GC7A 3DRSB 4M95A 3NHGA 4XO0A 1TVRB 3SZ2A 1NK8A 4BE0A 4E7JA 4E7HA 4E3SA 4Y1DA 4MIBA 4QOZB 4ED0A 1L5UA 3O3FA 3LWLA 4CESA 5EU7A 3MR5A 4MIAA 2G8FA 5I3UB 4FLUA 3KKSA 1RA7A 1T05B 2IGIA 4JLHA 4XPEA 4ZP6A 3UR0A 3THVA 2Z1HA 4J9NA 1WSIA 3H4BA 3CJ0A 2HAIA 3O4NA 4HUFA 2BDPA 5KFTA 3HVRA 4IDKA 2C2DA 4YP3A 3KLIB 3SQ4A 4ZVHA 2JC1A 1BHLA 1U09A 4FLZA 4CJ4A 2P5OA 4EZ9A 4CFCA 1YTUA 1KLMB 4M3UA 1KVBA 1RBUA 4WXOA 4ZTFA 3KLEB 5KFPA 4F4XA 4WZQA 4O5BA 3PW2A 3G10A 3V1RA 5C42A 2HMIB 4IR9A 1RT3A 3SI6A 4DMNA 2G8VA 1BIZA 1JLBB 5DG7A 1JLCA 3SFGA 3OHBA 1ASWA 2D0BA 4BACA 1RT4A 5KFCA 3DI6B 4AHVA 4RUCA 4RNFA 3IGNA 4NCGB 4FK2A 3QIPA 5FROA 2FLLA 4ZPDA 2YNGA 3DM2B 4U7CA 2EHGA 1DLOB 3OYAA 3QEWA 2UVUA 1C1CB 1FKOA
chains in the Genus database with same CATH superfamily
2YWKA 4QIVA 1IKVB 2DNZA 4I2PB 5JUMA 1HBNB 3GP9A 2AX1A 2BJ3A 1S5ZA 5D3GA 3JQJA 5AFUH 3FEYB 4JI0J 1EQMA 2UP1A 4J90A 1F5BA 4CTAB 2O8CB 4QWAA 5T7LA 4DR2J 2W40A 1FJ7A 3C14A 2Q0RA 3ELHA 4F04B 1UP1A 2DKOB 1GXTA 3HRGA 4JKHA 4NLCA 2KFNA 4MH8A 4ZLPA 4CM2A 4I6MA 2G0JA 2E9ZA 4M3RA 5KFXA 3J7YI 3QEPA 3O3GA 1HARA 1REVA 3AVIA 3NY0A 4RW9A 1F21A 3NGIA 2PC6A 1I3AA 4F02A 2RU3A 2HNDB 2F8HA 3PV8A 2P9SA 3VQ7A 3CF5Q 4MKAA 3ZXWA 2Q3PA 1JX4A 4GY2B 4LF2A 2GJFA 2A3JA 5LT5A 3M8PA 4DR6F 2D0AA 5KFDA 3SBMA 3AO5A 1T9XA 4PL8A 3RBXA 4DL2A 2CAJA 5J1NA 4PKIA 3THTA 4ZCIA 4FLWA 2EKNA 1B9DA 3W3DA 4LRFA 3DOLA 2E7VA 5EWFA 4CF0A 1FEHA 2DTUA 4J2BA 1H98A 1U48A 1TQLA 1XR6A 1GLCG 4OV1A 2RD5C 4IEEA 4NXNK 3MR2A 1JJ4A 3AA8A 2W9BB 3SK3A 1ILYA 1UWBB 1RDDA 2UXDK 3V6HA 3ZSXA 2XI3A 3CSKA 1S6UA 1UFLA 2EPIA 3CNQP 1HNXK 2Z58B 5JICA 3CC2S 3E2EA 2GO9A 1KFDA 5JXSA 2YKNB 5L39A 5HO4A 3HJVA 4RL1A 4FVUA 2R2RA 4ZP8A 1NK0A 3AVNA 2XMMA 1RP5A 4FLVA 3BGRA 1HFEL 4FVMA 4EI2A 2FVQA 4ISGA 5B7WA 3RU0A 4DV1F 3HD1A 1FA0A 2HSTA 2YQ1A 2HBQB 3CJ8A 4WP3A 5AQYA 4AILC 3S8SA 2FLOA 3WQPA 4OKJA 1TGOA 3S01A 1CJTB 4RX6A 4DR4J 1Q16B 3KHYA 5ADXA 4DTXA 3CQ8A 1TKXB 2HVDA 3HK2A 1MMLA 3OFGA 1RBSA 2MLYA 5EDWA 4NLWA 1BISA 1QE1B 3CD6N 3M30A 4OX9F 1S9EB 4OZJA 4RW4B 4X62F 3K0SA 2HEKA 4B3OA 3MCSA 2DGXA 2XSFA 4DV0F 4ER8A 5J2PB 4ZPAA 1JLBA 3BB5A 3I9V9 1FKAF 1N54B 1TTHB 2Z57B 4HACA 5LMUJ 3IG1B 3DMJB 1E6VB 1XWLA 2MHEA 3D2FB 1FRKA 5AXNA 5GAGP 2YKQA 3QIDA 1WOOA 3MPUB 2RF2A 4YB1P 5HK4A 3D28A 2Y8WA 1IBKF 4WK1A 3B8AX 4BE1A 1H38A 2VJUA 3K5NA 5BR8F 3EL2A 2V2KA 5D3GB 2ACMA 3VQ6A 4DR6J 1VR6A 1X4DA 2M70A 3NMUA 1TKZA 4CJWA 3LP3A 4CNZA 3MMCB 3VQ4A 2IAJA 2BRLA 4DSEA 1S0NA 4DUZF 2D7SA 3N6LA 2VC1A 3OLBA 3ZNJ1 3OVNA 1JK9B 4GO5X 2ATLA 3H90A 2PBDA 4I6MB 3L3CA 1M5OC 1F9EB 2VBZA 4WU2A 1NSAA 5KFLA 5FDLA 5AE2A 3SUNA 4FZZA 3TP2A 4PXCA 2CKWA 1NJIT 2A1SA 4CH0S 5AQFA 3DRSA 1T8EA 3ETOA 1BU6O 2LQ8A 3VF6A 2RRAA 3OSPA 4R0JA 2QGFB 2OIHA 3CCWA 2H5EA 1R0BG 1OQ6A 2ZITA 3OYEA 3CCRS 3FQKA 1SJFA 3SJJA 1HRHA 1WF0A 4EUVA 4LF7J 1U0HB 3O9TA 3LAKA 1Q86T 4NL5A 2PAVA 4OZ1A 4MYTA 3AA5X 3AAPA 4CZGA 2JZ5A 4R8UA 2F4VJ 2DO4A 2YX4A 4OYIA 2HHHJ 5DK5A 1A5XA 2FB0A 4DR2K 4YQWA 3THWB 4P73A 2DFFA 2LSNA 4BR9A 2XS2A 1XEZA 1P1TA 3OS2A 4ZLJA 4K43A 1VQ8S 2CADA 2CPXA 2ILZA 3N79A 2V4QA 1TZ0A 1NOYA 1CJUA 4W4MA 1VSIA 2G8UA 1CJVA 3VETA 4HLBA 1ZBSA 2DGWA 3E9OA 1PBAA 3L4BC 3CC4S 2CJXB 3QMQA 2DB1A 5M1NA 1RTDB 1M5PC 5ETOA 4RW7B 5KQDA 4NASA 1G7CB 3MEDB 1BG3A 2F8SA 1S76D 4M94A 3LP2B 4ZIVA 3DOMB 4KYZA 2I38A 4E1MA 1SIWB 4DR5J 1RT5A 3K2PA 1M5KC 4PWUA 4Z4GA 1X4HA 4J91A 3V2UC 4ZJLA 5KT3A 2J9EA 4LT6A 1W9HA 4P72A 3KK2A 3EVOA 4DV4F 5H9FK 1KOOA 1VQPN 2IHR1 1S9FA 2AQ4A 2GELA 2VQFJ 3V9WA 2CQCA 2UUBF 2DRAA 2P9EA 3W65A 2NUHA 2E5LK 3GJQB 4TLRA 2DTJA 2VG6A 1KKHA 4E2FB 