4DGNA

Crystal structure of maize ck2 in complex with the inhibitor luteolin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Inhibition of protein kinase CK2 by flavonoids and tyrphostins. A structural insight.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dgnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dgnA02
2OGVA 1ZZLA 4BCFA 1NVSA 2CSNA 4L3JA 3DB8A 4O21A 5DEYA 1Q41A 2C6KA 2Z7RA 3A99A 3AT4A 5AV3A 2C3LA 5HORA 4UMUA 3KB7A 5JT2A 1E1VA 3NPCA 4AP7A 4E5WA 1UKHA 4FKTA 4HYUA 2C5OA 3FUPA 3ZO3A 2F7EE 3HA6A 3MSSA 4J96A 1DAYA 3SG8A 5DH3A 5FLFA 3O50A 2B54A 3NAYA 5IDNA 3RP9A 4Y72A 4O7VA 5C4LA 2XJ0A 5AUZA 2R3JA 2OZOA 5G1XA 1WZYA 2JC6A 2R4BA 3DXNA 2UW7A 3TWJA 2B7AA 3ATTA 4XMOA 3HMIA 4OLIA 4JXFA 2I40A 1VYZA 3O8PA 4G9RA 3R30A 4I3ZA 2VTQA 4Y46A 3KMUA 4ZJIA 3SW4A 1Y91A 3KN6A 4IVCA 1ZOHA 2UW3A 3ORTA 3I4BA 3IK3A 4QTBA 2FSTX 3SXFA 3R9OA 4DFNA 4DFBA 2ZM4A 4CKRA 3F3WA 5EM8A 4D55A 5L2TA 4AW5A 4YNOA 3SRVB 4FG7A 4GG7A 1F3MC 3DK7A 4O1OA 1IEPA 4O0WA 3ORLA 3LIJA 3TUBA 5EW8A 4DGLC 3C0HA 5M51A 3GC7A 2O65A 3DQXA 1OPKA 2ITZA 3I5ZA 1M52A 1Q4LA 2X4FA 3PRIA 4IAFA 4X2JA 3VS3A 3MH0A 3VQUA 4TKSA 3TKIA 3S3IA 4FVQA 5E1SA 3V6SA 3DS6A 2QQ7A 2XYUA 1R39A 3KVXA 3PPJA 5AP1A 5HE1A 2XUUA 4N70A 3U6HA 5EW9A 3HGKA 1WBWA 3UJGA 3GFEA 3F3VA 4CZTA 2VO6A 4LL0A 4ZY6A 4DYMA 2WQMA 3AG9A 4IZ5A 1M14A 4JLCA 4CTBA 4IX4A 5CY3A 4BC6A 2O2UA 4CKJA 4YZNA 5DFPA 4XUFA 3R9HA 2PY3A 2C5NA 3R7EA 4NFMA 5TF9A 4GCJA 3WOWA 4II5A 3MYGA 4WSYA 5E8WA 5HHWA 2XK4A 4F4PA 5HIEA 4OAUC 4FZFB 4G6OA 4PF4A 1G8SA 2GNFA 4RIYB 4FGRA 3ZFYA 3RAWA 1KE8A 5M57A 1OIYA 4QP2A 3A62A 5IQBA 4AXAA 2Z7LA 3K3IA 1SMHA 5BMSA 4NCTA 2GNIA 2JIIA 1VEBA 4M66A 3TG1A 3WIKA 4MXAA 3RI1A 3SXSA 4R3CA 5CAPA 5M53A 1NVQA 4RWLA 1P4FA 4FSQA 4WUAA 4XRLA 2YAKA 3DAKA 3QRUA 3L8SA 3CD3A 4IWDA 2J9MA 2KULA 4FL1A 5J79A 2UV2A 4AN9A 5ITAA 3NNUA 4EORA 3EMGA 3QTUA 4UXQA 4B99A 4BB4A 2BZJA 3TTIA 3F69A 3P0MA 3ZEWA 5E7RA 4DGNA 5CF6A 5TO8A 2VNWA 1XH6A 4ZS0A 4CFVA 2YFXA 4F64A 3HV7A 5KBQA 3QD3A 2W17A 4QMTA 5ICPA 2XKEA 5IUIA 2EXMA 4IVBA 2C1BA 4MXYA 4CLIA 5ANJA 5ETCA 2BFXA 4PUZA 4QP4A 4O38A 3JR1A 2O63A 3JPVA 3TV4A 4GRBA 4M0YA 4EC9A 3FKNA 3WF6A 2QURA 5K0XA 3CTHA 4FV4A 4JIAA 1ZOEA 3R63A 4DF3A 4QPMA 3COHA 5JGBA 3HUBA 4YZDA 2BRNA 2YJRA 3KRJA 3TDVA 4O22A 4CYJA 4YPDA 2W1DA 2I0EA 4ZZOA 4XV9A 4A9SA 5JFVA 4UWYA 3KC3A 2YISA 1QCFA 5AUWA 3D7TB 4OT5A 3VUTA 1L8TA 5KKRC 2W5AA 4LV5A 5HBEA 5CWZA 3R7VA 3I0QA 2FSLX 5HO6A 4IC7A 4DTBA 4UZHA 5HU3A 4FTCA 2HZIA 2XKFA 4IANA 1BL7A 4XRJA 1CM8A 3FMEA 4CV9A 3UNKA 4AA4A 2BZKB 2RG5A 2V7AA 3P4KA 3HP5A 4G17A 4H36A 4L42A 4O81A 3W16A 1PKDA 3WARA 3ENHA 3FLZA 2ITPA 5C9CA 1XH9A 3FLYA 2O8YA 2YWVA 3VBTA 4AF3A 2BIYA 3KN5A 5D9HA 2BFYA 2YJSA 4RJ7A 5E1EA 2A27A 5IKWA 4EOIA 5EFQA 1CTPE 4E20A 1ND4A 2R64A 3H4JA 1V0PA 4FA2A 3FHRA 3H10A 2QD9A 3F82A 3D15A 3CSVA 3IKAA 4JBVA 4RX7A 4F9YA 3E7VA 4LL5A 2C5VA 4PP7A 4WO5A 2QCSA 3H0ZA 2XBJA 3QGYA 3WILA 5AUVA 4C4IA 1QPCA 4RJ3A 4EEVA 1BKXA 4I4EA 3KREA 1OIUA 2BMCA 4CXAA 4XLVA 4UWCA 4DEGA 3ZO4A 3M11A 3QLFA 1KOBA 3HMMA 1PKGA 2YCRA 3LQ5A 2R3RA 5AWMA 1DI8A 5CANA 1ZZ2A 3QYZA 3MWUA 4I92A 3I7CA 3R01A 3MY1A 4RX8A 5IF1A 1XKKA 5IA5A 3NZ0A 1SVGA 2EVAA 2XVDA 3IDPA 4G3CA 4C7TA 5JGDA 4C3RA 1PYEA 4RIWA 1H4LA 4ZK5A 1PRYA 1M17A 2XK7A 2X7GA 1R3CA 4C8BA 5BVOA 3PIZA 4U40A 3FL4A 3NEWA 3QZHA 4S33A 2JKMA 5CXZA 2UUEA 3DBQA 3OW4A 3W8QA 4Y83A 5L2IA 5CNOA 5LVLA 4DEEA 3ZM4A 2WNTA 3KU2A 5HEZA 4FTIA 4I0SA 2QG5A 3U6IA 4IZAA 3BU5A 3MA3A 5BVKA 3R83A 4L53A 3F5XA 3CIKA 4I1ZA 3D0EA 3GB2A 4X2NA 2GQSA 4AGWA 2NRUA 4RFZA 1PMEA 4XEYA 5L2SA 1OL2A 3NW6A 4D28A 5KZ0A 3RJCA 2P4IA 4HGTA 1YXXA 3EQDA 4HPUE 4PL4A 2PZ5A 2J5FA 5IA1A 4C4EA 1A9UA 2ZAZA 3WYXA 2UVXA 3DBEA 3D5XA 2VTPA 4JL9A 3HAMA 2DQ7X 5KBRA 1ZY5A 2UVYA 3W33A 4BGHA 2G2HA 2FH9A 4BGGA 4BR3A 3QF9A 3O17A 5IQFA 2HZ4A 4FTAA 2QOQA 3DA6A 3FLSA 4GIIA 4KIKA 5F95A 2IVUA 2PVRA 4UY9A 2VD5A 3K54A 1WAKA 3QTRA 4TYHB 2XNOA 1YHVA 2FB8A 3AT3A 4FT3A 4V0GB 5JK3A 3SD0A 2G15A 2IZTA 3FZRA 3I79A 2W0JA 4TXCA 1IR3A 4DG2E 4ALWA 1FOTA 1MQ4A 3S00A 3CQUA 2H96A 5HO8A 4UYAA 2EWAA 1QL6A 2HWPA 3IDBA 2WFYA 2VX1A 3PLSA 4BCKA 2UZTA 1PMUA 4EWQA 4C4GA 4KBAA 4V05A 2HENA 2OBJA 1H26A 3LXPA 3GFWA 4BCJA 3I7BA 4AA0A 3MDYA 1Q3WA 5CT0A 4I5PA 5D7AA 5E91A 4NM0A 4BHNA 4TY1A 4U3YA 4R6VA 3ODZX 3CEKA 4TWOA 5K5XA 3NLBA 4C38A 3RHKA 5IA2A 4IC8A 4PL5A 5HKMA 3R8ZA 2ZYBA 5AAFA 2B9HA 4FTNA 2QOKA 3KRWA 4PDSA 3ZBFA 3G0EA 3E63A 4OTRA 4S32A 3P1AA 4QMWA 5M09A 2X2LA 2XCHA 2PVMA 1KE6A 3POOA 3QD0A 4FSMA 5AV1A 1Q8WA 2XNEA 3R8PA 2AC5A 4NL0A 4AT3A 2CGVA 5LVOA 4F9CA 2XYNA 4C36A 2XMYA 3BI6A 4JG8A 3UPXA 4FEXA 2EXEA 1ZAOA 2J0IA 4JQ8A 5FEEA 3TKUA 4BICA 5M06A 4QMQA 3PJCA 3ZFXA 4ZIMA 4YHJA 1QPDA 2XK9A 4D2PA 5C8NA 1YQJA 1OKZA 4IW0A 5AAGA 2PVKA 1YDTE 3DDPA 2OJJA 5DI1A 3FY0A 4EBVA 3O96A 3OC1A 4FG8A 5FXRA 4U81A 4EOMA 4FSTA 4ANBA 2B55A 2OF4A 4GUBA 2I0HA 4TW9A 3CTQA 4DCEA 4FYNA 3CE3A 3NYVA 4FKOA 3VUHA 2BR1A 3E93A 3PJ2A 4IQ6A 4PTGA 4TT7A 4DINA 4QT1A 2IWIA 5K3YA 2OIDA 4X2FA 5ANDA 4MCVA 4BWXA 4PNKA 4HCTA 3FMMA 4O7SA 1SNXA 1K2PA 1W0XC 2ETRA 3B2WA 4L7SA 4R3RA 5DR2A 