4DG1A

Crystal structure of hiv-1 reverse transcriptase (rt) with polymorphism mutation k172a and k173a
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
sequence length
549
structure length
549
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFAAQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse Transcriptase P66 subunit
publication title HIV-1 Reverse Transcriptase (RT) Polymorphism 172K Suppresses the Effect of Clinically Relevant Drug Resistance Mutations to Both Nucleoside and Non-nucleoside RT Inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 149
structure length 549
sequence length 549
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 4dg1A01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dg1A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 4dg1A05
1Q9YA 4NLOA 4CIEA 4YMEA 4RW6B 3DOKA 2YV0X 2WB4A 4KKOA 4CK2A 3DLGA 1JLBA 4FJ8A 3PW7A 4OKJA 4BDPA 5DG9A 1HQEB 2HNYA 5KT7A 3HK2A 2XCPA 5DLGA 3MEDA 2OPSB 4FW1A 3QO9A 1X9MA 3AVHA 3KHRA 1DTQA 3RWUA 3AVKA 3DRSB 2IJNA 5T7BA 4O3PA 1YVUA 4DQPA 1IO2A 3OS2A 3FQKA 4N76A 4W5OA 2D0CA 4KO0A 3H2LA 1K1QA 4CHZA 2P1JA 4CEFA 3AA2A 4QWEA 3CFOA 2BQRA 1KVCA 1C0TA 4KKOB 3DLGB 3MECB 2IJFA 3NF6A 1NK0A 2C28A 1NOZA 2AWZA 2IMWP 2QKKA 4F3OA 4E7KA 1S1TA 5FDLA 4H4MA 4E1NA 4RNMA 3CIZA 2I5JB 2RKIA 5KG6A 2P5OA 5F8GA 4ZPBA 3KLHA 3AO5A 3V6KA 1QE1A 2W9AA 3VQPA 1KCFA 5KT2A 1UOCA 1SV5B 1TKXB 3VQSA 5KG2A 3QLHB 3VQ9A 4EP4A 2KW4A 4KO0B 4FZXC 3QIOA 4M3ZA 4KHNA 2HMIA 4DTPA 4MQ3A 2VG6B 3RAQA 3E01A 5EDWA 5C24B 2G8FA 1T3NA 3ZT0A 3PR4A 4M3XA 3B6OA 4IDKA 4B9NA 4IG0B 5HRRA 2J6TA 3RR7A 3GIKA 1OS5A 5KFZA 3AVCA 4DFPA 4JS5A 4KV8A 3CJ5A 4J9OA 4RW9A 2G8VA 3GIMA 2O4IA 2ASJA 2RKIB 1RTDA 2UUWA 3G6XA 3BQ0A 3ZSQA 3QEVA 1QAJA 3DMJA 5F8MA 3HPHA 4QAGA 4KFBA 3VQ8A 3LP0A 1RTHB 1TKZB 4ZVHA 3V9UA 1RBRA 1LW2B 1J53A 3PO4A 2GIQA 5KFXA 4L8RB 3M8RA 1XC9A 2YNGB 2YKNB 2J6SA 2G8UA 2YNIB 4Q8EA 5HBMB 3KK3B 3OYIA 4N5SA 2E4LA 3CG7A 2IM2A 4MK9A 3Q8QB 3E01B 3C6TA 1B9DA 3VQQA 1DTTA 3AVIA 2UVWA 4YR0A 5KFKA 1ASWA 3KJVA 2ILYA 3KHLA 3OS1A 1L3SA 2FBYA 4EZ6A 3AVJA 3PW2A 2UVUA 3PX4A 3BJYA 3M9OB 3T3FA 3DMJB 2HWHA 3NHGA 4KFBB 1NJYA 3LP0B 4E89A 4CF2A 1EX4A 4GC6A 3HP6A 3O3HA 4CF8A 4DQIA 3H59A 2F8EX 1RA6A 1RT1A 4F2RA 3HSTB 3LALA 3BSOA 2BRLA 3VA3A 3OL9A 3RMCA 2F8TA 2YHBA 4CEEA 3TAGA 5KFUA 1DTTB 1IM4A 1QSLA 4Z4GA 3DLKA 2IM3A 3RB0A 3CJ2A 1NJZA 4FBTA 1LAWA 2VWKA 5KGXA 1C1CA 2W9CA 1GOAA 4Z4FA 3MEEA 3UPFA 1VSJA 3WNGA 3CWJA 2C2RA 4E7HA 2B4JA 1L3UA 4FJLA 2DFEA 3P1GA 3VQEA 3IGNA 3MR2A 2B5JB 1VSHA 1R0AB 4NLPA 1REVB 4CJFA 2JC1A 4JLHA 4EP5A 1BL3A 2IOCA 2R8JA 3HPOA 3KLIA 1WNEA 1XI1A 4Q43A 1S1XA 3RB6A 4WYWA 4KHUA 1QUVA 1Z25A 4K4ZA 3AVGA 3ZSRA 5DMRA 4MKAA 2OA8A 2ASLA 1VSLA 3PUFA 4DTNA 3LPUA 3HKWA 1HYVA 3NFAA 4AHTA 3V6HA 4KHRA 5L9XA 3AA3A 2RDJA 4NLDA 1GOCA 2ATLA 4J9RA 3KD5E 4FS1A 1JKHA 1JX4A 4RZRA 1VRUA 3QGGA 2JEGA 2BQUA 3I0SB 2W8LA 3K2PA 4J2AA 3K5LA 4CGIA 3KLGB 4J2BA 4KTWA 1HMVB 4NLSA 1F21A 1N48A 4MFBB 4H4OB 1TL3B 3KLIB 4PQUB 3TVKA 2FBVA 4FW2A 4CK1A 3DI6A 4NLWA 1XHXA 1ZBLA 3IS9A 3LAKA 2WOMA 2FVQA 1S0MA 3ZCMA 3LP2B 1LWFB 3BQ1A 3ISND 2J6UA 4MIAA 2PYJA 1N4LA 2XHBA 1VRTB 2ZE2B 3CQ8A 2JC0A 2GV9A 3T5KA 3GYNA 3S3OA 4QWCA 2CKWA 4OGCA 4QCLA 2GUIA 3RMBA 3K5MA 3QIDA 4I9QA 1KSPA 3PO5A 3MR3A 3SNNA 5J2MA 3DRPB 1YTUA 2HHWA 3MTKA 4CFCA 4YNQA 2OYQA 1T94A 4OKEA 3FFIB 4ID5B 4K4UA 3O3GA 4E1MA 1RILA 1TV6B 1RBVA 4DSJA 3DM2A 1U04A 4IG3B 3VQAA 1L5UA 4NRUA 1LAVA 2V9WA 1RTIA 3OSPA 4BDYA 4HKQA 2WRMA 3AVMA 1NKBA 1RT2B 2JLEA 1TKTB 1JIHA 4ZPDA 2OPQA 4DTUA 3B6PA 4XIUA 3SV4A 4C8LA 4Q5VA 4OKKA 3D45A 3M8PA 2RF2A 1KHVA 3CVKA 1T03B 4AHSA 5I42A 1DLOA 4E7IA 5J2MB 4LH5A 3TI0A 4KTQA 5KFHA 3OYCA 5J2NA 4DG1B 1A5XA 5KFDA 2IAJB 4Z4EA 3D0PA 2AQ4A 3KKSA 2XI3A 2YKMA 2D5RA 4FLVA 4E7JA 1S1WB 4KAIA 3T5HA 1WLJA 3MXJA 2VG7B 3PHEA 3UDLA 3DLHA 3OYGA 3BR9A 1SKWA 3DM2B 2IM1A 3V9XA 1IKYA 1RDCA 4OJRA 3H4BA 3I0RA 1JLGA 3UQSA 4MIBA 3KK1B 4DU1A 3LP1A 2FC0A 5KFRA 4CJSA 2VG5A 5KG5A 3EPIA 5CYMB 4XPCA 5D3GA 4CF9A 1U45A 4DMNA 4WXOA 1RAJA 1K1SA 1JLCA 2V4RA 3LAMA 2R2UA 4DTRA 4CGJA 1TKDA 3DLBA 4KHYA 4O5BA 3ZSZA 4OPKA 2B6AA 4DL6A 2JEFA 1RT4B 2YNFB 3M8QB 3V1QA 4ZTJA 3DOLA 2AGOA 1RT3A 1SL0A 3VQ5A 4QW8A 4O4GB 3IRXA 1N6QA 4M42A 4B9MA 4IOBA 1Z4UA 4CHYA 1TK0A 2F96A 2BE2B 4M3TA 1HPZB 4HUEA 3ZT4A 3HVTA 5I3UA 4QW9A 5KFPA 1K6YA 3P5JA 2ETJA 4ED0A 1T05B 2NUBA 4KRFA 1QS4A 3H5SA 3G86A 1BCOA 4DSFA 2O4GA 4FJJA 2W42A 2VWJA 5D3GB 3I8DA 3OYJA 2W7PA 2HNZB 3SUNA 4AH9A 1CSJA 3KIOA 4F4KA 4ELTA 1KHWA 4J9MA 3KLEA 1JLQA 1KLMA 1IKVA 4DS4A 2Z1IA 4ELVA 3UR0A 1BCMA 4OLAA 1BGXT 5DGAA 3JYTB 2YNHB 1XHZA 3MR5A 4IKAA 1RBTA 4JRQA 4NLVA 1S1VA 3DOLB 1RT3B 4DL5A 3H5YA 3A2FA 5CYQA 4JV2A 2X78A 4TN2A 1N6QB 3KLVA 2RPIA 4O44A 5KFGA 4IH7A 3S3NA 4B3OB 4FM1A 4Y2AA 5JUMA 3L2VA 2AX0A 4RNHA 2W9BA 5KFEA 4WE1A 2V0NA 1HNVA 4IR1A 1JLFB 2E9RX 3HVTB 3C94A 2Z1JA 1JLEB 3TANA 4MKBA 4CJQA 4OGEA 4IFVA 3LZJA 1TL1B 4O3RA 1HQUB 2CJQA 4KHMA 4LSNB 4LSLA 4PUOB 3MEGA 3VQ4A 4RW4A 4O3QA 3NBPA 3VQ6A 4CJVA 1JL1A 2GC8A 3KOAA 2KQ2A 4CJKA 1KLMB 3GQCA 4ECRA 3K5OA 4WZMA 1IKVB 3DOKB 4KE5A 4J9SA 2P51A 4KB0A 1SUQA 