4DGEC

Trimcyp cyclophilin domain from macaca mulatta: h70c mutant, hiv-1 ca(o-loop) complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
136
Chain Sequence
PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRIMCyp
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Isomerase/viral protein
total genus 47
structure length 136
sequence length 143
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgeC00
1D1DA 1M9EC 4U0FA 1G03A 2PWOA 2M8PA 2WLVA 1EIAA 4PH0A 2XGUA 4U0EA 4XRQA 4DGEC 3NTEA 4U0AA 1GWPA 5JPAA 3H4EA 4XFYA 4U0CA 2EIAA 5HGKA 3H47A 5HGOA 2XGVA 4XFZA 2Y4ZA 2PXRC 2V4XA 2JPRA 1M9XC 2PWMA 5HGLA 2XGYA 4QNBA 4DGAC 1M9FC 5HGNA 2LF4A 3MGEA 5HGMA 3BP9A 1QRJA 2KGFA 1EM9A 2X83A 4PH2A 1M9DC 1AFVA 1E6JP 1M9YC 2M8NA 1M9CC 2WLVB 4XFXA 2GOLB 3P05A 4LQWC 1P7NA 4INBA 4U0BA 4B4NA 2X82A 2M8LA 1AK4C 2GONA 4U0DA 4E92A 2X2DD 1L6NA 4HTWA 4PH3A 4WYMA 1U7KA 2XDEA 4J93A 4XROA 4E91A 4NX4C
chains in the Genus database with same CATH superfamily
1D1DA 1M9EC 4U0FA 1G03A 2PWOA 2M8PA 2WLVA 1EIAA 4PH0A 2XGUA 4U0EA 4XRQA 4DGEC 3NTEA 4U0AA 1GWPA 5JPAA 3H4EA 4XFYA 4U0CA 2EIAA 5HGKA 3H47A 5HGOA 2XGVA 4XFZA 2Y4ZA 2PXRC 2V4XA 2JPRA 1M9XC 2PWMA 5HGLA 2XGYA 4QNBA 4DGAC 1M9FC 5HGNA 2LF4A 3MGEA 5HGMA 3BP9A 1QRJA 2KGFA 1EM9A 2X83A 4PH2A 1M9DC 1AFVA 1E6JP 1M9YC 2M8NA 1M9CC 2WLVB 4XFXA 2GOLB 3P05A 4LQWC 1P7NA 4INBA 4U0BA 4B4NA 2X82A 2M8LA 1AK4C 2GONA 4U0DA 4E92A 2X2DD 1L6NA 4HTWA 4PH3A 4WYMA 1U7KA 2XDEA 4J93A 4XROA 4E91A 4NX4C
chains in the Genus database with same CATH topology
1D1DA 1M9EC 4U0FA 1G03A 2PWOA 2M8PA 2WLVA 1EIAA 4PH0A 2XGUA 4U0EA 4XRQA 4DGEC 3NTEA 4U0AA 1GWPA 5JPAA 3H4EA 4XFYA 4U0CA 2EIAA 5HGKA 3H47A 5HGOA 2XGVA 4XFZA 2Y4ZA 2PXRC 2V4XA 2JPRA 1M9XC 2PWMA 5HGLA 2XGYA 4QNBA 4DGAC 1M9FC 5HGNA 2LF4A 3MGEA 5HGMA 3BP9A 1QRJA 2KGFA 1EM9A 2X83A 4PH2A 1M9DC 1AFVA 1E6JP 1M9YC 2M8NA 1M9CC 2WLVB 4XFXA 2GOLB 3P05A 4LQWC 1P7NA 4INBA 4U0BA 4B4NA 2X82A 2M8LA 1AK4C 2GONA 4U0DA 4E92A 2X2DD 1L6NA 4HTWA 4PH3A 4WYMA 1U7KA 2XDEA 4J93A 4XROA 4E91A 4NX4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1D A;  1M9E C;  4U0F A;  1G03 A;  2PWO A;  2M8P A;  2WLV A;  1EIA A;  4PH0 A;  2XGU A;  4U0E A;  4XRQ A;  4DGE C;  3NTE A;  4U0A A;  1GWP A;  5JPA