5FP6A 3RM7A 2ZDTA 3PP1A 4RG0A 4AZVA 5GJGA 5F20A 3DBCA 2YCSA 4HPTE 2X8DA 1PJKA 3ETAA 3QU0A 5KCVA 3RALA 2XCKA 2XK3A 1PMVA 1TKIA 1BMKA 2G1TA 2UVZA 2YIRA 2X2MA 3F61A 4JG6A 4MX9A 5AR4A 4FV0A 1DM2A 3ZH8A 4CG9A 4Y8DA 3VUKA 3HEGA 4FGBA 4ZAUA 3EQCA 3KL8A 3LM0A 4H3PA 4QMUA 4U97A 3ZONA 2PZPA 2BKZA 4O0VA 2RG6A 3NYNA 4UV0A 2GS7A 2EUFB 2OKRA 3FI3A 3VF8A 3CC6A 4E93A 5DIAA 4MTAA 2GS2A 2YDJA 4ZLZA 4PDPA 4IZYA 4X0MA 3TN8A 3UZPA 4JR7A 3UYSA 3DKGA 3EFLA 2XNBA 4PDOA 4YSJA 2QOCA 5HE3A 5CEQA 3QC9A 1K3AA 4YJTA 3PP0A 5KMIA 1PXOA 4L45A 3VJNA 5IQAA 3RMFA 1R78A 3Q53A 5E8YA 3RM6A 4C33A 3LCTA 5EI8A 4F9AA 4QTEA 1H0VA 2WO6A 2QHMA 4EH9A 1HCLA 3BWFA 4RWJA 3FQHA 4U0IA 2UZDA 3AOXA 1GIIA 3IOPA 4BWKA 3OY3A 5HNGA 1IRKA 4R7IA 3GVUA 4O7TA 5T68A 4C3FA 4EL9A 1TVOA 2XS0A 3Q4TA 4NJDA 3C1XA 4DH5A 1Z5MA 4E6CA 3OCSA 5FEQA 2WTWA 1ZMWA 3PPKA 4JIKA 2JBPA 4M14A 2HXQA 3PSBA 2J51A 3UP2A 3IW8A 3DV3A 4I6FA 1Q97A 4MQ2A 3U87A 2Y8OA 3OCBA 4ITIA 1MRVA 3VS4A 2WGJA 1J1CA 4YZCA 1PXLA 4IAAA 2BTRA 4D9UA 2W5BA 4UX9A 3QTSA 2UZEA 3MI9A 2A0CX 3I0OA 3PJ1A 3D2KA 3EOCA 1MQBA 4A4LA 4O7LA 3ANQA 4RIXB 4KRCA 3GU6A 1W7HA 4J98A 4GK3A 5HE2A 5EYMA 4G2FA 4U80A 2DS1A 3QZGA 3H9RA 4TPTA 2PU8A 5J8IA 3ZDIA 2W1EA 4LQMA 4FUYA 4BRXA 3ZRMA 5CSHA 4G3DA 4LRJA 4AE9A 4FTLA 4O6EA 3UDBA 2RFEA 3ZRKA 4YJSA 4DH7A 3GQLA 4OBQA 4AGDA 4IWPA 4O0TA 5EYKA 3TZ9A 4RZWA 3SOCA 5EI2A 1XHAA 2PK9A 4LGGA 2B4SB 4YBJA 3TJDA 1YOLA 1JSTA 3TKHA 2C4GA 3AMAA 3G5DA 5G6VA 3SVVA 3O7LB 3R7OA 1IAHA 2J0KA 3DT1A 3ZS5A 5B7VA 5TT7A 4HZRA 3OF0A 3PG3A 4NCTC 5LMAA 3SW7A 3OS3A 3OTUA 4NSTA 1F0QA 3VW8A 4GT5A 4Q9SA 2R7IA 2XNMA 4UALA 3DBFA 5BX0A 2GHLA 3QD4A 4N0SA 2RKUA 5L6PA 1HOWA 3ID6C 2YWPA 4G3FA 3R9DA 2JGZA 3MB6A 3R8MA 4XOYA 3ZUVA 4DGOA 4PTCA 4GEOA 2QNJA 2E9PA 3MFRA 2JDTA 2OH4A 2WIPA 2BZIB 3VHEA 3G51A 2ITXA 3KA0A 4L43A 2OU7A 4IM3A 3O23A 4Y73A 4EK3A 4W8DA 4IB1A 3RNYA 2WMQA 3UOLA 4O6LA 2OJGA 3CGFA 3ZLXA 2ITOA 4PDYA 5CEKA 4GIHA 4RX9A 4BCHA 4X6QC 4FSZA 3TV6A 3JVRA 4NZWB 3QKMA 3ZU7A 4F7NA 1G3NA 3QTIA 2X8EA 5JZNA 4C4JA 2O64A 4EKLA 5DR9A 1IA9A 3TM0A 2OK1A 4UMPA 3QKLA 1ZWSA 4J52A 1Q24A 4RBLA 1S9JA 3A2CA 3DOGA 3QQGA 3ORZA 4ZSAA 4QYFA 2PVFA 3HX4A 2ZMCA 2OFVA 4L6QA 5FP5A 3V3VA 4C58A 1F5QA 3ORXA 4U45A 3UNJA 2VO7A 3R2BA 4BCPA 4OTDA 1OKVA 1H00A 3FLQA 1UWHA 3PA3A 4AW2A 4CMOA 3FI8A 4AOJA 4J53A 5M4UA 3ALOA 3LM5A 5CS6A 3EQFA 4XX9A 4OT6A 2H6DA 3C4CA 3CPCA 3M1SA 4EH5A 4DE4A 2ETMA 2R3HA 5LQFA 2PZYA 3LJ2A 4X3FA 2X39A 2VTSA 2VWUA 4E8AA 3UVQA 3RGFA 5KZIA 3MH2A 4DTKA 4WA9A 1Q61A 4ZMFA 3NRMA 4RVLA 5IH5A 4BDBA 1O6KA 4L9IA 4CNHA 3ZM9A 3Q9XA 4HYSA 4YJRA 2GS6A 1OPJA 3CBLA 2VWIA 4DBNA 4XHKB 4C61A 4U41A 4FV3A 5DA3A 3LFQA 4W9XA 4FTKA 4D1ZA 2UZWE 4GS6A 4FKJA 3KCKA 3NGAA 2DWBA 2WMBA 3Q2MA 4TYJA 5CAQA 5HBJA 2NO3A 4LUDA 4AZEA 3HV4A 4QP9A 1T45A 4D4SA 5HBHA 4F9WA 2PULA 4QOXA 1XBCA 5HX8A 4L67A 3D94A 5GZ9A 3QWJA 3IGGA 3IOKA 4MK0A 3PPZA 4KNBA 3AD6A 3FXWA 4RWKA 4AU8A 2Y9QA 3A4PA 5ANGA 3RWQA 2VTIA 3R8LA 4WG4A 2I1MA 2W9FB 3AC5A 5F1ZA 2Z2WA 3C7QA 3EZRA 5AA8A 4L46A 2X6DA 3BHYA 3EN4A 5IQIA 5CLPA 4IMYA 3LFBA 1IA8A 1GZOA 2WOUA 1JWHA 5HIBA 3AC2A 2X0GA 4ZJJA 1VYWA 3KMMA 2Y4IC 4KBCA 4ZSLA 4H3BA 3NUNA 1HCKA 4H1MA 4IH8A 4IVAA 4O84A 3QQJA 2H34A 3BYVA 4WBOA 5FQDC 5GJFA 3ZOSA 4GW8A 1OITA 2QONA 3MA6A 3VQHA 4RC4A 3BLQA 4YP8A 3CS9A 4QD6A 2RL5A 3UE4A 5IEXA 3QX2A 4YZ9A 1L3RE 2PE0A 2WPAA 3ITZA 2QODA 3L9NA 1ZLTA 4E4LA 4UXLA 3OFMA 2JIVA 4BDKA 3GC9A 1YHSA 4LUEA 4MKCA 3IO7A 4I94A 2FUMA 4IB5A 2X7FA 2LGCA 4UYNA 3P23A 4IBMA 5CAOA 3HV5A 4AOIA 2UW5A 4O0YA 4IX5A 4ACGA 4G34A 3UTOA 2UW4A 3MTLA 2VWZA 4MAOA 2ZDUA 4XG4A 3DDQA 4AWIA 3BE9A 1MP8A 3R28A 2OJIA 3OCGA 3U4WA 4FIIA 4FTTA 4X2GA 4F99A 3TJCA 3H30A 4BHZA 2OXXA 1FGIA 5CENA 5I9XA 2IZRA 3QXPA 2PUNA 1BX6A 4C02A 5HI2A 2EB3A 5D1JA 2CDZA 3T9IA 3C5UA 4BIEA 5JZJA 2OJFE 4WSQA 2YABA 4JBPA 2OICA 1PY5A 4MBJA 4WRGA 5AX3A 3UP7A 2PMLX 3VNTA 3ZUTA 4AT4A 4AZSA 2C5XA 3FE3A 3R7GA 4IAYA 4O7ZA 4I24A 3FZSA 2UZUE 2JDRA 2YEXA 4QQJA 4IAZA 3ZYAA 5L3AA 2XBAA 2YITA 3B8RA 4J7BA 4F08A 2BHEA 4WRSA 3GUBA 4GH2A 5KMJA 3OWPA 3N4TA 4EK6A 3VUMA 4GJ3A 4CEGA 4EH3A 5HVKA 2JITA 3IS5A 4R1YA 4ZTLA 4QYEA 5CYIA 4CQEA 2PWLA 4L00A 4PY1A 3UIXA 3FZOA 3FMLA 2FYSA 4PPCA 4KSQA 4H05A 1KOAA 2YA9A 1CKJA 1UU3A 4RIOA 3TEIA 2OFUA 4EWHA 2R0UA 5HESA 1REJA 2WQOA 2QOIA 3G90X 3JY9A 3ZSHA 2CN5A 4USFA 2YHVA 1WVYA 3HL7A 4YGAA 3MPAA 2R7BA 4KKEA 5A46A 5AAEA 2WTJA 2XKDA 2CGXA 3E8NA 3TXOA 3KRRA 3Q04A 5TOZA 3FHIA 3E62A 4ITJA 2PMIA 4ORKA 3WE8A 5HCZA 4C3PA 3CXWA 1YRPA 4XYFA 3DAEA 3F3UA 5AUTA 4KB8A 3OUKA 4ANLA 3TL8A 4YO6A 5LVMA 3BLHA 4GUEA 4IFCA 3SV0A 3U54A 4U44A 2GNHA 3CKXA 4WHZA 3BU6A 3HA8A 3ULZA 1K9AA 4AGUA 3IECA 2F7ZE 4XG2A 3SX9A 4YTFA 3DBDA 1OL1A 4FNWA 3GCSA 1R1WA 2BKKA 1GY3A 4NM3A 4L68A 5AP2A 3R8VA 4GYIA 1OUKA 3FPQA 4AT5A 2BILB 4EYMA 4LI5A 2OLCA 4QMSA 3GU5A 3DZOA 3U9NA 3DK6A 3R9NA 4HVHA 2QC6A 1ZYCA 1H1WA 4FKRA 4G1WA 3BGQA 4M0ZA 4BZDA 3FLNC 1QPEA 4JNWA 4EH4A 2JKOA 3POZA 3MJ1A 3KF4A 4FR4A 2P33A 5LXMA 3RVGA 4USDA 5ACKA 2C0IA 4W9WA 3AD5A 5IISA 3NCZA 4S34A 4XBUA 3RHXA 2Q0NA 2XK8A 4EOQA 4L52A 4WT6A 2ZJWA 5AM7A 4OUCA 3ZUUA 5JFWA 