4DGNA

Crystal structure of maize ck2 in complex with the inhibitor luteolin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
b'SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Inhibition of protein kinase CK2 by flavonoids and tyrphostins. A structural insight.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dgnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dgnA02
4ASDA 3PWDA 4FZ7A 1PXPA 4MBIA 3NUPA 4IWOA 5M4IA 4U6RA 3PVGA 3P7CA 1JBPE 4IAAA 3TDVA 2QNJA 2IW6A 3BHVA 4PDOA 5E4HA 4R3RA 5KNJA 3DK6A 4FL2A 3PY1A 3HLLA 2HY0A 1PXJA 3NNWA 3QCXA 3NYNA 4CFFA 3CJGA 3EN4A 3HECA 4X7QA 3RNYA 4D2RA 5HNGA 1Q8TA 3BLHA 3KK8A 4BI2A 1NT2A 3REPA 5L2TA 4ANSA 4K11A 5CENA 5J5SA 2O8YA 5KMLA 4KUJA 4NL0A 3QTXA 3NS9A 3PXRA 3R2YA 3KCFA 5I9UA 3RTPA 2R3RA 2FB8A 3DPKA 1APME 3BYOA 1REKA 5HLWA 4RIYA 4FYNA 4CTCA 1AQ1A 3FJQE 4FSYA 3FV8A 3BYUA 2O64A 3HP5A 3RCJA 4O7YA 4JL9A 2R7BA 3MBLA 4FSNA 5CSPA 3VJNA 5BYLA 3JYAA 4LRMA 3HDNA 3ZONA 3EFWA 4TL0A 2W5AA 4BDHA 1XQZA 3P78A 1S9IA 5FDPA 5GIOE 3VO3A 5CNOA 3ELJA 3Q4ZA 2H8HA 4EOKA 2V7OA 2HW7A 3QD4A 3CTHA 4DEAA 5CEOA 4FOBA 3RPYA 4F9BA 3ORPA 2CNQA 3V5LA 1JNKA 2W5HA 3LCDA 4D2WA 4EH4A 2YIXA 1Y57A 2XKDA 3Q4TA 3PLAE 2VZ6A 3W16A 4EWHA 2BRMA 2H9VA 5M07A 4FKSA 3DBCA 3FZRA 5CF5A 4N57A 3UIXA 2ITTA 2YABA 5HBEA 2WHBA 4E5WA 3D14A 5CF4A 3VW8A 5CWZA 3S3IA 2F7EE 2OJFE 4E6AA 3OWJA 3PXKA 2I7QA 4FV3A 2BALA 1BMKA 1JKKA 3FY2A 5HCXA 3W1FA 5E92A 3LW0A 4QMMA 3EZRA 5KO1A 2YLFA 3OEZA 5E1EA 1PMNA 5BVWA 4CMOA 5IDNA 4XBRA 1LP4A 3T3VA 4O38A 5DI1A 3TDWA 2QOQA 3EJ1A 1PJKA 4CVAA 4JG6A 4PL5A 3O8TA 3Q9XA 4NJDA 3EQRA 4AA0A 4F09A 3L9MA 4ITHA 4ZTHA 3LZBA 1Q24A 3VUTA 5ANOA 5JZJA 4DFBA 2I0VA 3RK5A 3HV4A 5D41A 4GV1A 2VTNA 2CSNA 3P23A 4OW8A 4KBCA 1YDTE 3QRIA 4V0GA 2X6DA 3BEAA 5HD7A 4DEEA 4QQ5A 4FL1A 5LVLA 3GXLA 2GNFA 4FV9A 3W2OA 1P4FA 2ITZA 1ZYSA 4XOYA 1BYGA 2F49A 3KU2A 5AM6A 3TV6A 5J95A 4D2PA 5BYZA 3T9TA 4EH6A 3TACA 1V0BA 5HTIA 5HE0A 2XKCA 1A9UA 2UZBA 3LQ5A 2KTYA 5A46A 1W98A 4I5MA 4AOIA 4ZJJA 2HAKA 4ZJIA 3EOCA 4UXLA 3TNIA 3OTVA 4II5A 2VTTA 4QMPA 3R9NA 3H9FA 2OKRA 5C03A 2J0IA 3EKKA 3UIMA 4F1MA 4WA9A 3RVGA 4UMPA 1NA7A 4J8MA 5JFSA 4LOOA 4LGGA 2WTWA 2GFCA 4ASZA 4M0YA 4DLJA 1U5QA 1XH8A 3VS3A 3ZMMA 4TT7A 4TKSA 3V8SA 1FGIA 2O65A 4W4WA 5GJFA 3ZDIA 3QA0A 4BI0A 2F2UA 5KUPA 3PRFA 5CT7A 5F95A 3E7VA 3R1YA 4BDKA 3C5UA 1WMKA 2BAQA 3L8XA 3QTSA 3QCQA 4NM0A 2OIDA 5JEBA 4RZWA 4O7NA 3ZM4A 5GINE 3LQ8A 4WNOA 4R5YA 3UODA 1YVJA 5J8IA 4D1SA 2J7TA 5HZNA 2E9VA 2H6DA 1FPUA 4KBAA 4NH1A 4UXQA 5L2IA 3A8XA 3MWUA 3OP5A 3UMXA 4RC3A 4IVCA 2IZRA 4QP6A 1JKSA 4LL5A 3WZKA 5F9EA 3GCQA 3RAWA 3VS1A 2F7ZE 2R5TA 4XV2A 3QQLA 4I4EA 2CKQA 4C4JA 1Z5MA 4JRVA 4CQGA 4G16A 4RWJA 4WSYA 1KOBA 3HKOA 4IM3A 1JSUA 4KSQA 5C27A 4EZ7A 3UZTA 3GB2A 1NVSA 1QPJA 1XHAA 5ICPA 4PNIA 3ZSHA 5D10A 3KXZA 2YJSA 4OTWA 3DU8A 4ZLYA 3PVWA 5EQPA 5CXZA 2R3KA 3IW8A 2C3IB 3BHYA 4FBXA 3UQGA 5HX8A 2YAAA 1FOTA 3PXYA 3H4JA 2J5EA 4CCUA 5JKGA 3Q96A 3PSCA 3V04A 1P2AA 4AZEA 3EYHA 4L8MA 2ZM3A 3HMPA 3HYHA 3CIKA 3FMHA 4N6YA 4AG8A 3KVWA 4FK3A 4NM3A 1ZMVA 3HMOA 3A7JA 5EDQA 3PIXA 5FP6A 3DB8A 2CDZA 5CI7A 3KQ7A 4HYIA 3AD5A 3ALNA 4A4OA 4MNEA 3ZRMA 3IG7A 1I44A 3FY0A 3IW7A 3KVXA 2WQBA 4WRGA 2YM5A 3NDMA 3QZGA 3U4WA 4ZTSA 3MJ1A 3UG2A 3FI4A 5HIEA 2DWBA 4JQ8A 4NEUA 4QMLA 3FMMA 4G34A 5LARA 5CU3A 5BUIA 5J1VA 2JIUA 5M08A 4EH5A 3W55A 4NJ3A 3RHXA 4AUAA 4TPTA 4JVGA 2QO7A 2YDKA 4TYEA 5EFQA 3UP2A 2VTRA 4FTLA 1SM2A 3C4EA 1H1WA 3DKFA 5H2UA 2IPXA 2X8IA 4QTDA 3R2BA 3IOPA 1JKTA 4G2FA 3TT0A 2WTJA 4G1WA 4JXFA 2QKWB 3WF6A 3I1AA 4J95A 3ZLXA 3G0FA 4APCA 3H3CA 3KXMA 4A9RA 3GCSA 2W1GA 3CE3A 2W17A 3ODZX 4M8TA 2OH4A 1T45A 5EDPA 4FSZA 4EOIA 5CAPA 4IIRA 3QF9A 5A4EA 4F0FA 3S00A 4F9CA 3SVVA 3I5NA 4CG8A 1UA2A 1ZYJA 2R3FA 3LJ1A 3WE4A 3B2WA 4O0RA 5DE2A 3RWQA 1MRVA 4FK6A 4QMWA 3UQFA 4O7WA 4ALVA 3RKBA 4C02A 2XUUA 3KK9A 5BUEA 2PULA 4S2ZA 2X81A 1Y8YA 1J91A 4C38A 4ZTNA 3FKLA 1UKHA 2BKKA 1K9AA 3F2NA 3NAYA 4WKQA 1V0OA 1OIYA 3I7CA 1KE9A 3UYTA 3UNKA 4IHPA 4ARKA 4DFZE 2RFDA 3PY3A 3EQCA 3MVLA 2PZIA 5HLPA 3A8WA 3MIYA 4MXOA 3DLSA 3TKUA 3KMMA 3RPVA 4O0WA 4OUCA 5TOZA 3L8VA 3EHAA 2OJGA 2YEXA 3DGKA 3RPRA 3LMIA 4XCUA 2GSFA 1HCLA 4YLKA 5HO6A 2AYPA 3N4UA 5AV4A 1H1PA 1ZARA 3QRUA 4GW8A 3ORMA 3TM0A 4M14A 5I9YA 4BF2A 3VRZA 4ZEGA 4FTQA 1FVTA 4WUAA 4BYIA 4CZTA 2P3GX 1LR4A 4ZZOA 2ZOQA 4LI5A 2BAJA 1IA8A 4FTOA 2FGIA 2R0IA 3QYZA 2VTOA 3MA3A 4RPVA 2PUPA 3QQGA 1PXNA 4BTFA 5LVPA 2CLQA 4MTAA 2IJMA 3P86A 3ZU7A 3HV7A 3P1AA 2G2FA 4B8MA 5FP5A 2XP2A 4JBPA 3HP2A 4YJTA 2W1HA 3R1QA 3C0GA 3SX9A 4C4FA 4IC7A 2R3OA 3UPXA 5FRIA 1GZNA 4AW0A 3SGCA 5LWNA 2QO9A 3KKVA 4E26A 3BGQA 2QODA 5L3AA 3SKCA 3TNQB 3AC3A 2F4JA 2UZEA 4PDPA 4YJUA 2WIHA 3CY3A 4IWDA 3VUHA 1HOWA 3QTIA 3MSSA 2WB8A 3KRLA 4XP3A 4AGWA 5HESA 3S0OA 4TXCA 4A9YA 2WOUA 4KIOA 2YIYA 4GU6A 3HA6A 5KCVA 4DGMA 2X39A 2OIQA 2WMRA 4AF3A 4CZYB 1U59A 3V3VA 4IVBA 3ZM9A 2VUWA 4FNWA 4JG7A 4EZ5A 4LG4A 5HG8A 4CQEA 4UYAA 1YKRA 4NUSA 3GC0A 3FHRA 4X21A 5M55A 4A4LA 4S30A 3FKNA 4EH7A 1M7QA 4FV1A 4D4SA 4QMOA 2VU3A 4K0YA 3SXRA 4DBXA 3ZBXA 4X3FC 5T68A 2E2BA 2WGJA 3MTLA 5ACBC 