A;  3H4E A;  4XFY A;  4U0C A;  2EIA A;  5HGK A;  3H47 A;  5HGO A;  2XGV A;  4XFZ A;  2Y4Z A;  2PXR C;  2V4X A;  2JPR A;  1M9X C;  2PWM A;  5HGL A;  2XGY A;  4QNB A;  4DGA C;  1M9F C;  5HGN A;  2LF4 A;  3MGE A;  5HGM A;  3BP9 A;  1QRJ A;  2KGF A;  1EM9 A;  2X83 A;  4PH2 A;  1M9D C;  1AFV A;  1E6J P;  1M9Y C;  2M8N A;  1M9C C;  2WLV B;  4XFX A;  2GOL B;  3P05 A;  4LQW C;  1P7N A;  4INB A;  4U0B A;  4B4N A;  2X82 A;  2M8L A;  1AK4 C;  2GON A;  4U0D A;  4E92 A;  2X2D D;  1L6N A;  4HTW A;  4PH3 A;  4WYM A;  1U7K A;  2XDE A;  4J93 A;  4XRO A;  4E91 A;  4NX4 C; 
#chains in the Genus database with same CATH topology
 1D1D A;  1M9E C;  4U0F A;  1G03 A;  2PWO A;  2M8P A;  2WLV A;  1EIA A;  4PH0 A;  2XGU A;  4U0E A;  4XRQ A;  4DGE C;  3NTE A;  4U0A A;  1GWP A;  5JPA A;  3H4E A;  4XFY A;  4U0C A;  2EIA A;  5HGK A;  3H47 A;  5HGO A;  2XGV A;  4XFZ A;  2Y4Z A;  2PXR C;  2V4X A;  2JPR A;  1M9X C;  2PWM A;  5HGL A;  2XGY A;  4QNB A;  4DGA C;  1M9F C;  5HGN A;  2LF4 A;  3MGE A;  5HGM A;  3BP9 A;  1QRJ A;  2KGF A;  1EM9 A;  2X83 A;  4PH2 A;  1M9D C;  1AFV A;  1E6J P;  1M9Y C;  2M8N A;  1M9C C;  2WLV B;  4XFX A;  2GOL B;  3P05 A;  4LQW C;  1P7N A;  4INB A;  4U0B A;  4B4N A;  2X82 A;  2M8L A;  1AK4 C;  2GON A;  4U0D A;  4E92 A;  2X2D D;  1L6N A;  4HTW A;  4PH3 A;  4WYM A;  1U7K A;  2XDE A;  4J93 A;  4XRO A;  4E91 A;  4NX4 C; 
#chains in the Genus database with same CATH homology
 1D1D A;  1M9E C;  4U0F A;  1G03 A;  2PWO A;  2M8P A;  2WLV A;  1EIA A;  4PH0 A;  2XGU A;  4U0E A;  4XRQ A;  4DGE C;  3NTE A;  4U0A A;  1GWP A;  5JPA A;  3H4E A;  4XFY A;  4U0C A;  2EIA A;  5HGK A;  3H47 A;  5HGO A;  2XGV A;  4XFZ A;  2Y4Z A;  2PXR C;  2V4X A;  2JPR A;  1M9X C;  2PWM A;  5HGL A;  2XGY A;  4QNB A;  4DGA C;  1M9F C;  5HGN A;  2LF4 A;  3MGE A;  5HGM A;  3BP9 A;  1QRJ A;  2KGF A;  1EM9 A;  2X83 A;  4PH2 A;  1M9D C;  1AFV A;  1E6J P;  1M9Y C;  2M8N A;  1M9C C;  2WLV B;  4XFX A;  2GOL B;  3P05 A;  4LQW C;  1P7N A;  4INB A;  4U0B A;  4B4N A;  2X82 A;  2M8L A;  1AK4 C;  2GON A;  4U0D A;  4E92 A;  2X2D D;  1L6N A;  4HTW A;  4PH3 A;  4WYM A;  1U7K A;  2XDE A;  4J93 A;  4XRO A;  4E91 A;  4NX4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...