4DGEC

Trimcyp cyclophilin domain from macaca mulatta: h70c mutant, hiv-1 ca(o-loop) complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
143
structure length
136
Chain Sequence
PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRTHPPAMGPLPPGQIREPTGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diverse HIV viruses are targeted by a conformationally dynamic antiviral.
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Isomerase/viral protein
molecule keywords TRIMCyp
total genus 47
structure length 136
sequence length 143
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4dgeC00
2X82A 1M9EC 2X2DD 3P05A 1EIAA 1U7KA 4PH2A 4PH0A 2GONA 4PH3A 1G03A 4U0DA 2XGYA 5HGMA 1M9CC 3H4EA 4WYMA 2EIAA 5HGLA 2Y4ZA 1GWPA 2GOLB 4U0FA 1M9YC 5HGKA 3NTEA 4XFZA 4XFYA 4XROA 1M9FC 2LF4A 2PWOA 1D1DA 1AFVA 2PWMA 4XFXA 1QRJA 1L6NA 5HGNA 3BP9A 4NX4C 2XGUA 2JPRA 2XDEA 5HGOA 1E6JP 1M9DC 2WLVB 2XGVA 4DGEC 2V4XA 4U0EA 1M9XC 4QNBA 4U0AA 4U0CA 3MGEA 5JPAA 2WLVA 3H47A 4HTWA 4INBA 4U0BA 2M8LA 1AK4C 4B4NA 4E92A 2M8PA 2M8NA 1EM9A 1P7NA 4J93A 4DGAC 4LQWC 2KGFA 4XRQA 2PXRC 4E91A 2X83A
chains in the Genus database with same CATH superfamily
2X82A 1M9EC 2X2DD 3P05A 1EIAA 1U7KA 4PH2A 4PH0A 2GONA 4PH3A 1G03A 4U0DA 2XGYA 5HGMA 1M9CC 3H4EA 4WYMA 2EIAA 5HGLA 2Y4ZA 1GWPA 2GOLB 4U0FA 1M9YC 5HGKA 3NTEA 4XFZA 4XFYA 4XROA 1M9FC 2LF4A 2PWOA 1D1DA 1AFVA 2PWMA 4XFXA 1QRJA 1L6NA 5HGNA 3BP9A 4NX4C 2XGUA 2JPRA 2XDEA 5HGOA 1E6JP 1M9DC 2WLVB 2XGVA 4DGEC 2V4XA 4U0EA 1M9XC 4QNBA 4U0AA 4U0CA 3MGEA 5JPAA 2WLVA 3H47A 4HTWA 4INBA 4U0BA 2M8LA 1AK4C 4B4NA 4E92A 2M8PA 2M8NA 1EM9A 1P7NA 4J93A 4DGAC 4LQWC 2KGFA 4XRQA 2PXRC 4E91A 2X83A
chains in the Genus database with same CATH topology
2X82A 1M9EC 2X2DD 3P05A 1EIAA 1U7KA 4PH2A 4PH0A 2GONA 4PH3A 1G03A 4U0DA 2XGYA 5HGMA 1M9CC 3H4EA 4WYMA 2EIAA 5HGLA 2Y4ZA 1GWPA 2GOLB 4U0FA 1M9YC 5HGKA 3NTEA 4XFZA 4XFYA 4XROA 1M9FC 2LF4A 2PWOA 1D1DA 1AFVA 2PWMA 4XFXA 1QRJA 1L6NA 5HGNA 3BP9A 4NX4C 2XGUA 2JPRA 2XDEA 5HGOA 1E6JP 1M9DC 2WLVB 2XGVA 4DGEC 2V4XA 4U0EA 1M9XC 4QNBA 4U0AA 4U0CA 3MGEA 5JPAA 2WLVA 3H47A 4HTWA 4INBA 4U0BA 2M8LA 1AK4C 4B4NA 4E92A 2M8PA 2M8NA 1EM9A 1P7NA 4J93A 4DGAC 4LQWC 2KGFA 4XRQA 2PXRC 4E91A 2X83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X82 A;  1M9E C;  2X2D D;  3P05 A;  1EIA A;  1U7K A;  