4DSIA 3PW5A 3KHHA 1RBSA 1JLBB 2ZKUA 3NH2A 1T8EA 1NK6A 1NJXA 1HRHA 1S10A 3OLAA 4YP3A 2HNYB 4O44B 4ZP7A 3MEDB 2JGUA 4RW7A 1VSDA 4N41A 3QO9B 3NF9A 1SL2A 4FZZA 4IRDA 3ZSVA 4K4YA 3EYZA 4AILC 1DTQB 4ZHRA 4HVJA 1HNVB 3KK2A 4FLUA 1NNDA 1Y97A 3K57A 3OYNA 4Z4HA 4YR2A 2FVCA 2O5DA 3BGRA 4WFZA 3AO4A 2Z1GA 3MFIA 4DL7A 3IG1A 4FLXA 1MMLA 2FJXA 4ZVFA 3QINA 3RR8A 1BI4A 3I5CA 1JL2A 2QKBA 1C0TB 2HB5A 3PW4A 5KI6A 5KRTA 4PA1A 1RNHA 4I7FA 1VSEA 4DTMA 1S1TB 1SH3A 4NYZA 5FDLB 3SFGA 4H4MB 1FKPA 3SPYA 4FBUA 2AGQA 4AHCA 1IKWA 4ICLA 4J9QA 2VA2A 1D1UA 2RN2A 3FDSA 4LQ3A 5KFCA 4CJTA 4B9LA 3KLHB 4O4RA 2XRIA 2UUTA 3SZ2A 1TVRA 4ZPAA 1D5AA 1U49A 3BSNA 1LWCA 1QE1B 2D0BA 4JUZA 5DQIA 2ITGA 4NLYA 2W8KA 4J2DA 4K8XA 2B43A 4NLRA 3HVRA 4CHPA 4M3YA 3IG1B 4G1QA 1C1AA 4JV1A 5F9LA 3NMAA 1C1BA 1GX6A 2D41A 1RT5A 2HMIB 5EWFA 1BI4B 1RTJA 5KG3A 4NLQA 4IDKB 4NCGA 4Q45A 1W9HA 4IRKA 1RT7A 4W5RA 2DPJA 2QXFA 3RBDA 1ZYQA 4CCHA 4KV8B 1IKXA 3JSMA 4RW9B 4RNFA 4J9NA 1RTDB 3V1OA 1NOYA 4KI6A 3F9KA 4BDZA 4NLXA 2R2TA 5KT4A 2XWYA 4AHVA 4FLZA 3AA5X 4X2BA 2AJQA 2XI2A 4WFXA 4EO8A 5FRMA 4FK0A 3TQ1A 3OLBA 4Q0BA 4WFYA 1RYSA 4CGFA 4Y34A 1B92A 1HNIA 1C1BB 5HLFA 3SQ1A 4FJGA 1Q8IA 1O1WA 3V1RA 5KFSA 3C6TB 3L2UA 5KFIA 3OS0A 1SKRA 3OL6A 2ZQBA 4CEAA 1RT7B 3D28A 3KJVB 2R7YA 3PVXA 4N47A 1N5YA 3NAHA 3OY9A 3V4IA 4IFYA 3KMQA 1G15A 2V4QA 4RW8A 1S0NA 5SZTA 3WNEA 4C8MA 4B9TA 3N6LA 4KSEB 3OJUA 3LPTA 5DGBA 3V9ZA 4MH8A 5KFWA 1RDRA 5L1JA 1A5VA 2I1RA 5HRPA 2OZMA 5KG7A 3SFUA 3CDWA 3CO9A 1RT1B 5EU7A 1LWEA 1RDDA 5JS2A 3TAQA 2FVPA 3ZT1A 3SI6A 2DFFA 4DF8A 4TY8A 1ZBHA 4GMJB 4CIGA 4ECSA 4F3TA 2EHGA 3H40A 1BHLA 1BISA 4K4XA 1MU2A 3DLKB 3ICLA 1NK9A 3ALYA 4ED2A 4IRCA 1C1CB 2W9CB 3CYMA 3ZSXA 2G8HA 3MEEB 1TP7A 5C25A 2IC3A 4IQXA 3CDEA 1YTAA 3NAEA 2FVSA 4JS4A 3S3MA 4CE9A 4I2PA 5J1EA 5F9NA 1HJRA 1HYZA 3TAEA 1U47A 4E7LA 4CK3A 3L3UA 3QNOA 4J9LA 3ZT3A 3VQ7A 4CFDA 4OLBA 2KFZA 4BE1A 3AV9A 2P5GA 5KTQA 2R8KA 2ZD1A 1JLAA 1NK5A 4DS5A 4NCBA 3L2QA 4U7CA 4DU3A 3SUQA 3MF5A 4YFUA 3RB3A 1BQMA 3MAQA 2XY5A 1S6QA 5KFOA 1S1XB 3U3YA 2WONA 1FKOA 1WSGA 4FJHA 2GBZA 4CGHA 5EUHA 3C6UA 4CJ4A 4QWDA 1J54A 2AU0A 4K4WA 2D3ZA 2UVRA 4CESA 1SKSA 4PWDA 2YHAA 3HM9A 4R5PA 5C25B 2E6MA 2D3UA 3SI8A 3AA4A 2IC3B 3OYHA 4PY5A 3PV8A 1JKHB 1TK8A 1VRUB 2Q3SA 1W25A 3N6MA 2X6SA 4BE0A 1S6PA 4CGDA 3AVBA 4NLTA 4J9KA 4DF4A 3DRRA 3HJFA 1NJWA 2WK4A 4Q8FA 2BDPA 1QHTA 2ZD1B 3T5JA 3L3VA 4ED1A 3P83D 3VN5A 2FVRA 1UA1A 4CFAA 1WAJA 4RU9A 1C0UA 2DFHA 1RA7A 5JS1A 4O0JA 1KTQA 5C42A 4Z0UA 5KRSA 3DI6B 5J2QA 5K14A 1TAUA 4ZP8A 2BANA 3GV8B 1FKOB 3IS9B 3SJJA 3QIPA 4C8KA 2HHVA 1LW0A 2WOMB 4ZP6A 4AHUA 3C6UB 5KT3A 1S97A 3O3FA 1ZTWA 2OPRA 3QNNA 3NAIA 3PX0A 1XR5A 2F8SA 3L8BA 4QPXA 4I2QA 4FZYA 2D7SA 3LP3A 4FJXA 4RNNA 1I3AA 3PY8A 3IAYA 1WSEA 4NYFA 4NZ0A 4R8UA 2D0AA 3TAMA 4NLGA 1S6PB 4CIFA 3SQ0A 4BWMA 2LSNA 4M3WA 1IH7A 4O3NA 3Q8RB 1W0HA 2Y1IA 4F4ZA 2HHUA 4FJIA 3O4NA 3DYAA 3CFRA 3QEWA 4ED8A 5C42B 3QGHA 5KG0A 3SCXA 4U6PA 3WNHA 3HVWA 1LW0B 4ELUA 4FLWA 5EWGA 4LY7A 3M9MB 1RTIB 3DLRA 3DDKA 4Z4IA 3V81A 4O3SA 5HROA 2VA3A 2OPQB 4CEOA 5HP1A 3RAXA 4F8RA 1EXQA 1KFSA 4KI4A 1UWBA 5HRSA 4EBDA 3QEPA 3M8PB 3NH1A 2RF2B 4CHOA 4XO0A 3Q8PB 1EETA 5I42B 1DLOB 1X9WA 2GIRA 4ECXA 4KHWA 5J2NB 1J5OA 4HTUA 1U4BA 3OHBA 2EC0A 3KNAA 1SL1A 2E9TA 4IKFA 1A5WA 4DFMA 2YKMB 5J2PA 3SYZA 3NGDA 4KTZA 2E6LA 4DTOA 1X9SA 3K58A 4CFBA 5F8IA 3ASMA 2XGPA 1ASVA 3N6NA 4B08A 1SH0A 1IKYB 1I6JA 4DL2A 3TARA 2HHQA 2R8IA 3QEXA 3M8SA 4CECA 1FK9A 2FLLA 4FJ7A 3EY1A 1XWLA 4ZVEA 3AO2A 3CJ0A 3I0RB 3QEIA 3RRGA 1JLGB 3F73A 2FJVA 4FK2A 1VK0A 4ECZA 4RW6A 3GIIA 3LP1B 1BQNA 4B8CA 3S9HA 2WTFA 4DQSA 3KLFA 3V6DA 4DTSA 4HCCA 4EYHB 2VG5B 3MFHA 1HQEA 4FYDA 4LH4A 2OPSA 1JLCB 4CJUA 4Y1CA 5J2PB 4ED7A 3OYAA 3DRSA 4J9PA 1WSIA 4ED3A 3THVA 3H08A 2B6AB 1KRPA 2FLPA 4OVLA 4IBNA 2HW3A 3OYEA 3QYYA 5L1IA 2XY7A 5JXSA 1C0MA 3HL8A 1QTMA 3FQLA 4DEZA 4F50A 3IRXB 5KFJA 4YQWA 2QV6A 3OL8A 2WCXA 4ECUA 3PJXA 1ZTTA 4FJMA 1J9AA 3V9SA 1BQNB 3L2RA 4NLUA 3MECA 3KLFB 4CEZA 3V6DB 5I3UB 1ZBIA 4URSA 3V6JA 1QAIA 3MXIA 4KHQA 3PW0A 2I5JA 2A1RA 5EWEA 4DQQA 4K50A 3RMAA 5F8JA 3RMDA 4FLTA 1S48A 4TYBA 3KLEB 1JLQB 1HYSA 4FM2A 3PX6A 5KG1A 3IN5A 3ITHA 2OH2A 2UVVA 1RDBA 3OVNA 5CY4A 1SV5A 1N56A 1S1VB 1TKXA 1T7PA 5KFYA 4H54A 3QLHA 5CYQB 4KB7A 4CJ5A 1KLNA 4FJNA 3QESA 4K8ZA 1BIUA 2VG6A 2XC9A 5C24A 3RBEA 1BIZA 1CZ9A 5KFFA 4W5NA 4TQRA 2W9BB 5FRNA 4WE1B 3FRZA 4IG0A 4R0EA 4CEBA 4TY9A 3EZUA 1LV5A 3PZPA 4OPJA 4O3OA 4IFVB 4RUAA 4TSXA 4J2EA 4DFKA 5DG8A 2OPPA 4LSLB 4CJ3A 2XO7A 3MEGB 5KT5A 1Z26A 4RW4B 2JEIA 5KT6A 3NBPB 3UIQA 3ZSYA 4F4YA 4DTJA 1JXLA 4E19A 1RTHA 3C95A 1TKZA 4KAZA 5FROA 3CDUA 3I5AA 1S9EA 1HYSB 3NCIA 2KZZA 1LW2A 4FJKA 1WNSA 4DU4A 3ITHB 1SUQB 3SUPA 4TLRA 4Y3CA 3U6FA 4OL8A 2YNGA 2YKNA 4FLYA 3KD1E 3HHKA 4KREA 2YNIA 4CERA 3BDPA 5HBMA 3KK3A 5L1LA 3ZSWA 3OYMA 4RW7B 4CJPA 4ECQA 3E51A 4LD0A 3H5UA 5KFBA 3LZIA 1S9FA 1QQCA 4ZHRB 3MXMA 3KK2B 1NK8A 1XR7A 1QSSA 1CZBA 2BGGA 5DG7A 2R8GA 3BGRB 2DPIA 3NH0A 4DL3A 4KPYA 2OPPB 2R8HA 3WNFA 1NHVA 2FBTA 5L1KA 1HARA 2IBKA 1UAXA 4I9LA 4RNOA 4IH5A 2BRKA 3VQCA 1C6VA 1S9EB 1U09A 4YR3A 1ZETA 1RT6A 4I7FB 4RG8A 1VSMA 1FKPB 3T1AA 