4R8QA 3RAKA 3CTJA 1H25A 1V0BA 4IWQA 2P0CA 2JKQA 4AACA 3PXQA 4GVAA 3LFFA 4O7YA 3A7FA 3R1NA 4AA5A 4FEWA 3R71A 3Q6WA 2XIZA 3JVSA 4FBXA 2WMAA 4J1RA 2Q0BA 3TNQB 5CF4A 4AUAA 2V7OA 3ZO1A 3BYSA 2WMTA 4L7FA 3HUCA 4K1BA 3O71A 4IJ9A 2J90A 4FSUA 5E8XA 4E3CA 4ZY4A 4FT7A 3GCPA 3EB0A 2Z7QA 3V5WA 3W1FA 4AZTA 5AADA 3UO5A 4IB0A 4X7QA 3NUAA 3W10A 2VGOA 4D2TA 5FBOA 2GMXA 3FXXA 4P5ZA 5I9YA 5IEVA 1XH4A 1WFCA 3A8WA 3DKFA 5IH4A 4MVFA 3R00A 2X81A 3PSDA 4AS0A 3Q6UA 2JLDA 4H58A 2H9VA 5HICA 3V6RA 4EQMA 2C1AA 3QTXA 4DFXE 5L6WL 2GDOA 4BWPA 3GXLA 3L9MA 3ODYX 2CGUA 3Q9YA 4L01A 5EDPA 3UMWA 5L8KA 3UZTA 3NYOA 5JFXA 4OTIA 4RRVA 1GAGA 1OL7A 2C6TA 1DAWA 2OZAA 4OR5A 3WYYA 2ONLA 3HP2A 5BYZA 3W2QA 4P4CA 3BRBA 5CU0A 5HIDA 5D12A 5BQ0A 4LOPA 4OTWA 3TNPC 4NTTA 5CU3A 1REKA 1T46A 3R73A 4P5QA 3VS2A 3P7CA 4HVIA 4MD7E 2E9VA 4FEUA 4M69B 3PJ3A 3OHTA 3F2AA 3K3JA 4LGHA 4M3QA 4JDIA 3RTPA 4Z16A 3VVHA 4BGQA 3LFAA 3Q4ZA 2ZV9A 3HRFA 5CZHA 4RQVA 5M4CA 3NVMB 1CKPA 3PIXA 3R8UA 4CLJA 1UU7A 4EUUA 1PYXA 2RGPA 5J9YA 5LCJA 3KULA 5IPJA 3Q52A 3S95A 5EYDA 4I0RA 5H9BA 5M4FA 1FVTA 4DFUA 4RVMA 3QA8A 3IW6A 3K2LA 3Q5IA 4F0FA 5T6KA 4R7HA 1ATPE 2WQNA 4TZRA 3LZBA 1NA7A 2DUVA 3PUPA 4TWNA 3E92A 2WB8A 2HY81 1YVJA 2IVTA 5AP7A 3FC2A 1WBNA 4FKUA 2C6MA 1H0WA 2SRCA 3DXQA 1YXTA 4CSVA 4MYGA 3RPYA 5HQ0A 5M08A 2BRGA 4IHPA 1V0OA 3GCUA 4ZP5A 3HNGA 3HKOA 3MFUA 4EHEA 5L8LA 3QQHA 4D0XA 3H9FA 4TYIA 1QPJA 4U79A 2WTCA 2JDVA 2VN9A 4GG5A 5EQEA 4E26A 4FIGA 4S2ZA 5GHVA 1W98A 3HMNA 5E8ZA 3EIDA 4JJRA 4U9AA 5DT0A 4BCQA 4CRLA 3LFCA 5BUIA 3R21A 1OVEA 3I60A 3LCOA 2ITVA 3OOGA 3QA0A 1M7NA 2BDWA 1KE7A 3ORIA 4FODA 3WZKA 4BDDA 4RSSA 1ZARA 4J71A 5CASA 2Z02A 3HV6A 3QRKA 3KCFA 4HGSA 4X3FC 3VUIA 5D7VA 3UOHA 1OB3A 5IMEA 3IDCA 2C3KA 2VRXA 4ENXA 2VV9A 4YMJA 5LOHA 3LE6A 3DTCA 4QMMA 4BIBA 2CNQA 3QGWA 2VWWA 3EQBA 5H8BA 5L8JA 3C0GA 5ETIA 4OTFA 5HLPA 2ZV2A 3UC3A 3EL8A 4XS2A 5IA3A 3V5PA 3LOKA 1J3HA 3R1YA 4C34A 2W5HA 3MN3A 4UB7A 5JMSA 1FVRA 4CT1A 4UZDA 4XG6A 1LEZA 2QLQA 5JQ8A 3BCEA 3OVVA 2WTIA 3OXTA 4FV2A 3E5AA 2WMUA 1XH5A 5C8MA 4EH7A 5J1VA 4MNEA 4EHGA 5HO7A 2J2IB 4FKIA 3LJ0A 1TQIA 4HOKA 2HZ0A 3RKBA 1RW8A 5DGZA 4B7TA 4D5KA 1UU9A 5CVHA 4BIDA 1GZNA 3Q5ZA 2C69A 3DQWA 3VBYA 3WI6A 5BVWA 4IX6A 4D1XA 4XG8A 3F5UA 4EHZA 2IW9A 4HYIA 2X8IA 2QU6A 4DH1A 3TNWA 2XM9A 1H8FA 3IPHA 4BTJA 3EYHA 4Z7GA 3CQWA 1OKYA 2PTKA 4OBOA 4RIXA 4MF0A 3COMA 1Y57A 2PSQA 4LG4A 2I7QA 2DYLA 5CEPA 4XOZA 3SKCA 2VWYA 4I4FA 3B2TA 3BIZA 4Q2AA 4QYYA 4FKLA 4EH2A 2OIQA 2W9ZB 4FTJA 4D58A 2ZB0A 4YPSA 1OMWA 5I5ZA 3IONA 1LR4A 3N4UA 3II5A 3FMDA 3P9JA 3NUSA 3Q9WA 4WBBB 5D11A 4KKHA 3EQHA 2XIKA 4RZVA 3G15A 1H1QA 2Z7SA 4APPA 1CDKA 3CLYA 2IVVA 4JBOA 4YU2A 2E2BA 3ORKA 4XBRA 4AQCA 4CRSA 1XR1A 3PZEA 4JS8A 3PXYA 4DC2A 5IA0A 5I9VA 3QL8A 3LKMA 3VS1A 2VTRA 4EOKA 3OZ6A 5CI7A 4ZTRA 2Z8CA 2QLUA 3CJGA 5HCYA 3OCTA 5IQHA 4MEDA 4N57A 2GU8A 3MH1A 1AQ1A 5HG9A 3FL5A 1WBVA 2R3LA 3DB6A 2UZOA 3WF7A 4PNIA 3R7YA 2BDJA 3UQFA 5FUTA 4NUSA 2UW8A 2B0QA 2GHMA 4F7JA 2YM7A 5L6OA 4QO9A 4QQ5A 1ZMVA 3R0TA 3MPTA 5BUEA 1WBPA 3R1SA 3REPA 3KFAA 3DKOA 4JDKA 1W84A 3HZTA 1E9HA 1PXIA 2UZBA 4XNEA 2WELA 4UWBA 4YJUA 3ZDUA 4BF2A 4G3GA 2VTNA 2QI8A 5CQUA 4IAIA 5DT4A 5H3QA 1YXUA 2BAKA 3D14A 4RT7A 4K18A 4FTQA 4NIFA 3BKBA 2BIKB 3G0FA 4FKVA 2NPQA 3OT3A 4ZSEA 5F94A 3VO3A 3HV3A 3PA4A 2C68A 2IJMA 1NT2A 3AQVA 2ETKA 2R3IA 4C0TA 4DN5A 1J7LA 5ANEA 5EKNA 5IUGA 4O7WA 3FMKA 3GEQA 5BPYA 3Q32A 3UVPA 3VRZA 2NRYA 4FV9A 3CR0A 5HNIX 3EKNA 3LJ1A 5ACBC 3PFQA 3BGPA 1OBDA 5EKOA 5T3QA 4IZ7A 2F2UA 5CF8A 5CTPA 2ZM3A 4EK8A 3T3VA 4JX7A 4BDIA 4ASEA 4AN3A 2CNVA 4L3LA 3CGOA 4FNYA 5HD7A 1FVVA 1U54A 3AMBA 4QMNA 4UN0C 2A2AA 3UPZA 2V62A 3P86A 5J5SA 4JQ7A 3HLLA 5J9LA 4O83A 2QO2A 2C47A 3ATSA 4JAJA 2ZB1A 4DAWA 3OROA 4FZ7A 4BN1A 3TNHA 4WG5A 3RWPA 4ENYA 4D5HA 2BHHA 3KEXA 3IQ7A 2UW9A 4QYGA 3DNDA 4D4YA 4EZ5A 3HRCA 4AGCA 4M15A 3PJ8A 2CKOA 4I41A 2W1CA 3H0YA 3KGAA 1YI3A 4KIQA 4YR8A 2WIHA 2BTSA 2YERA 4NKAA 4EK5A 2ITUA 2XNGA 4ANMA 4DEDA 1JKKA 2W7XA 2C6IA 4AN2A 5DHJA 3BBTB 4O27B 2B9FA 3LXNA 3NIEA 4JR3A 2XIXA 3AMYA 3UBDA 5IH6A 4KWPA 2VX0A 2CJMA 3EKKA 5DT3A 5HOAA 3OWLA 4B0GA 3SAYA 5C1QB 4YC6A 4CQGA 2PE1A 4RIWB 1NXKA 4BL1A 2B9JA 3C4ZA 2WQEA 4I20A 2WMXA 4PMSA 4E4MA 1GZKA 4PWNA 3MVJA 4FT5A 4RVTA 4B4LA 5DN3A 4HJOA 4O91A 4BKYA 4YTCA 5IZFA 2UW6A 4KS8A 3QHRA 3HVCA 4ZLOA 2XEYA 5JN2A 2VWBA 1JBPE 5DR6A 3E8EA 4LFIA 4ZSGA 5J1WA 1J7IA 3UODA 2HELA 3A8XA 5A3XA 3MFTA 4C35A 5FM3A 3RCDA 4FUXA 2QO7A 1MRYA 3NAXA 3H9OA 4QMLA 2F9GA 3V5JA 4FV5A 1OL5A 4EYJA 3O2MA 4H3QA 2Y4IB 3QFVA 4AZFA 4KD1A 4C57A 1J1BA 4YC3A 4O96A 4IDTA 5EQYA 5BYYA 3DNEA 4QMZA 2HZNA 4PQNA 2X7OA 4I22A 5DYJA 4RJ8A 3UVRA 3ZXZA 3QRJA 4MHAA 5JKGA 5LWMA 2YM6A 3KF7A 4K2RA 4CG8A 3EN7A 4G6LA 4DHFA 4P2KA 4BY9E 1ZYJA 2J0LA 4JVGA 2X4ZA 3FZTA 3UO4A 4YO4A 4ZMEA 1KE9A 5DWRA 4A9TA 2REIA 2WMRA 2FSMX 2ACXA 4KIKB 5HG8A 3SQQA 4MD8E 4ERKA 4L3PA 3VIDA 3QQLA 4TYGA 1S9IA 3HMPA 4ARKA 1WBOA 4GU6A 4YZBA 4O0UA 3P7BA 1JKLA 4KINA 4Z9LA 4C2WA 5IMXA 1IASA 3GBZA 5E8TA 2OXYA 4F6UA 2QOOA 3AC1A 4BKJA 1ZXEA 3NIZA 5AUUA 2WEIA 4XH6A 2PVJA 3CCNA 3F5PA 3PSCA 4WG3A 1OECA 