4KHRA 4YN3B 4K25A 5D4PA 4BWJA 4DSJA 1NHUA 1SC1B 1IBCB 3I6PA 3D4JA 2RRNA 5DETA 3CDUA 4LFCJ 1L3KA 3ENQA 1TAUA 1RILA 3KLFA 1XQSC 5F9LA 4JI5J 1Z26A 1TMJA 3MN5A 2B7CB 4M1KA 3H45C 4K4ZA 1RBRA 4DB3A 1WNSA 2LXIA 1U2RA 5CZXA 4DSIA 5KI6A 1BI4A 2VKZG 4FOIA 2E5IA 5H9EJ 2VUGA 5F3TA 1SH3A 2NSBA 5C2DA 1E3MA 5DRKA 3R3LA 4CJEA 2F9JA 4ED2A 1FDBA 3PW0A 1TU0B 2FD2A 1TK0A 5KT7A 3BSAA 3UD4P 3W7BA 3CWJA 4RUBA 3MGJA 3FBBA 4IQMA 3QRRA 4CLWA 4ECZA 1QLNA 4DHYA 3U1LA 4RNMA 4CJFA 1IR0A 1LKZA 3PJ9A 2DCUB 4LBIA 2D0CA 1LEOA 3MR7A 3IXQA 3OS1A 1NNEA 3LF0A 1SI9A 2V6AA 3UN3A 2QO3A 2GA7A 3PHTA 5GADP 1Z25A 1KNZA 1W7AA 3GV8B 4C98A 2VPZB 3BGUA 3BQ2A 2W24A 1HYSA 4YHHF 3CHWA 1I5OB 1VQ9S 2G13A 1SB6A 2L9NA 4AXJA 4LSLA 2BE9B 1OKJA 3R5CA 2EC0A 3IUCA 1GQEA 3CB4A 1XIQA 1R8CA 1HYZA 2V4JB 2PT0A 4DFJA 4OO1J 4DR6K 3QMLA 1F9FA 2ZQBA 4CJSA 3H08A 5KG1A 1BC6A 3R9LA 5C15A 2JLFA 4FM2A 1G2EA 3BEXA 4JKGA 3PYEA 1RTHA 3P5TL 4KAIA 2HHVA 4P52A 3BKUA 3KXDA 2YKMB 4HHHA 4ZHRA 2HHUA 1CG2A 3SPYA 4QYZJ 3T69A 1C2PA 1NJZA 4W5TA 5IS2A 5JVHL 3ULEA 2AGOA 3QAEA 4Z4IA 1W26A 3GYXB 4RU9A 1KVAA 1T9WA 4I1TA 3G2XA 1WSRA 2ZZMA 1VSHA 2QMXA 4B9LA 3IWXA 1EIYB 4YOUA 4ID5A 3MR3A 2E2QA 4NA3A 3M8QB 3ZX0A 4JV0A 3CUNA 2V34A 4P2XA 2QTDA 1R3NA 4DJBA 1NDCA 3F73A 3BDEA 4JS4A 3B4DA 2F96A 3ZNUA 5J1EB 2G4BA 4TY8B 5MLCV 3WIVA 3HHLC 2XGPA 4CZJA 3AB4B 1WC1A 4OYPA 2AEMA 1S1XB 3IRXB 2RKIB 2HHWA 2BW2A 3DOKA 2DNHA 4R79A 4DCPB 1JNRB 2XLJA 2UUAJ 4PKDB 3K58A 3M32B 2YVSA 4OHXA 4ETXA 1U7LA 3J7AN 2V7YA 1ULRA 3U1MA 2VG6B 4B3MF 4JI2K 3SQ1A 4RTFD 2M8DB 3QLHB 1CULB 1NGGA 1TUUA 2NNWA 2KTQA 2BBEA 5AJ3K 1FRJA 3MOZA 1GEHA 3J7YU 2UU9F 1CBKA 1RWWB 2NS1B 4Q8EA 3E8OA 4G1QA 3TTFA 4PQUA 2UU9K 2O8BB 3QJJA 4JKCA 3NWRA 5HBMB 1GLBG 2ASMA 2F8MA 3OW2M 3WBZA 3FCWA 1R7IA 1XJWB 2B4OA 1EKSA 5A6PA 3CC4N 4Q43A 4P7VA 1VQLS 1U04A 1WOQA 3ZT0A 4BG8A 4WTYA 3MMBB 3G0ZA 3QYYA 1A6LA 3N4QA 2XZTB 3FEXB 1YJVA 4PQAA 2GBZA 2QA1A 1YBTA 1QSSA 5BR9A 1HPZA 4HH0A 4FWSA 4U9RA 3OYGA 4PG5A 1PGZA 4CZHA 3M8RA 3BREA 4CH1A 1T3OA 1NO8A 4WZMA 2R42A 3R5BA 4OJ1A 1ACMB 3O8WA 2VOPA 1VK3A 4TU9A 2QWMA 2VDHA 4CNYA 3L3VA 4A8OA 4MK8A 5LM7E 1ZXOA 3EXYA 1K8KA 3JQKA 3NL0A 3QNOA 4XH1A 1IJJA 4FWQA 2OH2A 5GINA 3H7HB 2R7UA 2ZJRQ 4YNQA 5CZVA 3NBPB 3D7SB 1N48A 4PZVA 4JI5K 1ZAVA 1NJWA 1QJHA 5DO2A 3R6MA 4YMEA 2NLWA 4BR4A 2DGVA 3DGPA 5HMXA 3V9ZA 3KG1A 2E4LA 1ZPVA 4NZ0A 4U7UD 1FKOB 4ED6A 1NSPA 3CMAS 1FJGF 4DL6A 1NU4A 2A41A 3IA0A 2CJ9A 3LWMA 4IG3A 3OL7A 3O9RA 1JQGA 1WKLA 3QBWA 3VEYA 4JEPA 4MIWA 2VQFK 2ZJQL 3NGTA 3GYGA 4NPOA 2F7VA 1IJEB 4ZHRB 3Q8QB 2DFHA 4OZNA 1S4FA 5I42B 1LWCB 3OT9A 1FCAA 2VWJA 4D3GA 5D0GA 4BC7A 4BRMA 5FD1A 3T1HK 2XZDB 3ISZA 5EY4A 4JV5K 3QAUA 3PSIA 3EKSA 5KAKA 2XBPA 4AQYK 2QYCA 2UVWA 2XMVA 1DTTA 5K14B 4E98A 4ED4A 1Z6RA 3QB0A 1YWXA 1OYEA 4R0EA 2AJ4A 4XDDA 1OH8A 5DDOC 1UW9A 2ZC4A 4C8KA 1UVIA 2QI2A 2ACYA 3J80Y 3O4QA 1GXUA 1EKRA 1GXLA 2ZDOA 4I69A 1VQ6S 4JOUA 1XNRK 3BGFA 2HFZA 3M1VB 2UXDJ 4K2JA 4X4OA 3TAFA 1HA1A 3AVFA 2HLUA 3PZPA 2IVOA 3G96A 4OX7A 4DR7K 4MYUA 5GVQA 3B6BA 3QPIA 7FD1A 4NI2B 5AZIB 1XI1A 4NLXA 2B9XA 1NGAA 4LH4A 1ASUA 4FXVA 4YUDA 3R3TA 2QM1A 4F3OA 2G1DA 4DV2K 3KLHA 2EWHA 4TXSA 1KCFA 1U1MA 3ID6A 2DXFA 3PM9A 3TA0A 1AUSL 3F0NA 5F0UA 3W8GA 1AW0A 2QXLA 2JOQA 4EP5A 4WE1B 3ZT3A 4B3TK 2VU5A 1DZ5A 2FHJA 1MROA 5CAAA 1F2GA 3GFZA 2L48A 4DV3F 3GG4A 3AO1A 3NGSA 3AO2A 2K06A 1CQMA 2CQ2A 1JJHA 1MWQA 4O5FA 2GX9A 3GL1A 3CJCA 2E5LF 1NK7A 2BKOA 2L41A 3EJMA 5IC6B 3T9ZA 3CJ5A 2KRRA 3IBFB 1N33K 4A48A 1URNA 3KJNB 2AJ2A 4HHJA 1TK8A 1O13A 3TWZA 2M9KA 5ADZA 2XRIA 4J2EA 1EX4A 4V19J 3Q23A 4KHNA 