4NYNA 4CJWA 1IKWB 4ICLB 1EKEA 1GOBA 1QSYA 2X6NA 2E9ZA 1TVRB 5KFVA 1LWCB 2HVHA 3NKYA 3OYBA 1CLQA 4W5TA 4ID1A 4MK8A 5DLFA 2Y1JA 5DQGA 3BSCA 1CXQA 3OL7A 4W5QA 1I39A 4FJ9A 4FK4A 2KTQA 3OYLA 4G1QB 2PY5A 3T19A 5KFNA 4DTXA 4DQRA 1RT5B 3M9NB 4FS2A 4HYKA 3SQ4A 1RTJB 4WYLA 2B5JA 1R0AA 4NCGB 2HWIA 4CEDA 2FLNA 1REVA 4WZQA 3O4QA 4B9VA 1GX5A 4TXSA 3EZ5A 3TWHA 1RT6B 4NRTA 4IR9A 2FBXA 5KGWA 5KFLA 4N56A 4M94A 3G0ZA 2IDOA 3V9WA 3NL0A 3CM6A 1IKXB 3JSMB 3HPGA 3TAFA 4ECYA 2QK9A 5KFQA 3G10A 3U3GA 2AGPA 2BQ3A 3QERA 4DSLA 3IGVA 2HHXA 2AX1A 3EPGA 1CXUA 5F8NA 3TAPA 4ECVA 3DLEA 4EBEA 3LANA 1S9GA 3AO1A 4Q0BB 4H8KA 3ZSOA 4GW6A 4K4VA 2ASDA 3HYFA 1HNIB 3G6VA 5E41A 5HLFB 3VQDA 3TR8A 4URQU 2G8KA 3OSNA 3I0SA 4KHSA 3KLGA 1S0OA 1HMVA 4CF0A 2ALZA 4FM0A 2HHSA 5KFAA 4F4WA 3KTQA 4MFBA 1N5YB 2EX3A 4H4OA 1TL3A 3V4IB 3HXMA 1IG9A 4IFYB 4PQUA 5C5JA 4DSKA 5T14A 5SWMA 2R2RA 4RW8B 5KFMA 1S1UA 5CZ2A 3I5BA 4B9UA 1NK4A 1YT3A 3LP2A 4GVMA 2PZSA 1LWFA 2Z1HA 1KVAA 4ECWA 3LWLA 1SH2A 3QGIA 3DLEB 1X1PA 1S9GB 1VRTA 1ZBUA 2ZE2A 4QWAA 3Q8SB 2C2EA 1NKCA 1WSHA 2HHTA 3SV3A 4HCBA 1LWEB 4Y2CA 3OYFA 3H4DA 3KMSA 1RYRA 3PR5B 4QOZB 1RCHA 4TY8B 4M3RA 3GV5B 2W7OA 4CJEA 4CEQA 3DRPA 4DLEA 4CHQA 4EO6A 1MU2B 4HHTA 4E0DA 4HUFA 2G8IA 4LQ9A 3RTVA 1YVFA 3H98A 3FFIA 4ID5A 4ED6A 3CFPA 1TV6A 4XPEA 4Q44A 3ISNC 1S5JA 1NK7A 4CF1A 3SQ2A 2BR0A 1D9DA 1S1UB 1ZBFA 4B9SA 4FCYA 4IG3A 1RBUA 4I2PB 5J1EB 2IA6A 1WSFA 2KFNA 2HVIA 1TK5A 2IM0A 3QETA 4F2SA 1RT2A 3SPZA 1TKTA 4M45A 3HO1A 3OYDA 2XGQA 1WAFA 3LWMA 4UQGA 5F8LA 2XY6A 1JLAB 4URGA 4B8AB 4Z4CA 4EBCA 4BACA 4KBIA 4TYAA 2ATQA 4K4SA 1BQMB 1S6QB 4CHNA 4DFJA 1ITGA 1T03A 4ZP9A 1VSKA 4FVMA 2WONB 2A1SA 1VSFA 2G8WA 3CJ4A 4DG1A 3ZT2A 4BE2A 3AVLA 4MK7A 2IAJA 3KKRA 4DL4A 1S1WA 1TGOA 4FXDA 4EYIB 4PWDB 4BWJA 3VA0A 3H5XA 3AVNA 2VG7A 4CJRA 4C8OA 4R5PB 3G6YA 2IGIA 3K5NA 3CM5A 4RUCA 2IS3A 4EEYA 1Q9XA 3QZ8A 4ZMMA 3DRRB 3KK1A 1L3VA 3PJWA 4ZVGA 1UA0A 3AVAA 2OZSA 1C0UB 2FJWA 4K4TA 2XCAA 1KFDA 5CYMA 1S4FA 5J2QB 4DLGA 5K14B 4C8NA 3NGZA 4HUGA 2BANB 3GIJA 2C22A 2KZMA 3SUOA 1C2PA 3QIPB 4O0IA 2JEJA 4WXWA 3OYKA 5KFTA 2C2DA 4NCAA 1XR6A 1EP4A 2OPRB 2ILZA 3K59A 3CJ3A 1S49A 4I2QB 1FXXA 1VSIA 4JRPA 3L2WA 2WHOA 1RT4A 2YNFA 4E3SA 5KG4A 3D5MA 3M8QA 1NKEA 1D8YA 4R8UB 1WN7A 3TAMB 3BSAA 2HNDA 4O4GA 1L3TA 5CZ1A 3AVFA 3OHAA 2HAIA 2BE2A 2RDIA 1HPZA 2X74A 1NHUA 4O55A 3DYAB 4ZPCA 3TABA 4TQSA 4M95A 3NGYA 4M3UA 1T05A 1KVBA 1D0EA 1B9FA 3KHGA 4F4XA 3HVAA 1TQLA 4EZ9A 2HNZA 2PYLA 4GC7A 3NGIA 1EP4B 3V81B 5F8HA 5HROB 4DWIA 3NE6A 1ASUA 5HRNA 5HP1B 1TAQA 3NDKA 3QZ7A 2XY8A 3JYTA 1UWBB 2YNHA 5DQHA 1WSJA 2R2SA 4G3IA 4JV0A 3ULDA 3NF7A 3GILA 4M41A 1JXBA 4CGGA 1EETB 4DSEA 2HNDB 3BQ2A 1RDAA 1U48A 3MR6A 3GV7B 3OJSA 1J5OB 3RB4A 3FSIA 4B3OA 4Y1DA 3AO3A 3HT3A 1JLFA 1JXEA 5DK5A 3HP9A 1JLEA 4AHRA 4ECTA 1TL1A 4IH6A 4QWBA 1D9FA 2DY4A 3RRHA 4CJLA 1HQUA 3T5LA 3VQBA 4KB1A 4FJ5A 4LSNA 3NF8A 4PUOA 3LDSA 4ZTFA 1FK9B 3BREA 2QE5A 2DTUA
chains in the Genus database with same CATH superfamily
4B3RK 5AJ3K 4YOUA 4K5RA 4DV2F 3CCQN 1VQ5S 2NNWA 4KKOA 5JLFA 1MN9A 4GV3A 3JB9k 1QHAA 2CXEA 5AQVA 2FY1A 3CULA 4OKJA 2KHDA 3SSQA 1HQEB 4LFBF 5KT7A 4A62A 4A5AA 1P6TA 3GONA 4FW1A 2MSSA 3CCES 1W2BM 3AVHA 3KHRA 1FFGB 1Y64A 1K8KA 1DTQA 1NXIA 2W4CA 4KBOA 4DR2K 1HNZK 3O9RA 3J7YI 1IO2A 2VL1A 3OS2A 4OX6A 2K3IA 3O08A 3FQKA 4N76A 2F7VA 4KO0A 4PR6A 3M2UA 1G2EA 3JXUA 4CHZA 4CEFA 2RILA 4DV0J 1UAWA 1RB0A 1G4CA 2BQRA 1T02A 4CLKA 4JI4J 2ZH2A 3N01A 3DLGB 1Y11A 5GAHI 3Q0AA 3MECB 3NF6A 1NK0A 3MR7A 4M5MA 1FX2A 2P9SB 1YRTA 3W5XA 2MKYA 4E7KA 1S1TA 2DO0A 1YUWA 4NI2A 3D6FB 5KG6A 1Z2ZA 2P5OA 1U2CA 3L7OA 4LFCK 3AO5A 4DCOB 1AT1B 3HZEA 1VK3A 4WU2A 3N5FA 3M6XA 2RMLA 2M3DA 5FJ4A 3WXMB 2XZDB 4KGKA 2YHWA 3CCLN 1SV5B 2DGTA 1F9FA 2DIVA 2GVDA 1ZZNA 5KG2A 3VQ9A 1N54B 4J7CA 1RAFB 3QIOA 3NOCA 5LXYA 2HMIA 2MLXA 4MQ3A 1BHNA 1OQ3A 4FWLA 3ZT0A 4M3XA 1VQON 3I4HX 3NCRA 2FSNA 1YVNA 1NSQA 4V1Ak 2V2VA 2XSFA 4KC5A 1S72N 5C0YA 2Z58B 3AVCA 4DFPA 2QG9B 4KV8A 1YKWA 3GBTA 2FY8A 2VOOA 2RKIB 1RTDA 3CCJS 3BH7B 4LF9J 2HS0A 3ZSQA 3ZX2A 4OLOA 3HPHA 3LP0A 1ACMB 1QQOA 1GH8A 3OPKA 2E7VA 3G6EN 1RBRA 2AMCB 2BA9A 2B9WA 4O5FA 3UR3C 4CT9A 3AD9C 1FRHA 3M2RA 3CPWR 4L8RB 1YJ9N 2YNGB 2J8AA 2J6SA 5C15A 1C4AA 3KK3B 4N5SA 3JSBA 2E4LA 2IM2A 4MK9A 2H5EA 4BRIA 3H3OB 4H0YB 1KQKA 1ASWA 1DHMA 2O8FA 2RU9A 2M4MA 5ETSA 2OTLN 2L08A 3O5TB 2V8HA 2AV5A 2Q79A 1S79A 3CCRS 3O6WA 2UUCK 2NZTA 6FD1A 3DLJA 4GRSA 2ZHOA 4F36A 3NHGA 4KFBB 2IPOB 4ETZA 3AXKA 4YDXA 3H59A 2FB0A 4M63C 5HL7L 4RL1A 1ZBSA 2FJBB 1I3OB 2AYGA 3BSOA 2KKHA 3SBTA 3BKUA 1PO6A 3IBWA 4LF7K 2WSEC 2F8TA 1KOHA 4X62F 4P7VA 4ZVQB 4Z4GA 5LSOA 3DLKA 4BQLA 4C1NK 3CJ2A 4GKJF 1ZAWA 1NJZA 1LAWA 3C6HA 3FBBA 5KGXA 4ER8A 4PKIA 2DNMA 5A0YB 1FI4A 1NM1A 2KT3A 1L3UA 3TZYA 3VQEA 1N33K 3MR2A 2FD2A 1YLXA 2KDOA 1FFSB 5EVZA 1HI8A 4CJFA 2JC1A 2PFFB 2BJ8A 2RQCA 2CRLA 3KLIA 1XI1A 1S1XA 3WC2A 1QUVA 2L9NA 1Z25A 2ZH8A 1CLFA 3AY9A 5DMRA 4MKAA 2OA8A 3R6GB 4CJ7A 2C2OB 4AFFA 3PUFA 3LPUA 1IUJA 4AHTA 2RDJA 1KNZA 3LW5C 1GOCA 3HJVA 3H0PA 3VR1A 4OMFG 1YJ7A 1A7GE 4J9RA 3KD5E 5AZJA 3SMSA 4RZRA 3NGKA 2DH9A 2P9EA 1G3OA 2B8QA 3MN9A 4HLBA 1IV0A 2FZKB 