5H8GA 2I6LA 3BBWA 4F6SA 1KV2A 2QHNA 3OEZA 3Q96A 5EYCA 2BUJA 4BCIA 2RF9A 3AC4A 2XIYA 3PWYA 1OIQA 3ELJA 4FKSA 1STCE 3VBQA 1AGWA 2R0IA 2W05A 2GTNA 3R04A 2B52A 4FV6A 5AP4A 3ULIA 1UNGA 2F4JA 3F7ZA 1H24A 3BV3A 3FJQE 1CKIA 1SM2A 2ONLC 3HECA 3PRFA 4Y95A 4AAAA 4EUTA 4DTAA 1YI6A 3G9LX 4IJPA 2RFSA 5A4EA 2W99B 3W32A 4JAIA 3FBVA 3SC1A 3EWHA 2PHKA 2HW7A 5E8SA 3RCJA 3OEFX 2GTMA 2XRWA 3IG7A 3KXNA 1YWVA 4G6NA 4QMPA 4JI9A 3VBWA 5EQPA 3CY3A 3TZ8A 3L8PA 4NEUA 4D2VA 4EH6A 2YDIA 2QR7A 1RJBA 1KUTA 1B39A 2PYWA 4EZ7A 2A1AB 5FWKK 2CMWA 3QUEA 2VTOA 5DBXA 1NY3A 2BALA 3FPMA 2XA4A 4MNFA 5AR7A 2QG7A 1RDQE 1H28A 2I0YA 2Y6OA 4K77A 5C03A 5DG5A 3WBLA 4AOTA 4EQUA 3I5NA 4O2ZA 4XV1A 3RPSA 3ZZWA 4A9YA 2CNUA 5FBNC 4KS7A 1CMKE 3DXPA 3GI3A 1OPLA 3MY5A 3F3TA 4U3ZA 3V5LA 4PRJA 3WZUA 1URCA 3FYJX 3V51A 1YW2A 3VBVA 4HNFA 4O7NA 2UZNA 4FSYA 5E8VA 2J50A 1SYKA 4KABA 4I0TA 4RC3A 4BCNA 3KKVA 4B6LA 5AP5A 4U7ZA 2A19B 3D83A 3H3CA 3PVUA 1MUOA 4RVKA 2YIWA 1WMKA 2W96B 3ACJA 4XP3A 4E4NA 3DFCB 2J5EA 4C2VA 5LMKA 3FKLA 3P5KA 4ZEGA 2P3GX 4BFMA 2R3PA 2PL0A 3PE2A 1EH4A 2OW3A 3VN9A 2ITNA 3A60A 5L4QA 4ONAA 3LFEA 5E9EA 1XBAA 4QMYA 5CVGA 3VWAA 3TUCA 5IQDA 5BVFA 4HVGA 3FMNA 3GU8A 3HRBA 3JUHA 4K11A 4D4VA 1OUYA 5CEMA 4UMTA 3SA0A 2QR8A 2UZLA 3QD2B 4FT0A 2YACA 5J7BA 3TUDA 3IW4A 3BZ3A 1Z57A 3AXWA 4DG3E 3O7LD 2WTKC 3PVBA 2WTVA 5EHYA 1BUHA 1BYGA 5KE0A 3SRVA 1Q99A 3KXZA 4GYGA 4HYHA 3VRYA 1ZOGA 2PVYA 4U6RA 1M7QA 3NWWA 4IEBA 4YTIA 1JSUA 4ZLYA 3A7HA 3ZSGA 1FQ1B 1PW2A 4DH3A 5EI6A 4G9CA 2VTMA 1YXVA 1UKIA 4FF8A 4I5MA 3ERKA 4ALUA 3LMHA 3FDNA 4F6WA 1YOMA 3QUDA 3V04A 3FV8A 4FZDB 4WUNA 5AUYA 4EH8A 3LPBA 3GGFA 5CEOA 3DPKA 2Z60A 3COIA 3DZQA 1P5EA 5CF5A 1H1PA 3GU4A 1G5SA 4HZSA 4PP9A 3NUYA 5KNJA 3N9XA 5BVNA 1VR2A 5HCXA 3ORMA 4IXPA 4M68A 2B53A 2ERZE 4K33A 4BI1A 4BBEA 2IW6A 3MV5A 5DEWA 4DT8A 1XJDA 4D9TA 4KAOA 4I6BA 5CEIA 4E6QA 5EDQA 4RC2A 4F1MA 4ZY5A 4RIYA 4BTMA 3NX8A 1H1RA 3QQFA 3EHAA 3WIGA 4G3EA 5KMNA 4V04A 4AX8A 3FZPA 2QVSE 5B2LA 2HCKA 3FI2A 5F4NA 3T8OA 5M56A 3GT8A 3F9NA 3FEGA 4O82A 1PXNA 3ZC6A 1P2AA 3QCQA 4UMQA 3R1QA 4Z7HA 2QOBA 4MBIA 4F0IA 4KBKA 5GJDA 2BROA 3MGYA 2B1PA 4YUQA 3W2OA 4QP3A 4PPAA 4A4OA 5KHWA 3TV7A 2X1NA 1YHWA 1ZY4A 2XB7A 3A4OX 3NUXA 5A4LA 4YJVA 5FM2A 1KSWA 1JNKA 2XIRA 4E4XA 1JPAA 3MFSA 1OIRA 5B2KA 3VS7A 3Q4CA 4D2RA 1GIJA 3U9CA 4QPSA 4DG0E 5GNKA 5BYLA 3TDWA 2ITYA 3LCSA 3SXRA 5I9WA 2E9NA 4JDHA 3ZLYA 2JDOA 4A9UA 4CTCA 2W1GA 4AG8A 3FLWA 3MB7A 3WZJA 2J0JA 4N6ZA 5JH6A 2VAGA 2XK6A 3T9TA 1P14A 3OD6X 2OH0E 3QX4A 3GC8A 4QRCA 5AUXA 4MQ1A 2YM3A 2V55A 3L9PA 3BHVA 4NW6A 5KKRB 1LEWA 3D7TA 2C6DA 3F3ZA 5HLWA 3QRTA 4YLKA 3OMVA 2W1IA 5M4IA 1PXJA 3OBGA 4RLKA 4A4XA 4BZNA 4KIPA 5A4TA 2BRHA 1CSNA 2B9IA 4MXOA 1GJOA 1UA2A 4AFEA 4TL0A 4ZOGA 5HU9A 3PXRA 5AV0A 3ZC5A 3E8DA 4PL3A 1FINA 4Y5HA 4E6DA 5KO1A 2PUUA 5BUJA 4YJQA 5F9EA 3KMWA 2OXDA 3F2RA 5LJJA 3KXGA 3V5QA 4QNYA 4O7RA 5TR6A 3RINA 4C4FA 3E64A 5J7HA 3G2FA 3ROCA 4D1SA 4ASZA 1AD5A 3LQ8A 4YLJA 1W83A 3LCDA 2WU6A 4G5JA 5AR5A 2QKWB 3EYGA 3PXKA 5E8UA 5JEBA 3I1AA 3FMHA 4AE6A 4A07A 4A06A 3C5IA 2XJ2A 5CVFA 3Q2JA 4CGAA 4IACA 2R9SA 4TNBA 2CGWA 1U59A 2WQBA 3PY1A 5AEPA 1FMKA 2JFMA 1W82A 2R3QA 3FWQA 2YIYA 3ZBXA 4ZTQA 3I6UA 5LARA 3W2RA 5KMLA 4QP1A 4R5SA 3U55A 3R9RA 2R2PA 3D9VA 4IVDA 4X3FB 4BDFA 2HXLA 5CAVA 5K9IA 1M2RA 2PUPA 3PIYA 4E73A 2BPMA 1WBTA 4QP8A 4RFMA 2IG7A 4S30A 1FGKA 5DLSA 4M7IA 5DRBA 3F6XA 4TNDA 3WF9A 1FMOE 4BDEA 1O6LA 4RPVA 4UBAA 4F65A 3RK7A 2ERKA 2HY0A 2P55A 1OI9A 4FKQA 3P7AA 4O0XA 3S4QA 5FTGA 4OTHA 5IA4A 5EW3A 4PPBA 4YJOA 3PVWA 4CFUA 4HVDA 1R0PA 2PVHA 4WNOA 2YM8A 1ZRZA 5H2UA 3EQIA 5AM6A 2FGIA 5AR8A 4FL3A 4CFFA 4JX3A 4OBPA 4F09A 2C0OA 1OM1A 3LMIA 4R7BA 1J91A 2FVDA 3L1SA 1TQMA 4I5HA 4IWOA 5IUHA 5K4JA 3N4VA 1IG1A 3DLSA 4F63A 3QBNA 3EN9A 1DI9A 1Z9XA 3THBA 2GNLA 3D2IA 3OTVA 4YJNA 2WMVA 4M84A 1JSVA 1SVHA 4NU1A 3C9WA 3MY0A 4AW1A 3IW7A 3S1HA 1IAJA 3NVKI 3PZHA 3BPRA 3E7OA 4FTMA 3VHKA 5JSMA 4DCAA 3KRXA 5EK7A 1JAMA 5BNJA 3LAUA 5I0BA 3A61A 1JKTA 4FYOA 4TYHA 4YJPA 4V0GA 4QQTA 3R7UA 2C3JA 4HGEA 1UU8A 4MWIA 1PMNA 2X2KA 3FKOA 2BVAA 4LV8A 4FKGA 3NR9A 4CKIA 3LVPA 4CFMA 4LOQA 4F1OA 4ZXTA 1OL6A 4ACDA 5HZNA 5CT7A 4FL2A 4PTEA 4TYEA 4BTKA 3WZDA 3GOPA 3MPMA 4CZUA 3UGCA 4FKPA 3OT8A 4EOSA 5HLNA 3COKA 3F7WA 3OW3A 4BI2A 4BYJA 4ERWA 2J0MB 5M44A 3FI4A 4RGJA 3C0IA 4ZZMA 2ZMDA 3LMGA 3ZXTA 2EXCX 2EB2A 5KMOA 4DLIA 4EONA 4E1ZA 3TIYA 4JOAA 3C13A 3LLTA 2V0DA 4N4SA 2JFLA 4R78A 3CPBA 4LRKA 2WU7A 4R3PA 1FPUA 4FIJA 4H1JA 4B8LA 5J9ZA 2ZOQA 5LVNA 4G16A 3PVGA 4ZTMA 2CKQA 4BTFA 4GV1A 3E3BX 1PF8A 3HDMA 3ALNA 3CY2A 3FSKA 2ZM1A 3GNIB 2GQRA 2X6EA 3Q9ZA 1Q5KA 2IW8A 3QZIA 3AC3A 3DAJA 3S2PA 3O8TA 4XV2A 4R1VA 2EU9A 3KQ7A 5JRSA 1PXMA 5EM6A 3PA5A 2W06A 2QOLA 5IDPA 1YI4A 4XP2A 1YKRA 4EOOA 4QYHA 5FG8A 2Y4PA 3ZO2A 2QO9A 5FD2A 5TKDA 3FC1X 2VU3A 4DT9A 4IX3A 5CSPA 3RAHA 1J7UA 1BI7A 3LXKA 1FBNA 2IN6A 3V01A 1PXKA 5J87A 4CMTA 3FY2A 4ZS4A 2VWXA 4IIRA 4MXXA 3ZLWA 1XH8A 3PLAE 5EM7A 1W8CA 2W4KA 4F0GA 3PXFA 2PUIA 3FQEA 3QXOA 2BZHB 2CHLA 4DFLA 1OGUA 2F7XE 4QTDA 4TWPA 3GP0A 3OXIA 4MF1A 3WZEA 2O3PA 4CCUA 4MWHA 4I5CA 5D41A 