4GT4A 2OJ9A 4EYJA 4J97A 3BU5A 3CGFA 1P4OA 4KKGA 3TTJA 4A07A 4CRSA 2G1TA 1Q8ZA 1FGKA 3NGAA 1VJYA 1F3MC 3D15A 4PL3A 1O9UA 3A4PA 4QP7A 2YM8A 2RF9A 4Y73A 4BBEA 2GNHA 1OBDA 5E91A 3AC8A 5JRSA 4GH2A 3UZPA 2YERA 5KHXA 3BYSA 3R1SA 4FGBA 5FD2A 5JGDA 1JKLA 2VNYA 3DFCB 4Q2AA 3P08A 4K77A 4C34A 4AZSA 4U44A 4FTMA 3FC2A 2W1EA 1W83A 5ANKA 2Y4PA 3VBQA 5HEZA 3F3TA 4FG8A 4U3YA 4J52A 1XH7A 3R7IA 5CAOA 3E8NA 5HBHA 5EHYA 3ULZA 3W18A 2C47A 4RLLA 4BCOA 1MQ4A 3POOA 1WAKA 4RJ4A 3I81A 2ITQA 3RBWA 2GS6A 2GNLA 2QHMA 2VNWA 3OWPA 1R39A 4C2VA 3CP9A 4NM7A 4XH6A 4YZDA 3LLTA 5KMJA 4U45A 3PY0A 2RFNA 4WHZA 4R77A 4M68A 4H1JA 3DB6A 3FZOA 2HYYA 4Y5HA 2LAVA 3F7WA 2WMAA 4ANLA 3A62A 3RM6A 1H27A 1O6KA 4GFGA 4I0SA 4O7TA 5KMIA 2XJ1A 4FG9A 1PYEA 2XEYA 3UMWA 1OKVA 3MY1A 5BVOA 2EVAA 3DTWA 2XCKA 4F64A 1URWA 4D4YA 4HVDA 2XM8A 5DN3A 1W84A 2ZB0A 2WU7A 4W4VA 4WNMA 5IH4A 2DQ7X 4H3PA 4BIEA 2QCSA 2JKQA 5FEDA 3PPZA 4YNEA 4BDJA 3VQUA 1NW1A 2B1PA 4PRJA 1QMZA 2PSQA 3EB0A 2J2IB 3T3UA 3FZSA 4U3ZA 4AAAA 3C0HA 3BPRA 3C1XA 3PJ8A 4YJSA 2BZKB 4UMTA 5E8TA 5T3QA 4FNZA 4ZZMA 3PP0A 5AP7A 3LKMA 2PTKA 1J7IA 3ZZEA 5AV0A 4YLJA 5HVYA 3TJCA 3NRMA 5CYIA 3UPZA 4R78A 4D5KA 1L3RE 4XOZA 1BI7A 3BBTB 3AD4A 3FC1X 3FLZA 3LXKA 3WZDA 4D0XA 4O82A 3VC4A 3PA5A 4H3BA 3WYYA 4BBMA 1OPLA 2ITUA 4XMOA 5FGKA 2E9OA 3TL8A 4E7WA 1OPKA 4DH8A 5L6OA 3P7BA 4M69B 4RQKA 3DCVA 3ZUVA 2QQ7A 5AUWA 4N4SA 5EKNA 3E92A 3BWJA 2W1DA 3DY7A 5LVNA 4L42A 2IN6A 3BE2A 3FMDA 5HLNA 2WIPA 3TZ8A 5IDPA 3DBFA 4EC8A 1OB3A 2JBPA 4AP7A 4OT5A 4BI1A 1K3AA 5BVNA 2ZB1A 5E90A 1TQMA 4KSPA 5L4QA 3C4WA 1UU9A 2VX1A 3PZEA 5DG5A 4GEOA 3TWJA 4IVAA 3E8EA 3QQJA 4JDKA 3LLAA 3R7UA 1ZMUA 4FX3A 5A4TA 4EOMA 3F2RA 3ORZA 1OL2A 4JS8A 1BUHA 4CG9A 3ALOA 1P14A 5HQ0A 5CXHA 3DQWA 5HE1A 3G51A 1DI8A 4CFWA 2Y0AA 5CEKA 2QU5A 4FSQA 3RAKA 3QD0A 5B2LA 4HYHA 5H8EA 2ETRA 4H36A 4WOVA 4YHJA 2WMBA 3ANQA 4FKLA 2PZRA 4K1BA 5IA3A 4F1TA 5CS6A 3AT2A 2CHLA 1QL6A 4ERWA 4IB5A 4J53A 3NIEA 4M66A 3P9JA 5L8JA 3DKGA 5ITAA 2XIZA 5J9ZA 4S31A 4GK2A 2UZTA 3AXWA 4U7ZA 2PVNA 2Z7SA 3GT8A 1ZY4A 5CEIA 3VHEA 3ZO2A 2WO6A 2XRUA 5KMMA 5A14A 3OBJA 5ACKA 3QZIA 5J7BA 2EXEA 3MW1A 3F3VA 3FXZA 3WZJA 4C7TA 4P5ZA 4R3PA 2XA4A 4GG7A 4DFXE 3R8MA 3OY3A 3RI1A 4M7IA 5IUGA 3PJ3A 2CN8A 5IU2A 4IANA 3CPCA 4MXYA 1GIJA 4RC4A 2QD9A 3V5PA 4EK8A 3HUCA 4YLLA 1YDRE 2PMLX 3Q60A 2OXXA 4E8AA 4I6HA 3DJ5A 4FVQA 4FUXA 3THBA 4I5HA 4FKTA 2XBJA 2UW5A 4RIOA 4U9AA 2GMXA 4FTTA 4YBJA 3NCZA 3CGOA 2UW8A 2X2KA 3A2CA 3HDMA 2H96A 4EOSA 3ULIA 1H0WA 4MBJA 1YXUA 4U43A 3ZC5A 4PMPA 3NNVA 3P4KA 3TI1A 2GCDA 4Y95A 3KULB 5HE3A 3MH0A 4O6EA 4JRNA 1Q41A 1Y91A 3ORKA 4TWCA 4IAIA 4P4CA 4E4LA 5DEYA 2IZSA 4U8ZA 2QLQA 3NSZA 3ZZWA 4UN0C 4EK3A 4L9IA 5F4NA 4ENXA 3U9CA 4ZLZA 3Q2MA 5AR2A 5H8BA 2W96B 3V8WA 2Y9QA 4CYIA 4DH3A 1STCE 3C4ZA 2QOKA 3O8PA 3N4TA 5DMZA 1IEPA 1WCCA 2WMTA 3TTIA 4F0IA 3O0GA 2C3JA 4DF3A 2CCHA 1H1RA 4I6BA 4GT3A 4A9SA 5AM7A 1GZ8A 4CMTA 5M44A 5KMOA 4ACGA 2DYLA 3GU7A 4MF0A 1L8TA 5EK7A 3OTUA 4OTIA 3SV0A 4RX9A 4KAOA 1BL7A 4R5SA 3LJ2A 5E8YA 5E8ZA 4BGHA 4ZTRA 4ZZNA 2ERZE 4ACCA 5A4QA 1OL5A 2PVJA 2GHMA 4UYNA 4Y83A 2HWPA 3IDPA 4IM2A 4ZOGA 3OW4A 3W10A 4AXAA 4C8BA 4QO9A 3R6XA 2VGPA 2UW3A 5T6KA 3ZXTA 4AZWA 5IA1A 2BRGA 4X3FB 2GQSA 4RJ6A 5EYCA 1Q8YA 3BZ3A 4KKHA 2OJIA 3EQDA 4IMYA 4J7BA 1Q4LA 2C6LA 4D2TA 3RPOA 2EU9A 4XV9A 5HGIA 2UZVA 5HOAA 4AW2A 2QG7A 1WVXA 3V6SA 3BV3A 3UO4A 4QD6A 4BGQA 4YC3A 4EQUA 4O81A 3NUYA 3FSKA 4PWNA 4QP2A 3VBTA 4ZY4A 3LQ3A 3VIDA 2JAMA 1M17A 1KE6A 1OIQA 2ITYA 2W99B 2DUVA 2YFXA 3ANRA 5EW8A 2XNBA 3R63A 3BU3A 5I9XA 1S9JA 3VBVA 4J98A 4FEWA 4NWMA 4DA5A 3PJ1A 4MH7A 2Z8CA 4HPUE 4RWLA 4WO5A 5CANA 2UZWE 4L7FA 4BGGA 3F5XA 2Z7RA 4M12A 4B7TA 3S4QA 2YIRA 3C50A 3QBNA 4RJ3A 1ZZLA 2JLDA 3DNEA 3OC1A 3QQKA 4DH1A 1OUYA 2PVHA 3VUIA 2XK8A 3DBEA 4I22A 2X2LA 4F9AA 5CALA 5EYDA 3TUCA 4H3QA 3EL7A 3D94A 5ANIA 1Y6BA 3C0IA 4AACA 4JOAA 4DH5A 4YZ9A 4FIHA 2P55A 1XO2B 4UMQA 2EUFB 5IG1A 2YN8A 4FT7A 1H26A 5EH0A 2WEVA 5DGZA 3I79A 2VWXA 4FKVA 4MK0A 5H3QA 3VRYA 4BBFA 4ACDA 3QC9A 5AIRA 2UW6A 2ZM4A 3Q9WA 3R22A 4Z9LA 4DCEA 5I3OA 1YXXA 2BR1A 3F3WA 4NCTA 5I4NA 1UNGA 4MQ1A 2WQOA 3WF8A 5IEXA 3UGCA 4Y85A 3UNZA 4ZJVA 2FO0A 3PFQA 3SQQA 3TZMA 3LXLA 5BX0A 2JEDA 2CCIA 2WMSA 4ZSGA 4MXZA 5K5XA 5HE2A 5IZFA 4C57A 4FSTA 4R7BA 2XCHA 2J0MB 1ZYLA 2X0GA 2Y6OA 4USEA 2Q0BA 1V0PA 4O86A 5AV3A 1ERKA 5HORA 1OM1A 5CQUA 5LVOA 4BY9E 2B9FA 5DBXA 4YP8A 1JAMA 2XK3A 5JGBA 2XNEA 3BX5A 4YC6A 4EK5A 2PL0A 5HNBA 2P0CA 4YO4A 3GOPA 4OTQA 3EWHA 4IZ5A 2O3PA 4BCFA 2LGCA 4IDVA 4IW0A 4MF1A 4TNDA 5HCYA 4RA5A 4NCTC 3MFUA 4ITJA 3F3ZA 3LM5A 4D58A 3KN6A 4FTCA 3D7TB 2RFEA 2R9SA 5HICA 2BCJA 2GDOA 3R28A 4E5BA 3D5VA 3NCGA 5IISA 3DDPA 4I5PA 1W8CA 4L67A 3FL4A 1R0EA 3K5UA 3GU5A 3KRWA 2XIKA 1FMKA 4G6LA 4GUBA 4J8NA 5HG7A 5A6OA 1ZAOA 1J7LA 1VYZA 5JGAA 3QTZA 1OGUA 4L3JA 4AA4A 4RVKA 2QONA 3NPCA 4AW1A 5K3YA 2WNTA 1KUTA 3N51A 4V01A 3G15A 4G9CA 2CJMA 5E7RA 5IQHA 4WG3A 4NTSA 1KSWA 4I41A 4KKEA 1GAGA 3BQCA 5A3XA 4RJ8A 3W2RA 3W8QA 5DR9A 5FTGA 1MP8A 2Z02A 3BCEA 2PMIA 4LV5A 2Z7LA 3MESA 5AP0A 3IDCA 4E5AX 1ZYCA 3CBLA 4F6UA 4UWCA 5CY3A 5FBOA 3AC4A 4GL9A 