4FDFA 4ZJLA 3K5LA 2NSCA 1Q7YT 4PXCA 1F21A 2J0SD 4HH0A 2UXCF 4MFBB 2N4CA 4JKFA 3LOUA 2CGKA 4PQUB 1CJKA 2XMTA 1ZBLA 3M2VB 3OXLA 2VBXA 2FVQA 3GIRA 5GAEI 3LP2B 4LFAJ 2G2ZA 3POTB 4OI1A 2MKSA 3T5KA 4QWCA 4CZIA 3M4XA 4M8LA 4CBWA 2E5LK 1KSPA 3ZZOA 1MWMA 3SNNA 1MWYA 4KPCA 3TR5A 3DRPB 3H1QA 2XEXA 4CFCA 2OYQA 4ED5A 4WQ5A 1GTEA 2RSQA 4K4UA 4CI0B 3U8XA 2QA4N 1YAGA 1R8CA 3VQAA 1LAVA 3C2PA 3T1HJ 2MPUA 1RT2B 3THXB 3CCSS 4C0OC 3R8YA 2O66A 4ZA1A 4AYBD 2W6LA 1UVJA 1G7CB 4LRBA 5KQDA 3PIOQ 1KHVA 3CVKA 1CQMA 1T03B 1FESA 5I42A 2GQQA 2QT7A 5J2MB 1R43A 2A0FB 3TI0A 3OYCA 3TJAA 4Z4EA 2RHSB 1XMQK 5ETNA 4H4KC 4BRKA 2VG7B 4AUKA 3UDLA 1GLJO 2C3YA 3K8VA 1P9QC 4OHZA 4XTTA 3I8BA 2G0JA 3GJQB 1IKYA 4Y6IA 1HNXF 2CQ2A 4YY3J 3H6EA 4Y2MA 1N34J 3I0RA 4MIBA 1S12A 3W2WB 4KRWA 3BGUA 1FTCA 1U2RA 1Q82O 3NMRA 5KG5A 3CC7S 2DNRA 2VQEJ 5DRKA 2ZM6K 4XPCA 5D3GA 2HIQA 1RAJA 1WEYA 1WDDA 5H9EJ 3HBTA 3LAMA 4FPRA 5D78A 4CGJA 1TKDA 5HK4A 4KHYA 3CJ7A 4BROA 2U2FA 3RZAA 2CQ3A 2YNFB 1V5IB 3M8QB 1X4BA 4LVNP 4LR9A 4QW8A 1NPKA 2CWKA 1N6QA 3QFHA 4B9MA 4IOBA 3K9KA 3UCUP 2IFXA 4CHYA 4DCPB 1HQ2A 4WIQA 2BE2B 2C2NA 2ZOMA 3QGPA 3AODA 3IDHA 3CMES 3HVTA 4DUZK 1VBKA 2EXUA 2LXUA 2DRDA 3NCPA 3EWGA 3AOAA 1T05B 4KRFA 1KD1O 1AW0A 3MUVP 2CJXB 3I8DA 3OYJA 1JJ4A 2K1RB 2BACA 3SUNA 3CCZA 2LLZA 3O1WA 2YI1A 1Q53A 4PWUA 4DS4A 2VKZG 3EJMA 4OZ1A 5DGAA 2XWXA 3U27A 3MR5A 3KYLA 4JRQA 3CDAA 1S1VA 3DOLB 3IAM9 1LCUA 4V19J 4OYXA 3H5YA 3A2FA 3WHIA 2E8AA 4NYPA 4E8UA 3KLVA 4O44A 3HFZB 1FW6A 4IH7A 4PPDA 3HHNB 4FM1A 2XG8A 4F26A 4WQ4A 1PJ6A 5AQUA 4RNHA 2V0NA 5DDRC 4RBTA 1JLFB 1GMVA 3UVJA 5HL7Q 2E1CA 4ZLPA 2Q97A 3S6EA 4JBCA 3MAAB 4O3QA 3VQ6A 2BKOA 4JI5J 1JL1A 3SLCA 4WZMA 4FN5A 3UE5A 4KE5A 3K0JA 3KWMA 1SUQA 3KHHA 1JLBB 4WQ5C 2UXDJ 2QI2A 3H46O 5HQMA 3Q23A 1CS4A 1ZAXA 3MEDB 1I51B 2FHJD 4RW7A 1TUUA 4N41A 4IRDA 4LR8A 2NLXA 2YWFA 2AJ2A 1AZSA 4JI0J 4ENOA 1Y97A 1VQ8N 2A10A 4Z4HA 4WF9L 4XEIA 1NGGA 4P2SA 4JKAA 1NZ8A 1PBUA 2FJXA 4QBUA 4WU3A 1JNZB 1PJ5A 3QINA 2AJ1A 3D2EA 2OFHX 4ANCA 5KI6A 4NZ7A 4DMZA 3F41A 1OJ4A 3QT6A 1NDPA 3TZZA 4I7FA 4A8YA 4NA2A 4CWBA 1VQNN 3ZYYX 5FDLB 4H4MB 5A8KB 1IKWA 4HDHA 2N3LA 3GSIA 4CJTA 4J8FA 2UUTA 1M90O 2ZDPA 3A0IX 1D5AA 4Y28C 3AH6A 4CZCA 4FKYA 4FYVB 1YDLA 2CQCA 1VQ6N 1QAYA 4G1QA 4JV1A 3ZZUA 1HPMA 4M7XA 3NMAA 4X62K 1C1BA 2DNNA 4WIIA 2XSJA 1RTJA 4CO2A 4DN0A 1ILYA 4DV4J 3Q2TC 3MPUB 2R7SA 5DDOC 2QWRA 1WOQA 3F9MA 4CVNE 4IOCQ 1BWFO 3VEWA 3JSMA 1AB8A 4RW9B 2RAQA 2HRTA 4RNFA 4J9NA 1WOPA 1NPRA 2VQFK 4RBVA 1HWIA 2XWYA 2GHPA 4FLZA 3FLCO 4U7UD 1FVSA 1S99A 3J7ZO 5FRMA 2O8EA 5C7PA 2NZ4A 1NB2A 2V2QA 2LP4A 4WTOB 4Q0BA 2F9WA 1RYSA 1FRJA 1RWNB 1HNIA 3THWB 1N36F 4LF8J 3SQ1A 1Q8IA 1Y7PA 3V1RA 2NSBA 3J8AA 2NYIA 1SKRA 1RT7B 2R42A 3D28A 3KJVB 4C48A 3VF4A 1N5YA 3QBCA 4WP9A 1XMOJ 3JXOA 3W60A 4XH4A 2MQOA 1S0NA 1RACB 4JI1F 3THYB 3OW2M 1TYQB 3OJUA 5DGBA 2ASYA 4M5DA 3O9TA 3P45B 2VCPA 1A5VA 1M5KC 2QLFB 3TTCA 3SFUA 2UXCK 3CDWA 3MDFA 5JS2A 1SKUB 2IVPA 1ULRA 1FJ7A 4TY8A 1ZBHA 4CIGA 2EHGA 4WCEQ 1BHLA 3ENHA 4DCHA 3ZO7A 4L3KA 3W3DA 1YI2S 2POKA 1YBUA 2W9CB 3HHEA 2QFIA 3MEEB 4F3QA 1BUPA 3D9BA 3OFGA 4MMOA 5IS2A 4N8OA 2GW8A 3S3MA 3KJFB 4I2PA 3KJQB 3TAEA 3QDKA 3L3UA 2E1YA 3TVYA 2RE2A 1SQGA 2BM0A 1R7IA 3AV9A 2UUBF 1JLAA 1NK5A 3A12A 4NCBA 4U7CA 4DKWA 5CHCB 6FDRA 5KFOA 5LMUF 3I87A 2KYZA 4KHPJ 1WSGA 4F4AA 4CJ4A 4QWDA 1RU1A 1J54A 2D3ZA 5B08A 2GEMA 3O9UA 1DKGD 1BMQB 2HZVA 4HACB 5B0AA 2YHAA 2OGUA 3VAKA 3VEVA 4KJIA 5BR9A 2IC3B 5IQ6A 4PY5A 5CCLA 1CJUA 3CMAS 1JKHB 3CW2C 2PO4A 3LGNA 3LDLA 3N6MA 3NS5A 4J9KA 2CQHA 1H7WA 3G71N 4DF4A 3HJFA 1U24A 3I56N 2O8DB 4DR3F 3THPA 4Q8FA 1QHTA 2FVRA 3M6GA 1WAJA 4RU9A 1RA7A 3MMCA 2ZOFA 2YX1A 2OELA 2ZWOA 3DI6B 3GFYA 1HNXK 4LF4F 2FHJA 3SQGB 1FKOB 4C8KA 2HHVA 1LW0A 2WOMB 3UNGC 4FL9A 4K41A 2F65A 3VTIA 2NQPA 1S97A 1K47A 2OEJA 3O3FA 2OPRA 1VJWA 4FJXA 2NRVA 2LA4A 3EVMA 5E5NA 4JI3J 2B9XA 3C65A 4WK1A 3TZWA 5I9EB 1WSEA 1NJIT 1TMMA 2Z57B 4NZ0A 4R8UA 2B8PA 4C11A 3ZEUA 1S6PB 4CIFA 1TFWA 2CQIA 3G4SS 4M3WA 5MAOA 3MM7B 1IH7A 1X9JA 3D6HB 2NXEA 1N32J 1UVLA 4HWIA 2EFOA 3H20A 3KG4A 4FJIA 3H8YA 3DYAA 3ULEB 3QEWA 4ED8A 1GLBG 3QGHA 4W92B 1RDWX 5A76A 2A5XA 2DTJA 3K5PA 2Y8WA 3EN9A 5BRFA 3HVWA 8ATCB 1WBBA 4PG5A 3ZNJ1 5RUBA 3UN5A 3E9PA 4NXNJ 3V81A 5HROA 1HWLA 5IM0B 1CJVA 2OPQB 2GELA 5HP1A 2JL9A 3VGTA 1W2IA 1UWBA 2DNOA 3ATVA 2RF2B 2Q6CA 3OFHA 3DKDA 3ZETB 5J2NB 4HTUA 3KNAA 3OHBA 2EC0A 2IHR1 2E9TA 3NMUA 4DFMA 3MPDA 3BBCA 5CYJA 1CJTA 2J8SA 4EHTA 3KUEA 1IBMJ 3H7HB 1J2VA 5F8IA 4P7TA 2D74B 5I4MA 1EJ7L 2I9SA 2DB1A 1ASVA 4IOXA 4OO1J 3QWPA 4NA3A 4B08A 4OJGA 4OV1A 3TARA 3AY0A 3QRPA 2HHQA 3QEXA 4IQMA 4QYRA 5EOYA 1QQNA 2CDRB 1GEHA 3IP0A 3CJ0A 3C7NA 4NE9C 3GIIA 2Z0GA 4W4MA 1U0SA 1BQNA 3VPZA 5H1SQ 3KLFA 1H74A 2E5HA 4L76A 3Q86A 4A48A 1WF2A 3PIPL 1HQEA 1XNQJ 3C15B 4AL7A 1WHVA 5HMYA 2XMUA 2W24A 3ZXWA 1WF1A 2ZF5O 2D3O1 3A3OB 5KPTA 1U6ZA 4J9PA 1WSIA 1H38A 2ZZNA 1ZA2B 2B6AB 2P9NB 2M52A 4BCAA 3D2FB 2JLGA 1NCLA 3KUGA 1S4EA 3HL8A 1QTMA 3FQLA 3MPWA 2ZJRQ 1IR1A 1WHWA 2QA4G 4ECUA 1UMJA 4F04B 1J9AA 4DV5J 2M0GB 3CF5Q 4NLUA 1NGBA 3MECA 5JVGL 4IOAL 2P9SA 5LSRA 5AQLA 1ZBIA 4L3QA 2XNRA 4FPBA 5AQFA 3MXIA 2M70A 