4DG1A

Crystal structure of hiv-1 reverse transcriptase (rt) with polymorphism mutation k172a and k173a
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
549
structure length
549
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase P66 subunit
publication title HIV-1 Reverse Transcriptase (RT) Polymorphism 172K Suppresses the Effect of Clinically Relevant Drug Resistance Mutations to Both Nucleoside and Non-nucleoside RT Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 149
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4dg1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dg1A05
5L1LA 1JXEA 4M3TA 1GX6A 4JV1A 4CFAA 1TK5A 2YKNA 2IA6A 3OYCA 3C6UB 2IC3A 4IOBA 3PW7A 3MEGB 4KHYA 4Z4EA 5JXSA 3GILA 1BQNB 3RAQA 3H5XA 4BWMA 4DFJA 5HRSA 4FK2A 3ITHA 4NCGA 4PUOB 3EZ5A 3Q8RB 4LSNB 1JLFA 3VQ7A 3DLKB 4CJ4A 2NUBA 4FJ7A 5DQIA 3NBPB 2FVPA 5I42B 3V6JA 1ASUA 4CJQA 2IJNA 4ELUA 4DL4A 3BGRA 3LP1A 4L8RB 4LD0A 2WRMA 5DLGA 3AVBA 5F8MA 3OYLA 1QTMA 1KFSA 4URSA 3DMJA 2Q3SA 3EY1A 4B9NA 4KHRA 4NRTA 4IKAA 5F8GA 2FLNA 3Q8SB 3D0PA 3LZIA 1WNEA 3B6PA 3T3FA 2O4IA 5KFBA 3DOLA 3H98A 1T03B 1JLAB 2B6AB 3SYZA 4QWCA 3GIMA 3G6YA 3FFIA 2FBYA 1S5JA 4B08A 3LPUA 3DRSB 1RAJA 4O3OA 4FW1A 4I7FA 5J2NA 1HQUA 2HNDB 4B3OB 4ZMMA 4CIGA 4LSLB 1TV6A 1U4BA 2FVRA 4TN2A 1SKWA 2V4QA 1EP4B 2JGUA 3GIIA 2W9BB 4NLDA 3HO1A 2XY6A 2BGGA 5K14A 2J6UA 4HUEA 4LQ3A 2ZD1B 4FLYA 2E9ZA 3TAGA 4FS2A 4B8AB 4FJ8A 4PY5A 2R8HA 4IRCA 2AGPA 1RDDA 3DI6A 4IDKB 2IM1A 1T05A 3CVKA 4OVLA 3CJ3A 4Q43A 1DLOA 4WXWA 3RAXA 4CEBA 3T5HA 3HVAA 2J6SA 4ZPAA 4MFBB 4TQRA 1IO2A 1TL3B 4HTUA 4EBDA 4HVJA 3QERA 5CYQB 1NK6A 3LAKA 4IBNA 4FK0A 2Y1JA 4YP3A 1VSLA 2OH2A 3L2WA 3HL8A 2BQRA 5DK5A 4DTRA 1QUVA 4EYIB 4O4GA 4CF1A 1SH3A 3SI6A 3MEEA 3DDKA 2D41A 2UVRA 1RT2B 3H2LA 4WFXA 3QINA 5JS2A 2DFFA 1LV5A 5KT6A 3HYFA 1WSGA 1IKXA 2YNFA 1NK0A 1W9HA 2WONB 2YNIA 1RDRA 1LW0B 3OHAA 1RT1A 1YTAA 2BE2A 1U04A 5J2PA 2GIRA 4GMJB 4CGFA 3V6HA 2QXFA 4DSKA 4RZRA 3AVNA 3C6TA 3KKRA 3O3HA 5KG4A 5FRNA 2VWKA 4OKJA 1Z25A 1CSJA 2IOCA 1B9FA 1LAWA 4FM2A 4KKOA 3K59A 1SKRA 1N6QB 4OLBA 1HQEA 1RTDB 3HHKA 3LPTA 3K57A 3PY8A 4TXSA 3PR5B 1EETB 4WXOA 3U6FA 3IRXB 2IJFA 3MR6A 1UA1A 3F9KA 1JLQA 2OPSA 2XI3A 4CHZA 2YNHB 1I6JA 4WYLA 3I0RB 1QE1A 1UA0A 2BRKA 4BDZA 4R0EA 5HRPA 3K5MA 3K5LA 3H59A 4RNNA 3S3OA 5DG9A 4E3SA 1VRTB 2XCPA 4WE1A 2AX0A 1RT7B 2DY4A 2HWIA 2ITGA 3B6OA 4H8KA 1RBSA 4HUGA 4WFYA 4IR9A 1SKSA 3NMAA 3CM5A 3OYBA 1C2PA 3V9UA 5L9XA 5KGXA 2BQUA 2JC0A 2W7PA 4DQQA 1T7PA 4CF2A 4HKQA 3VQ5A 4CEOA 4HCCA 4ED6A 4YR0A 1KFDA 1NJWA 4KV8B 2XC9A 1S9EB 2AX1A 3VQ8A 5D3GA 1BCOA 1SL0A 1A5XA 3F73A 3RWUA 1JLGA 3UPFA 4K4XA 3QETA 5KT5A 1S1XA 3TAFA 2ATQA 1DTQA 2EX3A 1KVBA 1DTTA 4FBTA 2AQ4A 4NYZA 4CK1A 4CCHA 4DFKA 3PJXA 3DLEB 1YT3A 1QS4A 4MK9A 3CDUA 2IGIA 4HUFA 3O4NA 2DPIA 3NGZA 4OGEA 4ECVA 2WOMB 3QEWA 3V1QA 3H08A 3FDSA 4ECYA 2KFZA 3L2QA 1A5WA 5KG0A 4J9MA 3THVA 4KE5A 4BDYA 1IG9A 1WSIA 1RBUA 3VA0A 1RTIB 1TKZB 3HPHA 1XHXA 1N56A 3LP0B 5C24A 2Z1HA 1RT3A 1VRUA 2RKIA 3KJVB 1NOZA 3CIZA 3QGHA 5KFGA 4FJIA 4G1QB 4DG1A 1Q8IA 1QSSA 2HB5A 3V6DA 2R2SA 5T7BA 4ZPBA 2A1SA 4ED7A 2UVUA 3DRRA 1JLBA 3KLIA 3QLHB 1RDBA 2RPIA 4MIAA 4KO0A 5KT3A 3SPZA 2YKMA 1Z4UA 3OL7A 3SPYA 1FXXA 2I5JA 3G6VA 3CFRA 3TWHA 3DLRA 5KG5A 4F4WA 1U47A 4Z4FA 3SUPA 1NK4A 4RW4A 2FJWA 3TARA 2AU0A 3OS2A 1I39A 2F8TA 2IDOA 3OSPA 5EU7A 3KK3A 4CHQA 3OLAA 3VA3A 4ICLA 2C28A 4IH6A 1C1CA 3I0SB 3PR4A 4M94A 2WTFA 1NJXA 3S9HA 5HROB 2VG7B 3KK2A 4E19A 3OYJA 4N5SA 4LQ9A 4R8UB 5KFNA 1S48A 5DGBA 4F2SA 4E89A 3I5BA 5HP1B 3N6MA 4Q8FA 2AWZA 4DLGA 3S3NA 4MKBA 1RBVA 5KFDA 3I8DA 3L3VA 3VQ6A 1C0TA 1TVRB 4XPCA 2XRIA 1CZ9A 4AHRA 3MEDB 4TLRA 5HLFB 1HNIA 1R0AA 3PO4A 3E51A 3C94A 4U6PA 3QNNA 1KSPA 4CJEA 3AA5X 2R2TA 2O5DA 3OYMA 2P1JA 4KHNA 1C1BA 4FBUA 2IAJA 4DTXA 2FLPA 4IRDA 1FKOA 3H40A 4CGJA 4TY9A 1ZTTA 4AHCA 1WAFA 1S9GA 4DU4A 3QEPA 1REVA 1U49A 2OZSA 5C5JA 2G8HA 4DTMA 4ZVFA 3CJ0A 3V81A 5KT2A 1KLNA 4XIUA 2X6NA 1ZBUA 3MXIA 3L3UA 3Q8QB 4J9PA 3GV7B 1EXQA 3SQ2A 3KLHB 3CDWA 1S49A 4CJWA 4ECTA 4JLHA 4DU1A 4CJRA 3DLGA 4CESA 1A5VA 4K4ZA 4E1NA 1T3NA 5KFQA 1UWBA 1S0NA 1KVAA 3TABA 2XWYA 1TP7A 2OA8A 4DQRA 2BANA 1NK7A 1S97A 2IM0A 3OLBA 4CEDA 5HBMB 4BACA 1C0UB 3JSMA 4NLXA 4OPKA 1J5OB 3HVTA 1B9DA 1MU2B 2Z1IA 4F4YA 1RCHA 1WNSA 3TI0A 2VG6A 4WYWA 3QIDA 2W42A 4DSFA 4IG3B 5J1EB 4C8OA 4B9MA 4YR3A 4J9QA 4E7HA 4F3TA 2HNYA 4TY8A 5KFTA 4ZTFA 1L3UA 3V1RA 2Z1GA 2B6AA 3RMCA 5CZ1A 4XPEA 2ASJA 2JEIA 3RR7A 2W9AA 2DTUA 2QE5A 2FVCA 4K8XA 1QAJA 4EZ9A 3NAEA 2VG5B 4ED3A 2D3UA 4NLRA 1S1VB 2CKWA 3HK2A 3NDKA 3DOKB 3O3GA 1Q9XA 1HRHA 2QK9A 4CHNA 3SQ1A 1RBRA 4WZMA 1J9AA 5KFEA 1TQLA 3L2VA 1LWEB 1LWFA 1ASWA 3LP2B 2B5JA 1HYSA 3BQ1A 3AV9A 4CFCA 2E9RX 4J9RA 1I3AA 4O3PA 5C25A 4KI6A 4DL6A 2HNZA 3VQSA 4CIEA 3G86A 2HHVA 4O3NA 4Y3CA 1TL3A 3KLGA 3MAQA 4M3XA 2IMWP 4CEAA 1NK9A 3WNFA 4I2QB 3DM2B 1RNHA 1RT4B 4FJXA 3KNAA 1WSFA 3ZCMA 3OSNA 3NF6A 4M45A 1JX4A 4MH8A 3QEIA 3CJ4A 1RT2A 3KK1A 3PV8A 3PW4A 3KD5E 2IM3A 1K1SA 5FDLA 4H4MA 1XR6A 1FKPA 5KFIA 1LW0A 4RUAA 4RW8B 3ZSVA 1HMVB 4NCBA 1RDCA 2RF2A 4B9SA 5KT4A 2P5GA 1RTHB 