2R3OA 3K5VA 5CQWA 3AT2A 2XNPA 4ANNA 4E5AX 3PYYA 2AC3A 4DFYA 4EOPA 3BHTA 3E88A 4DLJA 2CKPA 1VZOA 3B8QA 4U5JA 2OI4X 4XG3A 2GCDA 2YCQA 3GQIA 4CYIA 1WCCA 3UOKA 4CFWA 4ZTHA 3RPOA 4WNMA 4M12A 2VWVA 3TZ7A 2XF0A 4PMPA 2F57A 4QMOA 3BEGA 4FMQA 3UO6A 4EBWA 4HW7A 2R3FA 2C30A 3FZ1A 2ITQA 4FV1A 3VC4A 5IG1A 5LMKC 3VUDA 4RJ6A 3V5TA 4K6ZA 5I4NA 4OW8A 3DFAA 5I9ZA 5J5TA 1KE5A 3RPRA 2WKMA 3QQKA 3RPVA 3KK8A 3HAVA 3ZEPA 5I3OA 3GCQA 4CD0A 5DMZA 4CCBA 3DK3A 3BHHA 2BAJA 4F7LA 3PE1A 3ORPA 4A9RA 4BDCA 4USEA 4WOVA 4AFJA 2CLQA 5DNRA 4EQCA 4NK9A 3MESA 2VX3A 1ERKA 4DEAA 4X3JA 3PG1A 3LW0A 2ITTA 2PE2A 4FX3A 5EDRA 5HTBA 3U8WA 3QALE 4NH1A 3UQCA 3VF9A 5BVDA 2Q83A 3F2NA 4FEVA 4GT3A 4TRLA 4FZAB 2OF2A 1XH7A 3MIYA 3O8UA 2VTLA 4FK6A 4RJ5A 5EOLA 3PTGA 4LGDA 5AP3A 3LFSA 4FV8A 3RBWA 4QMVA 2Y0AA 2JKKA 3C4FA 3UG1A 4N6YA 4FNZA 2VUWA 4RWIA 4U43A 4DEHA 1XO2B 3VJOA 3ZLSA 3DLZA 5HX6A 3C4XA 4ANQA 4K0YA 3MIAA 2H8HA 4F70A 4EHVA 3BV2A 2RFNA 1VJYA 3L9LA 4Q5EA 4M67A 1Q8UA 4BKZA 5HD4A 3RK9A 4NFNA 1OBGA 2PZRA 2JEDA 4FVPA 1Y8GA 5AMNA 4FICA 4GJ2A 3BX5A 3C50A 4GK2A 3G9NA 4NM5A 3PY3A 1UNLA 1XQZA 2O0UA 2XRUA 2P2HA 1O6YA 3MVMA 4FIHA 5CU6A 5AFVA 4D4RA 3IGOA 4X2KA 5HE0A 3QUPA 2C0TA 1Q8ZA 2P2IA 3PWDA 2J4ZA 2ZVAA 2GQGA 1BL6A 2W1ZA 3I81A 4I23A 1SNUA 3D5VA 3ZFMA 3LXLA 3NNVA 1LUFA 3OBJA 4FOCA 2XM8A 2BRBA 1G8AA 2LAVA 1LPUA 3R7IA 5CXHA 2G01A 2OZAB 4HVSA 2F49A 3LHJA 4O0RA 1Y6AA 5GZAA 4JQEA 5CU2A 4BBMA 5AP6A 1SVEA 5CSVA 2IZSA 3UC4A 5LWNA 3ENMA 2GHGA 2JIUA 2OWBA 5ANKA 3UZRA 2R3KA 2YZLA 3U51A 3EL7A 2Y6MA 3VS5A 4U8ZA 1KV1A 4ALVA 2FA2A 2WTDA 4OTGA 5CZIA 3D5WA 4I6HA 4KA3A 4ID7A 3EZVA 2VZ6A 3CD8A 4RX5A 4FVRA 3UNZA 5EOBA 2XKCA 1BLXA 1H01A 3FQSA 3Q4UA 3EFWA 3AGMA 3RZFA 4KUJA 2G2FA 3KULB 4OTPA 2PVLA 2UW0A 5KMKA 3W55A 3MW1A 4FIEA 4FK3A 2JBOA 1JLUE 5FDXA 2JD5A 4MH7A 4FE2A 4FG9A 2QU5A 3P78A 5C01A 4UMRA 2OIBA 4A7CA 5A14A 1YWRA 3HYHA 4BZOA 3HMOA 5ETAA 1O9UA 3I6WA 5ANIA 4OTQA 4Y5QA 3BGZA 4WIHA 5EG3A 3ZRLA 1QMZA 4W4VA 4M13A 3S0OA 4EOJA 3BYUA 4IADA 3ZSIA 3OP5A 3BE2A 3R6XA 4HGLA 3P08A 4ASDA 4GK4A 3E87A 4J97A 2VGPA 2O5KA 4FOBA 2CKEA 4YNEA 1YDRE 3Q3BA 3VS0A 1B38A 3CQEA 3AD4A 3MVHA 4IAKA 4TTHB 4XLIA 4CFXA 5FXSA 3SOAA 5AIKA 2QKRA 2HAKA 4DH8A 1MRUA 3VUGA 5BVEA 3TNIA 4GFGA 3ET7A 1Q3DA 3LCKA 3MJ2A 5E4HA 1TQPA 2Y7JA 5IQCA 1UWJA 4S31A 4ZTSA 3QCXA 5E90A 2YCFA 5FTOA 2WTKB 3QTWA 4GL9A 4GVJA 3VW6A 5JRQA 4JT3A 4PMMA 4XP0A 3DY7A 4JRVA 3TTJA 5DOSA 3P79A 3QTQA 5I3RA 5A6OA 4F1TA 3A7JA 2R3GA 4YHTA 4QMXA 3DKCA 1JVPP 3W2PA 5D10A 3LLAA 2X9EA 4G5PA 3M2WA 2CPKE 2WOTA 3ZHPC 4K8AA 4CV8A 4NW5A 2CCIA 3MS9A 2JAVA 4MD9E 2WZJA 3EFJA 1Q62A 2VO3A 4DEIA 2AYPA 1OKWA 1UNHA 3BELA 3WF5A 5DPVA 3C4EA 3OWKA 1URWA 3R02A 2W4JA 4K9YA 3NCGA 4DGMA 3NNXA 4C59A 2ITWA 2GNJA 3AGLA 2NNWB 5HTIA 2RIOA 3F88A 4EKKA 3DJ7A 3CKWA 4J99A 2XJ1A 4QTCA 1ZYSA 5HG5A 3QCYA 2X9FA 4L8MA 4MNEB 4QP6A 5BMMA 1U46A 4APCA 3ZZEA 2RSVA 2AUHA 3KVWA 2C5YA 4J8NA 4HCUA 4NWMA 3V8TA 5JQ5A 4X6RA 3W18A 2YM4A 3NS9A 2W1FA 4D2WA 4O0SA 1JQHA 2JDSA 3NW7A 4ACMA 2F2CB 1X8BA 3KK9A 5J95A 1APME 4FKWA 5GINE 2CN8A 4FSWA 5A54A 3NUPA 3NW5A 5C8KA 4TWCA 4C4HA 2HOGA 4QTAA 5AR2A 4GU9A 5JGAA 3RK5A 3L8VA 2ESMA 3RAIA 2BRMA 4M97A 4GFOA 2YM5A 5C26A 1XBBA 3BYMA 4FTRA 4GMYA 2OO8X 4L44A 5AIRA 1B6CB 4EJ7A 3C51A 5KHXA 1NW1A 4NT4A 3CP9A 3GU7A 5CALA 4HCVA 4FTOA 1R0EA 2VTHA 3FXZA 5L2WA 1U5RA 2QOHA 2OJ9A 2ZV8A 3MVLA 4RMZA 1I09A 5FDPA 1WVWA 3RZBA 4ANOA 4ACCA 3BU3A 5CAUA 3KXHA 3ACKA 5DRDA 4DFZE 4BDGA 2HK5A 2YZAA 1SZMA 2YIXA 5AP0A 2VNYA 1M2QA 4W8EA 5A4QA 4GKIA 4IM0A 4B8MA 4WKQA 1LP4A 4IE9A 5E92A 3R22A 1KWPA 3DCVA 2G2IA 3A7GA 1Y8YA 3U4UA 3ROYA 2UZVA 5HG7A 2PVNA 1Q8YA 3BQRA 4GKHA 4KSPA 4JRNA 2HIWA 4RA4A 4UEUA 4D0WA 4ANSA 3DJ6A 2IZUA 2NP8A 4KRDA 5IQGA 4J8MA 4AW0A 4YTHA 2XP2A 2PMOX 4FV7A 3QC4A 3OWJA 2VTJA 3MBLA 2HYYA 4X21A 2V22A 3LFDA 3MTFA 5HVYA 4DGGA 3FSFA 2YN8A 3FMJA 3QRIA 4LRMA 1PXPA 4JDJA 3U6JA 2IPXA 3OG7A 3TACA 1UVRA 4IDVA 5GIPE 3SG9A 3D5UA 2JAMA 2R5TA 5CI6A 5CX9A 3QYWA 3G33A 4FIFA 5M55A 3GC0A 5KUPA 2XZSA 3K5UA 3QHWA 4YSMA 1H08A 5AA9A 4NIFB 4NYEA 4P90A 2XH5A 3PY0A 3NSZA 4XG9A 1UV5A 3T3UA 3TT0A 4QNAA 5ANOA 5M07A 2FSOX 2BCJA 1ZYLA 3KRLA 1U4DA 4LM5A 5AR3A 4MBLA 4CZYB 4FI1A 4OAVB 3G6GA 3W8LA 4BYIA 4V01A 3GCVA 2C6LA 4CT2A 4DEBA 5EHOA 5HTCA 3SLSA 3DJ5A 3GOKA 1GOLA 4MXCA 1WVXA 3C4WA 3L8XA 3O51A 5GZ8A 3TI1A 1U54B 1M2PA 3JS2A 4ZTNA 4QQCA 3UG2A 1Q8TA 3NMUF 2PZIA 3QQUA 3ZCLA 4ACHA 5IU2A 4BDHA 5AX9A 2HWOA 3ZTXA 4ITHA 4P7EA 3UYTA 1JOWB 4YHFA 3FYKX 3HDNA 3GENA 4BVUA 4RFYA 3NNWA 4PV0A 4WNPA 3QTZA 1ZMUA 2WD1A 4XCUA 3UIBA 4C62A 4EI4A 3G6HA 3PDTA 1U5QA 3EN5A 3PXZA 1YWNA 3NDMA 4RJ4A 1V1KA 5ETFA 4DA5A 3EJ1A 3RNIA 4E5BA 4PMTA 4GFMA 4FSRA 4ZJVA 4HNIA 3WF8A 2WEVA 1I44A 2A4LA 3N51A 5LVPA 3BEAA 3QLGA 2PPQA 4W4WA 3VAPA 3DU8A 3QCSA 3SGCA 2IVSA 4QPAA 4CMUA 3NUUA 3Q60A 1WBSA 4DBXA 5L2QA 3E8CA 3CJFA 1YOJA 2R3NA 3FAAA 4FTUA 3JXWA 5A6NA 4EC8A 5EHLA 3EH9A 3VULA 2FO0A 1H27A 4R77A 3KXXA 4Q5HA 2PMNX 5IQEA 2GFCA 2KTYA 5DE2A 4ZZNA 3R2YA 4IFGA 3UIMA 3E3PA 2GFSA 3D4QA 3AC8A 3DTWA 3SDJA 3W2SA 4BI0A 4EJNA 3DGKA 5A4CA 3BLRA 4WD5A 5FRIA 5AV2A 4EOLA 