4O44B 4U67L 1RK8A 3MAAB 3EKUA 1KOHA 1GMWD 2R7WA 3FJ2A 2W2OP 3GJTB 5EX0A 2YWFA 2G2ZA 4Z4EA 2XQCA 2A2DA 1JWWA 5HQMA 1TV6A 2VPXB 4DL5A 4CEAA 4WKRA 4D3HA 1EZZB 2RQCA 1VSFA 2Z1JA 3K57A 2W42A 2OA8A 4GKKF 1J5EJ 1NBEB 3CC7S 4DQPA 3KK3B 2JDJA 1RT7A 4B3RJ 4LF6J 2PE8A 2NRXA 4CGJA 1R89A 3MTJA 2DHHA 2C2NA 4YB7A 1A5WA 3EEQA 4DR1F 2XCPA 3I31A 1FDAA 3N0VA 3H46O 3UE5A 1HNXJ 2A3ZA 2GHWA 5BR8J 2DPNA 2JSXA 3M7VA 4WBFA 1FHTA 3NAHA 1NGEA 4C6AA 1DQ9A 3LP1A 2IVFB 2Q2RA 1ZBFA 1Q7LB 5HMYA 1X3NA 1J2VA 2VB6A 4A8QA 2QLFB 5DM7Q 3NS7B 3IG1A 3OYMA 1S6OA 4CEDA 4WKYA 1VCTA 1WSGA 4M41A 5F9NA 3FMWA 1DKGD 2C42A 5E2QA 3X3UA 4TU7A 1NGCA 1IKWB 3MURP 4EYIB 3PG9A 3L4IA 2V5HG 3QBXA 1QVGM 2V69A 2VJVA 4BVPA 1YAGA 2CGKA 4QIGA 1UW4A 4X64J 4UF4A 4KR0B 4WP9A 3N5FA 4C8MA 2J6SA 4BGBA 2J76E 4NYOA 3FNNA 2B9WA 1IR2A 1KAYA 3VAGA 2X6SA 5A8WA 2IM1A 4ZPBA 4GW6A 2ZH8A 3GPAA 5LJ3Y 1P8GA 3H0PA 2IA0A 4HWIA 4IYQA 2RHKA 2B3TB 5KFBA 2X3GA 3NGUA 4FKYA 3Q8SB 1VHXA 3CJ3A 3IFRA 3ILLA 1R43A 1T9TA 4ZVEA 4LF4F 3VOVA 2P2CB 4Y2CA 5AQPA 3QEXA 4CF9A 5L1IA 4O55A 1HLUA 3EVMA 5H9FJ 4P2FA 3DLKB 4Y2AA 2BVZA 3CM6A 3MM9A 1UJ4A 4OYZA 3TSQA 3PVXA 3K0JA 5EVZA 1PC5A 4BG9A 2H4YB 1RNHA 4JV1A 3FVYA 3VF2A 3BH6B 4DS4A 5B0CA 5I3QA 2OPRA 3RUBL 2ZH2A 3HM8A 2XS7A 4AM7A 4OHVA 5F0WA 2GIQA 3TYTA 1WSJA 1KHWA 4DLEA 1K47A 2MJUA 1TKXA 3AVBA 3TU5A 1TL7B 3D0IE 3SI8A 2RDDA 1HQUA 4M3WA 4YEAA 3NOGA 3W9HA 3MCMA 1HWIA 2BQ3A 1VIXA 1AROP 5DLFA 4EBEA 3AVHA 5ELZA 1FRLA 3DDKA 4IBNA 3QNNA 4DUYK 4WQ5A 3ITHB 3IKMA 2UUBJ 3O3HA 5HROA 3CT9A 4CLUA 4OLAA 4BR0A 3FFKB 4MKVA 2FJWA 3L2RA 1JLGB 2FIUA 4IZ9A 2ZGYA 1PJ5A 4E19A 4CE9A 2YX7A 1RT7B 1FE4A 1VGYA 4LF5F 3MEKA 3AARA 1VC5A 2KL8A 2FJXA 3E51A 4KHPK 1SJ4P 3NGKA 4A8FA 4JI4J 2A5XA 2YY3A 4L76A 4FWNA 2DNPA 4ILLA 2RILA 3HFVA 1HNVB 1HUXA 3TA1A 3CCVS 4CEQA 3UKUB 3DRRA 2X74A 3CCMN 1S7IA 1NPRA 5KRSA 4X4UA 5IWAJ 2ALZA 2CJBA 4L8RB 1Q81O 1VQ9N 4LF6K 1N8RO 5E7OB 1WOSA 2R8IA 4YFUA 4PWDB 4B9SA 3FZBA 4KT0C 4Y3CA 3UDLA 4MO4A 3DOKB 5AE3A 2M7SA 3M9MB 2OFHX 3OUYA 4CFAA 4JBCA 3JSMA 1PC4A 1HPMA 3VERA 3C6HA 4OI2A 5F8NA 4ZS6A 5C0YA 4OKKA 2ZWOA 4PY5A 3C19A 3BUZB 3I56S 3ZX2A 3BJYA 2VBYA 2YTCA 4J9VA 1HNWF 2FZCB 2IYIA 3FBFA 1FD8A 1U1KA 5AFUA 1FJGK 4DUTA 2OTLS 3RAMA 4PQUB 2F7TA 2O8BA 3OBYA 3SCKE 3RR7A 3CCSN 1UVKA 2VFRA 3T1YF 1S3XA 4KHUA 1C0MA 4ELVA 1QVFM 1OS5A 4M3TA 5HJYA 2XMKA 2DVIA 2QSWA 2J8AA 1IKXB 1AT1B 4JI4K 2VG5A 1J6ZA 2ZDPA 1R8AA 3UVJA 2BTFA 4BRLA 1XMOK 3MOJB 1R8BA 1RHRB 1Z2ZA 3P39A 2DY1A 5KPTA 4E1NA 1RTDA 1EAYC 4URSA 5D4LA 1F60B 5EWGA 4OYWA 2B4UA 3BN4A 3BZKA 2ZBQA 2AIRB 3RAXA 2Y1IA 2KB2A 3HTVA 1ZZNA 2OSQA 2E44A 4PWWA 3VZHA 1X7VA 4RBUA 4IOAQ 3GFXA 3OYNA 5E3AA 5DQGA 3TANA 3MCPA 1K8AO 1UVNA 1SJRA 4NLBA 4EU0A 3GG0A 3J7ZT 1SH0A 4FPRA 3MCOA 3L3UA 3MF5A 3Q2TC 1MNEA 4M8LA 5DMRA 1J27A 1UA1A 2DNNA 3OR1A 2DT9A 1WLJA 3A3OB 1IWAA 3LTOA 4Y0FA 3NNCA 4H8KA 2FBVA 1WNEA 5M2RA 3K9JA 5KFYA 2GV9A 4E0DA 3BDPA 2YNIA 3DDIA 3R2CJ 1CEZA 3KD5E 9ATCB 1M1KO 2D41A 3H40A 4F4ZA 1WDDA 3EPGA 4K2XA 2JJ4D 3IWLA 4KC5A 3BO3A 1LW2B 3R5GA 4BRFA 3LDLA 3C14B 4DU3A 4GNIA 4ELUA 5IT0A 4AL7A 1GMUA 3GYNA 3CD0A 2C3MA 3J81j 2OPPB 1E4FT 2UUAK 3GZ7A 4ID5B 3CW2C 1V4SA 2B7BB 2K3IA 3CFRA 1V5IB 5DM6L 4ZVQB 2BM1A 5KOWA 3VQAA 3MPYA 4DV6F 2HHSA 3THYB 3I0SB 2V2ZA 4LFBK 4K4VA 2JNJA 3MN9A 4C1NK 3EWGA 3QFPA 2DR6A 4UQGA 2B4JA 2FF3B 4A5AA 2L9WA 3D66A 5BN8A 2DGSA 1MSWD 3JTOA 1T9UA 1QQOA 5CE3A 3AQPA 1S1WB 1VRTB 4IXCA 3OW2R 4IFEA 3RZAA 1U45A 1X4CA 2ASLA 1LFWA 2A10A 4C8YA 1BQNA 3IS9A 2HK3A 2E9TA 2V4RA 3CDAA 2POKA 3ZYYX 4MDAA 3QRQA 1SV5B 1Q0NA 3DLLQ 3W60A 4USTA 