1XNRK 2Q36A 2HHHJ 3Q2SC 5EWEA 4FLTA 3ENWA 4LIRA 1NGDA 2BMBA 3KLEB 4HT7A 1NMEB 1HYSA 1T6DA 3UKRA 3GP9A 3PX6A 2NXJA 4ZVPB 2UVVA 3TX0A 1SV5A 1N56A 1T7PA 5KFYA 2XTJP 3OFFA 2HBYB 4OX9J 2XLJA 4G6VB 4K8ZA 2WBNA 1MA9B 4ISEA 4AXJA 4OJHA 1EO1A 2V2ZA 3TNVA 2HK3A 1CZ9A 5KFFA 4X66K 2W9BB 4JI8K 2X3DA 3F44A 2HQGA 1IJEB 4TY9A 1U1QA 3NNCA 3W8PA 3PZPA 3SQOP 3W1YC 1CC7A 4J2EA 5E0OA 4JI7J 4DX5A 2CPEA 5DG8A 4LSLB 5A2QU 4CZJA 3BPSP 3RW6A 1Z26A 3UNYA 2JEIA 3NBPB 2NUUG 3NGRA 4DTJA 1EB0A 1UEUA 2LKZA 3W9IA 3I5AA 4CLLA 1Y00A 3B78A 4DU4A 4A8FA 2DVIA 3CJ9A 1EKRA 4OL8A 2YNGA 4GVBB 2Q43A 2OANA 2Q2RA 1NJIO 1U2FA 4LF1A 3KK3A 3RAMA 4RCHA 4UW2A 5LSLA 3ENQA 3ZSWA 2JWLA 3OYMA 4CJPA 3M30B 4QIGA 3UE2A 5KFBA 2GHWA 1M1KT 3ILOA 3KK2B 3AAQA 2EK1A 5GADP 4CYUB 3FBEA 2Y1RI 4NL5A 3BGRB 4HTIA 2OPPB 2QRRA 2WB1D 1TUVA 4I9LA 3VQCA 1WC1A 3VETA 5AQKA 1S9EB 4P2XA 4FWQA 3JQMA 3DU6A 1U09A 2CZVC 4W98A 3VERA 2O67A 1RT6A 4K59A 3CTRA 2VC1A 1A0OB 1FKPB 4CJWA 1ZPWX 1WG4A 3HSZA 2E9ZA 3G25A 1TVRB 5AXLA 1IVZA 5KFVA 2E7WA 1LWCB 3HKZD 3NKYA 3OYBA 1CBKA 3LPEA 4ID1A 4MK8A 5DLFA 5A0YA 2GFFA 4W5QA 1NH8A 3HFVA 4ZJQA 3T19A 1NGFA 1BUXA 1RT5B 1GQEA 1I94K 5IV3A 4EFAC 4D3HA 4FWOA 3O4QA 4B9VA 3TWHA 4NRTA 2FBXA 4N56A 3G0ZA 3V9WA 2MQLA 3TAFA 4TVAB 5KFQA 4OYPA 4LSZB 4FWPA 2BQ3A 1RBOB 1RCXB 4DSLA 1RU2A 2F63A 2AX1A 5GAGU 3FMWA 3HM8A 3TAPA 1FHTA 2HVEA 2DNYA 2JVOA 1XUPO 1RKIA 1S9GA 2FSKA 4GW6A 2I6WA 5ADXA 1IQZA 4K4VA 3W5ZA 3IM9A 4MYUA 3GYGA 5HLFB 1X4FA 3GJRB 3TR8A 2G8KA 1NGJA 3G82B 4AQYK 1RP5A 2HHSA 3FGVA 4MFBA 2P9GA 3QB0A 4PQUA 5C5JA 3D4JA 3CXCM 1C0GA 1K9MT 2R2RA 2V4JB 3T7ZA 1S1UA 1F6TA 3M2VA 4WWSA 3I5BA 4R25A 2PMZD 2V8PA 3EUNA 1NK4A 3LP2A 1GXUA 2FZGB 2DRAA 2PZSA 1UW9A 4ECWA 1SH2A 3CT9A 2F8HA 3DLEB 3FZMA 3POTA 5DZ7A 3C14B 4Y2CA 1IBCB 4XH1A 3T6BA 3H4DA 3ZZPA 4LJMA 1NUEA 3DXMA 3J81O 3PR5B 3MGJA 1RAEB 3GV5B 4A8WA 1Q95G 1JK9B 3DRPA 4DLEA 2IYIA 1MU2B 4NLBA 3WXLA 4USUA 4HHTA 3L6QA 4HUFA 2IVNA 2BW2A 1BDGA 5IOLA 2CDQA 7AT1B 2HBKA 3EZOA 3CFPA 4Q44A 2XMJA 1S5JA 3SQ2A 2DR7A 4JV5K 3VEOA 4FCYA 1VQ9N 1RBUA 3DXKB 2AEMA 1W2BR 1RT2A 3THXA 3MK6A 2GUPA 3WXJA 3TSQA 3OYDA 4IUFA 1V3RA 4P71A 1KWMA 2JDJA 4P72A 3EE9A 1YQHA 1S6QB 2XS7A 1S0VA 3D6TB 1T03A 3OVBA 2H51B 3IWXA 1HWJA 2A1SA 3DJCA 3AVLA 2XMKA 3OBYA 4DL4A 4CIOA 4FXDA 3JTNA 3TPQA 2VG7A 3OTOK 3UO0A 4R5PB 4YHHJ 2IGIA 4CM0A 1LFPA 2BTFA 3CC4N 1IBKJ 5D4PA 5F3ZA 1AA1B 4ZMMA 1N8RO 5BR8J 2KO1A 1MLAA 3DRRB 3OTBA 2GAGC 1L3VA 2JJ4D 4HH1A 3W2WA 4G1PA 2GQ2A 4OX8A 1KFDA 1NGHA 4KH1B 4Y0FA 2GGPB 1R0CB 4HUGA 2KZMA 1VQ8S 3OYKA 2MQMA 3BH6B 1SI9A 2OIHA 1FXRA 3CJ3A 1S49A 5CAAA 1IR2A 2WHOA 3VEZA 3NEKA 2YNFA 4DV0F 3D5MA 4USMA 3M8QA 1D8YA 2XYHB 1HWUA 4JI4F 3BDEA 1O5JA 2W25A 3N79A 2RUGA 2A18A 3HMJG 1JCGA 1VQNS 2KI2A 3MWPA 3A8KA 4PEOA 2BE2A 3FK4A 4G1IA 1NHUA 3LF0A 2FDNA 1HLUA 5K8PA 4CZGA 4M3UA 2NRTA 1T05A 5LMNJ 3PM9A 2ZH5A 4F4XA 3HF5A 2MXYA 1VQ6S 3CCUN 2PYLA 2BJ1A 2QYCA 1EP4B 1CVJA 2J4RA 2Q0RA 3NDKA 1WSJA 4A4JA 4DV1J 4G3IA 5AZIB 3ULDA 3CJQA 1TMJA 3MDQA 5HN0A 2V34A 4DSEA 4WKYA 4XDDA 1RDAA 1U48A 3MR6A 4I69A 3OJSA 1QY7A 4M1KA 1FA0A 3QT7A 2DR5A 4Y1DA 2LEBA 1F9EB 1AYEA 1JLFA 2X1FA 4K0KK 4LF9F 1T11A 2Y1LB 2CYYA 2GMHA 3OXFA 4QWBA 4ZVOB 2OD6A 3VQBA 5GADI 3NF8A 3BF1A 3MAAA 2MHNA 1FK9B 2DTUA 4NLOA 3IO1A 3TZXA 4DUYK 4CIEA 3D1OA 3NNHA 2IVOA 4CK2A 1JLBA 1JQGA 2QLXA 3MOJB 5CR4A 1Q86O 3K89A 3DOMA 2VFVA 4BHQA 3PW7A 1HNWJ 5DG9A 2UU9K 3HK2A 3MEDA 2OPSB 2AYBA 5AQRA 1EWRA 4CO4A 1IN0A 1IBLJ 1NDKA 2IMOA 3AVKA 3DRSB 1DAXA 5BPLA 3EM1A 1P90A 3AD8C 2G2OA 1XERA 5BJRA 4O3PA 1YVUA 4DQPA 2GZOA 4XDCA 4RUHA 5F0UA 2HVDA 2DIUA 1F5BA 1OPZA 3H2LA 5CA5A 2KFYA 2PA8D 2X1BA 3AA2A 2GJFA 4KKOB 2MTLA 4BRDA 5HOOA 2C28A 5KOXA 2IMWP 5LM7E 5FDLA 4KY3A 4H4MA 2HG4A 5A8KA 2XYGB 5A8WA 2J0WA 5D4NA 3R1LA 4LUBA 1PJ7A 1NBEB 5F8GA 2HBZB 3TO8A 2BEFA 4X4SA 2EG2A 1KCFA 3THTA 4NXMJ 3ISZA 4DR4J 2W1BA 2DGOA 1J5EK 3AJ2A 3MHYA 3KNGA 4EP4A 2KW4A 4KO0B 4FZXC 4I4BA 1K44A 4RJVA 5BXIA 2CNKB 3FBCA 3AOCA 1XK8A 4J9VA 3B6OA 2Y9HA 1RK8A 3VQTA 1RJJA 3IWNC 3UDCA 4WFAL 1OS5A 1VBZA 1Q1KA 1TZ0A 3CJ5A 4RW9A 3ZZYA 2O4IA 4DR1F 5HVHA 2ASJA 3ZTQA 2V6AA 3VQ8A 1XQIA 1RTHB 4ZVHA 2AHOB 3T41A 4DR5J 4B3TJ 4DR7J 1XEZA 2DJWA 5HJYA 2GIQA 3G71S 4CP5A 2JNJA 3I56S 2R7TA 4A8KA 5K20B 5HO4A 2WW4A 4HTJA 3E3XA 3THWA 1BA0A 4YR0A 3M32B 2HQCA 2J7UA 3KJVA 2ILYA 1VQPN 4BC2A 5DM7L 3EGZA 2FBYA 3O4WA 2PDAA 4LFAF 3T1YJ 3PRVA 1ATSA 3PW2A 2UVUA 3SBGA 3BJYA 3THYA 2GJIA 1TYQA 1Z05A 1V5VA 1RXOB 3LP0B 1DURA 3IBCB 1EX4A 4GC6A 3O3HA 3S01A 2V51B 3VV2B 3G87A 2F8EX 4H5VA 4LMZA 4M5NA 2XB2D 3W66A 2K8GA 2FYXA 3HSTB 4CLYA 1MWQA 2FSJA 3VA3A 3OL9A 1U1RA 3VVUA 4CEEA 4B3RJ 5AJ3J 3BYPA 3TAGA 2F4VK 1VYAA 4B1XB 1W7AA 3BR8A 4S0MA 3O44A 1QSLA 3FKBA 1HX1A 1KC8O 3FBFA 2V9KA 3WT0A 3GE9A 7FD1A 4FBTA 2VWKA 2W9CA 1RISA 4Z4FA 3Q7BA 3MEEA 3UPFA 3CCEN 4CRJA 3T1HF 2VGNA 4YOVA 1VSJA 2KG1A 4E7HA 1S6OA 5IT4A 1SJQA 2QO3A 4FJLA 5E84A 2DNZA 2LXFA 4DR2J 4ILGB 2HBMA 4FZVA 1JJHA 1HNZJ 1VSHA 1R0AB 4NLPA 5IWAK 1MDUB 4DN9A 4JLHA 1NDLA 4F7VA 2RHKA 2IOCA 2R8JA 4MTPA 4ZCLA 5FIIA 2NR0A 3NP5A 3BN4A 5A6WA 2QTDA 1X0FA 3FZHA 4E2FB 2ASLA 1VSLA 4I64A 4DTNA 2EFNA 1JB0C 4BRGA 4YY3F 4HACA 