4GSBA 3OXZA 4I93A 2BDFA 5FTQA 3VBXA 5KMMA 2WMSA 3ORNA 3BQCA 5LCKA 3W2CA 4IM2A 4FT9A 4W4XA 2GNGA 4FEQA 4R5YA 5FXQA 2I0VA 3NYXA 5C4KA 1RQQA 4XG7A 4B9DA 4ZSJA 2OG8A 4AZWA 4LMUA 2OSCA 5K5NA 4OGRA 2VTAA 5CU4A 1YXSA 4J95A 4QP7A 4FZ6A 4RLLA 5FGKA 4YBKA 3TCPA 4BBFA 4KIOA 4RA5A 4YC8A 3BWJA 2J6MA 4Q9ZA 3ANRA 4Z3VA 1RE8A 4M8TA 3JY0A 3TZMA 4EZ3A 3EQGA 5EH0A 2RFDA 3SHEA 2E9UA 5GIOE 2ZV7A 4G31A 1A48A 4O86A 4I6QA 2W4OA 3OOMA 2YIQA 2W1HA 3WE4A 3UOJA 1H07A 5B2MA 2HW6A 2VO0A 2YAAA 4ASXA 3BHUA 4NTSA 4I21A 4E6AA 4F7SA 2WHBA 2YLEA 4Y85A 4C37A 3UQGA 1H1SA 2IO6A 2GPHA 2YLFA 4LMNA 2QOFA 4O2PA 4CFNA 1NVRA 2VTTA 4LOOA 4MXZA 1P4OA 3F66A 2C6EA 4M69A 3EQRA 5TE0A 3LQ3A 2G9XA 5HGIA 1BI8A 3V8WA 4F9BA 2WAJA 5IEYA 1A06A 5CNNA 4W4YA 1JKSA 1YDSE 5I9UA 2C3IB 3KY2A 2GSFA 4GT4A 4JG7A 5K4IA 3M42A 2CLXA 3LFNA 5DVRA 2CCHA 4D2SA 1DS5A 4BCOA 1PHKA 2R3MA 4U42A 3EN6A 2WMWA 3EQPA 2YDKA 4JBQA 3TIZA 2V5QA 4YLLA 4KKGA 4CVAA 3KXMA 5CSWA 1GIHA 4O1PA 3VS6A 3D7ZA 3QWKA 4FC0A 3QZFA 3QKKA 5LMBA 5K0KA 4EK4A 3BYOA 5FEDA 5KX8A 4NM7A 2XEZA 3EFKA 4NJ3A 4TN6A 2WXVA 4IB3A 3ZMMA 4BDJA 4H39A 1Y6BA 4YZMA 4DITA 3A7IA 2BAQA 4XV3A 3F5GA 3O0GA 5H8EA 3OUNB 3UMXA 1GNGA 5A9UA 4PX6A 4RQKA 4Z55A 5HNBA 4LYNA 3OY1A 4BDAA 3JYAA 4YURA 3IW5A 5AV4A 1GZ8A 1E1XA 2C6OA 2XNNA 3UIUA 3V8SA 4BCMA 1OZ1A 3QAME 4FSNA 5CSXA 5AJQA 5HVJA 1ZYDA 1XWSA 5JFSA 2J7TA 5B0XA 4BCGA 4XJ0A 5C27A 4E7WA 5EM5A 4FNXA 2E9OA 4WNKA 4NKSA 3MH3A
chains in the Genus database with same CATH superfamily
2OGVA 1ZZLA 4BCFA 4O4BB 1NVSA 2CSNA 4L3JA 3DB8A 4O21A 5DEYA 1Q41A 2C6KA 2Z7RA 3A99A 3AT4A 5AV3A 2C3LA 5HORA 4UMUA 3KB7A 5JT2A 1E1VA 3NPCA 4AP7A 4E5WA 1UKHA 4FKTA 4HYUA 2C5OA 3FUPA 3ZO3A 2F7EE 3HA6A 3MSSA 4J96A 1DAYA 3SG8A 5DH3A 5FLFA 3O50A 2B54A 3NAYA 5IDNA 3RP9A 4Y72A 4O7VA 5C4LA 2XJ0A 5AUZA 2R3JA 2OZOA 5G1XA 1WZYA 2JC6A 2R4BA 3DXNA 2UW7A 3TWJA 2B7AA 3ATTA 4XMOA 3HMIA 4OLIA 4JXFA 2I40A 1VYZA 3O8PA 4G9RA 3R30A 4I3ZA 2VTQA 4Y46A 3KMUA 4ZJIA 3SW4A 1Y91A 3KN6A 4IVCA 1ZOHA 2UW3A 3ORTA 3I4BA 3IK3A 4QTBA 2FSTX 3SXFA 3R9OA 4DFNA 4DFBA 2ZM4A 4CKRA 3F3WA 5EM8A 4D55A 5L2TA 4AW5A 4YNOA 3SRVB 4FG7A 4GG7A 1F3MC 3DK7A 4O1OA 1IEPA 4O0WA 3ORLA 3LIJA 3TUBA 5EW8A 4DGLC 3C0HA 5M51A 3GC7A 2O65A 3DQXA 1OPKA 2ITZA 3I5ZA 1M52A 1Q4LA 2X4FA 3PRIA 4IAFA 4X2JA 3VS3A 3MH0A 3VQUA 4TKSA 3TKIA 3S3IA 4FVQA 5E1SA 3V6SA 3DS6A 2QQ7A 2XYUA 1R39A 3KVXA 3PPJA 5AP1A 5HE1A 2XUUA 4N70A 3U6HA 5EW9A 3HGKA 1WBWA 3UJGA 3GFEA 3F3VA 4CZTA 2VO6A 4LL0A 4ZY6A 4DYMA 2WQMA 3AG9A 4IZ5A 1M14A 4JLCA 4CTBA 4IX4A 5CY3A 4BC6A 2O2UA 4CKJA 4YZNA 5DFPA 4XUFA 3R9HA 2PY3A 2C5NA 3R7EA 4NFMA 5TF9A 4GCJA 4DHIB 3WOWA 4II5A 3MYGA 4WSYA 5E8WA 5HHWA 2XK4A 4F4PA 5HIEA 4OAUC 4FZFB 4G6OA 4PF4A 1G8SA 2GNFA 4RIYB 4FGRA 3ZFYA 3RAWA 1KE8A 5M57A 1OIYA 4QP2A 3A62A 5IQBA 4AXAA 2Z7LA 3K3IA 1SMHA 5BMSA 4NCTA 2GNIA 2JIIA 1VEBA 4M66A 3TG1A 3WIKA 4MXAA 3RI1A 3SXSA 4R3CA 5CAPA 5M53A 1NVQA 4RWLA 1P4FA 4FSQA 4WUAA 4XRLA 2YAKA 3DAKA 3QRUA 3L8SA 3CD3A 4IWDA 2J9MA 2KULA 4FL1A 5J79A 2UV2A 4AN9A 5ITAA 3NNUA 4EORA 3EMGA 3QTUA 4UXQA 4B99A 4BB4A 2BZJA 3TTIA 3F69A 3NFGB 3P0MA 3ZEWA 5E7RA 4QEBA 4DGNA 5CF6A 5TO8A 2VNWA 1XH6A 4ZS0A 4CFVA 2YFXA 4F64A 3HV7A 5KBQA 3O5AA 3QD3A 2W17A 4QMTA 5ICPA 2XKEA 5IUIA 2EXMA 4IVBA 2C1BA 4MXYA 4CLIA 5ANJA 5ETCA 2BFXA 4PUZA 4QP4A 4O38A 3JR1A 2O63A 3JPVA 3TV4A 4GRBA 4M0YA 4EC9A 3FKNA 3WF6A 2QURA 5K0XA 3CTHA 4FV4A 4JIAA 1ZOEA 3R63A 4DF3A 4QPMA 3COHA 5JGBA 3HUBA 4YZDA 2BRNA 2YJRA 3KRJA 3TDVA 4O22A 4CYJA 4YPDA 2W1DA 2I0EA 4ZZOA 4XV9A 4A9SA 5JFVA 4UWYA 3KC3A 2YISA 1QCFA 5AUWA 3D7TB 4OT5A 3VUTA 1L8TA 2XAOA 3W0SA 5KKRC 2W5AA 4LV5A 5HBEA 5CWZA 3R7VA 3I0QA 2FSLX 5HO6A 4IC7A 4DTBA 4UZHA 5HU3A 4FTCA 2HZIA 2XKFA 4IANA 1BL7A 4XRJA 1CM8A 3FMEA 4CV9A 3UNKA 4AA4A 2BZKB 2RG5A 2V7AA 3P4KA 3HP5A 4G17A 4H36A 4L42A 4O81A 3W16A 1PKDA 3WARA 3ENHA 3FLZA 2ITPA 5C9CA 1XH9A 3FLYA 2O8YA 2YWVA 3VBTA 4AF3A 2BIYA 3KN5A 5D9HA 2BFYA 2YJSA 4RJ7A 5E1EA 2A27A 5IKWA 4EOIA 5EFQA 1CTPE 4E20A 1ND4A 2R64A 3H4JA 1V0PA 4FA2A 3FHRA 3H10A 2A98A 2QD9A 3F82A 3D15A 3CSVA 3IKAA 4JBVA 4RX7A 4F9YA 3E7VA 4LL5A 2C5VA 4PP7A 4WO5A 2QCSA 3H0ZA 2XBJA 3QGYA 3WILA 5AUVA 3AKLA 4AXCA 4C4IA 1QPCA 4RJ3A 4EEVA 1BKXA 4I4EA 3KREA 1OIUA 2BMCA 4CXAA 4XLVA 4UWCA 4DEGA 3ZO4A 3M11A 3QLFA 1KOBA 3HMMA 4D5KA 1PKGA 2YCRA 3LQ5A 2R3RA 5AWMA 1DI8A 5CANA 1ZZ2A 3QYZA 3MWUA 4I92A 3I7CA 3R01A 3MY1A 4RX8A 5IF1A 3W0OA 1XKKA 5IA5A 3NZ0A 1SVGA 2EVAA 2XVDA 3IDPA 4G3CA 4C7TA 5JGDA 4C3RA 1PYEA 4RIWA 1H4LA 1OGYA 4ZK5A 1PRYA 3TYKA 1M17A 2XK7A 2X7GA 1R3CA 4C8BA 5BVOA 3PIZA 4U40A 3FL4A 3NEWA 3QZHA 4S33A 2JKMA 5CXZA 2UUEA 3DBQA 3OW4A 3W8QA 4Y83A 5L2IA 5CNOA 5LVLA 4DEEA 3ZM4A 2WNTA 3KU2A 5HEZA 4FTIA 4I0SA 2QG5A 3U6IA 4IZAA 3BU5A 3MA3A 5BVKA 3R83A 4L53A 3F5XA 3CIKA 4I1ZA 3D0EA 3GB2A 4X2NA 2GQSA 4AGWA 2NRUA 4RFZA 1PMEA 4XEYA 5L2SA 1OL2A 3AKKA 3NW6A 4D28A 5KZ0A 3RJCA 2P4IA 4HGTA 1YXXA 3EQDA 4HPUE 4PL4A 2PZ5A 2J5FA 5IA1A 4C4EA 1A9UA 2ZAZA 3WYXA 2UVXA 3DBEA 3D5XA 2IEWA 4QDVA 2VTPA 4AQKA 4JL9A 3HAMA 2DQ7X 5KBRA 1ZY5A 2UVYA 3W33A 4BGHA 2G2HA 2FH9A 4BGGA 4BR3A 3QF9A 3O17A 5IQFA 2HZ4A 