2WRMA 2G1HA 3L0QA 2HNYA 2GGPA 1WEZA 3IC1A 2NRRA 3HT0A 4RUHA 3D67A 4L75A 3C16A 2VL1A 4ECUA 4PYAA 4FJJA 3AJ1A 3GE1A 1T95A 3KJFB 2MEWA 5E0OA 3C94A 2KU7A 3CO9A 1C6VA 2P51A 1HNIB 4GC7A 1HWJA 2OI2A 3N5BA 1TVRB 3SZ2A 4YHHK 5IC4B 1HBUB 1DT9A 1YX2A 2F4VF 4E3SA 3CCVN 4Y1DA 2A0FB 4ED0A 1FDNA 3SDEB 5EU7A 3MR5A 5L8RC 2ZHBA 1N36F 4Z7YA 4CO2A 2QMUB 4AXIA 2ROEA 1LWXA 1T05B 2IGIA 3FSXA 4JKGB 4XPEA 1NSKL 1P9QC 5HAOA 1S77D 4Z37A 3H4BA 3O6QA 1SXLA 1XERA 2MGZA 2KYZA 3HVRA 2F4FA 4DPYA 4AL5A 1FESA 1HBOB 1U09A 4FLZA 3CCJS 1YTUA 1FJGJ 2I7NA 4RCHA 3THWA 1RBUA 4WXOA 2C3YA 3KLEB 4F4XA 2W7AA 3O1BA 5DDQC 3PW2A 3AB2B 4USUA 4H5VA 1WUAA 3M30B 5C42A 2HMIB 1RT3A 1VOMA 4ZN1A 3ZEUA 2LP4A 1RWXB 3CJKA 4FYXB 1KXPA 3R1HA 5DG7A 1JLCA 3OHBA 1SZ2A 4Y2KA 2YKPA 5A6WA 3QATA 5KFCA 3ZTOA 2NSCA 5JLHA 2XTJP 1T9VA 2Q31A 3IR5B 4RNFA 4NCGB 5E84A 1ICEB 1MMNA 4KGMA 2FLLA 4B3SF 3PIPQ 3NNAA 1PJ6A 3NS6A 4ZPDA 4U7CA 1NH7A 3OYAA 3WXLA 2UVUA 4L3KA 1KQGB 2E6MA 3PACA 3NGYA 4F4KA 1BIUA 2O8EA 3LZIA 2HHQA 3U3YA 3LZJA 3UNGC 2X7IA 3HVTB 3P4UB 1JLFA 2KO1A 3C6UA 1HNZF 1YJNN 3ZSYA 4IOCQ 1BGXT 3NF7A 2BXJA 1DTQB 1R8HA 1RDCA 4B1XB 1UAXA 1RACB 5MAOA 3H42A 3ZT1A 3IP0A 2HK2A 4C48A 1WACA 5A0YA 2BJ8A 4EO8A 3SUQA 5GAEP 1RFQA 3KLGA 4XK8C 1A7GE 5HRNA 3L7UA 1VBXA 1NH8A 3VF0B 3GR0A 1H7WA 1RHKB 4BGAA 2F1FA 2NREA 4CHPA 1PAUB 5M2PA 4PPZA 2FHOB 4H4KC 2DY4A 4ETZA 2B0GA 2CYYA 5LY3A 4M5GA 1H74A 4AHSA 1NGDA 1IKWA 5K9FA 2AP1A 1UPMB 3QT5A 4DPWA 1XK8A 5A2QU 3ENVA 4KHWA 3PIPL 1H2VZ 5KFMA 2MQ8A 3BQ1A 1WHYA 4NCAA 4ICLB 5IFMA 2YJFA 2E1AA 2XHWA 1GOCA 2ZE2B 3Q0AA 4JKEA 3PEJA 4JI6F 3U4LA 4AYBD 3QETA 3AD7C 4OI0A 5DM6Q 3J8AA 1O8BA 4NOHA 1FEEA 2ZUAA 2FXUA 4O0IA 5C24A 4NXNF 3CEDA 4NX9A 4LF8F 3HOSA 1MU2A 1EKEA 5CR4A 3THXA 3Q86A 3M6VA 1NK4A 1SKSA 3L2QA 3NWGA 2PFFB 3S3NA 1MROB 1Y00A 2FBTA 4DR3K 3VQPA 1TVRA 1EETA 4KAZA 3MR6A 3M8ZA 2W9CA 2V2VA 1S6QB 2YXLA 4HDHA 4Y6IA 2MHNA 3SFUA 4YB6A 2O8FA 1Y5LB 1WAJA 4RO0A 2ZC3A 2KG0A 2V9KA 1T05A 2HQCA 5ADXH 2RMLA 3HKWA 1PYTA 3T7ZA 3PYGA 4IG3B 4KTWA 5KFKA 4N77A 2Q1LA 4JI2J 1S1VA 3KJQB 4FJHA 1AZSA 2EFPA 1U0SA 2WB1D 2E8AA 1LOTB 1FT8A 5DDRC 2AJ0A 3HHLB 5ETMA 1WHXA 4OI1A 5B09A 3KLEA 1FX4A 3MXIA 2K7KA 2OPPA 3U6FA 1XC9A 2GMLA 1BWVA 3OY9A 1RT3B 1N32F 2FVCA 3ZEUB 3ULEB 2Q66A 3KZBA 4U96A 4A61A 1ZBTA 2CDQA 2YH1A 2N3OA 2RPIA 4BRKA 3N01A 2LEBA 4LRAA 4O4GB 3G6VA 1UVMA 4LSZB 5E3QA 1SKRA 1F6TA 1WJ9A 3TOQA 4NCGA 4Z2XA 3VWSA 2BUPA 1NLVA 1VSKA 3PIOL 3DHWC 3NE6A 2DRDA 4KKOA 3C6TA 5LMNF 4CZLA 3RB3A 3GFYA 3AV9A 4BRGA 4FLTA 1N34J 2GS8A 2OSRA 5C25A 2IJNA 2N7CA 2BABA 4CJLA 3H6EA 4NLRA 3GDQA 4B3MJ 2Q3SA 1D3WA 5KPRA 1TL3A 1OPZA 3GIMA 3AD8C 2FSNA 3ENAA 2Q0UA 4XEIA 5HP1B 1GNKA 4FS2A 2NXUA 5IQ6A 1GH8A 1GTHA 3C3LA 4CI6A 2MXYA 4U6PA 2IS3A 1P6TA 4ECVA 1M5SA 2V8VA 4IO9L 3C16B 4KE5A 4OZ2A 3BZQA 4QR1A 4DV0K 2J6UA 4FYVB 1GK8A 4FJNA 2VKRA 2HLTA 4NXNJ 3G6YA 4LF8J 2KKHA 4CF8A 4ECXA 4ED1A 2X78A 4CLZA 4LD0A 4EEYA 4ILMA 1YJNS 4WYWA 1TUWA 4NLDA 4ZPTR 2EG2A 1UEVA 3LUYA 4LF1A 3GLJA 3FZMA 3RRKA 4FPBA 1KVKA 3CE8A 2E1CA 1VK8A 5A8WB 4DR5K 2H65B 2FJBB 2M5YA 4IG0B 3K89A 5L1JA 3A3NB 1N34K 2HGLA 3ISND 2ZE2A 4IDHA 5M1OA 4I2QA 2RB7A 5HQLA 4CLKA 4ECSA 3TZXA 4CBXA 1YZ7A 1Q7YO 2GVZB 2HNZB 1RDAA 1KAZA 2E20A 3CFPA 2O8DA 4IR1A 4QWEA 3OTEA 1LAWA 2P6TA 2O3DA 3CIZA 4FLXA 4FN5A 5A8RB 2RJZA 5ETPA 4JS5A 3RW7A 1IBKJ 2NXJA 4ZVRB 3HF5A 3GMGA 2KVIA 3DLKA 5D77A 3LDSA 1OVQA 1TUVA 2RQKA 4W5RA 1QAIA 2B5JB 1F0XA 3W2VA 4DPOA 3QICA 3BKTA 3DLBA 2J0SD 4FPIA 4EO6A 3B82A 4OPJA 3L09A 4CZKA 1IM6A 4DR4F 4BR2A 1LWEB 1NGFA 1VHIA 2YKAA 2CNOB 1Q18A 3L4QA 3EY1A 5L1LA 