3CB4A 4KHRA 1GLDG 4QS7A 1N34F 2CVIA 3VGLA 2JSXA 3WX8A 4FS1A 2EWSA 4HR2A 2HEKA 2HURA 4LFCJ 1JKHA 1T44A 4ZJOA 3I96A 3PEHA 4BG9A 3I0SB 2W8LA 3AB2B 3P31A 3K2PA 3WBZA 1VQ4S 3ELHA 2VQEF 4CGIA 3KLGB 4KTWA 1HMVB 3C66A 3CJRA 2L41A 1N48A 4H4OB 2H65B 2QWOA 3KLIB 2E1ZA 4JI6K 3DI6A 2Q6BA 3QBWA 3SQGA 3LAKA 2WOMA 2WVFA 2LVWA 3VTHA 2A6MA 4C3MA 1S0MA 1FE0A 3FEXB 2YH1A 1LQ9A 3AQPA 2R7QA 2WUSA 1PYSB 1VBXA 3ISND 1DARA 3BGOP 3CCJN 4DR6K 1VRTB 5AZJB 2HBJA 3D1HA 1KQFB 2GUIA 4DV3K 4I9QA 2V2KA 2HHWA 3MM7A 1R6YA 1OSDA 4GO5X 2OP5A 3ULEA 4E1MA 3DDIA 1RBVA 4DSJA 1KONA 4QIVA 1YGYA 4B17A 4OYWA 5AE2A 3DM2A 1U04A 4IG3B 2HF3A 1REGX 2A3ZA 1X4AA 1R89A 3OSPA 2UUAK 2WRMA 2GX9A 2KN4A 1WI6A 2JLEA 2WVDA 5IM0A 2BXJA 2OPQA 4DTUA 3CCRN 1ATNA 1DFDA 2UUCJ 2NREA 2KHOA 2RF2A 2RT3A 2VKRA 3P6YC 4CLTA 3BO3A 2CFXA 4KQZA 4AHSA 4E7IA 3ZETA 5KFHA 4C8YA 5T41A 5J2NA 3JSRA 4DG1B 2IAJB 3R3TA 8RUCA 3D0PA 4GKKK 3D0HE 2D5RA 4QIEA 4E7JA 1S1WB 3AJDA 5CH7B 1WLJA 4LF7J 3MXJA 3PHEA 2P2CB 4JEPA 3SAGA 4JI5F 3V9XA 4IO1A 1O51A 5FLXU 3MM8B 3DFEA 3J80U 3HFKA 2F40A 3H4BA 4CO0A 1MMNA 3H2VE 1U6BA 3KK1B 3PACA 3FNNA 1NLVA 4CT8A 1DQAA 4D3GA 3K2YA 1VQMN 1F1BB 1N33J 2PD1A 4BR5A 3C15A 4JYAK 1U45A 1F2HA 4OYBA 1JCFA 3VZIA 2GJ2A 2V4RA 1X60A 1M5PC 1WORA 2R2UA 8AT1B 1WHXA 2XM3A 3CO0P 4HT5A 2B6AA 4PRFA 4WFAQ 2P9NA 1SXLA 1RT4B 3D2FA 3V1QA 4ZTJA 2PEBA 5FLXO 3J80O 3OR1B 2AGOA 3DAWA 4L3NA 1SL0A 2JOQA 4RTFD 3VQ5A 3LO3A 1UP1A 3M6VA 2PI4A 2NZCA 2FGCA 4M3TA 4LRAA 1N52B 5GVQA 5KFPA 3P5JA 1QS4A 1SS6A 4DSFA 5D3GB 5DZ6A 4H5WA 2HNZB 4ZCMA 4UT4A 2PIIA 1BA1A 2P9LB 3FEYB 1GNKA 1CSJA 4F4KA 4ELTA 2F5GA 1KHWA 2J76E 4J9MA 3KLEA 2QN6B 2R7XA 1IKVA 2Z1IA 2BV3A 1BCMA 4DPTA 4OLAA 1XHZA 2V5HG 1WKKA 3JAMO 2DGQA 1V9OA 3FEZA 4DV4F 3OW2R 4JV2A 2B4UA 4DV7K 3Q22A 3SMPA 1N6QB 2RPIA 2BUNA 5I3QA 1VS3A 1VLYA 3AGKA 4Y2AA 3L2VA 2W9BA 2X1AA 1H3DA 2E9RX 3HVTB 1VC5A 2E5LJ 3PCOB 1H2UX 4OGEA 5DM6L 1UJ5A 1DQ8A 4O3RA 3ENAA 4GVLA 2CJQA 3E9LA 3I9ZA 4KHMA 1OY9A 4LSLA 5TKYA 3VQ4A 1WTBA 3NBPA 3QSYB 4XAKA 3LM2A 3KOAA 3KXDA 4CJKA 4ECRA 2JHEA 1EIYB 3K5OA 4CLPA 1ESVA 2F8MA 1FRLA 1RSCA 1AFIA 3EICA 1TR0A 4LF8F 3DRXA 4KB0A 3GPAA 1C4CA 3PW5A 1QVGM 2B51A 3UFCX 1S10A 2H4YB 4DU8A 2GWKA 1GLFO 4DR1K 2VH7A 3CCSN 3MOZA 4O44B 4RX6A 3JQJA 4ZP7A 4DXLA 2JGUA 1VSDA 3NF9A 4HTLA 1SL2A 1XMOF 5C10A 3ZSVA 4K4YA 4EK2A 1FDBA 3CJ1A 2YVSA 4AILC 4HVJA 3KK2A 4CYUA 2CAJA 3BBBA 4C9DA 5HATA 3TX8A 3VAJA 4YR2A 2O5DA 3BGRA 3J7YU 3MFIA 3VVTA 3IG1A 1XMQJ 5ETVA 1VQYA 5CCMA 1BI4A 3CCMN 4EIAA 3EE8A 1JL2A 5D77A 2IIRA 2DT9A 4JKCA 5GAHU 5CABA 2BM1A 3SFGA 1FKPA 1SB6A 2AGQA 1X4DA 4J9QA 3AOBA 2VA2A 2RN2A 3FDSA 1YJUA 4O4RA 2XRIA 1K73O 1TVRA 3CC7N 1DQ9A 3BSNA 1LWCA 3QT8A 3U1MA 1ZM2A 9RUBA 1J27A 2HS4A 4BRCA 3HSDA 4NLYA 3P8BB 2ZM6J 2B43A 4NLRA 1TL7A 3JTOA 4M3YA 3H90A 5F9LA 4A47A 1GX6A 1RT5A 5EWFA 1T9VA 5GMKa 2L9WA 1RWXB 4NLQA 4IDKB 3NS6A 1FFWB 5FLXY 3J80Y 4KHPF 1WF0A 2J9DA 1ZYQA 3RBDA 3RW7A 2XYPB 2VONA 3V1OA 3F9KA 2E20A 4NLXA 3CMEN 1VFJA 3VAHA 4K7QA 5B0GA 2QSFA 4DUZJ 2HLUA 2UV8A 2DH7A 2MLYA 3OVSA 3ZZZA 3HT0A 1UW4A 2W4DA 3OLBA 3E2EA 4NX9A 4A8XA 4RUBA 3CJKB 1B92A 2F9JA 1C1BB 5LT5A 5HLFA 1O1WA 4ZKAA 3C6TB 4USWA 3G82A 5KFIA 1YX2A 3OL6A 3MXHP 2ZQBA 4CEAA 1RHQB 1FEEA 1R3NA 3GFHA 3KDOA 3TVZA 3NAHA 3KMQA 2YKPA 1G15A 4X65J 2IDEA 4CD3A 4ZS6A 2CQBA 2V4JA 2E1PA 2K7KA 3WNEA 2QZ8A 1VIXA 2SXLA 4JI3F 2LQJA 4KSEB 4OHYA 3P96A 4QQBA 1PIEA 2QGFB 1RDRA 4UQTA 1RLDA 4JI2K 2KB2A 1KN6A 2QW9A 1SJ4P 3C14A 1RT1B 4L73A 3RBXA 4H0TB 2LQ5A 3TAQA 1FJCA 4MKVA 2ZJQL 2FVPA 2PFUA 1XBWA 3TTDA 2V63A 1N32F 2N3OA 3MUMP 3SI6A 3KDNA 2VJVA 4CH0S 3TSPA 4F3TA 1X3MA 2A1BA 1MU2A 2GV1A 2RJZA 4IO9L 3CCUS 4BGBA 2RQ4A 1UETA 1OYDA 2AYMA 3RGIA 2G8HA 1TP7A 2AD9A 5C25A 4NXNF 5M1NA 5D0RA 3LQVA 2AA4A 2MY7A 1NU0A 4M5KA 4CE9A 5KOWA 3DXKA 3GFZA 1HJRA 1HYZA 4E7LA 4OYOA 3VEXA 3B4MA 3ZT3A 3TTFA 4BE1A 1ELOA 2ZD1A 3DLLL 3L2QA 5GAGP 2W41A 2GVZB 2OEMA 2CPJA 4DU3A 3SUQA 3MF5A 5K8OA 4YFUA 3RB3A 3MAQA 2XY5A 1S6QA 3D3CJ 2MYFA 3RG6A 3FZFA 1FJGF 1NGAA 1OMSA 1AUDA 4FJHA 5EUHA 2MJUA 3MI7X 3P49B 4OYMA 4F0MA 4CESA 3TUZC 5LOQA 4R5PA 2DY1A 1X4HA 4X64K 4CM2A 1VAZA 1VRUB 1BY9A 3MN6A 2ZKTA 2FXUA 2EKNA 3ZX3A 3DRRA 1SJRA 1NJWA 1XNQF 2BDPA 4LC9B 3T5JA 4Y0WA 1EARA 2ZVSA 4CFAA 4X62J 3BEGB 1KTQA 5C42A 3HHLB 1QDUB 1WD6A 2HBQB 5KRSA 3OXGA 2GGPA 1TAUA 4PHTX 3IS9B 2F7TA 4ISFA 1LNQA 4QJVA 2KRBA 5IC4B 4IXCA 3D54A 3CJBA 2VOPA 1ZTWA 5GAEU 2F8SA 3R2CJ 3EXCX 2XLKA 1N5SA 3LP3A 3QJJA 5HANA 2VQFJ 1FNMA 3PDNA 2MMYA 2YHYA 4NYFA 5CD4A 2YTCA 3R5DA 2DHGA 5AE3A 4NLGA 4K25A 3NG8A 3SQ0A 2QWNA 3UDVA 2LSNA 2CQ4A 4O3NA 4AM7A 1W0HA 1XN9A 2HHHF 1HKGA 1NMNA 3O4NA 3U7JA 3MMCB 2EFPA 3V2UC 4U6PA 1JJ2R 1LW0B 4FXWA 3M1VA 4FLWA 3TA2A 3P5BP 5LL6Z 3BP8A 2GQCA 2EK6A 4OX9F 1KAXA 2ZWPA 1R6VA 4EBDA 1P27B 3SK3A 2XMAA 3NH1A 5AZIA 2RU3A 2HVZA 2QLJB 1X7VA 3Q8PB 5F0WA 2AKWB 1VHIA 4FSVA 1DLOB 2CNLB 2GIRA 2EW9A 3RSEA 2UXCJ 1U4BA 1TUGB 5E26A 4JI7F 5J2PA 4C2MA 1WC0A 1WSVA 1X9SA 3K58A 4CFBA 3ASMA 3SCKE 3Q7CA 2EI5A 3R97A 1OSCA 3G9CA 3M8SA 3DGPB 1YI2N 3W5YA 1FK9A 4A46A 4EI2A 2HSEB 3EY1A 1XWLA 4ZVEA 3AO2A 3QEIA 3RRGA 1JLGB 4USIA 1URNA 3F73A 4FK2A 4YB6A 2MQ8A 4M7YA 