4PH2 A;  4PH0 A;  2GON A;  4PH3 A;  1G03 A;  4U0D A;  2XGY A;  5HGM A;  1M9C C;  3H4E A;  4WYM A;  2EIA A;  5HGL A;  2Y4Z A;  1GWP A;  2GOL B;  4U0F A;  1M9Y C;  5HGK A;  3NTE A;  4XFZ A;  4XFY A;  4XRO A;  1M9F C;  2LF4 A;  2PWO A;  1D1D A;  1AFV A;  2PWM A;  4XFX A;  1QRJ A;  1L6N A;  5HGN A;  3BP9 A;  4NX4 C;  2XGU A;  2JPR A;  2XDE A;  5HGO A;  1E6J P;  1M9D C;  2WLV B;  2XGV A;  4DGE C;  2V4X A;  4U0E A;  1M9X C;  4QNB A;  4U0A A;  4U0C A;  3MGE A;  5JPA A;  2WLV A;  3H47 A;  4HTW A;  4INB A;  4U0B A;  2M8L A;  1AK4 C;  4B4N A;  4E92 A;  2M8P A;  2M8N A;  1EM9 A;  1P7N A;  4J93 A;  4DGA C;  4LQW C;  2KGF A;  4XRQ A;  2PXR C;  4E91 A;  2X83 A; 
#chains in the Genus database with same CATH topology
 2X82 A;  1M9E C;  2X2D D;  3P05 A;  1EIA A;  1U7K A;  4PH2 A;  4PH0 A;  2GON A;  4PH3 A;  1G03 A;  4U0D A;  2XGY A;  5HGM A;  1M9C C;  3H4E A;  4WYM A;  2EIA A;  5HGL A;  2Y4Z A;  1GWP A;  2GOL B;  4U0F A;  1M9Y C;  5HGK A;  3NTE A;  4XFZ A;  4XFY A;  4XRO A;  1M9F C;  2LF4 A;  2PWO A;  1D1D A;  1AFV A;  2PWM A;  4XFX A;  1QRJ A;  1L6N A;  5HGN A;  3BP9 A;  4NX4 C;  2XGU A;  2JPR A;  2XDE A;  5HGO A;  1E6J P;  1M9D C;  2WLV B;  2XGV A;  4DGE C;  2V4X A;  4U0E A;  1M9X C;  4QNB A;  4U0A A;  4U0C A;  3MGE A;  5JPA A;  2WLV A;  3H47 A;  4HTW A;  4INB A;  4U0B A;  2M8L A;  1AK4 C;  4B4N A;  4E92 A;  2M8P A;  2M8N A;  1EM9 A;  1P7N A;  4J93 A;  4DGA C;  4LQW C;  2KGF A;  4XRQ A;  2PXR C;  4E91 A;  2X83 A; 
#chains in the Genus database with same CATH homology
 2X82 A;  1M9E C;  2X2D D;  3P05 A;  1EIA A;  1U7K A;  4PH2 A;  4PH0 A;  2GON A;  4PH3 A;  1G03 A;  4U0D A;  2XGY A;  5HGM A;  1M9C C;  3H4E A;  4WYM A;  2EIA A;  5HGL A;  2Y4Z A;  1GWP A;  2GOL B;  4U0F A;  1M9Y C;  5HGK A;  3NTE A;  4XFZ A;  4XFY A;  4XRO A;  1M9F C;  2LF4 A;  2PWO A;  1D1D A;  1AFV A;  2PWM A;  4XFX A;  1QRJ A;  1L6N A;  5HGN A;  3BP9 A;  4NX4 C;  2XGU A;  2JPR A;  2XDE A;  5HGO A;  1E6J P;  1M9D C;  2WLV B;  2XGV A;  4DGE C;  2V4X A;  4U0E A;  1M9X C;  4QNB A;  4U0A A;  4U0C A;  3MGE A;  5JPA A;  2WLV A;  3H47 A;  4HTW A;  4INB A;  4U0B A;  2M8L A;  1AK4 C;  4B4N A;  4E92 A;  2M8P A;  2M8N A;  1EM9 A;  1P7N A;  4J93 A;  4DGA C;  4LQW C;  2KGF A;  4XRQ A;  2PXR C;  4E91 A;  2X83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...