4LMUA 4CFNA 2BTRA 3ODYX 4ZAUA 5J7HA 5CU2A 2ZDTA 5M57A 4JX7A 2VTAA 2GQGA 5AX3A 4OR5A 4FL3A 1V1KA 5HNIX 4D1ZA 3OY1A 5EDRA 2REIA 2J6MA 2UV2A 4WRSA 4QRCA 5HU9A 4QYYA 3ZYAA 3HL7A 4FTIA 2Q83A 3HA8A 3VUKA 3RGFA 1PYXA 3W8LA 3W2QA 5AUVA 2QOHA 4H39A 4TYIA 3QD2B 2E9UA 3LCOA 3COHA 4O7LA 2ZYBA 4TYGA 4QP1A 4KRCA 3VBYA 4RRVA 3R9RA 3R9HA 2KULA 3BHUA 4YZMA 3BIZA 1TVOA 3LMGA 4GRBA 2QKRA 1FVVA 5EW3A 2Z60A 3RAIA 5TR6A 3RWPA 3GGFA 5IEYA 4L01A 4AE9A 4UALA 4WD5A 4XG6A 3O7LD 2WQMA 1H00A 4YZCA 2BMCA 3MN3A 2B9JA 3AG9A 4EH8A 2UW9A 4DH7A 4C3PA 2B9HA 5H8GA 5C8NA 5HHWA 4O6LA 3R73A 3ZLYA 1H01A 3FLNC 4AW5A 3ZFYA 5I9VA 4PNKA 2NRYA 4EH3A 4X2GA 1FBNA 2WZJA 4I5CA 4IX6A 3BGZA 1J1BA 4KINA 4P7EA 1ZY5A 4UBAA 3WE8A 3Q5IA 5I0BA 1FMOE 3KXHA 5C8MA 3KC3A 2R4BA 4NFMA 4RJ5A 4C33A 5JQ8A 3LM0A 1SYKA 3IQ7A 5E8WA 4OTPA 1GOLA 1Q5KA 2VV9A 4FZFB 5HCZA 3V5TA 4LV8A 3BELA 5C4KA 1JPAA 4DITA 5DR2A 4U42A 3SDJA 3QU0A 4IB1A 1DS5A 2BAKA 3FZPA 5HG5A 1K2PA 4FKQA 4NM5A 4BWPA 1P5EA 5D11A 2W9ZB 5AUYA 3RP9A 2B9IA 4CKIA 5BNJA 5CU0A 2CKPA 4YMJA 4YR8A 1J1CA 1OPJA 3UVQA 5AWMA 4AGDA 1J7UA 2P33A 4K33A 4RVLA 2OU7A 3OEFX 4KNBA 3UZRA 2C5NA 5HIBA 4I93A 3PXFA 4MXAA 4DT9A 4Q5EA 4Q9ZA 4DBNA 2F57A 1UU8A 5F20A 1M2QA 3VF8A 4ANQA 3F5PA 2HENA 4BKJA 2BVAA 1E9HA 2GPHA 2PMOX 2X4FA 3QKLA 5AP2A 3W33A 5EKOA 3W32A 4I23A 4PX6A 4X2NA 3R01A 4OBQA 4HGTA 5BUJA 3A61A 2JDRA 4F65A 4D2SA 1TQIA 2XKEA 3K5VA 3MV5A 4K8AA 1CSNA 4XG2A 5KBRA 2DS1A 1YDSE 2OFVA 4L52A 4OTGA 3T9IA 3VAPA 4AFEA 5KKRB 2RIOA 4O84A 5H9BA 4TWPA 2X8EA 3OWLA 4FIEA 2J0JA 2C6TA 3DKOA 4M69A 4BDEA 4F7NA 4KWPA 2QO2A 3EN5A 4IC8A 4I0RA 4LRKA 4XBUA 4MEDA 4M3QA 3ZH8A 3E93A 4LUEA 4AX8A 4F9YA 4FA2A 4RQVA 2CNUA 1PRYA 4AU8A 2OZAB 2YAKA 3QUEA 1YWRA 2YACA 5DRBA 4NFNA 2HCKA 4V04A 2XF0A 2B53A 2FA2A 3R7OA 4J96A 2I6LA 1XH5A 5L8KA 5EI8A 3KMUA 3EH9A 5E9EA 3UBDA 4B8LA 3PJCA 3A99A 2VWYA 4FVPA 3TNHA 3I7BA 4IWPA 4MXXA 4D55A 4RIXB 4EBVA 1OIRA 4XG8A 3QZFA 4EOQA 4YTFA 5I3RA 4PTGA 4MKCA 3PXQA 5HIDA 3QGWA 4YJVA 5J5TA 5AA9A 2HZNA 4WNKA 3MPAA 3TCPA 4PQNA 3QLGA 4IAFA 3R7YA 4CV9A 2ZMDA 5BVKA 5FBNC 1I09A 2E9NA 2WQEA 4O2ZA 5AP3A 4BC6A 5A9UA 1M2PA 3H9OA 4DGOA 3VW6A 2JKMA 3FXWA 3JVRA 3SHEA 4I92A 3O51A 2XH5A 4IXPA 3K2LA 4Y5QA 4Z3VA 4HGLA 3A7HA 3CR0A 3CD8A 2HW6A 4GJ3A 4NK9A 3TV4A 4XNEA 4NSTA 3PDTA 1KV2A 4JT3A 3E64A 3R04A 3QUDA 5DFPA 2FVDA 2Z2WA 1M7NA 4ENYA 4C37A 4DFNA 4DEHA 4F1OA 4Z7GA 3S95A 1SNXA 3MPMA 2IWIA 4QMVA 3Q6UA 4QP8A 2JITA 4ERKA 1IA9A 5FXSA 3RCDA 2VN9A 1RE8A 4XRJA 3R30A 4AGUA 3NLBA 2V22A 2CGWA 4I21A 4L00A 2ZV9A 4CCBA 3V01A 3SLSA 4BTJA 3QD3A 3GOKA 1GZKA 2VAGA 3D83A 5KZ0A 3RMFA 5LQFA 3U6JA 4BCMA 3QUPA 3VHKA 2PUUA 2VO3A 2QR8A 1H25A 4GVJA 4QYHA 3NVMB 2VO7A 4JJRA 4M13A 4DYMA 3KULA 3PE1A 3T8OA 1YI4A 3NNXA 4ZMFA 4ZTLA 3D2KA 4AWIA 3R71A 3SAYA 4BFMA 3BLRA 3GNIB 5IKWA 5FUTA 3GEQA 3O96A 2PE0A 3U4UA 2ZMCA 3MH3A 3JR1A 1WBTA 4GFOA 4QMXA 3L8PA 2B4SB 1UV5A 3ZXZA 4ALUA 4BDFA 5CZHA 2O63A 4FV5A 3KRJA 5FG8A 4F6WA 2PVRA 4PY1A 3BHHA 3QHRA 4N0SA 4BHZA 4WG4A 3IW5A 4P90A 4DG0E 2CGUA 3MY5A 3ORXA 1G8SA 3QL8A 2PVKA 4F4PA 3WBLA 3OOMA 3P7AA 4YNOA 5IQIA 2C5XA 3DAKA 3LPBA 2IVSA 1G8AA 2OF2A 4TYHB 4UZDA 2OXYA 3DK3A 5ANEA 5I9WA 2ITWA 2WMQA 4QNAA 4U0IA 2X4ZA 1REJA 4RFYA 3WZUA 4TW9A 4CZUA 4X3FA 2WMXA 3G33A 2VX0A 5JSMA 2BDJA 4LGDA 4EHVA 4R3CA 4Q9SA 4O21A 2ZM1A 5IF1A 4JLCA 1U5RA 2RKUA 3QTRA 4GYIA 2AUHA 3OXIA 3CC6A 3SG9A 3ETAA 3PA3A 2O0UA 5D7AA 3IOKA 2EB3A 1FVRA 2FUMA 3BV2A 2X2MA 4KIPA 3OWKA 4MWHA 4BTKA 4U81A 1CKJA 2BZJA 3H9RA 4WNPA 1ZWSA 2XS0A 2YM4A 4DE4A 3OXTA 3IPHA 3SXSA 3GC7A 4EH9A 3U9NA 4KS8A 4BTMA 4GT5A 3C51A 4FMQA 2H34A 5J9YA 4QMYA 3WF5A 4AE6A 4PPBA 4QOXA 4CYJA 4O22A 4QQJA 5LOHA 3OCBA 3F9NA 5FEEA 4JNWA 1JQHA 5DWRA 2QVSE 3K54A 4FEQA 4FSRA 1IR3A 4K9YA 4FKPA 2XYUA 5D12A 4CMUA 3O7LB 2IZTA 5AMNA 2R7IA 5DLSA 3VS2A 5AR3A 2UZOA 3WIGA 4K18A 4NKAA 1OI9A 1H08A 1KE5A 1LUFA 1GNGA 3Q52A 1FINA 2WFYA 4BL1A 1WZYA 3IW6A 4O27B 4E6DA 5CVGA 4TWNA 4FTUA 2QOCA 3TXOA 2RG5A 2PVYA 3LMHA 4EK4A 2WTDA 4Z7HA 2WQNA 1Q62A 4FNYA 2FSTX 2X7FA 3M1SA 5AAGA 2JAVA 3D0EA 2CN5A 3M11A 5GZ9A 4R6VA 4QNYA 1MRUA 3DS6A 3V5JA 4I4FA 4N70A 4AN9A 3RHKA 2OLCA 3R0TA 2FYSA 2UW0A 2WMUA 1WBSA 4EEVA 5HD4A 3HAMA 2YM6A 3DZOA 2CLXA 1M2RA 3G0EA 4IFCA 1JWHA 1OMWA 4W8EA 1MUOA 1Q8UA 4I24A 4WBOA 3R8UA 3EMGA 5DPVA 3OXZA 2VWBA 2W9FB 2HZ4A 4BCNA 3R7GA 4IAZA 4UWBA 3AMBA 2YHVA 2J5FA 4HJOA 5GZ8A 2QU6A 5K0KA 5KMKA 4S33A 2P4IA 1SZMA 1UWJA 4OTHA 3QAME 4BVUA 4ORKA 1AGWA 5B0XA 3FMEA 3AQVA 4HGEA 4OTFA 3G6HA 4IB3A 2R3JA 2W05A 2W0JA 3LOKA 4RIWB 5BVFA 4BIDA 3KXXA 2R0UA 3VS0A 3KMWA 3ZC6A 4WBBB 1Z57A 4QYFA 4YTIA 4FT0A 1DI9A 2B54A 4PMMA 1JLUE 3D7TA 4GG5A 3HRCA 4X2FA 3A7IA 3SXFA 1YW2A 3EFJA 3PLSA 4C35A 2XNMA 4DLIA 2C3LA 3BE9A 5AR4A 4YJNA 4F6SA 1WBVA 3FZ1A 5E8VA 4CFUA 4YC8A 3TN8A 5A54A 1CDKA 2HZIA 4CT2A 5G1XA 3TKHA 1H8FA 3CSVA 3EN9A 3BBWA 5M06A 3CPBA 4AZFA 3QRKA 3OF0A 2OK1A 3NX8A 2XM9A 2A1AB 3NYVA 3QA8A 3U54A 3HV5A 4R1YA 5C1QB 5C4LA 1OKZA 1R1WA 4JBVA 1O6LA 2UW7A 4U40A 4DFUA 4ZS4A 4RVMA 3F2AA 1ZZ2A 4FI1A 2ETKA 1E1XA 3IO7A 5FTQA 2JDVA 4XLIA 5M53A 2OO8X 3CY2A 4MD8E 4Y8DA 4I94A 2OJJA 5F1ZA 