4ECZA 4A57A 2BH1A 2RQKA 4B8CA 4K5SA 4CZEA 2WTFA 3V6DA 4NEYA 4HCCA 4EYHB 1RCOB 2VG5B 3CD7A 1WG5A 2ZOGA 4LH4A 2GWJA 2MGZB 2JFDA 2OPSA 1JLCB 4M63A 5MLCV 2D0OA 3UD5A 4J91A 4CZHA 3DRSA 2NRRA 3OYAA 3PLAA 3THVA 1AUSL 5E3CA 1W97L 4X84A 3KFWX 2VGMA 3H08A 4BR7A 5AXMA 2E2OA 4OVLA 4IBNA 2QEXN 4PWWA 2HW3A 2UZAA 2HF4A 4CZLA 2XY7A 2HRYA 1C0MA 1NRKA 2YCHA 1UWAA 1PC4A 4NASA 5KFJA 3ETMA 1Q8LA 1R59O 2QV6A 3CC2N 1WEZA 1U1OA 3C7NB 1ZTTA 3W0LA 3TW0A 3CMAN 3KWIA 1BQNB 3CGIA 3L2RA 1TFYA 3KLFB 4EFHA 4IEIA 3V6JA 1U02A 2ERRA 4FPAA 1YZ6A 3T69A 2Z56B 1RADB 1ZPVA 4DQQA 3RMAA 2B4OA 3PKMA 1S48A 4ES2A 3ILIA 1JLQB 1YIJS 1HNXJ 3ITHA 3VGKA 2O8CB 4NB4A 1MN7A 3R2DJ 2FJDB 5GMEA 3H1VX 4BRAA 2MKKA 5CYQB 4NMXA 1KLNA 2XC9A 2CQ0A 5IT9U 1W7WA 3R6MA 1BIZA 1OPIA 3FRZA 2P9UB 3M05A 4R0EA 1P1LA 1BC6A 3EZUA 2PFDA 4OPJA 4O3OA 2ZJQQ 3G4SN 2EEYA 2VBZA 2GAHC 3OFEA 4DFKA 2O8BB 3TA0A 2XO7A 4CJ3A 5KT5A 4PL8A 3PJ9A 3ZSYA 4F4YA 2LA6A 3L4QA 1UZDA 1JXLA 1RTHA 2I0XA 4KAZA 5A6PA 3G8TA 5GINA 1ZC6A 1HYSB 4IO9Q 3UKRB 4KHPK 3SUPA 1OKJA 1Q7LB 4QU6A 4Y3CA 3U6FA 4FLYA 4G9ZA 3W65A 2KM8B 2APOA 5CXTA 3LA0A 2MZ1A 5EX5A 3UKUB 1YJRA 4OI3A 5IT9O 1H73A 4LD0A 3LZIA 3M32A 5LJ5Y 5M1OA 1QQCA 4PG6A 3QPIA 3DLLQ 1QSSA 3VAGA 2ZFHA 1CZBA 3I33A 2DY9A 5DG7A 3PYEA 4BC5A 4DL3A 3WNFA 2ZNYA 2FBTA 1T3VA 3KVGA 1BOTO 2ZH9A 2R7OA 4YR3A 2MSTA 5ETMA 1UCNA 3R7NB 1M5SA 1FJEB 2DITA 5CQGA 4RG8A 5ETRA 1VSMA 4LF5K 2MKIA 3J7AP 1EKEA 4BGAA 2QFJA 1NAQA 3MN7A 5GAGI 1FWKA 3K9JA 2CQGA 2YY3A 2HVHA 2D3OR 4A8QA 1F3FA 5FPMA 3OYLA 2C3OA 4C97A 5KFNA 1SBRA 1NSAA 4DQRA 4C1NI 5BYSA 2GTDA 3KKFA 4H4KA 2YH0A 2Y0BB 1R0AA 4NCGB 4ES3A 4WZQA 1GX5A 4TXSA 1RT6B 1Y0HA 1Q82T 2BOPA 3NL0A 3FE1A 3PNIA 4DB3A 2QK9A 3U3GA 3O80A 2M88A 4PG4A 4UZCA 3CI5A 3QERA 3QFWA 1GLLO 4YHHF 1SC3B 3FRYA 2HHXA 2ZHAA 4K2XA 2GNKA 4IYQA 2ASOA 2U1AA 4DV6K 3ZC4A 1IBKF 3LANA 3DHXA 1XNRJ 4GNIA 3ZSOA 2CGLA 3CETA 2ASDA 5BR8F 5C2DA 1KR4A 1HKBA 2X3GA 3NLCA 1FJGK 2DEJA 2DK2A 3B4DA 1RAAB 4URQU 4Z2XA 2A2CA 1VQMS 3I0SA 4KHSA 3KLGA 1S0OA 1HMVA 4FM0A 1DJ0A 4H4OA 3V4IB 1IG9A 4IFYB 1X5SA 1KD1T 2ZZTA 5T14A 5SWMA 1NGCA 4RW8B 4WYBA 3R3LA 3MEKA 3HI9A 2E2NA 3QWUA 4X66J 4JI8J 1HBOB 4JKGB 4IO8A 3LWLA 2P9PB 2BJEA 1YSJA 1H2VZ 1S9GB 1X1PA 1VRTA 1ZBUA 4QS9A 3Q8SB 2HHTA 1NKCA 3EX7B 1WSHA 4IJNA 4HCBA 1LWEB 3B8HA 3KMSA 1RYRA 3LH2S 1SC4B 1RCHA 4Z7YA 5F0XA 4CHQA 2YKQA 2FC8A 4DHYA 5LMNF 4X4NA 3RTVA 3MMBB 1HHQA 2KRRA 3MM9A 5BN8A 2MZTA 4X4OA 4CF1A 5IT9Y 2BR0A 1D9DA 1S1UB 1ZBFA 3JTPA 4IG3A 2H3EB 4F3MA 2CNNB 5J1EB 1WSFA 5L39A 1QTNB 2KFNA 2HVIA 4DV1F 3CMQA 2V67A 3SSRA 2XHWA 3M6UA 2QSWA 1FD2A 2H5JB 2XY6A 2C42A 4MJKA 4EBCA 2FHOB 4TYAA 2ATQA 1BQMB 1OH6A 4Q2LA 4CHNA 3DXMB 4UUXA 5LJVA 2W2QP 1VSKA 2WONB 1VSFA 3CE8A 2ZBRA 1F60B 2KYXA 3CJ4A 1BQXA 4DG1A 3ZT2A 4BE2A 3US5A 4MK7A 2IAJA 1NLKL 4C0HA 5KPZA 2RD5C 1S1WA 1GXLA 1FT8A 1XJWB 3VA0A 1GMUA 3NCQA 3H5XA 4NO7A 4C8OA 4YOWA 2MQNA 3CIMA 4RUCA 2IS3A 1EWQA 4EEYA 4DPUA 2JLFA 1HBNB 3MM8A 2D9OA 3QZ8A 1GAOA 4OJ3A 3SXLA 4IDHA 1GK8A 1HNWF 3KK1A 1YBAA 3PG9A 4TU9A 3UW1A 1PYOB 3BF4A 3A5MC 1IBLF 1WKJA 1WACA 3CPEA 1I94J 2KLAA 1S4FA 5J2QB 5K14B 3NGZA 3CUNA 3SUOA 2FF6A 3QIPB 2MQPA 5KFTA 1M90T 2FC9A 4NCAA 1XR6A 1Q8KA 3K59A 2ATCB 4I2QB 1FXXA 3EDQB 1RT4A 3CCMS 4E3SA 5KG4A 4JK8A 3EKUA 3PEJA 1NKEA 2BKPA 4DZ6A 4ZVUB 1WN7A 3OR1A 3VENA 3PKYA 2RQMA 2HNDA 3U1NA 1L3TA 4ILHA 1RAGB 2AYEA 1Y9OA 2E5IA 4ZCKA 2DISA 4GVEA 1GLEG 3AVFA 3OHAA 2HAIA 2RDIA 3VCDA 4O55A 2LQBA 1LXNA 3TABA 4GV9A 2J0XA 1RGVA 4AQYJ 1B9FA 4FYWB 2HNZA 2P9LA 4GC7A 4DR4F 3CJ8A 4DV2K 1OH8A 2BJ3A 3J7ZT 2OO4A 1HBMB 1N0VC 3NE6A 5KQ8A 2LMIA 1ASUA 4YEAA 1TAQA 3NXZA 2R7WA 4KT0C 3O5BA 1P1TA 3K8WA 4LFBK 3QJPA 4JV0A 2P8IA 3GILA 3AA8A 1HR0F 4M41A 1FRMA 1EETB 4BR0A 1XIQA 2F9TA 2FJEB 3GV7B 3KJNB 3QRQA 1J5OB 3FSIA 4LRFA 4QPTA 2CPZA 3AO3A 4UY8O 1FDAA 2JVRA 4RPFA 4BR2A 3HP9A 2EKYA 3Q8VA 4AHRA 4U67L 3A1YG 4EUVA 1D9FA 3RRHA 3T5LA 1ICEB 4KB1A 3GSDA 4PG8A 1GLAG 4DR7F 4GY2B 1R8AA 3DDNA 4FWRA 3BPDA 2DHAA 2WB4A 4JV5J 3M3ZA 3CJSA 1GFWB 4W90B 4FJ8A 3CD0A 3VALA 3EMTA 4BDPA 3HHLD 2VHGA 1JCEA 3UCZP 5DLGA 3QATA 3T1YF 3MCSA 3RWUA 4HL9A 1WSRA 3MMJA 1RKJA 3RVCA 1K8AO 1G6BA 3W9JA 3A4TA 4CTAA 3D68A 4BR4A 4W5OA 1RZMA 2ZH4A 2HSTA 4ZPWR 3OD2A 2Q1NA 4MLHA 1K1QA 4FWNA 1UJ4A 4CO1A 1I5OB 4QWEA 3OTOJ 1Q81O 1KVCA 4B3RF 5AJ3F 2C1EB 5E3RA 2IJFA 1NOZA 2P6SA 3DOMB 3R1XA 4F3OA 3N0VA 3UCGA 3HLUA 4E1NA 3MPVA 4RNMA 3CIZA 2I5JB 3FZKA 1KVJA 4ETXA 1WI8A 4BRPA 1WDTA 3SMZA 4KH0B 2HRUA 3VQPA 4LR7A 4GO7X 1J6ZA 4DR2F 4PQAA 1A6LA 3VQSA 3LPYA 1HNZF 5D0EA 4M3ZA 4OHXA 4USKA 2OCEA 4DTPA 2RNEA 3E01A 1U1NA 1T3NA 3P3DA 3PR4A 4IDKA 4B9NA 2EFVA 2HLTA 4HVZA 2CWXA 2X7IA 3I9V9 5KFZA 4J9OA 5A8WB 3GIMA 1TL4A 3QQCD 7FDRA 1QJHA 2UUWA 3G6XA 3BS9A 3DWLA 2QYGA 1ZAVA 2Z2MA 3QEVA 1QAJA 3DMJA 5F8MA 5L38A 4DX7A 2JX2A 2ACYA 1Z1ZA 1TKZB 3VAIA 4LFCF 4RLEA 1LW2B 4ES1A 5KAKA 1IWAA 3VWSA 3CJKA 2YKNB 4PXEA 3WC0A 2CADA 5HBMB 1HHTP 1JMTA 3OYIA 2A2DA 4YHHK 3CG7A 3P38A 3Q8QB 3C6TA 1DTTA 4GKJK 5KFKA 3FVYA 2OSQA 4OI2A 4FOIA 5HMXA 2HYIB 4B1YB 1R27B 3KHLA 2XHCA 3OS1A 1L3SA 2B0GA 4EZ6A 4U8YA 4Q2MA 3D2WA 5C12A 3FMBA 3H25A 2KJWA 4B9QA 3M9OB 2HWHA 1QAXA 5D6GA 4KH6A 