4F4KA 3SFUA 3VQEA 5CYMA 4W5NA 4IFVA 2Y1IA 3V6KA 4NLGA 3AVGA 1TL1A 2QKBA 4M3YA 1FK9B 2G8KA 4K8ZA 2FLLA 1IKYB 4O5BA 3RBDA 1IH7A 2W9CA 1EETA 1NK8A 2OPRA 3IRXA 3BJYA 1HJRA 1RBTA 4I2PB 5EDWA 3I0RA 1TK8A 4FLUA 1S1WB 4DMNA 4IFYB 2WHOA 5KFPA 3CFPA 2HHUA 4NLSA 4FJLA 1BIUA 1KTQA 3NHGA 1F21A 1SV5A 3AVCA 4QOZB 3BSOA 3V4IA 4AHVA 4MK8A 1KLMA 2YHAA 4FLZA 3ZSQA 4RNHA 3KHLA 3SUNA 4CJPA 3HP6A 1W25A 4O3RA 3QIPB 4B9LA 4GC6A 3OYHA 3KKSA 3LDSA 1JLEB 4KB0A 4YNQA 2X74A 4C8NA 1N48A 2R8KA 1BI4A 3IS9B 3DYAB 3UDLA 1X9MA 1S6PB 4G3IA 1BCMA 4FW2A 4O55A 3M8QA 3ISND 4K4VA 2AGQA 4BE2A 4F3OA 3K5NA 4IG0A 4NLQA 3ZSYA 4KREA 3E01B 3DLEA 3OL9A 4J9NA 2XHBA 2OPPA 3CJ2A 4O4RA 1HPZA 1S6QB 5C42B 1G15A 3KLEA 3OHBA 2WB4A 1BQMB 3MXJA 4ID5B 2WCXA 3M8PA 2FBTA 3RBEA 1NKBA 3HSTB 4M3WA 4CE9A 5KFVA 3LP0A 4DTJA 4Z4HA 5L1KA 1HNVB 4ECSA 2ATLA 3QO9B 1CXUA 2CJQA 3RB4A 2Z1JA 2YNGB 2FBVA 4NLPA 4EEYA 2KW4A 3ZSRA 1WSHA 4QAGA 3RR8A 4W5RA 1QHTA 1JL2A 3AVKA 1JXBA 3JYTA 2GBZA 4DU3A 2E9TA 4KTZA 2YKNB 3VQ9A 3UQSA 3SFGA 3GV5B 2IC3B 1B92A 3PX0A 3QZ7A 3TQ1A 4F2RA 3T5KA 4JS4A 2D0AA 2W8LA 3MR5A 2G8IA 2HHSA 1S0OA 1D9DA 4ED8A 4NCGB 1ZBLA 4E7KA 3NGDA 5L1JA 3H5SA 1JLFB 1RT6A 5CY4A 1Z26A 5HRNA 2DPJA 3BGRB 3TAMB 3OL8A 2FC0A 3I0SA 3V9WA 3MECA 2YHBA 3M8SA 2HWHA 4Z4CA 2ETJA 1NK5A 4NYNA 4CK2A 2VG7A 4DL2A 3DMJB 4R8UA 4I9QA 4KHMA 3LALA 3AO1A 4J9SA 5KG3A 1XI1A 2UVVA 1GOAA 4NLTA 4FVMA 4IRKA 4EO8A 4I9LA 3DOLB 4CHPA 5DG7A 1HYZA 4DL7A 4DWIA 3LWLA 3MF5A 3PJWA 4FJMA 1TVRA 2OPQA 1IKWB 3BQ2A 4NLWA 3G6XA 4RNOA 4O44B 3CWJA 4I7FB 3D5MA 3LZJA 5J2NB 3WNEA 4DSEA 1L3SA 1TV6B 4DEZA 4O3QA 3HM9A 5F8JA 2ILZA 1S1TA 5K14B 2E6LA 4NZ0A 1TKDA 3QEXA 2DFEA 3NH1A 3VQBA 4QWDA 4ELVA 3SCXA 3ULDA 3DI6B 3PW5A 4UQGA 5J2QA 5DGAA 1S1UA 1DLOB 5SZTA 2HW3A 3NH2A 3SQ4A 3PO5A 1ZTWA 1X9SA 4R5PA 4RW7A 3QIOA 1TKXA 2V9WA 2XY8A 1NJYA 3SNNA 1NNDA 1RTJB 3N6LA 4FJHA 4J9KA 1LW2A 4F4XA 4ECUA 1JLCA 3NAHA 4HHTA 4HCBA 3NFAA 3BR9A 3KIOA 3MEEB 4ZP7A 2J6TA 4NLYA 3CG7A 4FCYA 4YFUA 1L5UA 4PQUB 1IKXB 2YNFB 1YVUA 2R2UA 4ED0A 2YNIB 4ZVGA 1S9FA 4KPYA 1RT1B 4O0JA 2BE2B 5J2PB 1MU2A 3AVLA 3TAQA 3V1OA 3EPIA 3P83D 4DTPA 4FYDA 4AHUA 3U3YA 4BE1A 5SWMA 2D7SA 4IG3A 4CJVA 4ZHRB 3FQLA 4Q0BB 4KKOB 4CK3A 4M41A 3IG1B 1T94A 4EP5A 4N47A 4CGIA 1HQEB 4F50A 4M3RA 3KTQA 5CZ2A 2UUTA 3NGIA 2R7YA 1SL2A 4DTSA 5EWFA 3MXMA 3AA2A 4KHQA 1JLQB 2OPSB 3SUQA 5KG1A 1QE1B 4B8CA 3KLFB 3VQDA 2QKKA 2HMIA 4H4OB 3DOKA 2HAIA 3KMSA 2VA3A 1LWCA 1NOYA 4J2BA 4CIFA 3I5CA 2F8SA 2PYJA 4FS1A 4FJNA 1T8EA 4QCLA 3NKYA 4CJ5A 3ZSWA 3KMQA 3PUFA 4CJLA 3UIQA 1RT5A 2KTQA 2GC8A 2ZE2A 2BRLA 1K1QA 1ZBFA 4CJUA 3BDPA 4H54A 2VWJA 1GOBA 5KRTA 5D3GB 1JLGB 4RW9A 4RW6B 1S1XB 5KT7A 1RT4A 1DTTB 3I5AA 2ZKUA 4EYHB 1WN7A 5KFHA 3OYEA 4M42A 4CF9A 4RG8A 3C6UA 5EUHA 4IQXA 3DLBA 3AVHA 4Y1CA 3M9NB 4Z4GA 1CZBA 3MEGA 3RTVA 1NKEA 1BQNA 5KG6A 3MR2A 4ELTA 4PUOA 5KFUA 3M9MB 4DFPA 3TAEA 4LSNA 3DLKA 3NBPA 3KHHA 5KFAA 1EKEA 5I42A 2XI2A 3FQKA 2PY5A 5C24B 4EZ6A 1RT3B 1VRUB 2RKIB 4DTNA 2RDIA 3HPGA 2XGQA 3QYYA 3HVWA 3PW2A 2ILYA 1VSKA 3T5LA 3TANA 4DG1B 4JV0A 5J2MB 2JC1A 4LY7A 3VN5A 4DSJA 3V6DB 3AO5A 3DRRB 1JLBB 3RRGA 3KLIB 4Y2CA 5JUMA 3FSIA 2F96A 2YKMB 2ALZA 2XY5A 4FJJA 1T03A 1JLAA 5JS1A 2I5JB 2A1RA 4K50A 1C6VA 1RDAA 1WSJA 4E7IA 1BL3A 4JUZA 3DRSA 4KB7A 4RW4B 1OS5A 4DQPA 2HHQA 3V9XA 2HNDA 4B3OA 4LSLA 3ZT1A 1S0MA 1X9WA 3KK3B 2JEGA 4FXDA 3LWMA 1JLEA 1MMLA 4ICLB 4DQSA 4DF8A 1C1CB 1EP4A 5KFZA 2R8GA 2W9BA 1N4LA 4M3ZA 3AVMA 3K58A 2ZD1A 3KK2B 4IDKA 3SI8A 4DFMA 5KFFA 3LP3A 1WAJA 4FJ9A 4NRUA 4AHSA 3OYFA 3E01A 3OJSA 4MFBA 4BE0A 1O1WA 1C0TB 5KFXA 4IH7A 3OYAA 1D0EA 4TYAA 5CYQA 4ZP6A 1HNIB 1R0AB 3CFOA 3OVNA 4GVMA 1KRPA 2GV9A 4URGA 3QEVA 3WNHA 3NF9A 4DSLA 2BQ3A 2IAJB 4AHTA 4FLTA 4YMEA 1FKOB 4KFBB 4ECQA 4PWDB 2WONA 1S9GB 2YNGA 4O3SA 4DS5A 2AJQA 3KOAA 1REVB 2KZZA 2C22A 4RU9A 3C95A 3GYNA 3V81B 1VK0A 4FJKA 1SUQB 5KFLA 3VQCA 3HKWA 4QW9A 1TKTB 1N6QA 1RTDA 1KHVA 3DLGB 4CJTA 1UWBB 2D5RA 2IM2A 4DTOA 2XO7A 4N41A 3AVFA 2ZQBA 3ZT2A 2YNHA 4JRQA 2BANB 3H5YA 1JXLA 3ASMA 3SUOA 3HT3A 4CEEA 3D45A 3JSMB 2FVQA 4Y1DA 1NHVA 3HVTB 4NCAA 3TAMA 3IGVA 1VRTA 1VSMA 1LAVA 4EP4A 4ZP9A 1RT7A 1KCFA 3VQQA 2DFHA 5KFRA 2FBXA 3HJFA 4FZXC 2VG6B 2B4JA 4HYKA 3MTKA 3SZ2A 4ZPDA 4GC7A 4IH5A 4CECA 4FM0A 2GIQA 4KHWA 2HNYB 4Y2AA 4TY8B 3ZT0A 2KQ2A 3D28A 2HVHA 5F9LA 4NYFA 4N56A 4KAZA 4OKEA 2QV6A 4KV8A 4NLOA 4ZVHA 4AILC 1S9EA 4QW8A 2D0BA 1IKWA 4TSXA 4RUCA 1TGOA 3QGIA 3DRPB 4O44A 4FM1A 3OYNA 4QWBA 4E0DA 4NLUA 4RNMA 1IM4A 1JKHB 2V0NA 4KI4A 5KI6A 4E1MA 4E7JA 3BREA 3OS0A 3RB3A 4B9VA 1LWFB 3AVIA 4C8MA 1ZBIA 4KTQA 3LANA 2B5JB 1HYSB 4FJ5A 2WOMA 4E7LA 3AO2A 3M8RA 3BSAA 4F8RA 5C25B 4CGGA 3L8BA 2HNZB 1U48A 1RTIA 1TKZA 3EZUA 3RMDA 4DS4A 1RTJA 3KLGB 1L3VA 1N5YB 4EBEA 4CGHA 4KAIA 4CFDA 3KJVA 1VSIA 4CEQA 1QSYA 1BIZA 1IKVB 3HPOA 2D3ZA 4EO6A 3K2PA 4G1QA 5F8NA 1JIHA 3PZPA 5I3UB 4ZVEA 3KK1B 1X1PA 4PQUA 4KB1A 3QLHA 3VQPA 1XC9A 3P5JA 5FDLB 4H4MB 1RYRA 1FKPB 1S4FA 4CERA 3GQCA 2G8WA 2RF2B 3WNGA 4KSEB 1VSDA 3ITHB 4DQIA 2HVIA 3P1GA 4ZHRA 5CYMB 4CJFA 4IFVB 1C0MA 4Q0BA 1TL1B 4YR2A 2LSNA 4QWAA 3IG1A 3TVKA 2WK4A 4JRPA 1CXQA 3TAPA 3CJ5A 3NF7A 3LP1B 