3W9IA 2MY7A 2JEFA 2MKCA 4K8XA 4FVCA 1E4GT 3I82A 5DQHA 1ITGA 2LU1A 1HQUB 3OYLA 3HL8A 3WX8A 3OXGA 3D1OA 3OHRA 4O0NA 4CGGA 3AODA 3QO9B 3LP1B 5KFSA 2Y3YA 2XY6A 3OR1B 3RMAA 3BR8A 3CPEA 4KHMA 1K1SA 2XO7A 1UKUA 2Q36A 1T3VA 4UY8T 3PW4A 3NH0A 2XG8A 4LF7F 4WPAA 5BREA 1X0PA 3CCSS 2HZVA 3HZ6A 2HHPA 5I3PA 3O4WA 2IPOB 1VAZA 4IOXA 5KTQA 4B3OB 1DFDA 2CFXA 4RWXA 3ZTRA 3CPWM 1I3OB 3V4IA 1XBWA 4AHTA 1YLXA 2CIMA 1NGIA 2N82B 3PNIA 2D1KA 4QCLA 3KK7A 1RDRA 3C6TB 1S9GA 1JJ2M 4RNOA 4CK2A 4FNHA 1WN7A 3C7NB 5HL7Q 3THYA 5HATA 1HNWJ 3I0SA 3FFIA 3WQUA 2H1YA 2M0GB 3CJ7A 2QL7B 3UCUP 2QLXA 1DAXA 3CCUN 5AQHA 2RUSA 4CDIA 1NXIA 1XQIA 1WDTA 4JKAA 2C2ZB 3CO0P 4ZK7M 1YQHA 5HP1A 2E1RA 5IWAK 1L3UA 3MMCA 2QZ8A 2VBXA 5FPDA 4F3QA 3ID8A 3PRDA 4GKJJ 2CUYA 1FRXA 3MHYA 1S0VA 4CZIA 3CMAN 1UWAA 4DUYF 2MQLA 3AXKA 3KLHB 3TJAA 1YKWA 5B0AA 3DGVA 3OQ2A 1QZ6A 2XHCA 1AFIA 3DLRA 2DNGA 1KC8T 3MWBA 1NZAA 3IGVA 4FJLA 2ILYA 1D5AA 4IO1A 1EWRA 2IBKA 1NSQA 2IRUA 4NLPA 2ATCB 2D74B 5AQLA 1V9OA 2KZZA 2J7WA 3CTRA 3GCXP 4DLGA 2Z2YB 2ZNZA 2ROGA 2VFTA 2ASYA 2N7YA 1JXEA 3DLHA 1UZHA 4LFCF 4M7YA 3SDEA 3RBDA 4HDGA 2ZH6A 1VQSA 2BUNA 4CIGA 2IFXA 1RZMA 1KD1T 4ZP7A 3NP5A 1HQEB 3HHLA 3IAM9 3H98A 4A62A 1W97L 4OJRA 2H3GX 3CI5A 5HROB 4CGFA 4IH6A 2FY1A 4E1JA 2QFIA 4NRTA 1QVGR 4CJTA 4CF1A 2YNIB 1S1UA 1AB8A 3P6YC 3MX5A 2VICA 3HXMA 1CJVB 3T5LA 1CLQA 4V19X 2Y1LB 5HI7A 2YJEA 2MB0B 4FWOA 3F9KA 1S5JA 3JTPA 4FWMA 3S41A 3FLCO 3TARA 1IBLF 2JX2A 2DFEA 1JXVA 4PG4A 1K6YA 1O1WA 5M1PA 5B0EA 4A8YA 3W2VB 2YNFB 1WWHA 3LM9A 3I0RA 1ZA2B 1LAVA 2ASJA 2YCHA 2ZBCA 3M9NB 3FZKA 1RAOA 1ZOTA 1RT6A 1HW8A 2QW9A 1N33J 1BDGA 5KG5A 1JKHB 1PILA 4JYAK 4MTPA 4RKUC 2IVNA 3WZ0A 1ATRA 5EWEA 4JI0K 2P5GA 4PWDA 1D9FA 2R2TA 4B3SK 3VQTA 1NKCA 4A4JA 1C1CA 1U6ZA 3NVMA 3HHKA 3OUYB 3HP9A 4QWDA 4NXMJ 3AVJA 1S1TB 3H2LA 1HBMB 4JI1F 3CCTA 3KK1A 5I4MA 3B6PA 1HJRA 2X1BA 1TELA 2EVZA 2YPZA 1M5VC 3NDKA 3AVMA 3FEZA 3ONQA 4ZVTB 1KTQA 3CCJN 3W3SA 2GWJA 4DUYJ 1KBRA 3A5MC 5KFZA 3VGTA 1JLEA 4PA1A 4I9QA 2MKHA 4EAHD 1DJ0A 3OHAA 4FLYA 4IFVA 2NYIA 3W8PA 2DR8A 3V1QA 4PXDA 1NEEA 3AA4A 3GB0A 5LSLA 3G6XA 2ZHAA 1U1QA 4RJVA 3BSNA 5EUHA 3U3GA 2C2MB 2C2EA 3LL3A 4F4AA 2KH9A 4JD2A 3E01A 2K1RB 3H4DA 4OHYA 2HGMA 5K8PA 1Y9OA 1NDPA 4PAAA 2JWKA 4JK9A 4N41A 2DK2A 1Z4UA 2A42A 4R5PA 1WC6A 1VQOS 3ZLJA 4BR7A 1HR0J 2OD6A 3LGMA 2Q97A 1KLMA 4F36A 3QINA 4KBOA 4DTMA 3H59A 2CH6A 5DGAA 2DD8S 4ZITA 1ZYQA 1TL5A 3GIKA 1YTAA 1HBUA 4RW7A 2AX0A 4WFAQ 3SV4A 3KD1E 2GV1A 4A2BA 4O8KA 2VWBA 3P5BP 2R4FA 2O1PA 3A8EA 4ALZA 3NS5A 1BA1A 4KHYA 2BE2A 2DHXA 2XGQA 3UWTA 5L38A 2FJEB 2Q6BA 3PCOB 2O4IA 1TKTA 2DR5A 2V7ZA 2F5GA 2DR7A 3HI9A 2HB5A 1MA9B 1N33F 1YJUA 3TJ8A 3MMAA 2FYXA 4K7QA 1YITN 1IWGA 1DLOA 5HRRA 4ENOA 1Q5VA 2W6KA 1CS4A 1SCJB 2Q1NA 3LAMA 1WOPA 2BM0A 2WHOA 1KC8O 1HNZJ 2ZUGA 3V4MA 2CJKA 1UFWA 3AXMA 4U67Q 4LF9F 3M6WA 2WUSA 2OFGX 2QA2A 1B9FA 3VA0A 3B8HA 4KSEB 3D2EB 2O4GA 2ASPA 5KFJA 2AKWB 4C0HA 1J5OB 2PSZA 3BP8A 4OYBA 3ZSOA 4FF2A 2ZOFA 3QSIA 4RW4A 3JSBA 3Q22A 5IM0A 3MPDA 5HLFB 3AVGA 3MX2A 3C7NA 1XNRF 3J81O 2O8EB 3LW5C 4DX6A 3CVKA 4X4RA 3HVTA 2HG4A 4G1IA 3GWCA 5E41A 3MFHA 3E1YA 4AHCA 3M8PB 2ROPA 4JI3K 5AE1A 3O44A 2O67A 2V9WA 4M45A 3KG4A 3CJ4A 1I39A 1OMSA 4JI8F 4DXLA 1U1LA 4ZN3A 1NHVA 5A0YB 3MN6A 2DH9A 1KR4A 2ZWHA 2BANA 1QDUB 3OL9A 4WU3A 4OGEA 1TL1A 2HHXA 1LK5A 2IIHA 2NZ4A 2LU2A 3OSNA 2GEMA 4E89A 1RCXB 1U02A 5LXYA 1RYRA 1FFGB 1YG0A 4I9LA 5BN9A 5F0XA 3CMEN 1MWZA 4PG7A 4WFBL 1SC4B 3RTVA 4ECYA 2KT5A 1R0CB 3N6MA 3PLAA 1NK9A 1ZTWA 1JL1A 2C28A 4M3XA 3T1YJ 1HYSB 3SQOP 5KT2A 3P49B 1FW6A 1XUPO 3THPA 3HI0A 