4FTAA 2QOQA 3DA6A 3FLSA 4GIIA 4KIKA 4O4CA 5F95A 2IVUA 2PVRA 4UY9A 2VD5A 3K54A 1WAKA 3QTRA 4TYHB 2XNOA 1YHVA 2FB8A 3AT3A 4FT3A 4V0GB 5JK3A 3SD0A 2G15A 2IZTA 3FZRA 3I79A 2W0JA 4TXCA 1IR3A 4DG2E 4ALWA 1FOTA 1MQ4A 3S00A 3CQUA 2H96A 5HO8A 4UYAA 2EWAA 1QL6A 2HWPA 3IDBA 2WFYA 2VX1A 3PLSA 4BCKA 2UZTA 1PMUA 4EWQA 4C4GA 4KBAA 4V05A 2HENA 2OBJA 1H26A 3LXPA 3GFWA 4BCJA 3I7BA 4AA0A 3MDYA 1Q3WA 5CT0A 4I5PA 5D7AA 5E91A 4NM0A 4BHNA 4TY1A 4U3YA 4R6VA 3ODZX 3CEKA 4TWOA 5K5XA 3NLBA 4C38A 3RHKA 5IA2A 4IC8A 4PL5A 5HKMA 3R8ZA 2ZYBA 5AAFA 2B9HA 4FTNA 2QOKA 3KRWA 4PDSA 3ZBFA 3G0EA 3E63A 4OTRA 4S32A 3P1AA 4QMWA 5M09A 2X2LA 2XCHA 2PVMA 1KE6A 3POOA 3QD0A 4FSMA 5AV1A 1Q8WA 2XNEA 3R8PA 2AC5A 4NL0A 4AT3A 2CGVA 2XAMA 5LVOA 4F9CA 2XYNA 4C36A 2XMYA 3BI6A 4JG8A 3UPXA 4FEXA 2EXEA 1ZAOA 2J0IA 4JQ8A 5FEEA 3TKUA 4BICA 5M06A 4QMQA 3PJCA 3ZFXA 4ZIMA 4YHJA 1QPDA 2XK9A 4D2PA 5C8NA 1YQJA 1OKZA 4IW0A 5AAGA 2PVKA 1YDTE 3DDPA 2OJJA 5DI1A 3FY0A 4EBVA 3O96A 3OC1A 4FG8A 5FXRA 4U81A 4EOMA 4FSTA 4ANBA 2B55A 2OF4A 4GUBA 2I0HA 4TW9A 3CTQA 4DCEA 4FYNA 3CE3A 3NYVA 4FKOA 3VUHA 2BR1A 3E93A 3PJ2A 4IQ6A 4PTGA 4TT7A 4DINA 4QT1A 2IWIA 5K3YA 2OIDA 4X2FA 5ANDA 4MCVA 4BWXA 4PNKA 4HCTA 3FMMA 4O7SA 1SNXA 1K2PA 1W0XC 2ETRA 3B2WA 4L7SA 4R3RA 5DR2A 5FP6A 3RM7A 2ZDTA 3PP1A 4RG0A 4AZVA 5GJGA 5F20A 1TFFA 3DBCA 2YCSA 4HPTE 2X8DA 1PJKA 3ETAA 3QU0A 5KCVA 3RALA 2XCKA 2XK3A 1PMVA 1TKIA 1BMKA 2G1TA 2UVZA 2YIRA 2X2MA 3F61A 4JG6A 4MX9A 5AR4A 4FV0A 1DM2A 3ZH8A 4CG9A 4Y8DA 3VUKA 3HEGA 4FGBA 4ZAUA 3EQCA 3KL8A 3LM0A 4H3PA 4QMUA 4U97A 3ZONA 2PZPA 2BKZA 4O0VA 2RG6A 3NYNA 4UV0A 2GS7A 2EUFB 2OKRA 3FI3A 3VF8A 3CC6A 4E93A 5DIAA 4MTAA 2GS2A 2YDJA 4ZLZA 4PDPA 4IZYA 4X0MA 3TN8A 3UZPA 4JR7A 3UYSA 3DKGA 3EFLA 2XNBA 4PDOA 4YSJA 2QOCA 5HE3A 5CEQA 3QC9A 1K3AA 4YJTA 3PP0A 5KMIA 1PXOA 4L45A 3VJNA 5IQAA 3RMFA 1R78A 3Q53A 5E8YA 3RM6A 4C33A 3LCTA 5EI8A 4F9AA 4QTEA 1H0VA 2WO6A 2QHMA 4EH9A 1HCLA 3BWFA 4RWJA 3UDTA 3FQHA 4U0IA 2UZDA 3AOXA 1GIIA 3W0PA 3IOPA 4BWKA 3OY3A 5HNGA 3W0MA 1IRKA 4R7IA 3GVUA 4O7TA 5T68A 4C3FA 4EL9A 1TVOA 2XS0A 3Q4TA 4NJDA 3C1XA 4DH5A 1Z5MA 4E6CA 3OCSA 5FEQA 2WTWA 1ZMWA 3PPKA 4JIKA 2JBPA 4M14A 2HXQA 3PSBA 2J51A 3UP2A 2XALA 3IW8A 3DV3A 4I6FA 1Q97A 4MQ2A 3U87A 2Y8OA 3OCBA 4ITIA 1MRVA 3VS4A 2WGJA 1J1CA 4YZCA 1PXLA 4IAAA 2BTRA 4D9UA 2W5BA 4UX9A 3QTSA 2UZEA 3MI9A 2A0CX 3I0OA 3PJ1A 3D2KA 3EOCA 1MQBA 4A4LA 4O7LA 3ANQA 4RIXB 4KRCA 3GU6A 1W7HA 4J98A 4GK3A 5HE2A 5EYMA 4G2FA 4U80A 2DS1A 3QZGA 3H9RA 4TPTA 2PU8A 5J8IA 3ZDIA 2W1EA 4LQMA 4FUYA 4BRXA 3ZRMA 5CSHA 4G3DA 4LRJA 4AE9A 4FTLA 4O6EA 3UDBA 2RFEA 3ZRKA 4YJSA 4DH7A 3GQLA 4OBQA 4AGDA 4IWPA 4O0TA 5EYKA 3TZ9A 4RZWA 3SOCA 5EI2A 1XHAA 2PK9A 4LGGA 2B4SB 4YBJA 3TJDA 1YOLA 1JSTA 3TKHA 2C4GA 3AMAA 4FRFA 3G5DA 5G6VA 3SVVA 3O7LB 3R7OA 1IAHA 2J0KA 3DT1A 3ZS5A 5B7VA 5TT7A 4HZRA 3OF0A 3PG3A 4NCTC 5LMAA 3SW7A 3OS3A 3OTUA 4LV7A 4NSTA 1F0QA 3VW8A 4GT5A 4Q9SA 2R7IA 2XNMA 4UALA 3DBFA 5BX0A 2GHLA 3QD4A 4N0SA 2RKUA 5L6PA 1HOWA 3ID6C 2YWPA 4G3FA 3ML1A 3R9DA 2JGZA 1G8KA 3MB6A 3R8MA 4XOYA 3ZUVA 4DGOA 4PTCA 4GEOA 2QNJA 2E9PA 3MFRA 2JDTA 2OH4A 2WIPA 2BZIB 3VHEA 3G51A 2ITXA 3KA0A 4L43A 2OU7A 4IM3A 3O23A 4Y73A 4EK3A 4W8DA 4IB1A 3RNYA 2WMQA 3UOLA 4O6LA 2OJGA 3CGFA 4DHJA 3ZLXA 2ITOA 4PDYA 5CEKA 4GIHA 4RX9A 3KIOC 4BCHA 4X6QC 4FSZA 3TV6A 3JVRA 4NZWB 3QKMA 3ZU7A 4F7NA 1G3NA 3QTIA 2X8EA 5JZNA 4C4JA 2O64A 4EKLA 5DR9A 1IA9A 3TM0A 2OK1A 4UMPA 3QKLA 4BJJA 1ZWSA 4J52A 1Q24A 4RBLA 1S9JA 3A2CA 3DOGA 3QQGA 3ORZA 4ZSAA 4QYFA 2PVFA 3HX4A 2ZMCA 2OFVA 4L6QA 5FP5A 3V3VA 4C58A 1F5QA 3ORXA 4U45A 3UNJA 2VO7A 3R2BA 4BCPA 4OTDA 3UDSA 1OKVA 1H00A 3FLQA 1UWHA 3PA3A 4AW2A 4CMOA 3FI8A 4AOJA 4J53A 5M4UA 3ALOA 3LM5A 5CS6A 3EQFA 4XX9A 4OT6A 2H6DA 3C4CA 3CPCA 3M1SA 4EH5A 2XANA 4DE4A 2ETMA 2R3HA 5LQFA 2PZYA 3LJ2A 4X3FA 2X39A 2VTSA 2VWUA 4E8AA 3UVQA 3RGFA 5KZIA 3MH2A 4DTKA 4WA9A 1Q61A 4ZMFA 3NRMA 4RVLA 5IH5A 4BDBA 1O6KA 4L9IA 4CNHA 3ZM9A 3Q9XA 4HYSA 4YJRA 2GS6A 1OPJA 3CBLA 2VWIA 4DBNA 4XHKB 4C61A 4U41A 4FV3A 5DA3A 3LFQA 4W9XA 4FTKA 4D1ZA 2UZWE 4GS6A 4FKJA 3KCKA 3NGAA 2DWBA 2WMBA 3Q2MA 4TYJA 5CAQA 5HBJA 2NO3A 4LUDA 4AZEA 3HV4A 4QP9A 1T45A 3BLAA 4D4SA 5HBHA 4F9WA 2PULA 4QOXA 1XBCA 5HX8A 4L67A 3D94A 5GZ9A 3QWJA 3IGGA 3IOKA 4MK0A 3PPZA 4KNBA 3AD6A 3FXWA 4RWKA 4AU8A 2Y9QA 3A4PA 5ANGA 3RWQA 2VTIA 3R8LA 4WG4A 2I1MA 2W9FB 3AC5A 5F1ZA 2Z2WA 3C7QA 3EZRA 5AA8A 4L46A 2X6DA 3BHYA 3EN4A 5IQIA 5CLPA 4IMYA 3LFBA 3W0NA 1IA8A 1GZOA 2WOUA 1JWHA 5HIBA 3AC2A 2X0GA 4ZJJA 1VYWA 3KMMA 2Y4IC 4KBCA 4ZSLA 4H3BA 3NUNA 1HCKA 4H1MA 4IH8A 4IVAA 4O84A 3QQJA 2H34A 3BYVA 4WBOA 5FQDC 5GJFA 3ZOSA 4GW8A 1OITA 2QONA 3MA6A 3VQHA 4RC4A 3BLQA 4YP8A 3CS9A 4QD6A 2RL5A 3UE4A 5IEXA 3QX2A 4YZ9A 1L3RE 2PE0A 2WPAA 3ITZA 2QODA 3L9NA 1ZLTA 4E4LA 4UXLA 3OFMA 2JIVA 4BDKA 3GC9A 1YHSA 4LUEA 4MKCA 3IO7A 4I94A 2FUMA 4IB5A 2X7FA 2LGCA 4UYNA 3P23A 4IBMA 5CAOA 3HV5A 4AOIA 2UW5A 4O0YA 4IX5A 4ACGA 4G34A 3UTOA 2UW4A 3MTLA 2VWZA 4MAOA 2ZDUA 4XG4A 3DDQA 4AWIA 3BE9A 1MP8A 3R28A 2OJIA 3OCGA 3U4WA 4FIIA 4FTTA 4X2GA 4F99A 3TJCA 3H30A 4BHZA 2OXXA 1FGIA 5CENA 5I9XA 2IZRA 