4DGNA

Crystal structure of maize ck2 in complex with the inhibitor luteolin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title Inhibition of protein kinase CK2 by flavonoids and tyrphostins. A structural insight.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 325
sequence length 326
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4dgnA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4dgnA02
4FTRA 5GINE 3KFAA 3DB6A 1A9UA 4ZY5A 4GL9A 2Q83A 2PL0A 3DTCA 2XRWA 2C3JA 3GP0A 3LJ0A 1OL6A 3BLRA 3IK3A 3ZM4A 4AW0A 5LMKA 3E3BX 3TUDA 4W8DA 5ACBC 4RG0A 3WF7A 4F64A 2VTLA 3TZMA 2HXLA 5CY3A 2BIYA 2IVSA 4QRCA 4G3FA 1ZYJA 4QTDA 2XVDA 1AD5A 1XQZA 3Q6UA 4IWOA 3BHYA 4YJVA 4AOJA 4DFXE 1MQ4A 2FB8A 3HV4A 5J7BA 2QVSE 5CANA 3NPCA 3CD8A 4HJOA 5CT0A 3RHKA 5L6OA 1H1QA 4I5HA 2C5NA 5E91A 3WE4A 4HCVA 3FZSA 3KMUA 3NYXA 4I0TA 1Q8ZA 2OH0E 4EQUA 2QG7A 3QZIA 3BEAA 1RW8A 3RGFA 4ZLYA 3FC2A 5AM6A 4X2NA 3GB2A 5K9IA 1PF8A 3DBCA 2PVRA 4HNIA 3SOAA 3CS9A 4DBXA 4J7BA 1OPKA 2J5FA 2WNTA 4OTFA 5J9ZA 3A7FA 3RAHA 5E1EA 2J50A 3WYXA 3BYUA 1UVRA 2QR8A 3QQKA 4TTHB 4XUFA 2UUEA 1XO2B 5CWZA 4FEUA 3F2NA 3EN7A 5IUIA 2XZSA 4QO9A 4YHFA 4CQGA 2HYYA 4ASDA 4DINA 5HICA 5ETIA 2XNNA 2OJFE 4UV0A 4D5HA 5IDNA 1OMWA 3W10A 4HGEA 4B8LA 1KE7A 1U59A 2BZKB 5C27A 5TE0A 1U4DA 4CQEA 4F09A 4L45A 3ZONA 5A54A 1JAMA 2QURA 4NU1A 2XJ0A 3KU2A 2VWVA 2IVUA 2CKQA 2P2IA 4BGQA 4F08A 2X8EA 3HMMA 2X6DA 5IQGA 4IAKA 2NPQA 4A9YA 4ALUA 2R3FA 4DT9A 2YM8A 4EBVA 2XUUA 4FKSA 4IM2A 4FV3A 3LFQA 2O63A 3MW1A 3MI9A 4Q9SA 4ZK5A 5BUIA 3MV5A 4I6QA 5JGAA 1ZLTA 2V5QA 1OZ1A 5KMJA 3NS9A 3MGYA 4QYEA 2W4OA 3OUNB 4GMYA 4TYHB 5HD4A 4FTTA 3TL8A 2IG7A 4O27B 4G34A 2PVHA 3GU4A 3E8EA 4QTBA 2WQOA 3AC5A 3PJ1A 3O51A 4QYFA 4MNFA 4LUEA 4I23A 3KB7A 4HNFA 4B0GA 5L8JA 1G3NA 2XKFA 4ANQA 4QT1A 2H9VA 2X8IA 5M57A 4EOQA 3IO7A 2OIDA 4XNEA 3QXPA 1YQJA 5E1SA 2A27A 3TV7A 4EWHA 4J99A 2CLQA 2UW7A 4TYIA 3CJGA 5CEMA 2XM9A 4UALA 5FM3A 3SW7A 2C4GA 3F82A 5EQYA 3KXXA 4TWCA 5M44A 3HAMA 2C6DA 2PE0A 4PRJA 4RWLA 3UGCA 5DE2A 1GZNA 3UOJA 4KIPA 3MTFA 4PPBA 4NIFA 1UNGA 3NUNA 4H36A 4XP2A 3VS0A 5J79A 5DG5A 2W1IA 4NKAA 3H0YA 1XH9A 4A9UA 4ZSGA 3HV7A 3VBQA 2PUPA 5IQIA 1GIJA 5H9BA 3JVRA 4BKZA 3HMPA 3PVBA 4QMZA 3PXQA 3OTUA 3EN5A 1LPUA 2QKRA 5IG1A 2QU5A 4Z9LA 3DNEA 4K9YA 2FSTX 4EOSA 2WZJA 3F61A 4JRNA 5BQ0A 4FV5A 4C61A 4NTTA 2R3MA 4FGBA 4BTKA 4M97A 4FR4A 4R1VA 