3B2TA 3ZUUA 3F6XA 4YURA 4RFMA 3SW4A 5L2QA 4GVAA 1XH9A 1QPEA 2BPMA 1AD5A 1YOLA 5CU6A 1XH4A 3CKXA 4HCTA 3O71A 3QTQA 3KXGA 1GY3A 3CTQA 4GJ2A 4YZBA 5IUHA 3UO5A 3UIUA 4AA5A 3HVCA 3GFEA 4FTAA 3GU6A 4J99A 3PIZA 1NXKA 4IBMA 4M84A 2R3NA 4EOOA 4ZLOA 2YCRA 4GS6A 4OBOA 4ZK5A 5DVRA 4GUEA 1R0PA 2ESMA 4DTBA 1YQJA 4I6FA 5CVFA 3FI8A 3NAXA 4EOPA 4BCKA 2PUIA 3QTUA 3MY0A 5AP6A 3LVPA 1H07A 2G01A 4NT4A 5DRDA 4MNEB 2PZ5A 4G3DA 2O5KA 3I6WA 3UVRA 2ITXA 3D5XA 3QALE 3Q5ZA 3BRBA 4YJOA 4DCAA 1OL7A 3EQHA 2OF4A 2PYWA 3TIZA 4G6OA 3CD3A 1KE7A 1E1VA 5AV2A 3OW3A 3WF9A 2YIQA 5BMSA 1PXIA 4USFA 4C3FA 5AUUA 5FEQA 4QPMA 4M67A 4D4VA 4MVFA 5HTBA 2YZLA 4EUTA 5ETCA 1PMUA 2OICA 5CSHA 4UZHA 2UUEA 4P2KA 2HXQA 4NZWB 4E4NA 4YTHA 2BDWA 4XRLA 5KMNA 3KFAA 4MXCA 3ZO4A 3GC9A 1OUKA 4C61A 3I5ZA 2VGOA 4U41A 2PZYA 5CSXA 3DBQA 1YXVA 1YXTA 3HV3A 1NVQA 2XIXA 4DGLC 1SNUA 1F0QA 4ZY5A 4DC2A 2YA9A 2NP8A 4YUQA 1YI3A 2R64A 3DA6A 4IM0A 4XG3A 5M51A 3HGKA 2B7AA 2F7XE 2G9XA 5TKDA 3VVHA 2VWIA 3GU4A 1CKIA 4ID7A 5CAVA 1ND4A 4LGHA 4WSQA 4TWOA 5HI2A 5AFVA 5BPYA 1IAHA 4CD0A 3ORTA 3PVBA 5CTPA 3F5UA 5E1SA 4XG7A 2UW4A 4CLIA 1UKIA 4X2JA 3UO6A 3ZEPA 5AUZA 4CSVA 2UVZA 3COMA 2XMYA 2IW9A 4CRLA 4CTBA 2BIYA 4U5JA 1Q8WA 3E62A 3UTOA 3GCUA 2IVTA 3RK7A 4UMUA 5HO8A 4DEIA 5L2SA 2XK4A 4QMTA 4PUZA 2JBOA 5IA4A 3DFAA 4JR7A 5TF9A 4UY9A 4KS7A 4DT8A 2JDTA 3QWKA 3VS6A 4PMTA 1UU3A 3LFQA 4CNHA 1TQPA 1JSVA 2GNGA 4XG9A 1SMHA 4IACA 5ETAA 2PPQA 3FMNA 1RJBA 2JFLA 3HZTA 2C6DA 4TN6A 2F2CB 5M4UA 2XRWA 2OG8A 4XP2A 3FBVA 3ROYA 4JBQA 2BIKB 4JQEA 4PDYA 3DNDA 5EI6A 3F69A 4ANOA 4QMSA 3WF7A 4FT3A 2YCSA 4AN3A 3QQHA 3U87A 3NZ0A 4C2WA 3C13A 5M4CA 4HVIA 4HZRA 2R3PA 2B0QA 4O7VA 4JDHA 1WBNA 3QQUA 1Y8GA 5IMXA 4YSMA 4RWKA 3H0YA 3O50A 2OZAA 4FC0A 5DHJA 4ZXTA 4RSSA 4EI4A 2AC5A 1TKIA 3DAEA 2ERKA 5A6NA 3GP0A 1U4DA 2W4KA 3UYSA 3U6HA 3EYGA 3F82A 3CLYA 2XBAA 2WTIA 1LPUA 2WMWA 3I4BA 3K3IA 5J87A 3W2CA 4C3RA 3G6GA 4TRLA 2HWOA 4EKLA 3ZDUA 4RIXA 5FM3A 2UZUE 4C58A 4KBKA 3CJFA 3LFFA 4KIKB 4PPAA 5KKRC 4IFGA 3KY2A 5FWKK 1WBWA 4UEUA 2CMWA 2CPKE 2XK6A 3SOCA 4WG5A 4W9WA 1RW8A 4IX5A 3FLWA 3FSFA 3OVVA 4F08A 2A0CX 3FUPA 4CGAA 3COKA 2HELA 3FQEA 3CQUA 2QHNA 3KXNA 3MVHA 4QTBA 5JFVA 3ATSA 4QYGA 2A19B 3H0ZA 3TNWA 4I0TA 3PIYA 4LUDA 3OD6X 4PMSA 4FTRA 2W7XA 4XUFA 4QTEA 2OXDA 4ACMA 3V51A 3H10A 3LIJA 2XEZA 4HW7A 3MVMA 3R02A 4M0ZA 4D5HA 5AADA 3UVPA 4O1OA 4CKJA 3CS9A 5KE0A 5IQEA 4O1PA 5EYKA 2CKOA 2HZ0A 4RVTA 3U6IA 4LMNA 4HVGA 4YHFA 2BDFA 1M52A 1O6YA 5G6VA 3FMLA 3COIA 5HG9A 2C5VA 3R1NA 4TNBA 5AIKA 5M56A 3G9NA 4O96A 3V5WA 5FM2A 3E5AA 4GSBA 2NO3A 3CXWA 4O0YA 5KBQA 4BDDA 4EJNA 4FV2A 5HKMA 5EQEA 4EKKA 1DM2A 1KOAA 2EXMA 3LFDA 3ZSGA 4NW6A 4F7LA 2X1NA 2BILB 5CVHA 4EZ3A 4Z16A 4GKHA 3MGYA 3DT1A 1CMKE 5IA0A 2JDSA 3IKAA 3PRIA 3PTGA 3PG3A 4X3JA 4XYFA 4AT5A 3TEIA 3MFTA 2OH0E 4DTKA 4ANNA 3ZTXA 2C30A 4A9TA 3ZLSA 1DAYA 1W82A 2UZDA 5DT0A 3E3BX 5DIAA 1WBPA 4FV0A 5FLFA 1GJOA 3OHTA 3ZCLA 2PK9A 3RZBA 3Q32A 5BQ0A 4F63A 4W8DA 1QPDA 1U54B 3R83A 5CEQA 4ONAA 2CKEA 4ASXA 5EM6A 1XWSA 2PVMA 4FOCA 3LCTA 5A4LA 5K9IA 4B0GA 2C68A 2P2IA 4TZRA 1G3NA 4QQCA 2B52A 3KL8A 4TYJA 2J50A 5EM8A 3R21A 4L6QA 5EOLA 4NKSA 3VNTA 4G3EA 4CV8A 1CM8A 3F3UA 2PE1A 4FKJA 3MFRA 1ZOEA 2V55A 5C9CA 3DLZA 3JY9A 2I0HA 4KRDA 3OZ6A 4QMNA 2R2PA 3OT3A 5KZIA 5CAUA 4PTCA 5D1JA 2YM7A 4D2VA 5CI6A 2QLUA 4MAOA 4A06A 4FIFA 4IZ7A 2VTHA 4TYHA 4CLJA 5LMKA 5L6PA 3WARA 4CFXA 4EUUA 2W5BA 3E7OA 3FI2A 4IJ9A 4HZSA 5FXQA 4YSJA 3GCVA 2UZLA 3ZUTA 3NUAA 4E6CA 3MA6A 4AGCA 2GTNA 3R9DA 3PPKA 3ZOSA 4IWQA 5CSVA 3LFSA 4FKRA 4L53A 4QT1A 2E9PA 3CQEA 4RWIA 5LJJA 3VUDA 4JIKA 2YITA 3JY0A 5ANDA 2PE2A 4FIJA 5IPJA 4IADA 3FHIA 5M4FA 3C9WA 4IE9A 1OIUA 3EQFA 5BYYA 4O0TA 3KN5A 4GFMA 5JK3A 2YZAA 5L6WL 5EW9A 4NIFB 3EL8A 1A06A 3LAUA 5C26A 2C6KA 5C01A 2BZIB 5LMKC 4BKZA 4E6QA 4FODA 3ZO3A 3E8DA 4S32A 3SC1A 4FGRA 4QP3A 5FXRA 3FXXA 3HV6A 3I0QA 4D9TA 4EK6A 4FSWA 4ASEA 4BIBA 3HRBA 5I9ZA 2Y7JA 4DHFA 3P5KA 3PG1A 4G17A 2WOTA 3CKWA 4R7HA 4JIAA 1R3CA 3UOKA 1H28A 2GNIA 3P79A 1XKKA 5GNKA 3SG8A 3QRTA 3AC5A 1URCA 2GNJA 3EN6A 4IVDA 4E20A 3MB6A 3ORIA 3FAAA 3VN9A 3S1HA 4LL0A 2C1AA 1T46A 4X6QC 4D0WA 3EFKA 1OECA 1KWPA 3EZVA 3TUBA 4UWYA 3HAVA 4FNXA 4QPAA 1YRPA 3F7ZA 3BLQA 4XHKB 1BLXA 4F7SA 4B4LA 4EQCA 4L3LA 4HYUA 5EM5A 5EQYA 4L44A 2YWPA 3NUNA 4JDJA 2WELA 1UU7A 3R8LA 4C59A 5IQDA 4AOTA 1DAWA 4QMUA 4GIHA 2R3IA 3QRJA 3HMIA 3QZHA 1UNLA 3EN7A 4MYGA 3A4OX 3HRFA 3FPQA 3Q3BA 4C36A 2VTMA 3UDBA 3ZLWA 5K4JA 3ZRLA 4FVRA 2ITPA 4FKOA 2X9EA 1YHSA 2OWBA 4O7SA 3OFMA 2W4OA 1W7HA 5DNRA 4RIWA 4RMZA 3UC4A 3RALA 4LOPA 4YHTA 2VTPA 4ANBA 5DH3A 1EH4A 3AGMA 4DFYA 2XIRA 5AEPA 3NW6A 3RAHA 2X8DA 1M14A 3Q6WA 2WU6A 1SVEA 3VJOA 3SW7A 2AC3A 1Q97A 2ITOA 3A7GA 3GBZA 4N6ZA 4WUNA 5LCJA 3VS4A 3I0OA 4KIQA 2ONLA 4E1ZA 4NYEA 5KX8A 3MPTA 4XV1A 5D9HA 2YM3A 3U8WA 3ZEWA 1ZRZA 3LCSA 2WTCA 2XYNA 3OMVA 3LFEA 3LHJA 2F9GA 3IGOA 4RGJA 4QMQA 2W1IA 1RQQA 5AR7A 3ORNA 4E73A 5IQBA 2ZAZA 4ZSLA 1PKDA 2QI8A 3DBDA 3NYXA 3W2SA 4O0UA 4DG3E 1KV1A 4LYNA 5L2WA 2A4LA 3PYYA 4IAKA 3QQFA 2XVDA 3HX4A 4HGSA 1H1SA 5CNNA 5CEPA 4PPCA 4DAWA 3DJ7A 4PDSA 3SA0A 1BKXA 