3VMFB 1CC8A 1UAWA 2E88A 2RE2A 3U27A 4WYLA 4UOCA 3AOCA 2RHSB 3E3XA 1PAEX 1QZ5A 3MUTP 4JD2B 4K8ZA 3MD1A 4B9MA 1DY3A 4KI6A 4X84A 1Q5YA 5BRDA 1XMQK 4ZMMA 3SPZA 3TRGA 1S1VB 3PUFA 1G3OA 3VENA 3IM9A 4Y65A 3KDOA 3FCHA 3DWLA 4DWIA 3AAWB 5BYQA 3CJQA 5KRTA 4FJ5A 4EWTA 4AQYJ 4PYDA 5E5NA 2LYVA 2B6AB 1R0AA 4H5WA 3B6OA 2YKNA 3K5MA 4JN4A 4LVOP 3EZWA 4JKDA 2F63A 2E7XA 2YNGB 3P83D 5F8MA 1N4LA 1DHMA 2UVRA 3EXCX 4OKEA 4LF5K 1RYSA 2XMJA 3VAHA 1FNXH 1TUYA 1HI8A 4K4TA 1X3MA 3Q8YA 4MK9A 3OTOK 5J2NB 3VALA 1NM1A 4E7KA 5H1SQ 1KS2A 2MQMA 5AQZA 1KRPA 3H5XA 1B0PA 4DI6A 2EBEA 4F4YA 2B8QA 1BLUA 2DO0A 3WEEB 5T7LB 1XNRJ 2P9PB 4OX6A 1F3FA 3JSRA 1BQMB 1VSDA 1M5HA 1DTQA 4DN9A 4U95A 5JJBA 1UETA 2E6LA 3R1LA 2V67A 4BRAA 2GAHC 3N6NA 2HVZA 3VAFA 2BGGA 5KQ8A 1U1PA 3OYDA 1JIHA 1N6QA 4S0MA 3EGVA 5GIPA 4KB1A 3EE8A 3DLGA 4CLLA 4K59A 3KLVA 4DU8A 2EXUA 3CXCM 2B8PA 1D4XA 1JCFA 1YUWA 5C2FA 4ZCKA 1TP7A 2ITGA 2VASA 2IVYA 2X1FA 1RSCA 1IJFB 1XTZA 4F0KA 3K9KA 1LNQA 1QUVA 5FRNA 2QWQA 1JXLA 3BN7A 4L74A 3UKRB 1Y5NB 3H5UA 4A8MP 4FK4A 3MMBA 3PY8A 3LOUA 4DCHA 4YY3K 4HVZA 1NAQA 3ASMA 2KYXA 3NCPA 1WELA 1S9GB 1H6KX 4DV7J 1X5TA 3OFEA 1HKAA 3HYFA 2PO4A 2PMWA 3IBWA 3GG1A 5C24B 4URGA 3LM2A 3NFAA 4AUKA 3IBCB 1WHVA 1H2UX 2GX8A 2OD4A 2QL5B 1OSCA 4BBYA 2F8EX 4NZ7A 3A8IA 1FJCA 4IUFA 4C2MA 3D1QA 2OEKA 2P9LB 2GVZA 1S57A 4DV4J 3MEGA 3BO4A 1RWUA 1IBMK 4TQSA 4ILHA 4O0JA 3VGKA 5A8KB 5D4OA 2XMUA 1X9WA 2KRBA 2E66A 3JXUA 3TO8A 2OGUA 3WNHA 1K9MT 2FJDB 4NCBA 4BRQA 4IOBA 2HQDA 4HCCA 4CYUA 1LOUA 4CK3A 3PO5A 2UV8A 4OI6A 3T6JA 3MM6B 3DRYA 4AQYF 1UA0A 2J0XA 1IV0A 4KB0A 3OTOJ 3RWUA 1YTYA 2VHGA 2HWIA 2CNLB 1FERA 1FRMA 1U2FA 2KXFA 2CG4A 2KKZA 3MM8A 3AVLA 4N8NA 4O4RA 4DQIA 4HYKA 4PHTX 1RUSA 2YHYA 1K8AT 4DKWA 5KT6A 1YXQA 1J9AA 3G25A 4MKYA 2P9GA 1MLAA 5D15A 3O1LA 1VSLA 4WIIA 3KOAA 3EDRB 3IM8A 1YJ9S 4F8RA 1QD1A 2UUCK 1YHQS 1D1UA 2XMTA 2FLNA 1VJQA 3VEOA 2FZKB 2JL9A 4X4NA 4DF4A 4CHZA 2A1RA 2B5JA 1RAJA 2NR0A 1F2HA 4ILRA 4NWBA 4M5IA 1SC6A 1GTEA 1J53A 3KUEA 2XNQA 1NWKA 1N5TA 1QVFR 4HACB 3R5AA 4RW6B 1HW9A 4LIWA 1JB0C 3DXMB 1NG9A 1S6PB 4ZVUB 3JTNA 1PJ7A 4LRDA 1H73A 4Z4HA 5CZ1A 4KGVB 2WVBA 3Q89A 2R7VA 5KGXA 3UDEA 2CPEA 3HKZD 4DFKA 4DV7K 3O1WA 2I1RA 1ZBLA 3ZSZA 1B7YB 1OY9A 2AJQA 4WQ4A 4KGXB 5CCLA 1U49A 1T44A 4P2SA 1UJ6A 2XO6A 3VV2B 3IDHA 4IQXA 4Y34A 3D54A 3IS9B 5KFQA 2CXEA 1JLFB 3LO3A 2VF3A 1V3SA 4A2AA 4FXDA 2LA6A 2QX0A 4DV5F 2GJIA 1SV5A 1UVJA 3M6XA 1T0TV 1FDDA 1SQFA 2W2PP 4J9SA 1S99A 3D6FB 4WFXA 4ZKAA 3LDPA 3KMSA 2ATQA 3R9PA 4LH5A 4MKBA 3D1HA 1S0MA 2YHWA 1RT2B 2CWKA 2D9PA 3RGIA 3J7YP 2YWEA 4KH4A 5CY4A 2PDAA 2I6WA 3D45A 3SCXA 5HMZA 3U1NA 3J81Y 4HI2A 3OPKA 2MZSA 2D0PA 5ITHA 3L2UA 2DGQA 5FPMA 1Y7PA 4XTTA 5AJ3F 4RZRA 3ETMA 1TR0A 2XULA 3SMPA 5BYSA 5IZHA 2ZF5O 4DV4K 4RWTA 2KXHA 3CD5A 3IO1A 5D0EA 5JMVA 1HHTP 5AQNA 2VFVA 4P6QA 3KVGA 4A57A 4DTOA 2LFVA 3RMCA 4FK0A 3GV5B 4DHVA 2QYGA 4J7CA 4H54A 4IO8A 4B1YB 1T03A 1NPKA 4H0OA 1NLKL 2M8HA 4PRFA 1CZ9A 3E01B 2K1RA 1K9MO 5GAGU 5B0GA 3K59A 4AFFA 3LDQA 1FFSB 4HI1A 4CJVA 5JMNA 2XY5A 2Z2MA 1ATSA 2IDLA 2QEXS 1S1UB 3UB5A 4ID8A 2AW0A 2M3DA 2A40A 1O0PA 4ED8A 1VQ4S 3V6DA 1SUQA 1WSEA 1DQAA 3G82B 2LXUA 4M5MA 4LSLB 1K44A 3BY5A 2IM3A 5LMNK 4GVLA 1F1BB 4TVAB 2MSTA 2Z8QA 1F3VA 4QYRA 4P10A 3MM8B 2W41A 1B64A 1VQON 4USVA 2KZMA 3W9JA 4FSVA 1RKJA 1QHTA 3M5RA 2D3OR 4USIA 1CQNA 1CJKB 4DV2J 1KFSA 4H4OB 1YJWN 2WW8A 3TQEA 1VFJA 3J81U 1U26A 2FF6A 4J9RA 1BCOA 2ZFHA 3FE1A 2R8JA 1V4TA 1JLAB 2EBGA 1FTRA 2E5GA 3QZ8A 1S1XA 3IRXA 3OXFA 5AT1B 5SUHA 2VV5A 4LF7K 2ZVIA 4C0OC 3UO0A 2YNFA 5KT5A 4C8LA 3CMES 1RLCL 