2W9CB 3PX6A 3DLHA 3TR8A 2OPRB 5HROA 2OZMA 4LH4A 2G8UA 4CF8A 1WLJA 3AO3A 3KLFA 5KFWA 1RILA 4Q45A 2C2EA 4TQSA 5HP1A 4H4OA 1RA6A 1QSLA 3H4DA 1RYSA 4CJ3A 4F4ZA 4FZZA 3OL6A 1SV5B 2V4RA 3VQ4A 4Z0UA 3NH0A 3V4IB 2UVWA 4ECRA 3FFIB 2W7OA 3ALYA 4CHOA 4BWJA 1Y97A 2RDJA 1KLMB 3UR0A 3CQ8A 3MEDA 5HLFA 1HQUB 3OYDA 4MK7A 4M3UA 3RMBA 3OYKA 4X2BA 3M9OB 3AA4A 4QWEA 3ZT4A 3O4QA 4ECXA 4DSIA 4OKKA 3ISNC 4OJRA 2E4LA 1BI4B 4FK4A 4RW6A 3PHEA 4KBIA 3SQ0A 5DG8A 1XHZA 4DL5A 3HXMA 4CHYA 3M8QB 4JV2A 3CM6A 5FRMA 1ZYQA 2BDPA 1T05B 3L2RA 2ASDA 3KLVA 3CDEA 1SH0A 1XR7A 2E6MA 3ZSOA 4ID1A 4IG0B 3RMAA 3AVJA 5KFOA 4J9OA 3KLHA 1NJZA 1BISA 2OPPB 3GV8B 3L2UA 1QQCA 1HPZB 3HVRA 2JEFA 2KFNA 3KLEB 5KRSA 5KFYA 3HP9A 5F8IA 2P51A 4DL3A 4U7CA 3M8PB 4FZYA 2AGOA 5DMRA 4O4GB 4K4SA 4TYBA 1D1UA 1XWLA 4FLVA 3ICLA 4CEZA 1ZBHA 5HBMA 1RA7A 1C0UA 4M95A 2BR0A 1J5OA 4WFZA 4WZQA 2X6SA 1ITGA 4K4YA 1K6YA 1J54A 3T1AA 4J2DA 1HYVA 5J2MA 1TAQA 4MIBA 3BSCA 1QAIA 1NKCA 3C6TB 2FJXA 3JYTB 4OPJA 5J1EA 2XCAA 3CO9A 1GX5A 4FJGA 1TK0A 4ZPCA 2UUWA 4ECZA 4Y34A 5KTQA 1UAXA 2X78A 4N76A 4IR1A 2IBKA 5L1IA 3G10A 4W5OA 2HHWA 2HHTA 1RT6B 1YVFA 1D9FA 2VG5A 1S1VA 2FJVA 5F8HA 1SL1A 2IS3A 2C2DA 2KZMA 4KHSA 4C8LA 3Q8PB 2EHGA 3MFIA 3ZT3A 3MECB 4CFBA 4WE1B 3MFHA 3H4BA 3EYZA 3NCIA 1LWEA 5T14A 3LP2A 3ZSXA 1BGXT 2G8FA 2R8JA 4K4TA 4KTWA 3NL0A 1ZETA 3QZ8A 3IAYA 3IN5A 2I1RA 1VSFA 3MR3A 3A2FA 1VSEA 1J53A 3LAMA 4DLEA 3SV4A 5F9NA 3RB6A 1D5AA 2OPQB 4YQWA 5E41A 4O0IA 2GUIA 3PX4A 1CLQA 2VA2A 4CJKA 3NGYA 4I2QA 3DM2A 2ASLA 1DTQB 3O3FA 2YV0X 4J2EA 3QESA 2JEJA 1S1TB 5KGWA 4CJSA 5F8LA 4C8KA 4KFBA 5DQHA 3OYGA 4PWDA 4FLXA 4RW8A 2OYQA 1HMVA 3N6NA 1TAUA 3EPGA 5DLFA 2R2RA 5J2QB 4EBCA 1S1UB 5FROA 2F8EX 3AVAA 4GW6A 1U45A 1RTHA 2JLEA 1SUQA 4B9TA 3KHRA 1XR5A 2D0CA 4R5PB 4RW7B 4OLAA 3OYIA 1TKXB 3QGGA 5KFMA 5KFKA 4DF4A 1FK9A 4Q44A 3SV3A 3KD1E 1WSEA 1TKTA 4DTUA 1IKYA 4PA1A 5HRRA 4Q5VA 1LW2B 3H5UA 5KFSA 1JLCB 1ASVA 2PZSA 4J9LA 3T19A 4I2PA 3PVXA 3K5OA 1KHWA 5KG7A 4ECWA 3VQAA 4XO0A 1S1WA 5KG2A 1KVCA 1S10A 3NF8A 4Z4IA 4IFYA 3GIJA 2P5OA 3PW0A 3CYMA 1D8YA 3BQ0A 4KO0B 1HARA 3RB0A 1C1AA 3V9SA 3GIKA 4MQ3A 4B9UA 4ED2A 2RN2A 1JL1A 4CGDA 1L3TA 4CF0A 4ZTJA 3OJUA 4KRFA 1SH2A 4FLWA 3QIPA 4LH5A 3ZSZA 3S3MA 2HHXA 1Q9YA 1NHUA 1UOCA 5KFJA 3SJJA 3NAIA 4BDPA 2G8VA 5EWGA 4MKAA 2R8IA 3T5JA 1BHLA 2O4GA 3DRPA 3IS9A 3DYAA 4QPXA 4IKFA 4URQU 1S6PA 2HMIB 3OY9A 1EX4A 2B43A 2XGPA 3OS1A 3AO4A 1VSHA 4JS5A 5EWEA 1LWCB 3V9ZA 1JKHA 2FVSA 2PYLA 3KHGA 4W5QA 3G0ZA 1YTUA 4OGCA 4KHUA 3IGNA 1S6QA 5C42A 4K4UA 1W0HA 2W8KA 1RT5B 2ZE2B 1BQMA 4K4WA 4W5TA 3RRHA 2C2RA 2XY7A 4ID5A 4Q8EA 3QNOA 4RNFA 4J2AA 2EC0A 4CEFA 1U09A 1C1BB 4NLVA 5DQGA 4AH9A 4ZP8A 1HNVA 1N5YA 3FRZA 5KFCA 4OL8A 4ED1A 3QO9A 3BSNA 1IKVA 3U3GA 3AA3A 1VSJA 4RW9B 1GOCA 3NE6A 5I3UA
chains in the Genus database with same CATH superfamily
3SMSA 5JMNA 3DHWC 4M3TA 1GX6A 3NNHA 3A3OB 4CFAA 1TK5A 4RWTA 3EE9A 2YKNA 2IA6A 3OYCA 3NVKA 5A0YA 3RAQA 5IT9Y 1TU0B 2KO1A 4JI4F 3ITHA 4NCGA 3EZ5A 2OUGA 2XZDB 3HSDA 3T9ZA 4E8UA 5AJ3J 4CJ4A 4FJ7A 5KPRA 5F41A 3H2UB 1HNZJ 4CJQA 4ELUA 3BO3A 3BGRA 2MKJA 1R43A 4FWKA 6FD1A 2M8HA 2NSBA 1QQNA 2AV5A 3C15A 2IBOA 1AFIA 2WBMA 3K9KA 4B9NA 1FVQA 4OZ1A 1WC6A 2MKKA 1MWZA 3W5ZA 3D0PA 3O9SA 3LZIA 1TYQB 3T3FA 1FJ7A 1RGVA 5KFBA 3DOLA 2HBMA 3MCMA 3H98A 1T03B 2XZTB 2DB1A 2JWKA 4U67L 1IR2A 3C16B 3FFIA 1WC3A 2DH7A 4B08A 1ICEB 3OUYB 1RZMA 2GJ2A 1K44A 1WDDA 1N5QA 2XMWA 4O3OA 4I64A 4I7FA 1NHKL 1TUUA 1YIJS 1Q81O 2ZH3A 4TN2A 2HGNA 4F3MA 1QM9A 1I94K 4C8YA 1RE1B 1WOPA 2JGUA 1PAUB 3GIIA 4NLDA 3HO1A 4HUEA 1EB0A 2ZD1B 4LQ3A 3PYDA 4QIEA 4MLEA 3TAGA 4FS2A 2YWWA 1OSCA 2FPHX 4PY5A 4UOHA 2LKZA 3SDEB 2E5JA 3GJSB 5C2DA 1HR0J 5IQ6A 1DLOA 4WXWA 2QLJB 2O8BA 3VHQA 1BQXA 3KG4A 4TQRA 3ZNUA 1IO2A 1TL3B 4HTUA 1X4AA 4HVJA 2OMOA 5A76A 1YJRA 1NK6A 1IR1A 2OCEA 4GVBA 4F36A 5DK5A 3MPUB 4EYIB 3CPWM 1AW0A 4P7TA 2BABA 2VASA 2D41A 2UVRA 2B4PA 3HHLD 5CR4A 1Q7YO 3QINA 5DM7L 4RX6A 2YNFA 3CJKA 2RRAA 4GVLA 1U04A 2XMJA 5I3QA 4KGXB 1HIYA 2ROGA 3SMPA 1GK8A 5GAEI 5FRNA 4OKJA 2IOCA 1T3OA 4FM2A 2AW0A 4HVZA 3K59A 2MGZA 2IRYA 3M5RA 3U7JA 4W92B 1DURA 2V69A 2KXNB 4X65J 3PY8A 1UJ5A 4TXSA 3PR5B 2IJFA 2Z2YB 2QI2A 1TUVA 1JLQA 1I6JA 4H5NA 3Q7BA 3FSYA 4Z37A 2KG0A 1UA0A 2WW8A 2DR9A 4B3SF 3T1YJ 3K5MA 4ETXA 1R3NA 4QIFA 2XS5A 5K20B 4E3SA 1Q7YT 2CWXA 4WE1A 1VQMS 3M6UA 4FWNA 3CCVN 2PEHA 4M5LA 3VEYA 4JI5F 5AXLA 3B6OA 4WFYA 5IT0A 3JSRA 5G0RA 4ZIVA 3OYBA 1NCLA 2VODA 5KGXA 2JC0A 5M1OA 4HKQA 1NH8A 4K8RA 4C8ZA 4HCCA 1NJWA 1X0PA 4UOGA 1FA0A 2AX1A 3BBBA 3G8TA 4CZKA 4ISFA 1JLGA 3ENAA 3GE9A 2W2PP 3T41A 1H1VA 1SQKA 2LU1A 3JAMU 3ZNJ1 1XQIA 2AQ4A 3OR2B 4H5RA 4DFKA 3FK4A 4DV0F 3H7HB 4MK9A 1VMBA 4IFEA 3ZFVA 2FDNA 3CDUA 3D2WA 2IGIA 4B1YB 4N7TA 3UB5A 4X64K 4HI2A 3POTA 2FF6A 2KFZA 5KG0A 2PA3A 1VR6A 1IG9A 1IBMJ 2DRBA 1HNXF 3VA0A 1TKZB 4ZLNA 3LP0B 3THWB 1RT3A 1VRUA 4MIWA 1VC0A 2IDLA 1NGAA 2GQQA 2CJKA 1QSSA 3G96A 1BMQB 2R2SA 5T7BA 1NB7A 2A6OA 4AQYK 1RB0A 3QLHB 1RDBA 3R27A 2ROPA 3CT9A 2YTCA 4KO0A 3SPZA 4B1WB 1S79A 3G82B 2VC1A 3OL7A 2MY7A 2I5JA 3G6VA 2YWKA 4NXNF 5LT5A 1IBLF 4X62J 3SUPA 1B99A 3UD4P 3TARA 