4CF2A 4KGXB 4K0KJ 3HP6A 4DQIA 5AQZA 4USVA 1FNXH 4OFZA 4F0KA 2XMMA 3KUHA 2WVCA 1RA6A 4N8NA 1RT1A 4JKBA 3LALA 1HKCA 2YXLA 2YHBA 2F4FA 3CQXA 4DUYJ 2MZRA 2W2OP 4BREA 1IM4A 5AQNA 2IM3A 1KAZA 1WUUA 3BO4A 4CLUA 1MSWD 1GOAA 1YJWS 2UU9J 3WNGA 3CWJA 2C2RA 5AQWA 1S57A 2B4JA 4HHJA 4AF1A 2UUCF 2D1CA 3WQTA 2KH9A 5IFMA 1RQ0A 4ATNA 1NGIA 4NMLA 2ZUAA 2DHSA 1WKLA 1H7XA 3TWZA 3LDNA 2QL9B 4OZ3A 1BL3A 2GVZA 1T0TV 1RWOB 3IR7B 3HPOA 2XS2A 4YDUC 4WYWA 4RKUC 3WDOA 4LF7F 2OFGX 3LM9A 2ACMA 1O13A 1VR6A 1XMBA 3HKWA 1QLNA 1HYVA 2EG1A 3NFAA 3QRRA 4H03B 1PYTA 5L9XA 3AA3A 3C16B 4LF6F 1UPPA 2CJBA 2LU2A 2VWBA 1JX4A 5HMZA 4OLPA 2LDYA 3CCWA 3M8YA 1VRUA 1AXQA 4QR2A 2D4WA 2H9ZA 2JEGA 1NSPA 1TUYA 2QWLA 1GTHA 1WTFA 3FFKB 4J2AA 4J2BA 1N33F 4NLSA 1J5EJ 2R7VA 2NXUA 3OBIA 1TL3B 4J37A 2ZITA 3TVKA 1YTYA 3HHLA 3JS9A 2VPZB 4FW2A 2LECA 3IS9A 2QJ3A 1BLUA 2QEXS 2Q0UA 3O6QA 1WOSA 4CH1A 2PGCA 3LGMA 4NPOA 1LWFB 2W2MP 5LXRA 3BQ1A 5JMVA 3A5LC 3S7RA 1N4LA 3CQ8A 3VAFA 3CC2S 2JC0A 2GV9A 3S3OA 2B56A 4OGCA 1KDNA 4CBXA 1FX4A 3RMBA 4B1UB 5K9FA 2NS1B 3PO5A 4DU7A 3GMGA 3UB5A 3MTKA 4YNQA 2OMLA 2HQIA 3MX2A 4TLQA 1QVGR 4OKEA 3FFIB 4ID5B 3K17A 3BKTA 3I4PA 3JS6A 2A42A 2G9OA 3EL2A 4B1VA 1N0UA 1L5UA 4NRUA 2V9WA 4MIWA 4BDYA 4HKQA 1NKBA 3AVMA 5B09A 1B0TA 1JIHA 2Z8QA 4C3LA 1T3OA 2W7AA 4XIUA 4TKTA 4Q5VA 5U47A 4X4UA 1FF2A 1IJFB 4Y2KA 2QL5B 3R8EA 4KTQA 1DLOA 1NBWA 1S3XA 4IJAA 3FCVA 1KOOA 1YJTA 1WJ9A 2E5LF 5HVFA 5KFDA 2UXBF 3WQUA 4XK8C 3CJAA 1E4FT 3D67A 2WSFC 2F4VJ 1HR0K 1SKWA 3DM2B 2IM1A 2DNQA 3ENVA 1IWGA 4X4VA 3DGPA 4OJRA 3HI0A 1JLGA 1Y3JA 4HEA9 4K43A 5KFRA 4WF9Q 2B7BB 5KPRA 3QSIA 2VG5A 3IKMA 3EPIA 5CYMB 2W01A 2CPYA 3U4LA 4CF9A 4DMNA 4WXOA 2MGZA 1XTZA 1JLCA 5IWAJ 3PSIA 1DRZA 5JMNA 4LIWA 4DTRA 2KJVA 4O5BA 2W6KA 3ZSZA 4WP8A 4OPKA 1XMQF 1RLCL 2FLOA 1S22A 4DL6A 2JEFA 3DC2A 4M5LA 5B7WA 4CD1A 3AARA 1RT3A 1YHQS 4BY9C 2HS3A 5I3PA 2LQ8A 1B3TA 1Z4UA 2WVEA 3UDEA 1MMDA 3AB4B 4WJBA 5AQYA 1TK0A 2F96A 3TJ9A 1VC6A 1HPZB 3BGFA 1MG7A 3ZT4A 3HRGA 3PYFA 2ETJA 2AZ3A 3H5SA 3G86A 1VQ4N 4FJJA 3HDSA 2W42A 2PC6A 1S77D 3R6LB 2ZM6F 4C0BA 3KIOA 1VHFA 3ZZRA 4JN4A 3FZBA 1JLQA 1KLMA 1D3WA 3PFEA 4JI6J 4ELVA 3IXQA 1B64A 3JYTB 2DKOB 4OPAA 2M9KA 2N7CA 4YOEA 3MMAB 3CHWA 4YB5A 4YUDA 1OYEA 4NLVA 2O8CA 2I7NA 4DL5A 5CYQA 4I6WA 2X78A 4TN2A 3HHLC 5ETQA 5KFGA 4DR6J 5ETKA 1QVFM 4B3OB 5JUMA 3QAUA 5KFEA 1K0TA 1HNVA 2UP1A 4IR1A 1FDDA 2P9UA 3C94A 4A59A 4DV3J 3W7BA 3TANA 2V7YA 4CJQA 3LZJA 2W2PP 4DUZF 1HQUB 3PIOL 2O8BA 1ZH5A 4PUOB 2CPIA 4EGLA 2LQ9A 5GADU 1U0HB 2AEJA 3TUPA 4ZITA 2GC8A 1Y3KA 4JD2B 1IKVB 2PN6A 2Q3PA 3DOKB 2P51A 1YJNN 3ET6B 4DSIA 3R5JB 1T8EA 1HRHA 5AQHA 3OBWA 3OLAA 2MKCA 2UUAJ 4YP3A 2HNYB 3ATUA 3UKUA 4PXBA 4MO5A 2JWNA 4M5HA 3QO9B 3EYZA 4X65F 3GU0A 2HIYA 3BZKA 1HWKA 4NA1A 4NZ6A 4UY85 2ZHBA 2K7JA 3W64A 1SIWB 1JNRB 4FNIA 3K57A 2FVCA 1E4GT 4WFZA 1EZZB 2VFTA 4DL7A 4FLXA 1NG9A 4GKKJ 1MMLA 2ZBIA 4ZVFA 3SDEB 2E29A 2QKBA 1C0TB 3BZQA 2G1DA 2HB5A 1PBAA 1MW7A 5KRTA 1LK7A 1OWXA 1VI7A 4ZPTR 3MWTA 2PMHA 4NYZA 3SPYA 4FBUA 4AHCA 2HZCA 4USJC 3WEEA 3AQOA 3ILJA 1YK9A 4AL6A 5EHHA 4LQ3A 4KGZB 4B9LA 3KLHB 4QIWD 3SZ2A 4F0HA 2ZH3A 2VFRA 4P2MA 5L9NA 2ZH7A 1QE1B 2FHMA 3L0QA 5DQIA 5JVHL 2ITGA 2ADBA 3ZTPA 1S7HA 3KG0A 2DPNA 2V50A 4JYAJ 4QIFA 5A2QO 3EO3A 1N36K 3HVRA 3U02A 3IG1B 1VBYA 1EKSA 1GT8A 2QM1A 3L4IA 5M1FA 1BI4B 1N8RT 1B99A 5AQMA 4V19X 1PKUA 4NCGA 4Q45A 2P9KB 4IRKA 3G2XA 4W5RA 1PC5A 5T7LB 3J81j 2BYCA 5ETOA 4YDDB 4JI1K 2NXNA 5F1XA 2YWEA 1NOYA 2CJAA 3L9ZA 2VFUA 4BDZA 2A41A 1OY8A 3I55N 4I6MB 4X2BA 2AJQA 4ILMA 2XI2A 4WFXA 1Z2LA 1ITPA 1YG0A 4FWKA 4FK0A 3TQ1A 1X0PA 4MAKA 1TL7B 2K2PA 4DHVA 5H9FK 3R9PA 3UD3P 3N4PA 4FJGA 5KFSA 3UWTA 4CNYA 3L2UA 2QMXA 5K8NA 2W40A 2JFKA 3OS0A 2YQ3A 4LF6K 5HI7A 4N47A 3PVXA 3O1BA 3V4IA 4IFYA 4DV7J 2BKNA 2RHQB 2V4QA 2CJYB 4RW8A 4P10A 5HVGA 5SZTA 2QLWA 4C8MA 1U7LA 4B9TA 3N6LA 2EBGA 1CEZA 1U2VA 1HBOA 3LPTA 4JKGA 3V9ZA 2VQFF 5KFWA 1HI1A 3W2VB 2P9PA 2UUBK 3MM6B 1SQKA 4UTGA 5EU7A 3D6RA 1LWEA 3JSYA 3PRDA 4RR5A 3ZT1A 5LMUK 2VDIA 2DBBA 3TEGA 1BG3A 1NM2A 2DFFA 2F1FA 4GMJB 1KKHA 3H40A 1Q16B 5M2UA 4QYZK 4RBUA 3ICLA 1NK9A 3G96A 3ALYA 3MMBA 4DR1J 2I2YA 4MYTA 1C1CB 2DGVA 3F0NA 2VF3A 3K0SA 1UEVA 2Q66A 1HBUA 3CDEA 1YTAA 3NAEA 5J1EA 5F9NA 2KM8C 3MCOA 1BU6O 4BRNA 4CK3A 4YOYA 5C2CA 3QNOA 4DR3K 4U7BA 1CZAN 2AJ4A 3RRKA 3VQ7A 3LGHA 3J7Z5 2Y8YA 4OLBA 2KFZA 3MD1A 2ZEJA 1UPMB 4BVPA 5KTQA 4ILRA 1Q86T 2R8KA 4JNEA 2I8EA 1E6YB 4LF4K 1BQMA 1WWHA 3S41A 4GV6A 1MWKA 3UN3A 2WONA 2BZ2A 2GBZA 5BYQA 5D8HB 4CGHA 3C6UA 4X4TA 3WQPA 2AU0A 4PAAA 2QA1A 3EGNA 1PG5B 1YXQA 1SKSA 4CW7B 3HM9A 3R9LA 5C25B 3MCPA 3SI8A 1F5CA 2C2KB 3UN2A 5M1QA 3PIPQ 4IOCL 1Y5NB 2HFUA 2IIHA 3Q83A 1TK8A 1NHKL 2CZ9A 3ZTOA 1HBNA 3NGSA 4FYYB 4P74A 3RBZA 3MCMA 2CNOB 2UXBK 2X6SA 4YN3B 4BE0A 4CGDA 2IVYA 3DRYA 2AW0A 3AVBA 1O8BA 2KG0A 4Z94A 5G0RB 5HQLA 3ENBA 5A2QY 5AQGA 2ZD1B 4FWSA 3IM8A 4ED1A 5BRHA 3P83D 3VN5A 2E88A 2QWQA 1UZHA 5JS1A 4O0JA 4U95A 4Z0UA 5J2QA 3FJ2A 2W2NP 5K14A 2KHCA 5EX3A 2ASPA 3GJTB 3D6MB 3SJJA 3QIPA 1XC3A 4AHUA 4ZP6A 4Y00A 4A2AA 3L8BA 4I2QA 1SVDA 5JVGQ 4IOAQ 4RNNA 2BJ7A 1I3AA 4YOTA 1U26A 1T95A 2J9CA 2D0AA 4FP9A 2PE8A 1VC0A