1OKWA 5AAEA 2I0YA 2W1FA 2XNOA 2V62A 3MJ2A 2O2UA 3FEGA 5EHLA 2W4JA 4GK4A 5AP5A 3U51A 2FH9A 1PW2A 4C4IA 4USDA 5K4IA 3ZBFA 2ONLC 4CEGA 3PJ2A 4MCVA 4QPSA 4EC9A 2PHKA 4YGAA 3W2PA 1PXOA 4FKIA 1GZOA 4LRJA 3R7EA 3EQGA 4JBOA 1W0XC 4Q5HA 3BEGA 1OBGA 3UP7A 4BZOA 2QG5A 3N9XA 4QTCA 5JRQA 3BQRA 2C6EA 2G15A 2RG6A 1A48A 1SVHA 1YI6A 3D7ZA 2WXVA 2C1BA 1H4LA 2IVVA 4AZVA 3WIKA 4JQ7A 4FKUA 2A27A 2C4GA 2BKZA 4MWIA 2GHLA 3NWWA 4AS0A 5AUTA 4QMZA 2WAJA 3FLYA 3JPVA 1B39A 3B8QA 3ID6C 3QXPA 5IA2A 4ZP5A 5BMMA 2R3LA 3GC8A 4K2RA 4NW5A 5DEWA 2GFSA 2QOFA 4RX8A 2Q0NA 5CSWA 2QURA 3OUNB 3NR9A 3B8RA 4DFLA 3KRRA 4KABA 5JFXA 4ITIA 4UV0A 3G5DA 5EOBA 3KB7A 4S34A 3HMMA 3EKNA 4PTEA 3KRXA 2W06A 4U79A 2J90A 4E93A 2G2IA 2ZVAA 2UZNA 4GKIA 4K6ZA 3PSDA 4D1XA 3M2WA 4BDIA 3FLQA 3SRVB 2C3KA 3VS7A 3QLFA 1VZOA 3QWJA 5DOSA 3UNJA 2QC6A 1PKGA 4FIIA 3CCNA 3Q04A 5JFWA 4O7ZA 2VWZA 2OZOA 4GIIA 5J9LA 3RPSA 2GU8A 2R3HA 2QOOA 5CLPA 3R8ZA 3E8CA 3NYOA 5TE0A 4IX3A 4FKWA 2GQRA 2X7GA 4A7CA 1OL1A 2IVUA 3AT3A 3IONA 5C8KA 1KE8A 4LM5A 4AOJA 5AX9A 3U55A 4FEUA 4HNIA 2BHHA 5IH5A 1Q61A 1YXSA 3BI6A 3HUBA 4RJ7A 4C4GA 2PUNA 4PL4A 5LMBA 2OI4X 3QCSA 4M15A 3BKBA 5IA5A 4C62A 3FQSA 4KD1A 2Y8OA 3EQPA 3FPMA 4F9WA 1PXKA 3NUUA 2Z7QA 2XNPA 4RLKA 2Y4IC 2HK5A 5E8SA 1IG1A 4CFVA 5HVJA 3IS5A 5E8XA 2JIIA 3OCSA 2ETMA 4HYSA 4BCGA 4X0MA 4JG8A 4RC2A 5AR5A 3QXOA 4EHEA 2V5QA 3OT8A 5BVEA 5IQCA 3RZFA 1U46A 3GCPA 3WILA 3ZSIA 5AP4A 3NMUF 3QX4A 3D5UA 1VEBA 4HPTE 4IJPA 4EOLA 1J3HA 3DTCA 3Q4UA 4LFIA 2JKOA 2BRHA 3UIBA 3QCYA 1YOJA 5DA3A 1IAJA 3MB7A 1PMEA 3CTJA 1UWHA 3JUHA 4G6NA 1H0VA 5AA8A 4IQ6A 4O7RA 3NW5A 2UVXA 4ZS0A 5JZNA 4X6RA 4LQMA 3TJDA 3ZO1A 4DG2E 5IQGA 4IZYA 4EBWA 1CTPE 1XJDA 2BZHB 3MVJA 2YDJA 3UOJA 2OW3A 1VR2A 2FSOX 3FE3A 3L9LA 2OFUA 2GHGA 4FZAB 4GCJA 4NU1A 4R7IA 4TTHB 2ZV7A 1WFCA 3FI3A 3LJ0A 4PP7A 4FT9A 4P5QA 2C69A 3D4QA 3VBWA 5EI2A 3L9NA 1WBOA 2BRNA 2XKFA 3QX2A 2C5OA 2BRBA 4W9XA 3FMKA 3O8UA 5GJGA 4H58A 1IRKA 4ZSEA 3QYWA 4RIYB 4O0XA 1ZLTA 5B2KA 3UE4A 4XG4A 3E63A 4O2PA 2ACXA 4QYEA 2X6EA 2RFSA 2XJ0A 4OT6A 4BKYA 3C7QA 3ZFXA 2C5YA 5LXMA 3VUMA 3F5GA 3WZEA 2XK7A 5CF6A 4KIKA 3DKCA 4X2KA 1YWVA 3ITZA 5AAFA 4CFMA 2OSCA 4F70A 5J1WA 2W1CA 2I40A 5LMAA 3AMAA 3VQHA 3EIDA 5DT4A 5EM7A 3Q2JA 2R3MA 1OKYA 1WVWA 2C0TA 1QPCA 2J9MA 2VD5A 3TUDA 3FDNA 4Y72A 5E8UA 5CT0A 3QC4A 4DGGA 4IZAA 4OLIA 4ZTMA 3KA0A 4D28A 4ZMEA 3EFLA 3GQIA 2ITNA 3GUBA 2PY3A 3JVSA 2FSMX 3DOGA 5EG3A 3WYXA 1YHWA 2OIBA 4JDIA 3R9OA 4H05A 2W1ZA 3CEKA 3L8SA 4DEBA 2J0KA 1OZ1A 2C0IA 1Z9XA 2VO6A 3DJ6A 4JI9A 3AC2A 3FYKX 2GTMA 4O83A 4DTAA 2VWWA 2JKKA 2G2HA 3LCKA 5AUXA 1BX6A 4GYGA 2QOLA 4RT7A 3R7VA 4RFZA 2BHEA 3AD6A 3ZHPC 4UMRA 5AP1A 4MHAA 5HBJA 3O17A 3SOAA 3MIAA 4PF4A 4ZSJA 1F5QA 4RA4A 4G9RA 4WIHA 3O23A 3P0MA 2VWVA 4MD9E 5BVDA 3MH2A 2J4ZA 4V0GB 3QKMA 4KB8A 2C0OA 2GS7A 1VYWA 4RBLA 4FTKA 4UB7A 3L1SA 2YLEA 4F7JA 3ORLA 1MRYA 3PUPA 4ANMA 4FV7A 5F94A 4A4XA 2WTKC 1QCFA 2EWAA 2HXLA 3A60A 4YBKA 4ALWA 1CKPA 3D2IA 4QTAA 2VTIA 3PP1A 4XJ0A 5ETIA 5FTOA 4HVSA 2JC6A 3DZQA 4BDAA 4FE2A 3OOGA 1ZXEA 1B6CB 3MFSA 4F0GA 3QKKA 2RSVA 4HNFA 4AQCA 4OAVB 2CNVA 2C6OA 4RX7A 4FV6A 3DV3A 3OUKA 4J71A 3M42A 3KGAA 1ZOHA 2R3GA 4YTCA 4GK3A 1H24A 5B2MA 5JH6A 1U54A 3ACJA 5LVMA 2SRCA 2IZUA 4GMYA 2NPQA 5M09A 5K0XA 2NNWB 3D5WA 3BWFA 3DAJA 5HVKA 4U97A 2YIWA 5FQDC 3AC1A 3II5A 4JR3A 1OITA 3LXPA 4EONA 5CU4A 2BFYA 2XNGA 4EH2A 4D9UA 2V0DA 2CGXA 4FZDB 3UC3A 1ATPE 2PZPA 4L3PA 3TKIA 2WKMA 4AN2A 3VUGA 1R78A 4IDTA 3MYGA 3V6RA 3TG1A 1JSTA 5KHWA 2VO0A 2UVYA 2ZV8A 2XJ2A 1Q3DA 2IO6A 4JX3A 4L7SA 4AT4A 3E88A 2YWVA 3V8TA 2BTSA 4YO6A 4BYJA 3GENA 4YPSA 2BROA 3QHWA 1X8BA 4IEBA 4O0SA 3EQIA 3VBXA 4DINA 3NVKI 1PY5A 4FIGA 4U80A 3C4FA 4B9DA 4OTRA 4FF8A 3VWAA 2ITVA 3BU6A 4YJPA 4BCQA 2I1MA 3FZTA 4L46A 1JOWB 3NUSA 1H1QA 3BGPA 2VTQA 4NIFA 5AR8A 3GFWA 1PXMA 3D9VA 2VTLA 3FL5A 2I0EA 2J51A 2ZDUA 2PMNX 3GI3A 3OBGA 4FYOA 4XX9A 4ACHA 2EXCX 1PMVA 1G5SA 3F88A 4GU9A 5CZIA 1XR1A 4B99A 4E4MA 4BZNA 4XEYA 2YJRA 3DK7A 5CEMA 2A2AA 1MQBA 4FTNA 2PVLA 4IX4A 4BZDA 1PF8A 3IGGA 3IK3A 3MH1A 1BL6A 3F66A 4IH8A 5AJQA 4G3GA 3BYMA 4RZVA 4ZY6A 3TNPC 4DEDA 5CASA 3F61A 3K3JA 2GS2A 3KCKA 1ZMWA 3JXWA 3POZA 3RK9A 3TZ7A 4BICA 4YU2A 2YISA 2IW8A 3S2PA 4PP9A 3G9LX 4EOJA 3ATTA 3DQXA 5IUIA 4CT1A 2VTJA 4BCJA 4RX5A 2JGZA 3G2FA 4JAJA 4MX9A 3MDYA 3QGYA 5A4CA 3LXNA 3ENMA 5K5NA 2FSLX 3ACKA 3MI9A 3V5QA 5HO7A 2VWUA 3TZ9A 3MTFA 4E3CA 5IEVA 4BDGA 2JFMA 4G3FA 2Y4IB 4HOKA 5ANGA 3FQHA 3ROCA 1XBBA 4JAIA 2WEIA 4FSUA 5JMSA 2X7OA 4ZIMA 3DXPA 3LE6A 1NY3A 3O2MA 5CX9A 4BCPA 5EHOA 2QOIA 3OCTA 4BDBA 3GQLA 3KREA 4APPA 3HEGA 4H1MA 4D4RA 2HY81 3MS9A 4FKGA 4QP4A 5D7VA 1FQ1B 1BI8A 5I5ZA 2XNNA 2JD5A 3SD0A 4W4XA 5AV1A 3A7FA 3E3PA 2YCFA 4O0VA 2WD1A 3PXZA 4XP0A 3H30A 4FV4A 4BN1A 1RDQE 3KEXA 1XBAA 3OG7A 3NEWA 3PA4A 4LOQA 3UQCA 3G90X 3C5IA 2C6IA 2R3QA 2V7AA 4CXAA 4G5PA 5IQFA 4W4YA 3OCGA 4BWKA 3PVUA 2CGVA 3RJCA 4C0TA 4O91A 3ZRKA 4A9UA 2OBJA 3C4CA 4HCUA 5DR6A 4EL9A 3N4VA 3ZFMA 4BDCA 2WTVA 3R8VA 3GVUA 4YJRA 4KA3A 3UOLA 4CKRA 2VTSA 1YHVA 3VF9A 3PWYA 1UNHA 4EWQA 4IAYA 3NW7A 3DDQA 2WPAA 3CQWA 3FKOA 1HCKA 1UVRA 5DT3A 4C4EA 