4G6VB 2AU0A 2IDOA 5EU7A 4CHQA 2E1ZA 5DETA 3OLAA 5AQHA 3I0SB 4FO0A 4M94A 2FJAB 1U2FA 3MOZA 4N5SA 4LQ9A 4CLFA 2FB0A 2UV8G 4F2SA 1S99A 4E89A 1GMVA 2B0GA 2AWZA 4DLGA 3S3NA 1Z05A 3EDQB 3DXMB 1C0TA 2UUAJ 1UZDA 5AZJA 4XPCA 3BH6B 2JSXA 1W26A 5L9NA 3E51A 4OIXA 2GVZB 4LF5F 5HJYA 4KHNA 5E5NA 3DFEA 1GMUA 3FGVA 2BH1A 4JEPA 4ANDA 4DTXA 2LQBA 3L0QA 1Y4ZB 1WAFA 1S9GA 3GG1A 4DU4A 1UVMA 2CGKA 3SQGB 3E9PA 2DGQA 4LVOP 5KT2A 2AJ4A 1ZBUA 1P6TA 2RS8A 4J9PA 2B4UA 4IYQA 5E26A 3SQ2A 5KQDA 1YBTA 3AJ1A 1KS2A 4JI8K 2CJYB 4CJWA 1TR0A 5BRDA 1R31A 4CJRA 2YQ3A 3C14A 3E2EA 4E1NA 4LR7A 2AZ3A 1UWBA 1WF2A 1S0NA 1O13A 1KVAA 3O9TA 3TABA 3QWPA 2WVBA 3BF4A 3CCJN 3CJAA 5HBMB 4BACA 1GMWA 4NLXA 3VALA 3F41A 4A8XA 1J5OB 3M32B 4HH1A 1MU2B 1X0FA 4CD3A 1MDUB 1GTEA 1WNSA 4YOUA 3TI0A 1W7WA 4DSFA 4IG3B 4C0OC 4FOIA 4YR3A 4F3TA 2HNYA 2WZ1A 3BGLA 5E84A 1U7LA 2ZVSA 4TY8A 3US5A 1CJTA 1YQHA 2KB2A 4J9VA 1VIOA 4JHDB 2ASJA 4ZJQA 4LRFA 2DTUA 3S6EA 2H9ZA 2BOAA 4DV6J 2ZUGA 5GAHP 1NMEB 4ED3A 4NLRA 3BBFA 2CKWA 3HK2A 2MQPA 5H9EK 2IVOA 3SQ1A 4WZMA 5KFEA 1TQLA 5D4LA 2EK6A 1LWEB 3VGUA 1AA1B 4C0HA 3LP2B 2B5JA 3ENVA 3SDEA 5SUHA 3M30A 3L3CA 1RAOA 1TUYA 2E9RX 3UVJA 3QGPA 4O3PA 1UJ6A 2C3MA 4JI2F 5C25A 4BC9A 5A6WA 2HNZA 3VQSA 2HHVA 2QYGA 3G86A 1U0HB 4FVCA 3PKYA 1TL3A 3QFHA 2IMWP 2YWEA 5ETRA 2KT2A 4I68A 4OI2A 5LSRA 1YJTA 3GSIA 3IAS9 4X4TA 4QS7A 4IOAQ 1FDNA 3KNAA 1OH7A 2EI5A 3VVUA 4H0YB 2F7TA 1LXNA 2W4CA 1JX4A 3QEIA 2GQCA 2BEFA 3KK1A 4LF6J 1NSKL 5IFMA 1XR6A 3UN2A 2VONA 4RW8B 2FHJD 4K43A 3GU0A 2E5GA 3RVCA 4B9SA 3LDNA 4PRFA 2Q3PA 3J81U 3SFUA 5CYMA 1NLVA 1H0HB 5TKWA 4M3YA 4GKKF 3EKUA 1R6VA 1FRHA 3RBDA 1OVQA 2KHOA 3CJ8A 1HHQA 2W9CA 2Z2MA 3AY0A 2BOPA 2A41A 1MWYA 1HBOB 5BR8F 1V9OA 2F4FA 2HSEB 4ZVRB 1S1WB 4IFYB 2WHOA 4IOXA 5KFPA 3DKDA 1T9TA 2DO0A 2J0SD 2BUPA 5AQQA 3BKFA 1F21A 3CCMS 3E1YA 3AVCA 2IMOA 3BSOA 2LLZA 4E2FB 4AHVA 3IA0A 4LR9A 5EX0A 2HHHF 3SUNA 1D09B 3HP6A 4CJPA 3LOUA 2LQJA 4USVA 1ZH5A 1WKLA 4P2SA 1N5SA 4JD2B 3PJ9A 2JRSA 2M0GB 2O8FB 2CH6A 5E2QA 4L3QA 1UEVA 4YNQA 4I67A 2IVNA 1X9MA 1S6PB 4F0KA 4G3IA 2GMHA 4X4UA 3M8QA 1Q18A 4K4VA 3M6WA 4WP3A 2QA2A 3OBYA 5AQGA 5EY4A 2KDOA 4TLQA 1Q5YA 1WC5A 2D74B 3CJ2A 3K89A 5C42B 2E2NA 3DXBA 4DOZA 3OHBA 4JKFA 2V68A 5BJRA 4N8NA 4K42A 1S12A 2RAQA 1NKBA 2K7KA 3BZKA 4CE9A 3LP0A 1XJWB 1EHWA 4ECSA 2ATLA 2ACYA 4MT1A 1RADB 4B1XB 1XC3A 3MN5A 3RB4A 3VMFB 2YNGB 1ZXOA 2FBVA 1EJ7L 2OO4A 2KW4A 3FMWA 2Q36A 2Z2LA 4L76A 1LOTB 1QHTA 4YHHJ 3JYTA 4ANCA 2E9TA 3SFGA 3GV5B 5AXNA 5DDPC 2DJWA 3PHTA 3ADAC 3PX0A 3QZ7A 3TZXA 1M5OC 4F2RA 3T5KA 2D0AA 4DR5K 1FJEB 4CD1A 3R3LA 1ZBLA 2HAFA 2Y8WA 3MCAB 4E7KA 4DR2K 3NGDA 1JLFB 1RT6A 3ZLJA 5HRNA 3TTCA 4QYZJ 1XMOK 1WF0A 1WSRA 4AFFA 2DCLA 3I0SA 3V9WA 4YY3J 3M8SA 1FFSB 1NK5A 3MX5A 2HQIA 1NO8A 4I9QA 3D3BJ 3MMJA 5D78A 3LALA 3AO1A 4J9SA 5KG3A 4FYXB 4M5KA 1KQFB 2XLKA 2QX0A 1AB8A 4TU7A 1UAWA 4ED5A 1HYZA 1TMMA 3DXMA 3MF5A 1Y3JA 5D0HA 3F44A 3BQ2A 4DV1K 3OTEA 3G6XA 4O44B 2HIYA 3LZJA 5J2NB 1URRA 3TX0A 2VCPA 2ZC3A 3I82A 5F8JA 3BH7B 1XMQJ 4EGLA 3R6MA 1S1TA 2N3LA 5K14B 4CTAA 3IMQJ 4NZ0A 3QEXA 4YORA 3VQBA 3SCXA 4UQGA 3PW5A 3PEJA 1DQ9A 2GWJA 1RHMB 1SIZA 5J2QA 5HO4A 2I0XA 5M2PA 3VPZA 2HW3A 4MO4A 5THWA 1X9SA 2NNWA 4RW7A 3QIOA 3PIOQ 5B0DA 2V9WA 2XY8A 3R2DJ 3FZMA 1HNWK 1WTBA 4RL1A 1BWEA 3CDBA 1YITN 4OI4A 4J9KA 1RTZA 2AYEA 2BA9A 1RWNB 3NFAA 4FWMA 3MMBB 3G71N 3KIOA 2VF3A 3J80U 4H4KC 2VHGA 3CG7A 2XMVA 1L5UA 4PQUB 1IKXB 2K06A 2VQEJ 4X4SA 1S9FA 2DXDA 1RT1B 4O0JA 2BE2B 1MU2A 2DYAA 4WIIA 3TAQA 3CCVS 2JHEA 3P83D 2ZKTA 4LF9F 5C12A 2R7TA 1T11A 3VTHA 4BE1A 4OV6A 4IG3A 1Q79A 3F0NA 5FIIA 2VPWB 4RLEA 2J8AA 4EP5A 2FJEB 1HQEB 4F50A 2XWXA 4JHDA 3M1VA 4DR7J 2EEYA 3N9UC 2E1MC 1FX4A 3CEDA 1CULB 4LF8K 3BZQA 4K5RA 5AJ3F 4CJVA 2D1CA 2QKKA 2JH3A 3ZETB 2VA3A 3OFFA 4AM6A 2F8SA 4K7QA 3I9V9 3D7SB 5AE1A 2H54B 4MDBA 1F5BA 5GMKa 3CJTA 2OTLS 1K1QA 4F7VA 3QRRA 1ZBFA 4CJUA 4AF1A 2B3TB 3BDPA 3K2YA 5JVGL 2NXUA 3AAPA 4KH5A 3LF0A 4JI7J 2OAUA 5DDQC 2X51A 1XQSC 4DV4K 4FKYA 1U8SA 3X1LB 5C2GA 4BRAA 2ZKUA 1WN7A 5KFHA 3E3XA 2ZJQL 1VFJA 2FHJA 4OYAA 3C6UA 4OZLA 2RQCA 4ZDNA 3Q8YA 1KVIA 3HCXA 5F0WA 3ZX2A 1Z1ZA 3MTJA 2W24A 4PUOA 1HR0F 2UU9K 3BEGB 3TAEA 2ZJPL 4PG8A 5AQNA 4BRCA 3NBPA 5IT9U 1EKEA 5I42A 3FQKA 2PY5A 3M6XA 4J5OA 4DTNA 1FRKA 1WUUA 2RU9A 3QYYA 3N5BA 4I6YA 4IO1A 4JKGA 4NL5A 4JV0A 1S0VA 2JC1A 4AL6A 2VQFK 1IUJA 3AD8C 3HDSA 1JLBB 3RRGA 3KLIB 3R3TA 4Y2CA 3WUHA 3NY0A 5HQMA 2F96A 3BF3A 5JS1A 1ZPWX 1H74A 2V7YA 1C6VA 4E7IA 3U9ZA 1VYAA 3DRSA 1ULRA 3B4DA 1Q8LA 5M2RA 1KN6A 1X9WA 4LFBF 3KK7A 1FNXH 2ZH4A 4JD2A 4FXDA 4USWA 1DZ5A 2PFFB 5A2QO 2O8FA 2KVQE 1NGDA 2K2PA 3K58A 2MHEA 1KOHA 1UPPA 4DHYA 1SBRA 4JN4A 3CC7S 2NXJA 1OO0B 3T1YF 4KH0B 5KFFA 3LP3A 4G9ZA 2RSQA 3OYFA 3GFXA 3OJSA 1Z2ZA 2LFVA 1Y7PA 4V19J 3HFKA 2A6MA 2L3MA 2VBYA 5CYQA 2MB0B 2Z2ZA 4ZJOA 3EVMA 5B08A 4USKA 1HNIB 5LMUJ 4DV7K 4GVMA 4YDUC 4FXVA 2GV9A 4URGA 1SC6A 3QMQA 2YQ0A 1RDUA 4DSLA 5FPEA 2N7CA 4FLTA 1MROB 2VZ9A 1LFWA 2DEJA 1ZOTA 4KFBB 2XMAA 2B8QA 3FBBA 1EQ0A 2HBQB 2YNGA 2D3O1 4DS5A 1KWMA 1S72N 2NLXA 3EXCX 1O0PA 4LF4K 2R7SA 3V81B 3CJQA 4FWRA 4IEEA 4UY8O 2XBPA 1D4XA 2DTJA 