4DGEC

Trimcyp cyclophilin domain from macaca mulatta: h70c mutant, hiv-1 ca(o-loop) complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
136
Chain Sequence
b'PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIMCyp
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Isomerase/viral protein
total genus 47
structure length 136
sequence length 143
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgeC00
2PWOA 4NX4C 1D1DA 3P05A 1AFVA 2PXRC 2M8PA 1EM9A 5HGKA 4XFXA 2WLVB 2GOLB 2Y4ZA 2XDEA 5HGOA 2PWMA 4PH0A 4PH3A 4XFYA 3MGEA 2XGVA 4XROA 1E6JP 2LF4A 5HGNA 4U0BA 5HGMA 4XFZA 1M9EC 2X83A 4E91A 4WYMA 1AK4C 1G03A 1L6NA 4B4NA 2GONA 1EIAA 2EIAA 3H4EA 4INBA 4PH2A 1M9XC 1M9CC 1GWPA 4E92A 2KGFA 5HGLA 5JPAA 4J93A 1P7NA 1M9DC 4DGAC 4XRQA 2M8NA 2WLVA 3H47A 2XGYA 4U0CA 4DGEC 2M8LA 4LQWC 4U0EA 1M9FC 1U7KA 4QNBA 3BP9A 2JPRA 4U0DA 2XGUA 1QRJA 1M9YC 4U0AA 4HTWA 3NTEA 2X82A 2X2DD 2V4XA 4U0FA
chains in the Genus database with same CATH superfamily
2PWOA 4NX4C 1D1DA 3P05A 1AFVA 2PXRC 2M8PA 1EM9A 5HGKA 4XFXA 2WLVB 2GOLB 2Y4ZA 2XDEA 5HGOA 2PWMA 4PH0A 4PH3A 4XFYA 3MGEA 2XGVA 4XROA 1E6JP 2LF4A 5HGNA 4U0BA 5HGMA 4XFZA 1M9EC 2X83A 4E91A 4WYMA 1AK4C 1G03A 1L6NA 4B4NA 2GONA 1EIAA 2EIAA 3H4EA 4INBA 4PH2A 1M9XC 1M9CC 1GWPA 4E92A 2KGFA 5HGLA 5JPAA 4J93A 1P7NA 1M9DC 4DGAC 4XRQA 2M8NA 2WLVA 3H47A 2XGYA 4U0CA 4DGEC 2M8LA 4LQWC 4U0EA 1M9FC 1U7KA 4QNBA 3BP9A 2JPRA 4U0DA 2XGUA 1QRJA 1M9YC 4U0AA 4HTWA 3NTEA 2X82A 2X2DD 2V4XA 4U0FA
chains in the Genus database with same CATH topology
2PWOA 4NX4C 1D1DA 3P05A 1AFVA 2PXRC 2M8PA 1EM9A 5HGKA 4XFXA 2WLVB 2GOLB 2Y4ZA 2XDEA 5HGOA 2PWMA 4PH0A 4PH3A 4XFYA 3MGEA 2XGVA 4XROA 1E6JP 2LF4A 5HGNA 4U0BA 5HGMA 4XFZA 1M9EC 2X83A 4E91A 4WYMA 1AK4C 1G03A 1L6NA 4B4NA 2GONA 1EIAA 2EIAA 3H4EA 4INBA 4PH2A 1M9XC 1M9CC 1GWPA 4E92A 2KGFA 5HGLA 5JPAA 4J93A 1P7NA 1M9DC 4DGAC 4XRQA 2M8NA 2WLVA 3H47A 2XGYA 4U0CA 4DGEC 2M8LA 4LQWC 4U0EA 1M9FC 1U7KA 4QNBA 3BP9A 2JPRA 4U0DA 2XGUA 1QRJA 1M9YC 4U0AA 4HTWA 3NTEA 2X82A 2X2DD 2V4XA 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PWO A;  4NX4 C;  1D1D A;  3P05 A;  1AFV A;  2PXR C;  2M8P A;  1EM9 A;  5HGK A;  4XFX A;  2WLV B;  2GOL B;  2Y4Z A;  2XDE A;  5HGO A;  2PWM A;  