3ET7A 4RG0A 2X9FA 3LFCA 4FUYA 1NVRA 3OROA 1OL6A 3TV7A 4UX9A 5IMEA 3NUXA 5FDXA 5J79A 3PE2A 3PSBA 1WVYA 4Z55A 4FEVA 3FWQA 4YZNA 5IH6A 1IASA 3QTWA 3TIYA 4BB4A 3I6UA 5GJDA 4MNFA 4IB0A 4Y46A 5GIPE 1XBCA 3IECA 5CQWA 3RM7A 4XLVA 3WOWA 3PZHA 4M97A 1B38A 4HVHA 1YWNA 4G3CA 1GIHA 3AT4A 3KF4A 3NNUA 5GZAA 2Y6MA 5JT2A 2B55A 3UJGA 1SVGA 3KF7A 3LFAA 4BHNA 2P2HA 3L9PA 2WMVA 4MBLA 4AFJA 4BWXA 5IQAA 4I6QA 2ZV2A 5LCKA 4QQTA 4ZTQA 4WT6A 5CF8A 2C6MA 2JIVA 1JVPP 2RGPA 3IW4A 4DN5A 2XK9A 1OVEA 2NRUA 2RL5A 4I20A 3FLSA 4AT3A 3VS5A 3E87A 2XB7A 3AGLA 1LEZA 4AZTA 3JS2A 4NTTA 5CAQA 2XZSA 3HNGA 4XV3A 5JQ5A 3NIZA 2HIWA 1Q99A 2BFXA 4EHGA 4TY1A 2VRXA 4C4HA 2WTKB 2BUJA 3Q9ZA 5ANJA 4EHZA 3WI6A 1GIIA 4EYMA 2IG7A 2JDOA 4BCHA 4DGNA 4OAUC 3EQBA 3UOHA 2XIYA 5L8LA 3Q53A 4L45A 3C4XA 4EQMA 3LFNA 3SRVA 2QOBA 1Q3WA 5GHVA 2EB2A 4FT5A 5TT7A 4G31A 4G5JA 3R8PA 4L43A 5DYJA 4BR3A 4F99A 3QFVA 1PHKA 4B6LA 5HTCA 4DEGA 3ERKA 3PPJA 3Q4CA 4EORA 5ETFA 3AOXA 5EYMA 3DXNA 5JN2A 2J0LA 1Y6AA 2PWLA 4FSMA 3BHTA 2QR7A 4MQ2A 5HX6A 5LWMA 4FEXA 4MD7E 4PV0A 2VX3A 3OS3A 4FZ6A 3HMNA 2PVFA 3ENHA 4FG7A 4FICA 4I3ZA 4OBPA 4OGRA 4R1VA 4V05A 3FYJX 3ZS5A 1LEWA 4BCIA 4FR4A 5HU3A 4R8QA 4OTDA 2YCQA 3FMJA 3I60A 4YPDA 3LFBA 5TO8A 4ZSAA 3UG1A 3DXQA 4EJ7A 3AMYA 4QP9A 4L68A 1XH6A 3RINA 4E4XA 2YDIA 1ZYDA 2OGVA 2ZJWA 1PXLA 4I1ZA 4XS2A 3Q9YA 1ZOGA 2HOGA 3GU8A 3VULA 5B7VA 2PU8A 4YJQA 3IDBA 4J1RA 1YOMA 3R00A 4FV8A 3RNIA 4HCVA 4BRXA 3BYVA 4FTJA
chains in the Genus database with same CATH superfamily
4ASDA 3PWDA 4FZ7A 1PXPA 4MBIA 3NUPA 4IWOA 5M4IA 4U6RA 3PVGA 3P7CA 1JBPE 4IAAA 3TDVA 2QNJA 2IW6A 3BHVA 4PDOA 5E4HA 4R3RA 5KNJA 3DK6A 4FL2A 3PY1A 3HLLA 2HY0A 1PXJA 3NNWA 3QCXA 3NYNA 4CFFA 3CJGA 3EN4A 3HECA 4X7QA 3RNYA 4D2RA 5HNGA 1Q8TA 3BLHA 3KK8A 4BI2A 1NT2A 3REPA 5L2TA 4ANSA 4K11A 5CENA 5J5SA 2O8YA 5KMLA 4KUJA 4NL0A 3QTXA 3NS9A 3PXRA 3R2YA 3KCFA 5I9UA 3RTPA 2R3RA 2FB8A 3DPKA 1APME 3BYOA 1REKA 5HLWA 4RIYA 4FYNA 4CTCA 1AQ1A 3FJQE 4FSYA 3FV8A 3BYUA 2O64A 3HP5A 3RCJA 4O7YA 4JL9A 2R7BA 3MBLA 4FSNA 5CSPA 3VJNA 5BYLA 3JYAA 4LRMA 3HDNA 3ZONA 3EFWA 4TL0A 2W5AA 4BDHA 1XQZA 3P78A 1S9IA 5FDPA 5GIOE 3VO3A 5CNOA 3ELJA 3Q4ZA 2H8HA 4EOKA 2V7OA 2HW7A 3QD4A 3CTHA 4DEAA 5CEOA 4FOBA 3RPYA 4F9BA 3ORPA 2CNQA 3V5LA 1JNKA 2W5HA 3LCDA 4D2WA 4EH4A 2YIXA 1Y57A 2XKDA 3Q4TA 3PLAE 2VZ6A 3W16A 4EWHA 2BRMA 2H9VA 5M07A 4FKSA 3DBCA 3FZRA 5CF5A 4N57A 3UIXA 2ITTA 2YABA 5HBEA 2WHBA 4E5WA 3D14A 5CF4A 3VW8A 5CWZA 3S3IA 2F7EE 2OJFE 4E6AA 3OWJA 3PXKA 2I7QA 4FV3A 2BALA 1BMKA 1JKKA 3FY2A 5HCXA 3W1FA 5E92A 3LW0A 4QMMA 3EZRA 5KO1A 2YLFA 3OEZA 5E1EA 1PMNA 5BVWA 4CMOA 5IDNA 4XBRA 1LP4A 3T3VA 4O38A 5DI1A 3TDWA 2QOQA 3EJ1A 1PJKA 4CVAA 4JG6A 4PL5A 3O8TA 3Q9XA 4NJDA 3EQRA 4AA0A 4F09A 3L9MA 4ITHA 4ZTHA 3LZBA 1Q24A 3VUTA 5ANOA 5JZJA 4DFBA 2I0VA 3RK5A 3HV4A 5D41A 4GV1A 2VTNA 2CSNA 3P23A 4OW8A 4KBCA 1YDTE 3QRIA 4V0GA 2X6DA 3BEAA 5HD7A 4DEEA 4QQ5A 4FL1A 5LVLA 3GXLA 2GNFA 4FV9A 3W2OA 1P4FA 2ITZA 1ZYSA 4XOYA 1BYGA 2F49A 3KU2A 5AM6A 3TV6A 5J95A 4D2PA 5BYZA 3T9TA 4EH6A 3TACA 1V0BA 5HTIA 5HE0A 2XKCA 1A9UA 2UZBA 3LQ5A 2KTYA 5A46A 1W98A 4I5MA 4AOIA 4ZJJA 2HAKA 4ZJIA 3EOCA 4UXLA 3TNIA 3OTVA 3W0NA 4II5A 2VTTA 4QMPA 3R9NA 3H9FA 2OKRA 5C03A 2J0IA 3EKKA 3UIMA 4F1MA 4WA9A 3RVGA 4UMPA 1NA7A 4J8MA 5JFSA 4LOOA 4LGGA 2WTWA 2GFCA 4ASZA 4M0YA 4DLJA 1U5QA 1XH8A 3VS3A 3ZMMA 4TT7A 4TKSA 3V8SA 1FGIA 2O65A 4W4WA 5GJFA 3ZDIA 3QA0A 4BI0A 2F2UA 5KUPA 3PRFA 5CT7A 5F95A 3E7VA 3R1YA 4BDKA 3C5UA 1WMKA 2BAQA 3L8XA 3QTSA 3QCQA 4NM0A 2OIDA 5JEBA 4RZWA 4O7NA 3ZM4A 5GINE 3LQ8A 4WNOA 4R5YA 3UODA 1YVJA 5J8IA 4D1SA 2J7TA 5HZNA 2E9VA 2H6DA 1FPUA 4KBAA 4NH1A 4UXQA 5L2IA 3A8XA 3MWUA 3OP5A 3UMXA 4RC3A 4IVCA 2IZRA 4QP6A 1JKSA 4LL5A 3WZKA 5F9EA 3GCQA 3RAWA 3VS1A 2F7ZE 2R5TA 4XV2A 3QQLA 4I4EA 2CKQA 4C4JA 1Z5MA 4JRVA 4CQGA 4G16A 4RWJA 4WSYA 1KOBA 3HKOA 4IM3A 1JSUA 4KSQA 5C27A 4EZ7A 3UZTA 3GB2A 1NVSA 1QPJA 1XHAA 5ICPA 4PNIA 3ZSHA 5D10A 3KXZA 2YJSA 4OTWA 3DU8A 4ZLYA 3PVWA 5EQPA 5CXZA 2R3KA 3IW8A 2C3IB 3BHYA 4FBXA 3UQGA 5HX8A 2YAAA 1FOTA 3PXYA 3H4JA 2J5EA 4CCUA 5JKGA 3Q96A 3PSCA 3V04A 1P2AA 4AZEA 3EYHA 4L8MA 2ZM3A 3HMPA 3HYHA 3CIKA 3FMHA 4N6YA 4AG8A 3KVWA 4FK3A 4NM3A 1ZMVA 3HMOA 3A7JA 5EDQA 3PIXA 5FP6A 3DB8A 2CDZA 5CI7A 3KQ7A 4HYIA 3AD5A 3ALNA 4A4OA 4MNEA 3ZRMA 3IG7A 1I44A 3FY0A 3IW7A 3KVXA 4AAYA 2WQBA 4WRGA 2YM5A 3NDMA 3QZGA 3U4WA 4ZTSA 3MJ1A 3UG2A 3FI4A 5HIEA 2DWBA 4JQ8A 4NEUA 4QMLA 3FMMA 4G34A 5LARA 5CU3A 5BUIA 5J1VA 2JIUA 5M08A 4EH5A 3W55A 4NJ3A 3RHXA 4AUAA 4TPTA 4JVGA 2QO7A 2YDKA 4TYEA 5EFQA 3UP2A 2VTRA 4FTLA 1SM2A 3C4EA 1H1WA 3DKFA 5H2UA 2IPXA 2X8IA 4QTDA 3R2BA 3IOPA 1JKTA 4G2FA 3TT0A 2WTJA 4G1WA 4JXFA 2QKWB 3WF6A 3I1AA 4J95A 3ZLXA 3G0FA 4APCA 3H3CA 3KXMA 4A9RA 2XAMA 3GCSA 2W1GA 3CE3A 2W17A 3ODZX 4M8TA 2OH4A 1T45A 5EDPA 4FSZA 4EOIA 5CAPA 4IIRA 1TZDA 3QF9A 5A4EA 4F0FA 3S00A 4F9CA 3SVVA 3I5NA 4CG8A 1UA2A 1ZYJA 2R3FA 3LJ1A 3WE4A 3B2WA 4O0RA 5DE2A 3RWQA 1MRVA 4FK6A 4QMWA 3UQFA 4O7WA 4ALVA 3RKBA 4C02A 2XUUA 3KK9A 5BUEA 2PULA 4S2ZA 2X81A 1Y8YA 1J91A 4C38A 4ZTNA 3FKLA 1UKHA 2BKKA 1K9AA 3F2NA 3NAYA 4WKQA 