2O8DA 2XB2D 2P9NA 3IM9A 1KHVA 4CJTA 4K25A 2RE1A 4ZN3A 4OLOA 1XBWA 4N8OA 3M8YA 2XO7A 2HLUA 3W5XA 2ZQBA 3R5CA 2XS2A 2YNHA 4JRQA 2BANB 3IWXA 3TZWA 3HT3A 3D45A 4XAKA 2FVQA 5CE3A 1K0VA 2WC9A 1NGHA 4K59A 4RBVA 3HVTB 4BLGA 4NCAA 1VSMA 2FJDB 3NG8A 3VQTA 2F9JA 2JWNA 4L73A 4A8FA 2GIFA 4USTA 2DHSA 1KCFA 5KFRA 3AAWB 5CA5A 2DNQA 2FZGB 4C48A 1N0VC 1G2EA 5GADI 2H48B 3MK6A 2GIQA 1WELA 4Y2AA 2HRTA 2CQ1A 2A5XA 2A2CA 5F9LA 2YWGA 4KAZA 1H72C 4KGMA 4NLOA 4QW8A 2D0BA 2ZBIA 4IO8A 2CPXA 1JXVA 4X62F 4O44A 2ZH2A 5IV3A 3OTDA 1K9MO 3SCJE 4I6MB 1KQKA 4RNMA 4PXBA 3U27A 4KI4A 1N36J 3R7NB 3UNYA 3AVIA 3D6FB 4DR3K 3T1HJ 2CA9A 3CMQA 2HKEA 4R0JA 3R5JB 3BSAA 1KC8T 1K8KB 2YQ1A 1QVFM 4CGGA 4ZVUB 2HS4A 1M5HA 4OJHA 5BN8A 3A8KA 3EZUA 3RMDA 4LMZA 2UUAF 1L3VA 4CGHA 4CEQA 3HPOA 1K0TA 3K2PA 4RO0A 2EK1A 1JIHA 3PZPA 3JQJA 5I3UB 1GLJO 3A8YA 4ZVEA 4QU7A 1X1PA 2ZC4A 4PQUA 1YJNS 1XC9A 3CJBA 2HBZB 3CW2C 1VLOA 1WOOA 1Q4RA 2HLTA 2G8WA 2RF2B 5B8HA 4JYAK 2V8PA 2HVIA 4ZK7M 1FRLA 4OLPA 4CO0A 1TL1B 3MZIA 1U2VA 4DPYA 1WBDA 2QFIA 2QL7B 3MM8B 3TEGA 4C7QA 3LP1B 3DDNA 3TR8A 4KH6A 4DR1J 1CULA 3W1YC 1APSA 5CAAA 3HRGA 1RILA 4TQSA 1RA6A 1QZ5A 4M7XA 4ZS6A 3KVGA 1EWRA 2HBJA 3OQ2A 4HI1A 4C1NK 4F4ZA 4FZZA 1KOOA 1KD1O 3EVWA 2F4VJ 2LP4A 1M5KC 2HIQA 3NH0A 5JJBA 1Y5LB 1T0TV 3RSEA 1KLMB 3CQ8A 3GIRA 5HLFA 4KT0C 1V3SA 2UUCK 1HQUB 3WEEA 3OYDA 1WJ9A 3OYKA 2VGNA 3DCAA 1JNZB 1U6BA 3GCXP 4OKKA 3ISNC 4OJRA 2D0PA 4DV6F 4C4WA 2YKOA 3IWLA 1QQOA 2NRVA 5DG8A 4DL5A 4NYPA 1W2BM 2V7ZA 1ZYQA 2BDPA 3VGKA 3L2RA 4X64F 2IJRA 3KLVA 1SJ4P 4PG4A 2E6MA 2DNLA 4IG0B 1BXNA 4ENOA 2BJ7A 3AD9C 2B56A 3MMCA 1HPZB 1KD1T 5KRSA 2L08A 1ZC6A 1CJUA 1YK9A 4GO7X 5M1NA 4HHJA 1JWWA 2VH7A 3TPQA 3M8PB 2AGOA 2KM8C 1LNQA 4O4GB 4TYBA 4NA3A 1RA7A 1C0UA 2BR0A 3EE8A 4AQYF 3O5TB 1YJWN 4WFZA 4ED4A 2G2YA 4OX9K 4K4YA 1J54A 4J2DA 4MIBA 1IN0A 5K8MA 2CQGA 2IVYA 1QAIA 3BGFA 3BSCA 3C6TB 5J1EA 1FDDA 3CO9A 3BB5A 3K9JA 3SQOP 1HI0P 4ZPCA 5AFUA 1VQON 4I56A 5L1IA 2ZBQA 5K8PA 3LM2A 3EICA 2RRBA 3U02A 2JVRA 2NQPA 4OPAA 5EVZA 1I5OB 3QSIA 3O80A 4GRSA 4DDFA 4GV3A 3ILOA 2J0XA 2RHSB 3MECB 5I9EB 3PIPL 3H4BA 3EYZA 2AD9A 4FWOA 3O3LA 2EKNA 1Z6RA 2FLOA 3IAYA 3ID6A 4LIWA 1VSFA 3MR3A 2OEKA 1VSEA 2Y1LB 4UZCA 4NI2B 3VEOA 3SV4A 5DDRC 3TA0A 4H0XB 3TTFA 1D9AA 3AD7C 2CNNB 4YQWA 5E41A 1YITS 2QWLA 2QXLA 2ZUAA 2VA2A 4JKEA 3ZX0A 3WC2A 4KGKA 2RB7A 3G71S 2CQCA 4J2EA 2LEBA 1HLWA 5JVGQ 4EHUA 1N0UA 2QLWA 3SK3A 4X66K 2OTJN 4KFBA 5DQHA 3LDLA 3OYGA 4DV3K 2OYQA 2V4JB 1HMVA 3N6NA 4H03B 3HHDA 2HFUA 2VIHA 3VAJA 4M5MA 1RTHA 5E33A 4OLAA 3ZTSA 1TKXB 4M1KA 1NU0A 2YKAA 4H0OA 5EX5A 4CLTA 1XTZA 1WSEA 1IKYA 3U1NA 5AQFA 3IAM9 4UTGA 4NXMK 4Q5VA 1H2TZ 3H5UA 4DN0A 4CO3A 1W7AA 2PZSA 4ZPTR 1FJGJ 3PVXA 1KHWA 2UXDJ 5KG7A 4ECWA 4XO0A 2WBNA 5KG2A 1KVCA 3NF8A 1A9NB 2RS2A 3PW0A 3CYMA 1VQ4N 2VFUA 1HARA 1NNEA 2CVIA 3RB0A 3V9SA 4JOUA 4LF7K 3LPYA 4IUFA 3DXSX 4OJ3A 4B9UA 4ED2A 1FDBA 4BREA 3FJ2A 1GAOA 5DM6Q 2HYIB 3CUNA 5B09A 2MZJA 2E5LJ 3NNAA 5A8KA 4ES2A 4ZTJA 3W7BA 2DR8A 2LECA 4LH5A 2W6LA 5LJWA 3SJJA 4PZVA 2XYGB 3O5BA 4GO5X 1FTRA 1QHAA 3J7Z5 3AJ2A 3PNIA 2BKOA 5T7LA 2R8IA 3ENQA 1BHLA 4IKFA 1VSHA 3NCQA 4I6MA 3D4JA 4HDGA 4WQ4A 1YTUA 1UP1A 4KHUA 1S6QA 1JCFA 4K4UA 4Y0WA 1LXJA 4K4WA 4QS9A 2C2RA 1GLBG 2K1RB 4ID5A 4HT7A 1K8KA 3JTPA 2D69A 3FBFA 1Q5VA 4XH4A 1C1BB 4NLVA 4C3LA 3HTVA 2GJIA 4AH9A 5LSLA 1FHTA 5ADXH 1YSJA 4NWBA 3IM8A 5H9FJ 5I3UA 1JXEA 2UYTA 3UD5A 2HBKA 5JLFA 2IC3A 2HF4A 2ZVIA 4IOBA 1EAYC 1NH7A 4LVNP 4KHYA 3IBFB 2XHWA 3H5XA 3GBTA 3WXIA 5HRSA 5FPMA 1VK3A 1OY9A 3Q8RB 3OXGA 2QL5B 4CM0A 4LSNB 3C6AA 3VQ7A 5M1KA 3DLKB 1VDHA 3NS7B 1ASUA 5D4PA 3G4SN 3LP1A 1FD8A 3FZFA 5DLGA 1H2UX 5AXMA 3OYLA 4BQZA 3OXLA 2YHYA 3DMJA 3NOGA 4DX7A 2Q3SA 3VAGA 4KHRA 2VKRA 3C3LA 2UP1A 2FLNA 2N4DA 1O6XA 2VV5A 2VQEF 3LW5C 2O4IA 1P8ZA 1JLAB 1Q82O 3CXCR 1YF5L 4QWCA 3TTDA 3MCNA 3VVTA 4PABA 2QWRA 5IM0A 1FF2A 3MD1A 4X66J 5AQTA 1S5JA 2GO8A 3LPUA 3I33A 1RAJA 4FW1A 1BUPA 1HQUA 2HNDB 1E6YB 1TV6A 1N33K 1R8HA 1Q8BA 2V4QA 2DGVA 3CCES 4LIRA 5ETLA 2W9BB 2AYGA 2XY6A 3ENOA 2IVFB 1FEEA 1LQ9A 2G1HA 2MLXA 4FLYA 4JI0J 1NGIA 4B8AB 4PKIA 5AQVA 2PEBA 4IRCA 1RDDA 2MQ8A 1S72S 2IM1A 2ZJRL 1ATSA 3EXYA 2YVSA 1G99A 2P9UA 1NDLA 3CVKA 3DOMB 4CO4A 2J6SA 1ZM2A 4I69A 2QLFB 4MFBB 3WBZA 1CJKB 3R8EA 2A0FB 5HVFA 3HULA 1PGZA 1PILA 1UPMB 2Z8QA 2MXYA 2VDHA 1Q82T 4EFHA 1FWPA 4FK0A 4YP3A 4A8SA 2Q31A 2LA4A 3HSCA 2OH2A 3L2WA 2KM8B 2WBRA 4O4GA 4CF1A 5GAHI 4A4JA 1X4EA 2EFQA 5KT6A 1RACB 2XMTA 4GKJK 2WONB 4ZJLA 1RDRA 3OHAA 4GMJB 5J2PA 3LDQA 2QXFA 2HSTA 2OD4A 4RZRA 3RW6A 4P52A 3AVNA 1MN9A 3MPVA 3C6TA 3KKRA 3O9QA 3O3HA 4DR2F 1N88A 1B9FA 8AT1B 4KKOA 3TZYA 2R7RA 2LXUA 1SKRA 1WKJA 1N6QB 2AEMA 3K57A 4FZVA 4ES3A 4RWXA 1S5ZA 2W2MP 1RAGB 4CI6A 3MR6A 2OPSA 4WYLA 2K8GA 1QE1A 3HD2A 2BRKA 2HRUA 4R0EA 3GTYX 2IY5B 4RNNA 5DG9A 1NGGA 3NOCA 3Q7CA 3PXGa 2BE9B 2XCPA 2AX0A 4DR6J 2DNKA 1XK8A 4B3SK 1SKSA 3NMAA 3QBWA 3CM5A 2G0CA 3VGTA 2HQGA 2J0WA 3B54A 4DQQA 2CJXB 3VQ5A 1SC4B 4ED6A 5GMDA 2QG9B 3FKBA 4FOEA 4KV8B 3TSUA 4JKDA 4OZNA 3VQ8A 4FWQA 3P5BP 4JKCA 5D3GA 4JI3J 3F73A 2E8AA 3VEVA 4YDUA 3RWUA 3UPFA 5KT5A 1S1XA 3MEKA 3TAFA 4B02A 