5CYQB 3QT6A 1NK6A 4AHUA 3OTDA 4RG8A 3T9NA 2QXFA 4DFPA 1LWCA 2P9UA 3CERA 2HFVA 1FKPA 2UUCJ 4RW9B 2HNDA 1AYEA 3LPYA 3KKRA 1YVNA 3ZZPA 1U4BA 2HAFA 6FD1A 4JI7J 5JS2A 5I9EB 2X51A 2E1MC 2C2RA 1YJ9N 4J9MA 1C0FA 3GSDA 4JV5J 4BC2A 2L9DA 2HHHF 2D9OA 4IFYB 1HWLA 2AEJA 1MG7A 3K2YA 3X1LB 1YIJN 2RUGA 1WSHA 3CXCR 2FDNA 2YWHA 3SIPB 2JEGA 3OL8A 2APOA 1X5OA 3W1YC 3BF3A 1KD1O 1N56A 4YR0A 3K8WA 2CZVC 2CVIA 1FNOA 1RLDA 4QS8A 2IAJB 4NLGA 1VQPS 4BWMA 1W2IA 4W5OA 4FM0A 1HR0F 1ZM9A 3W5XA 1UL3A 4DU1A 3LP0B 3BSCA 2XY7A 2BANB 4Y2MA 2H5IB 2PA3A 2XSJB 1WUUA 4YDUC 1EP4A 4FF4A 3RBZA 2NCKL 4M95A 1WD6A 3QSYB 3CQXA 3DLJA 3ILJA 3T6BA 4DV1K 3BGOP 4DR5F 4OHZA 1YBAA 4P7TA 3ZTPA 2A2CA 1L5UA 6FDRA 4CESA 1ZA1B 4OJ3A 4K0KJ 1RA7A 4JLHA 3UR0A 1TFWA 5K8MA 4YOTA 2WVCA 3THVA 3BM7A 5GAEU 2Z1HA 2OHDA 1WG1A 4B3TF 2Y8YA 3O4NA 5GMDA 2C2DA 1HNXF 1I94J 3DGPB 3D0GE 5AZJB 2JC1A 2VD3A 3HX9A 3QNWB 2UXDF 4EZ9A 4CFCA 1VQKN 2P5OA 2DGTA 4M3UA 1VQNS 3CULA 3MUMP 3TX0A 2PIIA 4P75A 2KVQE 3MUVP 1GLFO 3O9SA 5E3PA 3G10A 3ZETA 5AQJA 3SI6A 2NZCA 4DMNA 3G82A 2BKNA 4U8VA 3V5RA 1BIZA 1JLBB 1G4CA 4B3RK 3SFGA 4HT7A 4CLYA 4BROA 4CIOA 1HWUA 5ETNA 1YSJA 4RUCA 2CQBA 3JAMY 3H8YA 4G1PA 3QIPA 4WQ5C 4CO5A 5HVFA 2NRZA 1X4BA 2DRBA 5IM0B 3DM2B 1X60A 2EHGA 3P8BB 1I51B 1C1CB 3D6RA 3EGNA 5CD4A 3U02A 4DV3J 5AQXA 2DHSA 2RS2A 2CQ1A 2K2PA 2MDAA 1FWLA 4QR0A 1U1NA 4JV5F 1DQ8A 2CWXA 4JAXA 3I33A 3Q7BA 1ROFA 2HQ3A 3HD2A 1N5YA 3I4HX 5IT9O 3HPGA 1OY8A 1FO1A 1I1GA 4Q0BB 4CJKA 5U47A 3D9BA 6AT1B 4J5OA 4H0PA 3JSMB 2FSJA 2J4RA 1GLDG 4ATNA 1QAYA 1WEYA 2DCLA 1SJ3P 3DXSX 3DRPB 1SH2A 2BW7A 5FJ4A 1KQSM 1KLNA 3PX0A 3DXKA 1HD1A 1ZC6A 5AQVA 3CC7N 2QIFA 3DU6A 1K1QA 4OLOA 2Q79A 2BJDA 4NB4A 1NBWA 2YX1A 4FZXC 3CCZA 3OYCA 3KJVA 2XLKA 3W66A 1S72N 4B3RF 3VAKA 1WHWA 2IM0A 3CMQA 2OELA 2ZEJA 3KFWX 2E1ZA 4OLBA 2PEBA 4ANDA 2K3KA 4JHDB 3CD6S 2BA9A 4LFBF 3PJWA 5LJ5Y 4CERA 4XIUA 1I94F 1QSYA 2CQGA 5A8RA 3C2PA 1K8KB 2R7SA 5F2RA 3CDWA 3FBCA 3P31A 1ZS6A 3MD3A 5M1FA 3I32A 5AXMA 1NGHA 1RU1A 2H5JB 3VEVA 4LRCA 1RAAB 1RTZA 4DSLA 4DPUA 1NMDA 2VWKA 1Q9YA 3ALYA 4M5JA 4X4PA 4LF5J 4CHYA 2W01A 2IMWP 3QWUA 4JUZA 1X1PA 3MM6A 4UUWA 3MM9B 3GR1A 2V51B 2MTLA 3I87A 4FWRA 3OBIA 2HBRB 2OJ3A 2KQ2A 3LPEA 3R5JB 3UDVA 3W64A 2KLAA 1RGVA 4YDUA 1C4CA 2R7RA 4Q8FA 4O44A 3MAAA 4AL6A 3IAYA 2P9KB 4GMJB 2QLBB 4WJBA 2FZGB 4M5LA 3MPVA 5CHIA 4K0KK 4Q45A 2COLA 3MM7A 5BPMA 2NUBA 3AOAA 1JLQA 2JHEA 4JI6J 1HR0K 3A3PB 1IR1A 3IR6B 4JP8A 2YV0X 1HI1A 1AXQA 5B8HA 3WIUA 2W8LA 2KFYA 1U1OA 1FTCA 3VGUA 1Z1ZA 2AYMA 2N4DA 3L7OA 3A8JA 4ZVOB 4LSNB 1SBRA 5DJBA 3ENOA 3WEEA 5J2QA 3A12A 3EZOA 4QS7A 3BV8A 3ICLA 4TY9A 1YJRA 3CJSA 1VRTA 2QJ3A 4WWSA 1B99A 1RWVB 2C3UA 2XLIA 4USWA 5F8HA 1Y4ZB 4DZ6A 1BWEA 1TL1B 1OY6A 3PW5A 4MFBB 1HD0A 3DRRB 4AE5A 3TQ1A 3Q8RB 1VQ5S 5LMUK 4FWPA 4M5DB 4JK7A 3F56A 2YH0A 1S1TA 1HL6A 1VRQC 4CLPA 4BR5A 4IRDA 3ATUA 3FRYA 4CO3A 1WSVA 3ZSVA 4BVOA 4BY9C 3MM5A 1FFWB 1YHQN 2EEYA 4G65A 3TAQA 4ECQA 1OIAA 5LJVA 5HMWA 4KH5A 5GADI 4IH7A 1JCGA 1TL4A 5D8HB 5GAEI 3EGZA 4LUBA 1BWFO 5KFUA 3BBFA 3N4PA 4IFVB 1ASVA 3VQDA 5LSRA 4DOZA 2ZOMA 4FJXA 2DGUA 1YI2S 3TUJC 4GVBA 4A5BA 4H4MA 1OYDA 3T19A 1RAIB 3R8EA 2HS3A 2WBNA 3N4WA 2CG8A 2R7QA 3GV7B 3P45B 3HO1A 5AZJA 3V9UA 1CPZA 2HBZB 4NLVA 3W61A 2FPHX 3CCMS 1F5CA 2XNRA 1JL2A 4ECRA 2BV3A 2DNOA 2H3EB 3F9MA 4L6V3 1WAFA 1Q4RA 1RCOB 1RXOB 4BREA 1RHJB 1RDBA 3P4IA 1CXQA 2VFUA 2ZGZA 3ZZTA 4CP5A 3VQQA 1V3RA 4FOEA 2Z2ZA 1Q78A 2DHGA 4N47A 2DJWA 1Q8IA 3W2WB 3Q8UA 4LF8K 4Q2LA 1HKBA 1NMEB 4DF8A 1BCMA 1RHUB 4YR3A 1B70B 2XZWA 4RPFA 3VPZA 4X66J 4HKQA 2MJNA 3RSEB 1XNQJ 