1V0OA 1OIYA 3I7CA 1KE9A 3UYTA 3UNKA 4IHPA 4ARKA 4DFZE 2RFDA 3PY3A 3EQCA 3MVLA 2PZIA 5HLPA 3A8WA 3MIYA 4MXOA 3DLSA 3TKUA 3KMMA 3RPVA 4O0WA 4OUCA 5TOZA 3L8VA 3EHAA 2OJGA 2YEXA 3DGKA 3RPRA 3LMIA 4AXEA 4XCUA 2GSFA 1HCLA 4YLKA 5HO6A 2AYPA 3N4UA 5AV4A 1H1PA 1ZARA 3QRUA 4GW8A 3ORMA 3TM0A 4M14A 5I9YA 4BF2A 3VRZA 4ZEGA 4FTQA 1FVTA 4WUAA 4BYIA 4CZTA 2P3GX 1LR4A 4ZZOA 2ZOQA 4LI5A 2BAJA 1IA8A 4FTOA 2FGIA 2R0IA 3QYZA 2VTOA 3MA3A 4RPVA 2PUPA 3QQGA 1PXNA 4BTFA 5LVPA 2CLQA 4MTAA 2IJMA 3P86A 3ZU7A 3HV7A 3NFFB 3P1AA 2G2FA 4B8MA 5FP5A 2XP2A 4JBPA 3HP2A 4YJTA 2W1HA 3R1QA 3C0GA 3SX9A 4C4FA 4IC7A 2R3OA 3UPXA 5FRIA 1GZNA 4AW0A 3SGCA 5LWNA 2QO9A 3KKVA 4E26A 3BGQA 2QODA 5L3AA 3SKCA 3TNQB 3TMOA 3AC3A 2F4JA 2UZEA 4PDPA 4YJUA 2WIHA 3CY3A 4IWDA 3VUHA 1HOWA 3QTIA 3MSSA 2WB8A 3KRLA 4XP3A 4AGWA 5HESA 3S0OA 4TXCA 4A9YA 2WOUA 4KIOA 2YIYA 4GU6A 3HA6A 5KCVA 4DGMA 2X39A 2OIQA 2WMRA 4AF3A 4CZYB 1U59A 3V3VA 4IVBA 3ZM9A 2VUWA 4FNWA 4JG7A 4EZ5A 4LG4A 5HG8A 4CQEA 3VONA 4UYAA 1YKRA 4NUSA 3GC0A 3FHRA 4X21A 4FRFA 5M55A 4A4LA 4S30A 3FKNA 4EH7A 1M7QA 4FV1A 4D4SA 4QMOA 2VU3A 4K0YA 3SXRA 4DBXA 3ZBXA 4X3FC 5T68A 2E2BA 2WGJA 3MTLA 5ACBC 4GT4A 2OJ9A 4EYJA 4J97A 3BU5A 3CGFA 1P4OA 4KKGA 3TTJA 4A07A 4CRSA 2G1TA 1Q8ZA 1FGKA 3NGAA 1VJYA 1F3MC 3D15A 4PL3A 1O9UA 3A4PA 4QP7A 2YM8A 2RF9A 4Y73A 4BBEA 2GNHA 1OBDA 5E91A 3AC8A 5JRSA 4GH2A 3UZPA 2YERA 5KHXA 3BYSA 3R1SA 4FGBA 5FD2A 5JGDA 1JKLA 2VNYA 3DFCB 4Q2AA 3P08A 4K77A 4C34A 4AZSA 4U44A 4FTMA 3FC2A 2W1EA 1W83A 5ANKA 2Y4PA 3VBQA 5HEZA 3F3TA 4FG8A 4U3YA 4J52A 1XH7A 4O4EA 3R7IA 3E8NA 5CAOA 5HBHA 5EHYA 3ULZA 3W18A 2C47A 4RLLA 4BCOA 1MQ4A 3POOA 1WAKA 4RJ4A 4DHJA 3I81A 2ITQA 3RBWA 2GS6A 2GNLA 2QHMA 2VNWA 3OWPA 1R39A 4C2VA 3CP9A 4NM7A 4XH6A 4YZDA 3LLTA 5KMJA 4U45A 3PY0A 2RFNA 4WHZA 4R77A 4M68A 4H1JA 3DB6A 3FZOA 2HYYA 4Y5HA 2LAVA 3F7WA 2WMAA 4ANLA 3A62A 3RM6A 1H27A 1O6KA 4GFGA 4I0SA 4O7TA 5KMIA 2XJ1A 4FG9A 1PYEA 2XEYA 1XMLA 3UMWA 1OKVA 3MY1A 5BVOA 2EVAA 3DTWA 2XCKA 4F64A 1URWA 4D4YA 4HVDA 2XM8A 5DN3A 1W84A 2ZB0A 2WU7A 4W4VA 4WNMA 5IH4A 2DQ7X 4H3PA 4BIEA 2QCSA 2JKQA 5FEDA 3PPZA 4YNEA 4BDJA 3VQUA 1NW1A 2B1PA 4PRJA 1QMZA 2PSQA 3EB0A 2J2IB 3T3UA 3FZSA 4U3ZA 4AAAA 3C0HA 3BPRA 3C1XA 3PJ8A 4YJSA 2BZKB 4UMTA 5E8TA 5T3QA 4FNZA 4ZZMA 3PP0A 5AP7A 3LKMA 2PTKA 1J7IA 3ZZEA 5AV0A 4YLJA 5HVYA 3TJCA 3NRMA 5CYIA 3UPZA 4R78A 4D5KA 1L3RE 4XOZA 1BI7A 3BBTB 3AD4A 3FC1X 3FLZA 3LXKA 3WZDA 4D0XA 4O82A 3VC4A 3PA5A 4H3BA 3WYYA 4BBMA 1OPLA 2ITUA 4XMOA 5FGKA 2E9OA 3TL8A 4E7WA 1OPKA 4DH8A 5L6OA 3P7BA 4M69B 4RQKA 3DCVA 3ZUVA 2QQ7A 5AUWA 4N4SA 5EKNA 3E92A 3BWJA 2W1DA 3DY7A 5LVNA 4L42A 2IN6A 3BE2A 3FMDA 5HLNA 2WIPA 3TZ8A 5IDPA 3DBFA 4EC8A 1OB3A 2JBPA 4AP7A 4OT5A 4BI1A 1K3AA 5BVNA 2ZB1A 5E90A 1TQMA 4KSPA 5L4QA 3C4WA 1UU9A 2VX1A 3PZEA 5DG5A 4GEOA 3TWJA 4IVAA 3E8EA 3QQJA 4JDKA 3LLAA 3R7UA 1ZMUA 4FX3A 5A4TA 4EOMA 3F2RA 3ORZA 1OL2A 4JS8A 1BUHA 4CG9A 3ALOA 1P14A 5HQ0A 5CXHA 3DQWA 5HE1A 3G51A 1DI8A 4CFWA 2Y0AA 5CEKA 2QU5A 4FSQA 3RAKA 3QD0A 5B2LA 4HYHA 5H8EA 2ETRA 4H36A 4WOVA 4YHJA 2WMBA 3ANQA 4FKLA 2PZRA 4K1BA 5IA3A 4F1TA 5CS6A 3AT2A 2CHLA 1QL6A 4ERWA 4IB5A 4J53A 3NIEA 4M66A 3P9JA 5L8JA 3DKGA 5ITAA 2XIZA 5J9ZA 4S31A 4GK2A 2UZTA 3AXWA 4U7ZA 2PVNA 2Z7SA 3GT8A 1ZY4A 5CEIA 3VHEA 3ZO2A 2WO6A 2XRUA 5KMMA 5A14A 3OBJA 5ACKA 3QZIA 5J7BA 2EXEA 3MW1A 3F3VA 3FXZA 3WZJA 4C7TA 4P5ZA 4R3PA 2XA4A 4GG7A 4DFXE 3R8MA 3OY3A 3RI1A 4M7IA 5IUGA 3PJ3A 2CN8A 5IU2A 4IANA 3CPCA 4MXYA 1GIJA 4RC4A 2QD9A 3V5PA 4EK8A 3HUCA 4YLLA 1YDRE 2PMLX 3Q60A 2OXXA 4E8AA 4I6HA 3DJ5A 4FVQA 4FUXA 3THBA 4I5HA 4FKTA 2XBJA 2UW5A 4RIOA 4U9AA 2GMXA 4FTTA 4YBJA 3NCZA 3CGOA 2UW8A 2X2KA 3A2CA 3HDMA 2H96A 4EOSA 3ULIA 1H0WA 4MBJA 1YXUA 4U43A 3ZC5A 4PMPA 3NNVA 3P4KA 3TI1A 2GCDA 4Y95A 3KULB 5HE3A 3MH0A 4O6EA 4JRNA 1Q41A 1Y91A 3ORKA 4TWCA 4IAIA 4P4CA 4E4LA 5DEYA 2IZSA 4U8ZA 2QLQA 3NSZA 3ZZWA 4UN0C 4EK3A 4L9IA 5F4NA 4ENXA 3U9CA 4ZLZA 3Q2MA 5AR2A 5H8BA 2W96B 3V8WA 2Y9QA 4CYIA 4DH3A 1STCE 3C4ZA 2QOKA 3O8PA 3N4TA 5DMZA 1IEPA 1WCCA 2WMTA 3TTIA 4F0IA 3O0GA 2C3JA 4DF3A 2CCHA 3W0PA 1H1RA 4I6BA 4GT3A 4A9SA 5AM7A 1GZ8A 4CMTA 5M44A 5KMOA 4ACGA 2DYLA 3GU7A 4MF0A 1L8TA 5EK7A 3OTUA 4OTIA 3SV0A 4RX9A 4KAOA 1BL7A 4R5SA 3LJ2A 5E8YA 5E8ZA 4BGHA 4ZTRA 4ZZNA 2ERZE 4ACCA 5A4QA 1OL5A 2PVJA 2GHMA 4UYNA 4Y83A 2HWPA 3IDPA 4IM2A 4ZOGA 3OW4A 3W10A 4AXAA 4C8BA 4QO9A 3R6XA 2VGPA 2UW3A 5T6KA 3ZXTA 4AZWA 2IF8A 5IA1A 2BRGA 4X3FB 2GQSA 4RJ6A 5EYCA 1Q8YA 3BZ3A 4KKHA 2OJIA 3EQDA 4IMYA 4J7BA 1Q4LA 2C6LA 4D2TA 2A98A 3RPOA 2EU9A 4XV9A 5HGIA 2UZVA 5HOAA 4AW2A 2QG7A 1WVXA 3V6SA 3BV3A 3UO4A 4QD6A 4BGQA 4YC3A 4EQUA 4O81A 3NUYA 3FSKA 4PWNA 4QP2A 3VBTA 4ZY4A 3LQ3A 3VIDA 2JAMA 1M17A 1KE6A 1OIQA 2ITYA 2W99B 2DUVA 2YFXA 3ANRA 5EW8A 2XNBA 1W2FA 3BU3A 3R63A 5I9XA 1S9JA 3VBVA 4J98A 4FEWA 4NWMA 4DA5A 3PJ1A 4MH7A 2Z8CA 4HPUE 4RWLA 4WO5A 5CANA 2UZWE 4L7FA 4BGGA 3F5XA 2Z7RA 4M12A 4B7TA 3S4QA 2YIRA 3C50A 3QBNA 4RJ3A 1ZZLA 2JLDA 3DNEA 3OC1A 3QQKA 4DH1A 1OUYA 2PVHA 4BJJB 3VUIA 2XK8A 3DBEA 4I22A 2X2LA 4F9AA 5CALA 5EYDA 3TUCA 4H3QA 3EL7A 3D94A 5ANIA 1Y6BA 3C0IA 4AACA 4JOAA 4DH5A 4YZ9A 