1CC7A 4FBTA 1WHXA 1ELOA 3VTIA 1BA0A 5B0CA 3O1LA 3PJXA 3DLEB 1YT3A 3HOSA 1B7YB 3HHNB 2DPIA 3NGZA 4PAAA 2RDDA 1PAEX 2POKA 4J91A 3H08A 4ECYA 3L2QA 1A5WA 2Q6CA 2GGPB 4OHYA 4A59A 4ERDA 3TUIC 1YJ9S 1RTIB 2P9IA 5AQPA 2Z1HA 1EARA 1KR4A 3G8SA 2DCUB 3CC2N 2RKIA 1KNZA 3KJVB 4A8KA 3CIZA 2EWSA 4HDHA 4G1QB 4DG1A 1JJ2M 1Q8IA 1JB0C 2HB5A 4O8UA 4DCOB 1GNKA 2QMWA 3DRRA 2CQIA 4FF3A 1FFGB 4JBCA 4C3MA 5KT3A 2YKMA 3SPYA 3EN9A 3WXLA 4V19S 3LUYA 3TWHA 3OTCA 4CO1A 1U47A 4Z4FA 4BC2A 3SIPB 3VR1A 4QOTA 1I39A 2F8TA 4OYZA 2G2OA 4ICLA 2C28A 5ETPA 1C1CA 3CERA 3QWUA 2R7WA 3PR4A 3PM9A 1IBLK 1NJXA 3S9HA 5HROB 2VG7B 3V4MA 1XNRJ 4OX8A 5AQWA 5F2RA 4F04B 1Q7LB 3I5BA 3FVYA 5HP1B 1Y3KA 3N6MA 5FLXY 3CCTA 4EWTA 1RBVA 3PIPQ 4NB4A 2QSFA 3I8DA 3L3VA 1TVRB 3W3DA 1MWQA 2YH1A 4AM7A 4K41A 4LFCJ 3MEDB 2FC8A 1R0AA 4DV4F 3PO4A 4U6PA 3QNNA 3W3SA 3WC0A 4MLHA 3OYMA 2B8PA 1C1BA 4FBUA 4DI6A 4CYUB 1TFWA 2MZQA 3H20A 2MKSA 3UI3A 2DGWA 2W6KA 5BREA 3H40A 4CGJA 2A2DA 4TY9A 1ZTTA 2E1RA 3HHEA 3NS6A 4QS8A 4LF5K 1REVA 3EGWB 4CLPA 3C8YA 5C5JA 3K7RA 2G8HA 2V8DA 3H1QA 3MXIA 3L3UA 4U96A 3Q8QB 2UU9F 1NMDA 3BPSP 4LBPA 3GV7B 3KLHB 2ZH1A 3CDWA 5LJ3Y 4EAHD 4QYRA 1S49A 1HBNA 4ECTA 4DU1A 3DLGA 4CESA 1A5VA 4K4ZA 1T3NA 4L72B 1BUXA 3MUVP 4BC3A 3ZEUA 4DQRA 2QA4S 3ZTPA 4A57A 1NK7A 1S97A 3VAKA 1RABB 3W2VA 1KXPA 4CEDA 3BS9A 3NGKA 2RHQB 1NUEA 5LMNJ 4OPKA 2XQCA 2M4MA 2Z1IA 4F4YA 3MMVA 3N0VA 3DJCA 2IRUA 2VG6A 2NXCA 4WYWA 2W42A 5E3CA 4C8OA 1CS4B 3BPDA 3L95X 2XSJA 3BKUA 2Z1GA 3CMES 3RMCA 3E66A 5CZ1A 3NLCA 1N8RO 1VJQA 3SXLA 4GVEA 1Y5IB 1FI4A 1ZAVA 3GJQB 1QAJA 3NAEA 2VG5B 1M90O 4WBFA 1E6YA 1S1VB 4BRIA 4PXCA 1VQ8S 3DOKB 1A6LA 4F0HA 3L09A 1HRHA 2JL9A 3MWTA 2VPYB 2OTJS 3QNWB 1E4GT 3ENBA 4L3NA 2HS3A 1WSVA 1HYSA 3R5AA 2AMCB 3AV9A 1YKWA 3K8VA 4OZ3A 5E3RA 4BQLA 4PWUA 4KI6A 4NO7A 3SCLE 4CIEA 4IQMA 4FVUA 2F4VF 2UXCJ 3J7AN 3KLGA 1QY7A 5CYJA 2COLA 2WSCC 2V6AA 1N8RT 2HEKA 4JI2K 4DZDA 3U9DA 3U1MA 1WSFA 3ZCMA 2J7WA 2BV3A 2QTWA 4M45A 2QC3A 3W5YA 1HKGA 3CJ4A 1X5TA 1M90T 1NBEB 2IM3A 1VQ4S 1K1SA 2KL8A 5FDLA 4LR8A 1FKPA 4ETZA 3P3DA 3ZSVA 3I32A 5HL7Q 1RDCA 3GJRB 4RKUC 4BRGA 4DL0C 5BPLA 2PD1A 3FR0A 4JV5K 4AL5A 1FNMA 4GY2B 3KDOA 4IFVA 2Y1IA 2FYXA 3HFZB 2HGMA 2QKBA 1AYEA 1UJ4A 4O5BA 3CCWA 2OPRA 1HJRA 4R25A 4UUXA 5EDWA 2B4OA 2C2ZB 3THTA 3CFPA 5C2CA 4RCHA 2ABYA 2ZITA 1SV5A 3IFRA 2I7PA 5BR8K 3V4IA 3GOIA 1NZ8A 2YHAA 4FLZA 1SJFA 2BKPA 1N5VA 2G1DA 3VAFA 3ULEB 9RUBA 1ZZFA 3QIPB 3UD3P 5GIPA 3M8ZA 4GC6A 5AQUA 1UWAA 2NUUG 1PJ7A 5LM7E 2NUHA 3P4IA 3QT6A 1J2VA 4D3GA 3VWSA 2VPZB 2HHHK 1BI4A 3IS9B 3DYAB 3UDLA 1U6FA 4CBXA 4DR3F 3FEZA 4JI6J 1X4HA 3K5NA 1XN9A 3ZZYA 1VQMN 3DLEA 1K8AO 3OL9A 3O8WA 3MM5A 1P8GA 4RPFA 2DY9A 3KLEA 2MLYA 2GMJA 2WB4A 3Q83A 1BQMB 2ZDPA 3MXJA 2ZJRQ 2BBEA 1EQYA 1QAYA 2P9KA 3WQUA 1NSAA 2FBTA 3HSTB 1AZSA 4C9DA 1BHNA 3AB4B 1UCNA 5KFVA 3O6QA 5L1KA 4C11B 1HNVB 3G4SS 1Y0HA 4G1IA 1NLKL 4NLPA 4EEYA 2LDYA 4CBUA 1WSHA 3RR8A 3AGRA 4W5RA 3OW2M 1JL2A 2OFGX 1JXBA 2GBZA 2DR6A 3H42A 3VETA 2HFZA 2YKNB 3MCSA 3TQ1A 2H5IB 4YB6A 5A0YB 2L48A 2CQHA 2W8LA 2J7UA 1K8AT 1M5VC 1N34K 3GG4A 4ED8A 4PR6A 4NCGB 3OTOJ 2JDJA 2M70A 2XHCA 3AFGA 3H5SA 3RUBL 3TSPA 2RVJA 4NX9A 5CY4A 5AZIB 1BC6A 3KWGA 3QRQA 6FDRA 1HI8A 3OV7A 3BGRB 3A13A 3PDNA 2YHBA 2HWHA 4Z4CA 1I3OB 5C2FA 3C15B 2QTDA 2J7KA 2VG7A 4KHPJ 2MSSA 2WVFA 1P1TA 2UXDF 2V52B 4ZIWA 1W2BR 1LKZA 2UVVA 1GOAA 5LXYA 2UUCF 4I9LA 3DOLB 3CJCA 5DG7A 3PJWA 3F56A 1TVRA 2OPQA 3SBMA 1NAQA 1M5PC 2OGUA 1VAZA 1H6KX 1TL4A 4RNOA 3TQEA 3D5MA 4I7FB 2E5LF 4B3MJ 3WNEA 4DEZA 3OVBA 4WCEL 1UVNA 2ILZA 5CABA 4CYUA 2XS7A 1TKDA 1NJIO 3MHYA 1UEKA 3NH1A 3LGHA 2DEIA 1KQSM 4ZVSB 4WU3A 1DLOB 3FLCO 5SZTA 4ZVPB 3NH2A 3SQ4A 2O8BB 4A5BA 4R5PA 1OYDA 2CQPA 1NJYA 1J5EK 3N6LA 2FUG9 1ESVA 3MWPA 1LW2A 4ECUA 4HHTA 3HHLC 5ETVA 4CIOA 2CH5A 4OX9F 4TKTA 3I9ZA 3BR9A 1Z2LA 2KRRA 4NLYA 1ZBSA 3A3PB 2YNFB 4ZVGA 3CJKB 3HJVA 1RU2A 1X5SA 1M5SA 3AVLA 3C6HA 3PSFA 1QQMA 4DTPA 2MQMA 4FYDA 1NJIT 4AHUA 4ZVOB 2Z30B 5K8OA 2Q43A 2LQ5A 5K8NA 5A8RA 3ZZPA 2HOEA 1X4FA 3HM8A 4BR9A 1HWIA 3FQLA 2W25A 3R1XA 3LDOA 2GAHC 3IG1B 4CGIA 2UUBJ 4LF9K 3KTQA 4M3RA 2RHKA 4XK8C 2R7YA 4DTSA 4KHQA 1JLQB 3SUQA 4CLYA 3VF2A 3CMAN 2HFNA 3KLFB 1VCTA 2B9WA 4FF2A 4M7YA 1G6BA 3A4TA 3AARA 3DOKA 3A3NB 4BC4A 3KMSA 2Y0SD 3JQKA 3H25A 4NZ7A 1WDTA 4J2BA 3S1TA 4J9UE 1BWVA 3S7RA 4FS1A 5AJ3K 3NKYA 5G0RB 1HNZK 1RT5A 3DRXA 2GC8A 2ZE2A 3O2IA 1ZAWA 4OZ2A 5B0AA 2BYCA 4FN5A 5H1SV 2YX6A 3KJNB 3M2VB 2MYFA 4DUZJ 3OBWA 1NM2A 4X66F 3J7YU 1JLGB 2QMXA 4RW9A 4DV3F 4RW6B 5CD4A 4CI0B 1PC5A 4PKDB 2RILA 5ELZA 2GHVC 3IRWP 2KG1A 4X4PA 3ENWA 4RG8A 1T9WA 4IQXA 3PLAA 3GFHA 3AVHA 4WP9A 5AXKA 3R6LB 4JI0F 3L7PA 3MEGA 1BQNA 3FZHA 1NDPA 5ETKA 2ZBCA 4NXMF 3POTB 1SZ2A 4ELTA 3HKZD 4UW2A 4ZLJA 3M9MB 4DFPA 3THPA 2BXJA 2G9OA 4WQ5A 4RBUA 3CPEA 3HSZA 3J80Y 5J1PA 1RT3B 1VRUB 1RQ0A 3HPGA 2XGQA 1HR0K 3PW2A 4JI1J 1U26A 3HZEA 2VJVA 1M1KO 3T5LA 2P9LA 5C0YA 2XTJP 4LY7A 2O01C 5LOQA 4DSJA 3AO5A 1FX2A 2BE7D 5KAKA 5AQOA 5JUMA 4OHZA 4A5AA 2QZ8A 3W65A 4CZHA 2I5JB 2JOQA 4K50A 1RDAA 4A62A 4WKYA 4JUZA 4BR7A 3K0JA 4B3TJ 1HBUB 1X3MA 3V9XA 4B3OA 2EFPA 3TZZA 4LSLA 3ZT1A 