3QXPA 2PUNA 1BX6A 4C02A 5HI2A 2EB3A 5D1JA 2CDZA 3T9IA 3C5UA 4BIEA 5JZJA 2AQXA 2OJFE 4WSQA 2YABA 4JBPA 2OICA 1PY5A 4MBJA 4WRGA 5AX3A 3UP7A 1TZDA 2PMLX 3VNTA 3ZUTA 4AZSA 2C5XA 3FE3A 3R7GA 4IAYA 4O7ZA 4I24A 3FZSA 2UZUE 2JDRA 2YEXA 4QQJA 4IAZA 3ZYAA 5L3AA 2XBAA 2YITA 3B8RA 4J7BA 4F08A 2BHEA 4WRSA 3GUBA 4GH2A 2ZFYA 5KMJA 3OWPA 3N4TA 4EK6A 3VUMA 4GJ3A 4CEGA 4EH3A 5HVKA 2JITA 3IS5A 4R1YA 4ZTLA 4QYEA 5CYIA 4CQEA 2PWLA 4L00A 3UDZA 4PY1A 3UIXA 3FZOA 3FMLA 2FYSA 4PPCA 4KSQA 4H05A 1KOAA 2YA9A 1CKJA 1UU3A 4RIOA 3TEIA 2OFUA 4EWHA 2R0UA 5HESA 1REJA 2WQOA 2QOIA 3G90X 3JY9A 3ZSHA 2CN5A 4USFA 2YHVA 1WVYA 3HL7A 4YGAA 3MPAA 2R7BA 4KKEA 5A46A 5AAEA 2WTJA 2XKDA 2CGXA 3E8NA 3TXOA 3KRRA 3Q04A 5TOZA 3FHIA 3E62A 4ITJA 2PMIA 4ORKA 3WE8A 5HCZA 4C3PA 3CXWA 1YRPA 4XYFA 3DAEA 3F3UA 5AUTA 4KB8A 3OUKA 4ANLA 3TL8A 4YO6A 5LVMA 3BLHA 4GUEA 4IFCA 3SV0A 3U54A 4U44A 2GNHA 3CKXA 4WHZA 3BU6A 3HA8A 3ULZA 1K9AA 4AGUA 3IECA 2F7ZE 4XG2A 3SX9A 4YTFA 3DBDA 1OL1A 4FNWA 3GCSA 1R1WA 2BKKA 1GY3A 4NM3A 4L68A 5AP2A 3R8VA 4GYIA 1OUKA 3FPQA 4AT5A 2BILB 4EYMA 4LI5A 2OLCA 4QMSA 3GU5A 3DZOA 3U9NA 3DK6A 3R9NA 4HVHA 2QC6A 1ZYCA 1H1WA 4FKRA 4G1WA 3BGQA 4M0ZA 4BZDA 3FLNC 1QPEA 4JNWA 4EH4A 2JKOA 3POZA 3MJ1A 3KF4A 4FR4A 2P33A 5LXMA 3RVGA 4USDA 5ACKA 2C0IA 4W9WA 3AD5A 5IISA 3NCZA 4S34A 4XBUA 3RHXA 2Q0NA 2XK8A 4EOQA 4L52A 4WT6A 2ZJWA 5AM7A 4OUCA 3ZUUA 5JFWA 4R8QA 3RAKA 1H25A 1V0BA 3CTJA 4IWQA 2P0CA 2JKQA 4AACA 3PXQA 4GVAA 3LFFA 4O7YA 3A7FA 3R1NA 4AA5A 4FEWA 3R71A 3Q6WA 2XIZA 3JVSA 4FBXA 2WMAA 4J1RA 2Q0BA 3TNQB 5CF4A 4AUAA 2V7OA 2AEGA 3ZO1A 3BYSA 2WMTA 4L7FA 3HUCA 4K1BA 3O71A 4IJ9A 2J90A 4FSUA 5E8XA 4E3CA 4ZY4A 4FT7A 3GCPA 3EB0A 2Z7QA 3V5WA 3W1FA 4AZTA 5AADA 3UO5A 4IB0A 4X7QA 3NUAA 3W10A 2VGOA 4D2TA 5FBOA 2GMXA 3FXXA 4P5ZA 5I9YA 5IEVA 1XH4A 1WFCA 3A8WA 3DKFA 5IH4A 4MVFA 3R00A 2X81A 3PSDA 4AS0A 3Q6UA 2JLDA 4H58A 2H9VA 5HICA 3V6RA 4EQMA 2C1AA 3QTXA 4DFXE 5L6WL 2GDOA 4BWPA 3GXLA 3L9MA 3ODYX 2CGUA 3Q9YA 4L01A 5EDPA 3UMWA 5L8KA 3UZTA 3NYOA 5JFXA 4OTIA 4RRVA 1GAGA 1OL7A 2C6TA 1DAWA 2OZAA 4OR5A 3WYYA 3VONA 2ONLA 3HP2A 5BYZA 3W2QA 4P4CA 3BRBA 5CU0A 5HIDA 5D12A 5BQ0A 4LOPA 4OTWA 3TNPC 4NTTA 5CU3A 4O4DA 1REKA 1T46A 3R73A 4P5QA 3VS2A 3P7CA 4HVIA 4MD7E 2E9VA 4FEUA 4M69B 3PJ3A 3OHTA 3F2AA 3K3JA 4LGHA 4M3QA 4JDIA 3RTPA 4Z16A 3VVHA 4BGQA 3LFAA 3Q4ZA 2ZV9A 3HRFA 5CZHA 4RQVA 5M4CA 3NVMB 1CKPA 3PIXA 3R8UA 4CLJA 1UU7A 4AAYA 4EUUA 1PYXA 2RGPA 5J9YA 5LCJA 3KULA 5IPJA 3Q52A 3S95A 5EYDA 4I0RA 5H9BA 5M4FA 1FVTA 4DFUA 3AKJA 4RVMA 3QA8A 3IW6A 3K2LA 3Q5IA 4F0FA 5T6KA 4R7HA 1ATPE 2WQNA 4TZRA 3LZBA 1NA7A 2DUVA 3PUPA 4TWNA 3E92A 2WB8A 1ST0A 2HY81 1YVJA 2IVTA 5AP7A 3FC2A 1WBNA 4FKUA 2C6MA 1H0WA 2SRCA 3DXQA 1YXTA 4CSVA 4MYGA 3RPYA 5HQ0A 5M08A 2BRGA 4IHPA 1V0OA 3GCUA 4ZP5A 3HNGA 3HKOA 3MFUA 4EHEA 5L8LA 3QQHA 4D0XA 3H9FA 4TYIA 1QPJA 4U79A 2WTCA 2JDVA 2VN9A 4GG5A 5EQEA 4E26A 1ST4A 4FIGA 4S2ZA 5GHVA 1W98A 3HMNA 5E8ZA 3EIDA 4JJRA 4U9AA 5DT0A 4BCQA 4CRLA 3LFCA 5BUIA 3R21A 1OVEA 3I60A 3LCOA 2ITVA 3OOGA 3QA0A 1M7NA 2BDWA 1KE7A 3ORIA 4FODA 3WZKA 4BDDA 4RSSA 1ZARA 4J71A 5CASA 2Z02A 3HV6A 3QRKA 3KCFA 4HGSA 4X3FC 3VUIA 5D7VA 3UOHA 1OB3A 5IMEA 3IDCA 2C3KA 2VRXA 4ENXA 2VV9A 4YMJA 5LOHA 3LE6A 3DTCA 4QMMA 4BIBA 2CNQA 3QGWA 2VWWA 3EQBA 5H8BA 5L8JA 3C0GA 5ETIA 4OTFA 5HLPA 2ZV2A 3UC3A 3EL8A 4XS2A 5IA3A 3V5PA 3LOKA 1J3HA 3R1YA 4C34A 2W5HA 3MN3A 4UB7A 5JMSA 1FVRA 4CT1A 4UZDA 4XG6A 1LEZA 2QLQA 5JQ8A 3BCEA 3OVVA 2WTIA 3OXTA 4FV2A 3E5AA 2WMUA 1XH5A 5C8MA 4EH7A 5J1VA 4MNEA 4EHGA 5HO7A 2J2IB 4FKIA 3LJ0A 1TQIA 4HOKA 2HZ0A 4O4FA 1RW8A 5DGZA 3RKBA 4AT4A 1UU9A 5CVHA 4B7TA 1GZNA 3Q5ZA 2C69A 3DQWA 3VBYA 3WI6A 4BIDA 5BVWA 2X0PA 4IX6A 4XG8A 4D1XA 3F5UA 4EHZA 2IW9A 4HYIA 2X8IA 2QU6A 4DH1A 3TNWA 2XM9A 1H8FA 3IPHA 4BTJA 3EYHA 4Z7GA 3CQWA 1OKYA 2PTKA 4OBOA 4RIXA 4MF0A 3COMA 1Y57A 2PSQA 4LG4A 2I7QA 2DYLA 5CEPA 4XOZA 3SKCA 2VWYA 4I4FA 3B2TA 3BIZA 4Q2AA 4QYYA 4FKLA 4EH2A 2OIQA 2W9ZB 4FTJA 4D58A 2ZB0A 4YPSA 1OMWA 5I5ZA 3IONA 1LR4A 3N4UA 3II5A 3FMDA 3P9JA 4AXFA 3NUSA 3Q9WA 4WBBB 5D11A 4KKHA 3EQHA 2XIKA 4RZVA 3G15A 1H1QA 3PFYA 2Z7SA 4APPA 1CDKA 3CLYA 2IVVA 4JBOA 4YU2A 2E2BA 3ORKA 4XBRA 4AQCA 4CRSA 1XR1A 3PZEA 4JS8A 3PXYA 4DC2A 5IA0A 5I9VA 3QL8A 3LKMA 3VS1A 2VTRA 4EOKA 3OZ6A 5CI7A 4ZTRA 2Z8CA 2QLUA 3CJGA 5HCYA 3OCTA 5IQHA 4MEDA 4N57A 2GU8A 3MH1A 1AQ1A 5HG9A 3FL5A 1WBVA 2R3LA 3DB6A 2UZOA 3WF7A 4PNIA 3R7YA 2BDJA 3UQFA 5FUTA 4NUSA 2UW8A 2B0QA 2GHMA 4F7JA 2YM7A 5L6OA 4QO9A 4QQ5A 1ZMVA 3R0TA 3MPTA 5BUEA 1WBPA 3R1SA 3REPA 3KFAA 3DKOA 4JDKA 1W84A 3HZTA 1E9HA 1PXIA 2UZBA 4XNEA 2WELA 4UWBA 4YJUA 3ZDUA 4AXEA 4BF2A 4G3GA 2VTNA 2QI8A 5CQUA 4IAIA 5DT4A 5H3QA 1YXUA 2BAKA 3D14A 4RT7A 4K18A 4FTQA 4NIFA 3BKBA 2BIKB 3G0FA 4FKVA 2NPQA 3OT3A 4ZSEA 5F94A 3VO3A 3HV3A 3PA4A 2C68A 2IJMA 1NT2A 3AQVA 2ETKA 2R3IA 4C0TA 4DN5A 1J7LA 5ANEA 5EKNA 5IUGA 4FJVA 3FMKA 3GEQA 4O7WA 5BPYA 3Q32A 3UVPA 3VRZA 2NRYA 4FV9A 3CR0A 5HNIX 3EKNA 3LJ1A 5ACBC 3PFQA 3BGPA 1OBDA 5EKOA 5T3QA 4IZ7A 2F2UA 5CF8A 5CTPA 2ZM3A 4EK8A 3T3VA 4JX7A 4BDIA 4ASEA 4AN3A 2CNVA 4L3LA 3CGOA 4FNYA 5HD7A 1FVVA