1HWKA 4W98A 4TKTA 2JGUA 2DPIA 3KNAA 2HRYA 5J1EA 4LF9J 2JFDA 1IN0A 3ZZOA 4GV9A 1GLAG 3U9ZA 4ZA1A 2PMZD 3E66A 1PYOB 1VQKS 2LEAA 4QIFA 3SCJE 1YZ6A 2HFUA 4OL8A 1D8ZA 4YR2A 3OFFA 2VONA 3UKUA 2B4PA 1LXJA 3VQ8A 4LR9A 1GT8A 3N28A 4EHTA 2OTJS 5A2QO 1SJQA 5AQWA 3RG6A 5LMNJ 4H0YB 1M1GA 3G6EN 4HHUA 3M05A 3EYZA 2Z56B 2KFZA 2KHCA 2DNRA 5C2GA 2W25A 3NKYA 1CULA 1S79A 5BYRA 5SZTA 1PCAA 2IBOA 1M90O 1FRIA 1DGKN 2J8SA 1JLEB 2MSSA 1U25A 3NH2A 3V81A 1NOZA 1NCLA 3RJMB 1EQ0A 3ZFVA 4X65K 2PFUA 1Y0HA 4YOYA 1J54A 2XYPB 2ZD1B 1VQ4N 3OVAA 2IYGA 3D6HB 4DEZA 4M63A 1TL3B 1NU0A 1RBLA 3S6EA 1M1KT 3TA2A 3MEGB 3MAHA 4IFYA 2NPFA 3TTDA 4PUOA 1VQ6N 3OYHA 1WBDA 2CDRB 3QJLA 4AD6A 3BYRA 4ED7A 2DY9A 3AFGA 2IVPA 2R3VA 5ETLA 3CJAA 3AVKA 3WUHA 2YWWA 2OEJA 3UVJB 4WK3A 2CQ3A 3HVAA 5E3CA 2PYJA 3CFOA 3CF5L 1GFWB 3GIRA 3FGVA 3BF1A 2GIRA 2N3LA 4DL7A 4CD1A 3NMRA 1VBKA 3P3DA 3T1YK 1REGX 1H0HB 3G4SS 4K5RA 2P9CA 3BO2A 2XWYA 3NOCA 2WTFA 1Q7YT 2FUG9 1KTVA 1TKTB 3I9ZA 4O3OA 4H0XB 3J7A1 4X66F 3MN7A 1C0TA 1N36K 2P9KA 2ZM6F 2SXLA 3L2VA 2AWZA 1NJXA 4CFBA 5JVHQ 1RHMB 1T11A 3ITHA 4ZVGA 1CS4B 5AQGA 2XS5A 3V6KA 3RMBA 3FBEA 4O8UA 2FBXA 3ENBA 3K8VA 3UE2A 2OYQA 3GILA 4TSXA 4F0HA 3I56N 1UMJA 4DZDA 3FQLA 3JYTB 1H72C 5KG0A 4KPCA 2X1AA 1WC5A 2Z1GA 1YK9A 2W8KA 4QU7A 1TV6B 3HHNB 3OYBA 2BOAA 1J5OA 2ADBA 1GLLO 5KFRA 2WVDA 5C42B 2HBYB 4USHA 1FXLA 2WSFC 1FK9B 4F67A 5KFEA 3OR2B 1RCHA 2PZSA 1SIZA 3N9UC 2BJ7A 4EHUA 2BX6A 3M2VA 1RAGB 5HSPA 4KGZB 1LCUA 4EBDA 2XHBA 3NGDA 1IBMF 4LMZA 2VG7B 1VLOA 4DV1J 3AVAA 1AUDA 1BQMA 1T02A 3TVKA 4PPDA 3WT0A 4OPKA 3MECA 4LF4J 3G9CA 2LMIA 4MK7A 3I55S 3KHHA 4DQ8A 3V1OA 5CHCB 2DITA 4YY3J 1FVSA 4CIEA 1P8ZA 1GX5A 1N5YB 4ZJQA 3SJHA 2DNMA 3CDEA 2LQBA 4J2AA 1FJEB 1HIYA 5KFIA 4ZLLA 3P5JA 3FZFA 1T6DA 4EBCA 4K4UA 1MMDA 1RAEB 1RBOB 4B1ZA 1VSEA 4KGKA 2QK9A 3C6AA 4A8XA 3BH7B 5CH7B 3WXIA 3OYKA 2OTJN 2FGCA 3RB6A 1CC7A 2QWRA 3TAEA 2D3ZA 1C1BB 4C11A 4K4SA 3G8QA 2VGMA 2XCAA 4HHTA 1SQEA 2UZAA 3D6TB 4CWBA 3QGGA 2F8TA 4BDPA 1IO2A 4U7BA 4DG1B 4DQSA 4KHPJ 2IVMA 1Y97A 3A5OC 5E33A 2F65A 2XEXA 3KLIA 9RUBA 4NLTA 1G6BA 2V8GA 2G8HA 2ZH5A 1JCEA 1X5SA 3TNVA 4QBUA 2MYFA 2LA4A 4BRCA 2OZSA 3TABA 4DR7F 4FKXA 4OV6A 4M63C 2OP5A 2HFOA 2B56A 3M2UA 3AQOA 1XMOF 4NXMF 5E26A 5H9EK 5HRSA 3HM9A 3O80A 2VPYB 4KBIA 4XH5A 4FYDA 1YIJS 4BDYA 1IG9A 3GCWP 4H03B 3KK3A 3RSEA 3VZIA 4QW9A 3NLCA 2EX3A 2Y1JA 5TKWA 2W9CB 1URRA 3BEGB 1B3TA 3MDQA 5RUBA 2RQ4A 4H0VB 1EARA 3CJTA 4B9UA 3DM2A 1S7HA 3MAQA 4FWKA 1NGBA 3KUGA 3HHEA 4C9DA 4C3MA 3KWMA 1BE4A 3HPHA 4Z0UA 1BHNA 2QA4N 4YS2A 4CF2A 1NGJA 3QFWA 4K8RA 2OPQB 4IKAA 1SS6A 3MWPA 5T14A 3E9LA 2MLZA 1DRZA 4HTJA 4UUXA 2PEHA 4OHWA 1S49A 1EXQA 3EICA 4Z7CA 5BJRA 1VYAA 2H48B 5IQQA 3AVCA 2V68A 4C8NA 1X4AA 3L7PA 4C0BA 1JLGA 2VBWA 5ETTA 2KM8C 1RWNB 2OTLN 2J0QD 2CPDA 1JLQB 4ID1A 1JKHA 3BSOA 3NCQA 3UDCA 2FLPA 2ZH3A 2J9DE 1RISA 4OLPA 4YOVA 3KHLA 3OYFA 2YBVA 4ES3A 4BC4A 1TKDA 5F8IA 5AQIA 5DQIA 3TUIC 4CLFA 5D0RA 3DMJA 3FMBA 4IJNA 4CTAA 2O8CA 1T6CA 1R59O 2PFDA 5K5MA 4L3QA 4ILGB 1P9YA 1X9SA 1C1AA 4QS9A 4QWBA 3R7NB 3S7RA 2W4DA 1W7WA 1RU2A 4BRHA 2YPYA 3HSZA 3KKFA 2DNQA 2JVOA 3O9UA 2BQUA 2ASOA 3QLHA 4MFBA 2BQRA 5IV3A 2D1CA 4ZPCA 4QJVA 4KHPF 3DHXA 4X65F 3H2UB 2XMAA 2P9IB 2E5JA 3G71N 3VEWA 4TLQA 5GMKa 5AXLA 3HSTB 1ELOA 3R7BB 4LFAJ 5G4DA 2KN4A 3SCLE 3SMZA 3AA3A 3K17A 2RN2A 2AJFE 2E2PA 2A6AA 2CJQA 3MDFA 1SQKA 1XMOJ 2RE1A 2MGZB 4JNEA 4R25A 1Q95G 5L46A 4HUGA 4I6YA 4ELTA 4B1UB 2OPRB 2MPUA 4I68A 1KHVA 1BL3A 1NPPA 1FXXA 1FXDA 3D3CJ 1SKWA 3HBTA 1NDLA 4ZLNA 4AT1B 3OJSA 4QR2A 4X4QA 5F8JA 2HZCA 5AQKA 5HQ8A