3O9RA 3MM6A 3MMAA 1VQNN 4DQSA 1EP4A 2ZM6J 4P6QA 4M3ZA 2IA0A 3ZTQA 4J37A 2O8CA 2JVOA 4IDKA 4AXJA 2FHMA 2Z0GA 4X65K 1V5VA 3O1BA 4NA2A 4BE0A 4ZCIA 1C0TB 3B78A 1GLLO 5AZJB 3FGUA 4HTLA 4TYAA 3T1YK 1RUSA 3C19A 3SBTA 4ZP6A 2LEPA 3OVNA 2F63A 1RHUB 3RYLA 1XNQJ 3D1OA 3HSGA 1RISA 2C3UA 4AHTA 1U24A 1FNOA 2QSWA 3TWZA 4ECQA 4KRWA 4CZFA 3WT0A 4JI3F 1H3DA 1S9GB 1H73A 1LK7A 2AJQA 1X4DA 2H5EA 3I56S 3IXQA 4PXEA 2BW7A 3VQCA 1TKTB 3HSJA 1RTDA 1DY3A 3C14B 2Q0UA 1UWBB 2CGJA 3Q23A 4DTOA 5AE3A 5M1PA 3ZT2A 4YDXA 1XEZA 3JSBA 1JXLA 5AZIA 1IR0A 4FSVA 1NHVA 4P9SA 3IGVA 4OFZA 1VRTA 1CJVA 4OX7A 3MUTP 4EP4A 4KR0B 4ZP9A 1RT7A 4CLSA 4ZVTB 4G65A 1WG5A 1IBMK 4HYKA 2DNOA 4ZPDA 4FM0A 1MA9B 5BYRA 2HNYB 4TY8B 5IC6B 3ZT0A 2GMLA 2IPOB 1RK8A 3D28A 5JVHQ 1CJTB 2HWTA 1N33F 4NYFA 2NPIA 2C3OA 4N56A 2QV6A 4CLWA 2K3KA 3QSYB 4ZVHA 3CCUS 1S9EA 1SAZA 3FZBA 4RUCA 2KXHA 4FYWB 3PYGA 3DRPB 2QEXS 4PYDA 4FM1A 3DRYA 4CZMA 2CVEA 2GV1A 3MD3A 4E0DA 2V0NA 2CGLA 4FWSA 2BJ3A 4ZA1A 1HPMA 3BREA 3OS0A 2FGOA 2W2QP 3RB3A 4X62K 4BY9C 4WKRA 2B5JB 4FJ5A 1XNRF 2WOMA 1HWJA 4E7LA 3M30B 3M8RA 3UVJB 1F5AA 4CH1A 2LXIA 5C25B 5GAHU 2C2KB 2HNZB 1DGKN 1BLUA 4KAIA 2ADCA 2J9EA 3OD2A 4LFCF 4GKJF 4DBQA 1KVJA 5LY3A 1EKRA 2FQQB 3MI7X 3PFEA 2UUAK 3AXMA 1SC3B 1Q81T 3KK1B 5HJXA 1X5OA 4IOCQ 1S6OA 2HZCA 5B0EA 4KB1A 3I8BA 2MKYA 1JCGA 2NRXA 3CO0P 2BACA 3SCKE 2MJNA 4CERA 4WP8A 4OYIA 2O8EB 4KSEB 1UMJA 1VSDA 4DQIA 3P1GA 4LSZB 3B6BA 5CYMB 2C3PA 3MM9B 4YR2A 3AA9A 4Y2IA 3IG1A 1OSDA 3AQOA 2E66A 1CEZA 3H8YA 2YCHA 2W9CB 4JB8B 3DLHA 2QYCA 3BM7A 2MZTA 4PHTX 3WX8A 1QJHA 4LH4A 2G8UA 4ER8A 4IZ9A 1RDWX 3AO3A 4CF8A 3KLFA 2XSFA 3HI9A 5DZ6A 4KBOA 3H4DA 5LMNF 1RYSA 4UUWA 3MAHA 3VZIA 3OL6A 4RU2A 3VGSA 3J7YP 2AJ1A 2V4RA 3THXA 2P9CA 4Z0UA 4ECRA 2ZH6A 5FLXU 1Y97A 3P4UB 3QICA 2VFTA 3AA8A 2V63A 4BG8A 5KPTA 4BGAA 5ETSA 2RUGA 1IV0A 3M2VA 1DJ0A 4M5NA 3AA4A 3O4QA 3AT1B 1WB9A 7AT1B 1MNEA 4DSIA 4HL9A 1F5CA 3FCVA 1RHJB 4RW6A 4JI4J 2CJAA 3UKUA 1XHZA 3TUJC 3M8QB 3CM6A 1T05B 4JK8A 1SH0A 1XR7A 2CPFA 4M5JA 3ZSOA 5KFOA 4J9OA 4DV6K 1V4TA 3ZTOA 3L2UA 4A8YA 1QQCA 2KFNA 2X1BA 2EFGA 2OTLN 1R8AA 4QIVA 1MWKA 4U7CA 3BKTA 3CCQN 5GIOA 4X4RA 2CQ0A 1HKBA 3FCHA 4EI2A 1D1UA 2HQ3A 4NYOA 3ICLA 3D6TB 4I6WA 1WOSA 3WZ0A 2X6SA 4YS2A 2F3JA 3T1AA 3RRKA 4CLKA 2X3DA 3JYTB 5K9FA 4OPJA 2XCAA 2AKWB 5CCMA 3SAHA 4FJGA 3KHYA 4NEYA 5U47A 5M2UA 2CG4A 4ECZA 5KTQA 2KRBA 3FEYB 4N76A 1PKUA 3R5DA 4IR1A 4DCJB 2HHWA 2V67A 2DY1A 2DD8S 4LF6K 2Q2RA 1RT6B 2QFJA 3LA0A 1HBUA 4O8KA 3WHIA 2FJVA 1V3ZA 2DNGA 2KZMA 3WIVA 4XDDA 4KHSA 1CZAN 1SS6A 5BN9A 3THYA 2KVIA 3NCIA 2DKOB 1FXRA 5M1QA 3CCSS 1XMBA 1BGXT 2H4WB 3ONQA 4K4TA 4BVPA 4ITSA 4WFNL 4MMOA 1RLCL 3W2WA 5B7WA 3NL0A 1ZETA 1VJWA 4FP9A 3MR7A 3IN5A 4PQAA 3A2FA 1HD1A 3D67A 2ZBRA 4DLEA 1VQSA 3F2KA 4V19X 3RB6A 1HD0A 2DR5A 2FSKA 1TUGB 2GUIA 3R5GA 3UNGC 4BGBA 1HBMA 4BS2A 3NGYA 4I2QA 3DM2A 3LQVA 2ASLA 3AHPA 1DTQB 4H0TB 2VPXB 3O3FA 2GJFA 4HTIA 1ATNA 1JK9B 4LFAJ 1S1TB 5AQIA 4USHA 4BRPA 4CTAB 4CJSA 5F8LA 4C8KA 1SJ1A 4OYXA 4MYTA 3QRPA 1H7XA 2L41A 3CC7N 4J90A 3EPGA 3A8JA 4PG6A 4M63A 5J2QB 4DPTA 1P9QC 1YJ7A 2F8EX 1U45A 2NPFA 2JLEA 1ZA1B 5ETQA 4RW7B 5JICA 2V5HG 1FK9A 3SV3A 1TKTA 4PA1A 5HRRA 1NPKA 5C10A 2ZH5A 2PA8D 3P8BB 1RAAB 4DPWA 3T19A 4JI5J 4I2PA 2YPZA 2ADBA 2G0JA 3CMAS 3EDRB 3K5OA 3CJ9A 4FPBA 4EK2A 3VQAA 2HVEA 4Q2LA 1D8YA 2W41A 3BQ0A 4P71A 3W9IA 4MQ3A 1GLFO 1VQKN 4ILGB 1RWOB 2GAGC 3NNCA 2OP5A 1JL1A 1GLDG 3TJ9A 3UE2A 4HTJA 2ZOFA 5K5MA 1E3MA 1NZAA 4EHTA 3C0BA 4KRFA 3NGTA 3PTWA 2HHXA 5HVHA 1NHUA 5KFJA 3M1VB 4DV2J 4DV0J 4YHHK 2YJEA 1NPPA 1QLNA 3OTOF 2HBRB 2H3GX 4MKAA 3RZAA 3T5JA 3K8WA 3DRPA 4P73A 4LREA 2DNMA 3AO4A 5EWEA 2EG2A 3MM7A 2P9PA 3V9ZA 3O1WA 1UW9A 4BR4A 2PYLA 1HNXJ 4W5QA 1HWLA 1MW7A 1T9VA 2EW9A 3S01A 2B9XA 4H5VA 5AQZA 3W8GA 4QYZK 4MKVA 1T3VA 3QT5A 1W2IA 4H5TA 4Q8EA 3QNOA 4RNFA 4J2AA 4YY3K 2DGXA 5L46A 3RG6A 3MCPA 2HZAA 3HZGA 3FRZA 5KFCA 1U2CA 1YXQA 3QO9A 3U3GA 3HHLA 4OYPA 5HMZA 1KAYA 3NE6A 4B3MF 2HFOA 4NXNJ 4JV1A 4UQTA 1WORA 2BW2A 3C6UB 3VV2B 4JV5F 4CLZA 1DFDA 5JXSA 1AT1B 2PAVA 4LUBA 4B1ZA 4BWMA 1NBWA 2O8EA 2PIIA 3VAIA 2R7QA 4FK2A 1XMQK 4PUOB 2NRWA 1I1GA 5ADZA 2F5GA 3MM9A 2YX4A 3NBPB 3FSXA 5I42B 3V6JA 1NGFA 2IJNA 4DL4A 1VQNS 2APOA 4DJBA 4LD0A 2WRMA 2CPDA 5F8MA 4JKGB 3AH6A 4URSA 5G4DA 1DKGD 3J8AA 1FERA 3EY1A 3RW7A 4IKAA 3Q8SB 1YJNN 3OXFA 3B6PA 5KPZA 2A40A 1SXLA 1UVKA 2R3VA 2AT1B 3SYZA 1G1XA 3GIMA 3G6YA 1GLAG 5HI7A 2FBYA 3DGPA 3DRSB 3CI5A 4IDHA 4USUA 4H5WA 2VQEK 4YB5A 4ZMMA 4CIGA 5LXRA 2FVRA 2FXUA 2H4YB 2IHR1 2UUBF 3RAMA 2V34A 2NZTA 2NXEA 4U67Q 2BGGA 2J6UA 2BJ1A 4RR5A 2E9ZA 2F40A 4FJ8A 2AGPA 1FRIA 2QT7A 3DI6A 1NU4A 2EFOA 1N54B 4DU7A 2C2NA 1T05A 4ILRA 2Y8YA 1FJCA 3CJ3A 4OVLA 4Q43A 2DIVA 1VQPN 2M5YA 3CD6S 5E7OB 4DR7K 1RJJA 4U9RA 3TJ8A 2JLGA 2WW4A 3KUEA 4C1NI 4EBDA 3I4PA 2V50A 5CYQB 2KH9A 2CJBA 2RJZA 2Y1JA 2MY8A 2BJ8A 1VSLA 1RWXB 2V2VA 4DTRA 1QUVA 1C4CA 3SI6A 2QJ3A 3MEEA 5EN1A 2P9SA 3BZCA 4NPOA 3H2LA 4WFXA 2MKIA 5JS2A 1LV5A 3DU6A 2MQQA 4TNOA 4FNIA 4C97A 1W9HA 2YNIA 2HS0A 5GAGP 2GIRA 4K0KJ 3ET6A 4CGFA 2HURA 2LQ8A 1X60A 4XEIA 1T9UA 1N34F 5KG4A 4JI7K 1FCAA 1CSJA 1Z25A 