4PH0 A;  4PH3 A;  4XFY A;  3MGE A;  2XGV A;  4XRO A;  1E6J P;  2LF4 A;  5HGN A;  4U0B A;  5HGM A;  4XFZ A;  1M9E C;  2X83 A;  4E91 A;  4WYM A;  1AK4 C;  1G03 A;  1L6N A;  4B4N A;  2GON A;  1EIA A;  2EIA A;  3H4E A;  4INB A;  4PH2 A;  1M9X C;  1M9C C;  1GWP A;  4E92 A;  2KGF A;  5HGL A;  5JPA A;  4J93 A;  1P7N A;  1M9D C;  4DGA C;  4XRQ A;  2M8N A;  2WLV A;  3H47 A;  2XGY A;  4U0C A;  4DGE C;  2M8L A;  4LQW C;  4U0E A;  1M9F C;  1U7K A;  4QNB A;  3BP9 A;  2JPR A;  4U0D A;  2XGU A;  1QRJ A;  1M9Y C;  4U0A A;  4HTW A;  3NTE A;  2X82 A;  2X2D D;  2V4X A;  4U0F A; 
#chains in the Genus database with same CATH topology
 2PWO A;  4NX4 C;  1D1D A;  3P05 A;  1AFV A;  2PXR C;  2M8P A;  1EM9 A;  5HGK A;  4XFX A;  2WLV B;  2GOL B;  2Y4Z A;  2XDE A;  5HGO A;  2PWM A;  4PH0 A;  4PH3 A;  4XFY A;  3MGE A;  2XGV A;  4XRO A;  1E6J P;  2LF4 A;  5HGN A;  4U0B A;  5HGM A;  4XFZ A;  1M9E C;  2X83 A;  4E91 A;  4WYM A;  1AK4 C;  1G03 A;  1L6N A;  4B4N A;  2GON A;  1EIA A;  2EIA A;  3H4E A;  4INB A;  4PH2 A;  1M9X C;  1M9C C;  1GWP A;  4E92 A;  2KGF A;  5HGL A;  5JPA A;  4J93 A;  1P7N A;  1M9D C;  4DGA C;  4XRQ A;  2M8N A;  2WLV A;  3H47 A;  2XGY A;  4U0C A;  4DGE C;  2M8L A;  4LQW C;  4U0E A;  1M9F C;  1U7K A;  4QNB A;  3BP9 A;  2JPR A;  4U0D A;  2XGU A;  1QRJ A;  1M9Y C;  4U0A A;  4HTW A;  3NTE A;  2X82 A;  2X2D D;  2V4X A;  4U0F A; 
#chains in the Genus database with same CATH homology
 2PWO A;  4NX4 C;  1D1D A;  3P05 A;  1AFV A;  2PXR C;  2M8P A;  1EM9 A;  5HGK A;  4XFX A;  2WLV B;  2GOL B;  2Y4Z A;  2XDE A;  5HGO A;  2PWM A;  4PH0 A;  4PH3 A;  4XFY A;  3MGE A;  2XGV A;  4XRO A;  1E6J P;  2LF4 A;  5HGN A;  4U0B A;  5HGM A;  4XFZ A;  1M9E C;  2X83 A;  4E91 A;  4WYM A;  1AK4 C;  1G03 A;  1L6N A;  4B4N A;  2GON A;  1EIA A;  2EIA A;  3H4E A;  4INB A;  4PH2 A;  1M9X C;  1M9C C;  1GWP A;  4E92 A;  2KGF A;  5HGL A;  5JPA A;  4J93 A;  1P7N A;  1M9D C;  4DGA C;  4XRQ A;  2M8N A;  2WLV A;  3H47 A;  2XGY A;  4U0C A;  4DGE C;  2M8L A;  4LQW C;  4U0E A;  1M9F C;  1U7K A;  4QNB A;  3BP9 A;  2JPR A;  4U0D A;  2XGU A;  1QRJ A;  1M9Y C;  4U0A A;  4HTW A;  3NTE A;  2X82 A;  2X2D D;  2V4X A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...