4FIHA 2P55A 1XO2B 4UMQA 2EUFB 5IG1A 2YN8A 4FT7A 1H26A 5EH0A 2WEVA 5DGZA 3I79A 2VWXA 4FKVA 4MK0A 5H3QA 3VRYA 4BBFA 4ACDA 3QC9A 5AIRA 2UW6A 2ZM4A 3Q9WA 3R22A 4Z9LA 4DCEA 5I3OA 1YXXA 3W0OA 2BR1A 3F3WA 4NCTA 5I4NA 1UNGA 4MQ1A 2WQOA 3WF8A 5IEXA 3UGCA 4Y85A 3UNZA 4ZJVA 2FO0A 3PFQA 3SQQA 3TZMA 3LXLA 5BX0A 2JEDA 2CCIA 2WMSA 4ZSGA 4MXZA 5K5XA 5HE2A 5IZFA 4C57A 4FSTA 4R7BA 2XCHA 2J0MB 1ZYLA 2X0GA 2Y6OA 4USEA 2Q0BA 1V0PA 4O86A 5AV3A 1ERKA 5HORA 1OM1A 5CQUA 5LVOA 4F78A 4BY9E 2B9FA 5DBXA 4YP8A 1JAMA 2XK3A 5JGBA 2XNEA 3BX5A 4YC6A 4EK5A 2PL0A 5HNBA 2P0CA 4YO4A 3GOPA 4OTQA 4QEBA 3EWHA 4IZ5A 2O3PA 4BCFA 2LGCA 4IDVA 4IW0A 4MF1A 4TNDA 5HCYA 4RA5A 4NCTC 3MFUA 4ITJA 3F3ZA 3LM5A 4D58A 3KN6A 4FTCA 3D7TB 2RFEA 2R9SA 5HICA 2BCJA 2GDOA 3R28A 4E5BA 3D5VA 3NCGA 5IISA 3DDPA 4I5PA 1W8CA 4L67A 3FL4A 1R0EA 3K5UA 3GU5A 3KRWA 2XIKA 1FMKA 4G6LA 4GUBA 4J8NA 5HG7A 5A6OA 1ZAOA 1J7LA 4JMQA 1VYZA 5JGAA 3QTZA 1OGUA 4L3JA 4AA4A 4RVKA 2QONA 3NPCA 4AW1A 5K3YA 2WNTA 1KUTA 3N51A 4V01A 3G15A 4G9CA 2CJMA 5E7RA 5IQHA 4WG3A 4NTSA 1KSWA 4I41A 4KKEA 1GAGA 3BQCA 5A3XA 4RJ8A 3W2RA 3W8QA 5DR9A 5FTGA 1MP8A 2Z02A 3BCEA 2PMIA 4LV5A 2Z7LA 3MESA 3UDZA 5AP0A 3IDCA 4E5AX 1ZYCA 3CBLA 4F6UA 4UWCA 5CY3A 5FBOA 3AC4A 4GL9A 4LMUA 4CFNA 2BTRA 3ODYX 4ZAUA 5J7HA 5CU2A 2ZDTA 5M57A 4JX7A 2VTAA 2GQGA 5AX3A 4OR5A 4FL3A 1V1KA 5HNIX 4D1ZA 3OY1A 5EDRA 2REIA 2J6MA 2UV2A 4WRSA 4QRCA 5HU9A 4QYYA 3ZYAA 3HL7A 4FTIA 2Q83A 3HA8A 3VUKA 3RGFA 1PYXA 3W8LA 3W2QA 5AUVA 2QOHA 4H39A 4TYIA 3QD2B 2E9UA 3LCOA 3COHA 4O7LA 2ZYBA 4TYGA 4QP1A 4KRCA 3VBYA 4RRVA 3R9RA 3R9HA 2KULA 3BHUA 4YZMA 3BIZA 1TVOA 3LMGA 4GRBA 2QKRA 1FVVA 5EW3A 2XARA 2Z60A 3RAIA 5TR6A 3RWPA 3GGFA 5IEYA 4L01A 4AE9A 4UALA 4WD5A 4XG6A 3O7LD 2WQMA 1H00A 4YZCA 2BMCA 3MN3A 2B9JA 3AG9A 4EH8A 2UW9A 4DH7A 4C3PA 3PUFC 2B9HA 5H8GA 5C8NA 5HHWA 4O6LA 3R73A 3ZLYA 1H01A 3FLNC 4AW5A 3ZFYA 5I9VA 4PNKA 2NRYA 4EH3A 1W2CA 4X2GA 1FBNA 2WZJA 4I5CA 4IX6A 3BGZA 1J1BA 4KINA 4P7EA 1ZY5A 4UBAA 3WE8A 3Q5IA 5I0BA 1FMOE 3KXHA 5C8MA 3KC3A 2R4BA 4NFMA 4RJ5A 4C33A 5JQ8A 3LM0A 1SYKA 3IQ7A 5E8WA 4OTPA 1GOLA 1Q5KA 2VV9A 4FZFB 5HCZA 3V5TA 4LV8A 3BELA 5C4KA 1JPAA 4DITA 5DR2A 4QDVA 4U42A 3SDJA 3QU0A 4IB1A 1DS5A 2BAKA 3FZPA 5HG5A 1K2PA 4FKQA 4NM5A 4BWPA 1P5EA 5D11A 2W9ZB 5AUYA 3RP9A 2B9IA 4CKIA 5BNJA 5CU0A 2CKPA 4YMJA 4YR8A 1J1CA 1OPJA 3UVQA 5AWMA 4AGDA 1J7UA 2P33A 4K33A 4RVLA 2OU7A 3OEFX 4KNBA 3UZRA 2C5NA 5HIBA 4I93A 3PXFA 4MXAA 4DT9A 4Q5EA 4Q9ZA 4DBNA 2F57A 1UU8A 5F20A 1M2QA 3VF8A 4ANQA 3F5PA 2HENA 4BKJA 2BVAA 1E9HA 2GPHA 2PMOX 2X4FA 3QKLA 5AP2A 3W33A 3TYKA 5EKOA 3W32A 4I23A 4PX6A 4X2NA 3R01A 4OBQA 4HGTA 5BUJA 3A61A 2JDRA 3AKLA 4F65A 4D2SA 1TQIA 2XKEA 3K5VA 3MV5A 3BL7A 4K8AA 1CSNA 4XG2A 5KBRA 2DS1A 1YDSE 2OFVA 4L52A 4OTGA 3T9IA 3VAPA 4AFEA 5KKRB 2RIOA 4O84A 5H9BA 4TWPA 2X8EA 3OWLA 4FIEA 2J0JA 2C6TA 3DKOA 4M69A 4BDEA 4F7NA 4KWPA 2QO2A 3EN5A 4IC8A 4I0RA 4LRKA 4XBUA 4MEDA 4M3QA 3ZH8A 3E93A 4LUEA 4AX8A 4F9YA 4FA2A 4RQVA 2CNUA 1PRYA 4AU8A 2IEWA 2OZAB 2YAKA 3QUEA 1YWRA 2YACA 5DRBA 4NFNA 2HCKA 4V04A 2XF0A 2B53A 2FA2A 3R7OA 4J96A 2I6LA 1XH5A 5L8KA 5EI8A 3KMUA 3EH9A 5E9EA 3UBDA 4B8LA 3PJCA 3A99A 2VWYA 4FVPA 3TNHA 3I7BA 4IWPA 4MXXA 4D55A 4RIXB 4EBVA 1OIRA 4XG8A 3QZFA 4EOQA 4YTFA 5I3RA 4PTGA 4MKCA 3PXQA 5HIDA 3QGWA 4YJVA 5J5TA 5AA9A 2HZNA 4WNKA 3MPAA 3TCPA 4PQNA 3QLGA 4IAFA 3R7YA 4CV9A 2ZMDA 5BVKA 5FBNC 1I09A 2E9NA 2WQEA 4O2ZA 5AP3A 4BC6A 5A9UA 1M2PA 3H9OA 4DGOA 3VW6A 2JKMA 3FXWA 3JVRA 3SHEA 4I92A 3O51A 2XH5A 4IXPA 3K2LA 4Y5QA 4Z3VA 4HGLA 3A7HA 3CR0A 3CD8A 2HW6A 4GJ3A 4NK9A 3TV4A 4XNEA 4NSTA 3PDTA 1KV2A 4JT3A 3E64A 3R04A 3QUDA 5DFPA 2FVDA 2Z2WA 1M7NA 4ENYA 3W0QA 4C37A 4DFNA 4DEHA 4F1OA 4Z7GA 3S95A 1SNXA 3MPMA 2IWIA 4QMVA 3Q6UA 4QP8A 2JITA 4ERKA 1IA9A 5FXSA 3RCDA 2VN9A 1RE8A 4XRJA 3R30A 4AGUA 3NLBA 2V22A 2CGWA 4I21A 4L00A 2ZV9A 4CCBA 3V01A 3SLSA 4BTJA 3QD3A 3GOKA 1GZKA 2VAGA 3D83A 5KZ0A 3RMFA 5LQFA 3U6JA 4BCMA 3QUPA 3VHKA 2PUUA 2VO3A 2QR8A 1H25A 4GVJA 4QYHA 3NVMB 2VO7A 4JJRA 4M13A 4DYMA 3KULA 3PE1A 3T8OA 1YI4A 3NNXA 1W2DA 4ZMFA 4ZTLA 3D2KA 4AWIA 3R71A 3SAYA 4BFMA 3BLRA 3GNIB 5IKWA 5FUTA 3GEQA 3O96A 2PE0A 3U4UA 2ZMCA 3MH3A 3JR1A 1WBTA 4GFOA 4QMXA 3L8PA 2B4SB 1UV5A 3ZXZA 4ALUA 4BDFA 5CZHA 2O63A 4FV5A 3KRJA 5FG8A 4F6WA 2PVRA 4PY1A 3BHHA 3QHRA 4N0SA 4BHZA 4WG4A 3IW5A 4P90A 4DG0E 2CGUA 3MY5A 3ORXA 1G8SA 3QL8A 2PVKA 4F4PA 3WBLA 3OOMA 3P7AA 4YNOA 5IQIA 2C5XA 3DAKA 3LPBA 2IVSA 1G8AA 2OF2A 4TYHB 4UZDA 2OXYA 3DK3A 5ANEA 5I9WA 2ITWA 2WMQA 4QNAA 4U0IA 2X4ZA 1REJA 4RFYA 3WZUA 4TW9A 4CZUA 4X3FA 2WMXA 3G33A 2VX0A 4DHZA 5JSMA 2BDJA 4LGDA 4EHVA 4R3CA 4Q9SA 4O21A 2ZM1A 5IF1A 4JLCA 1U5RA 2RKUA 3QTRA 5BV3A 4GYIA 2AUHA 3OXIA 3CC6A 3SG9A 3ETAA 3PA3A 2O0UA 5D7AA 3IOKA 2EB3A 1FVRA 2FUMA 3BV2A 2X2MA 4KIPA 3OWKA 4MWHA 4BTKA 4U81A 4AXDA 1CKJA 2BZJA 3H9RA 4WNPA 1ZWSA 2XS0A 2YM4A 4DE4A 3OXTA 3IPHA 3SXSA 2AQXA 3GC7A 4EH9A 3U9NA 4KS8A 4BTMA 4GT5A 3C51A 4FMQA 2H34A 4O4FA 4QMYA 5J9YA 3WF5A 4AE6A 4PPBA 4QOXA 4CYJA 4O22A 4QQJA 5LOHA 3OCBA 3F9NA 5FEEA 4JNWA 1JQHA 5DWRA 2QVSE 3K54A 4FEQA 4FSRA 1IR3A 4K9YA 4DHIB 4FKPA