2Q66A 5DM7Q 3KKFA 2CNLB 2PE8A 3TUZC 2O8DB 1KAXA 4OLBA 2P9NB 3HHKA 3VGLA 4PEOA 1EETB 4WXOA 3IRXB 4CLUA 1UA1A 1PYSB 2XI3A 2YNHB 4OV1A 2FGCA 3I0RB 3SEOA 4BDZA 3T6BA 4PYAA 2KHDA 1B0TA 3DAWA 3K5LA 4AXIA 3H59A 3FZLA 1RKJA 1YRXA 2YX1A 4JI1F 3UO0A 2NSCA 2ITGA 4H8KA 4I1TA 1S3XA 4NOHA 2XNQA 1G3OA 3V9UA 2W7AA 5L9XA 4CVNE 2W7PA 1T7PA 4OI3A 1S57A 3A8IA 2W2OP 1KFDA 3JB9k 2XC9A 5E3AA 3ILJA 2V8VA 3TSQA 1VQ6S 5FD1A 3FC9A 1BCOA 4WIQA 1ITPA 2Q79A 3QETA 4B3TF 1DTQA 2EX3A 1KVBA 1DTTA 2L9DA 1N32K 2M9KA 5ETMA 2C3YA 1QS4A 2NZCA 4PPDA 4WQ4C 3P96A 1AROP 1PJ6A 1J5EF 4C23A 1KTVA 4BRFA 3F9MA 1REGX 1FD2A 3V1QA 3FDSA 1IQZA 1WHVA 5LJ5Y 3THVA 3FNNA 4KE5A 4F67A 2RIJA 1WSIA 3HPHA 3H46O 1XHXA 2G13A 5C24A 2HK3A 4JNEA 3AODA 1RGIA 1H98A 3QGHA 4FJIA 1XNQF 1MSWD 3V6DA 2A1SA 5F1XA 5DDOC 3P6YC 5BR9A 2I8EA 5LMUK 3LM9A 4PKGA 2CPZA 1DARA 4MYUA 4R79A 3CFRA 3CNQP 5HMYA 4OYWA 1NK4A 4RW4A 2FJWA 1XERA 1JQGA 2QLBB 1WG1A 1U2VB 3KK3A 1SQFA 1EO1A 1SQEA 4IH6A 3IWNC 2NRTA 2Z58B 1HLUA 3OHRA 1BD6A 3BV8A 2FZKB 3KK2A 4WK1A 4E19A 5KFNA 1HHSA 1S48A 4L6V3 2O1PA 3NS5A 4FPAA 1HNZF 3QQCD 4FPRA 1WI8A 4ILHA 5KFDA 3MAAA 2CUYA 2ZBPA 2XRIA 3RSEB 4TLRA 5HLFB 1SI9A 4CNYA 4WFNQ 1WC4A 3C94A 2EKYA 3CCQS 3WEEB 2R2TA 2O5DA 2NZ4A 3P39A 1NWKA 1SJRA 2IAJA 3MPWA 2FLPA 4S0MA 1FKOA 4AHCA 3PEHA 3HX9A 1VS3A 3QEPA 3Q86A 1P9YA 1TZ0A 2OZSA 3Q2TC 4DTMA 4QIWD 4XIUA 5EX3A 3PCOB 2HVZA 4HR2A 3FFKB 3EVOA 3SLCA 1RAFB 3MMCB 3O44A 1U0SA 4ES1A 1CJUB 1F1BB 2IFXA 1HJOA 1PG5B 1XIQA 2E88A 2XWYA 1TP7A 1N36K 3R2CJ 3GYGA 1E6VA 2O66A 2IM0A 2E44A 1C0UB 3JSMA 4C2MA 3T1HK 2QN6B 3H2VE 4YOVA 4J7CA 2PFUA 3N79A 3VERA 4P10A 2MQNA 1RCHA 3TR5A 3MGJA 3QIDA 2PMZD 2XMKA 4DUYJ 1JNRB 5J1EB 2DGSA 4CJ7A 1IG8A 2RNEA 4FL9A 5KFTA 2RQKA 3L6QA 3CHWA 1U1KA 3RR7A 2JEIA 2E5HA 2E7XA 1M1GA 1N32J 1F3VA 2W9AA 2QE5A 2FVCA 1HW9A 2VFVA 2KYZA 2DGTA 3GP9A 3AJDA 1CPZA 2D3UA 3D2FA 3JTNA 3FMBA 3O3GA 3EM1A 2UXBJ 4X65F 2VL1A 1RBRA 2JJ4D 1J9AA 4QQBA 1KP6A 3L2VA 4ZKAA 2AEJA 1LWFA 1ASWA 1HQ2A 4DR4J 4IOAL 2PT0A 2FIUA 3D7EO 2CPYA 4J9RA 1I3AA 1BY9A 4XH5A 4DR1K 4DL6A 7FD1A 4O3NA 4Y3CA 3MAQA 4M3XA 3HF5A 1RNHA 5AR0A 3GFZA 4FJXA 2QWPA 3GFYA 2R9LA 4MH8A 2F4VK 1DBDA 3CCEN 4MJKA 2QRRA 3P45B 3B4MA 4H4MA 2E5IA 3ILLA 5KFIA 1HMVB 4NCBA 5DO2A 1VBXA 1VQKS 4JKBA 3R9PA 5KT4A 1YHQN 3RJMB 1RTHB 2M7SA 2CJ9A 2RQMA 4F4KA 3VQEA 2OEJA 3SMZA 2OMLA 3AVGA 2CRLA 3BEXA 3QATA 2HHPA 5EGYA 1IKYB 1HWUA 3O08A 1IH7A 2NXNA 1EETA 4IWVA 3IRXA 3BJYA 1GMWD 1RBTA 1T6DA 1OH8A 3JXUA 3I0RA 5BXIA 1TK8A 1IBMF 2ROEA 4FLUA 2ZDOA 4DMNA 4W4MA 1Q78A 5IWAJ 1OY8A 4FJLA 1KTQA 1FXLA 1B0PA 2CNOB 5ITHA 1HHTP 2E29A 3D68A 4DB3A 4QOZB 4DV5K 1S4EA 3H45C 3ZSQA 2CZ9A 4RNHA 3KHLA 1MG7A 5A8KB 1JCEA 4BRQA 5CCLA 1JJHA 4B9LA 3D2EA 3OYHA 4UY8T 4FWLA 4LF1A 3ZZTA 4KB0A 4DX6A 2MSTA 5IQQA 5T7LB 4C8NA 3ZO7A 3D9BA 1N48A 5BRHA 2HQFA 5DRKA 1BCMA 4ISGA 2D9PA 3CPWR 4F3OA 4USIA 4NLQA 5AQJA 1XUPO 4KREA 1S7HA 4MKYA 1FTCA 4J9NA 1FW6A 2OPPA 4O4RA 1S6QB 3BYPA 1UW4A 5D0EA 2D3OR 3NCRA 5AQRA 3T69A 3M3ZA 3JXOA 4ID5B 1NDCA 2FHKA 1NMNA 1OH6A 4M3WA 1WHYA 3E9OA 1ROFA 4Z4HA 2A10A 1R27B 4CH7A 2G0IA 1CXUA 2B7CB 2KKHA 3D1QA 4OI1A 3ZSRA 1BA1A 4QAGA 4PPZA 4M5DB 3AVKA 4EMDA 1B0VA 3PFOA 4LFAF 1FT8A 2WSEC 4KTZA 3VQ9A 3UQSA 1K9MT 4XDCA 3TJAA 3W64A 4MAKA 2DISA 2IC3B 2MKCA 3L7UA 1B92A 4LFBJ 4ZPVR 2KJVA 3T9NA 4JS4A 1S0OA 1BO5O 3M2UA 2IYGA 5L1JA 2CZVC 3MXHP 1YJ9N 1RWMB 2P6TA 2DPJA 3TAMB 1YBUA 3OL8A 2FC0A 4J8FA 1BG3A 4CK2A 3L7OA 1RU1A 3DMJB 4HWIA 1JMTA 3NWGA 2ACMA 4KHMA 1VQPS 1U1RA 4NLTA 4FVMA 2C1EB 5AQYA 2V94A 1FJGK 3W62A 1WWHA 3UCZP 4KQZA 3G2XA 4OJ1A 4DWIA 3TO8A 4FJMA 1YBAA 1IKWB 2UXDK 5IM0B 2ASMA 3ETMA 1BOTO 1CLFA 5CQGA 4NLWA 3EGVA 4NMLA 2VYPA 1L3SA 4DSEA 5A2QY 1NEEA 1TV6B 3HM9A 5M1FA 4BC7A 1C4AA 3PIOL 4DV2F 1U1LA 2E6LA 3QBXA 4KH4A 3J81j 3IBWA 1R7IA 3UCUP 4QWDA 2ZZNA 2E5LK 2HPUA 2P9UB 2BZ2A 1S1UA 1WEXA 4YOEA 5TKYA 5I3PA 4NLCA 1VQ9S 3PO5A 1F2HA 3A0IX 3GR1A 3ZXWA 1NNDA 2J76E 1JLCA 1PIEA 1WACA 1RP5A 3GE1A 2J9CA 2Q6BA 3OR1B 4DV5J 3GDQA 1FXDA 2J6TA 3M4XA 3DHXA 2YJFA 2R2UA 4ED0A 1O5JA 1BU6O 4I0WA 3VF6A 5J2PB 5AQSA 4AT1B 3EPIA 1I94J 2FC9A 3U3YA 1N5TA 3HBTA 2D7SA 1GXTA 1X4BA 4ZHRB 4EIAA 1GT8A 1ZAXA 1SB6A 4LF6F 3CCLS 4KKOB 4CK3A 4M41A 1T94A 5H9FK 4N47A 3V5RA 5CZ2A 5HN0A 2PMHA 5EWFA 3MXMA 2LYVA 3AA2A 2GO9A 1R0CB 2OPSB 2MJUA 2QA4N 5KG1A 2CZ4A 1QE1B 4B8CA 2ZEJA 4DCHA 1VBZA 1EWQA 2HMIA 1O51A 4H4OB 1IXKA 2HAIA 2BJEA 1LWCA 2D9OA 3RU0A 3QFUA 5I4MA 4CIFA 3I5CA 4ISEA 1ILYA 2VD3A 4O0NA 1UVLA 2PYJA 4FJNA 1T8EA 1S77D 3DDIA 4U8YA 2MMYA 3NGSA 2BRLA 2GELA 4ALZA 4OI6A 4H54A 1RCXB 3CMEN 3MN6A 2PSZA 4P75A 5KRTA 2DGOA 1LK5A 1SCJB 5D3GB 1TL7B 2BJDA 2E2OA 1HX1A 1S1XB 3UDVA 2DNHA 1ZA2B 1VQ8N 1CC8A 5E3QA 3OYEA 3DLBA 3M9NB 2VB6A 4Z4GA 4Z2XA 1CZBA 3RTVA 2WB1D 2VOPA 2NYHA 3SJHA 3J7YI 1EZZB 3MR2A 1FESA 1PBUA 3D6HB 5KFUA 2AEFA 3OT9A 3DLLL 2ZJQQ 4JI0K 3CCZA 4U8VA 2P9IB 2F8HA 1WOQA 2RKIB 2AJ0A 3HVWA 2CDRB 4NLBA 2ILYA 2MTLA 4DG1B 2FD2A 3VN5A 3VENA 1RHKB 2ZJPQ 1HA1A 1YZ6A 1PSDA 2M8DB 3DRRB 4KGVB 5D8HB 3FZKA 1TYQA 2U2FA 3HFVA 3FSIA 2YKMB 2ALZA 3D6RA 2XY5A 1T03A 2AZ1A 4K0KF 4WTOB 3C16A 1IBKK 1OVYA 1VRQC 1BL3A 3GWCA