4MCVA 1V0PA 2X7GA 4LM5A 2J9MA 3LCOA 3NCGA 5IEXA 4HZRA 1JNKA 5HLWA 2RGPA 2BTSA 1MP8A 2P2HA 1BX6A 1NA7A 2AYPA 4B99A 3R7VA 5CF4A 2UZOA 1YWNA 3DJ6A 1M2RA 2ITZA 2X4FA 1M7NA 5AFVA 5AUWA 3O7LB 5C1QB 2H6DA 2PE1A 3DBFA 4RIWA 4BCHA 3FXZA 5IU2A 2XEYA 3GEQA 5KBRA 2QCSA 4EK5A 5EW3A 1GY3A 2YN8A 4F7LA 2E9PA 1QPCA 4WSYA 3MFTA 3TIYA 4D5KA 2C0OA 3UNJA 3KXNA 3H9FA 5EDRA 3CGFA 4ZZNA 2BFYA 3P23A 3UIMA 4HOKA 5HCXA 4XOZA 3CBLA 4L7SA 4OLIA 1PYEA 2O8YA 4G6NA 3BBWA 3FUPA 3QTQA 5IQFA 2GFCA 2BHHA 5DT3A 5LVMA 2OF2A 2C1BA 4C59A 3V04A 5A4QA 4TN6A 4DTAA 3VWAA 5B2KA 2QO7A 4ALVA 4KWPA 1FBNA 4RSSA 1W0XC 1ZMUA 3LQ5A 3NIZA 2JEDA 4FT7A 2REIA 4D2VA 2VWIA 4FV9A 2JBOA 3UQFA 1PXLA 3HDNA 2E9VA 2FSMX 2OI4X 4FTUA 4XG6A 3GC8A 3T3UA 3ZSIA 4IW0A 5KMMA 1EH4A 3QF9A 4BTMA 4E4XA 2OZAB 3BV3A 3UZPA 3CR0A 5LVNA 3FLZA 2YFXA 5BVDA 5DGZA 3TZ9A 3SGCA 2C5YA 5E4HA 5AAEA 3OP5A 3UOHA 5M07A 3ZSGA 4CKRA 4IJPA 2QOIA 4JI9A 3FI4A 3LFBA 4MYGA 4NCTC 2XRUA 3VRYA 4FSYA 1HOWA 2R3NA 5HE2A 2Q0NA 2YDKA 3PJCA 3QYZA 2GS2A 3POZA 5EYCA 4EQMA 1K2PA 1KV1A 4FKWA 3EYGA 4M14A 1WVYA 3DDQA 5C01A 4GEOA 3POOA 3LCTA 1SM2A 3Q4TA 4DEIA 2R7BA 3P08A 5FLFA 1TQMA 2HZ4A 3M42A 3CEKA 1M52A 1QL6A 5DWRA 3AQVA 4JAIA 4DLIA 3FZOA 4BTFA 3RPVA 3ET7A 3NUXA 3R71A 3RMFA 3PXKA 1OIYA 1KE6A 3C4WA 3BPRA 5CNOA 3MIYA 1ZYCA 4QTAA 3BYSA 2F9GA 3F7WA 5AUTA 4O2ZA 2CGUA 4WUAA 2BCJA 2XKDA 5CYIA 5J95A 2VTQA 2B4SB 2RG5A 4TY1A 4PDSA 4YC8A 3U6HA 4PMMA 4O0SA 4YTCA 2QOFA 2BAJA 3MA3A 3DAKA 3IOPA 3C4CA 4I93A 4XRLA 3WF6A 4BN1A 3TTJA 5D7VA 3R22A 1CDKA 1PXJA 3PA3A 4O7YA 4I0RA 5KMIA 5HU9A 1NY3A 4N0SA 3QKMA 2WMWA 2E2BA 3FE3A 4ZJJA 2F57A 3E93A 3L8SA 4E5AX 5GNKA 1S9IA 2R64A 1NVQA 3FY2A 3L8PA 4FUYA 2CCHA 2UZDA 2YM3A 4QTEA 1XH6A 4FG8A 3NRMA 3A60A 4JDKA 1PXMA 1AGWA 5AV0A 1Q97A 4M66A 4NW5A 5HTBA 3FLQA 3D7TB 4RT7A 4NZWB 3N9XA 4TW9A 2WO6A 3BU3A 4TYHA 3R73A 3KRRA 4FSZA 4JX3A 3IW7A 5L2TA 3U9NA 1YI6A 3P79A 3RCDA 3RP9A 2E9UA 4TNDA 3ZTXA 4D28A 5AA9A 4DT8A 3H4JA 3D2IA 2B9FA 4WNPA 3A61A 2FSOX 4Q5EA 4BIDA 4I6BA 2C6LA 3PYYA 4AA5A 2GNLA 3P0MA 3ALOA 5EYDA 3DV3A 3ZUTA 1YDTE 2RFEA 4HGTA 3R1QA 2UZEA 2BAQA 3GUBA 4ZTQA 3ZZWA 4QNYA 4RJ8A 4YZ9A 4MKCA 5CSPA 3QX2A 2QOCA 2E9NA 3ACKA 2WMRA 4XG9A 4AA4A 1WBSA 3AG9A 4HVGA 1QPDA 4KBCA 4YJSA 4ALWA 4YJOA 2P55A 4IX6A 3LAUA 3VHKA 3WYYA 4BDEA 1R39A 5G6VA 4D58A 2IN6A 2W05A 5FBOA 2WKMA 3PP1A 4UXQA 3ORNA 1Y91A 4PDYA 1PY5A 5TT7A 1PHKA 3BU5A 4YLKA 4R3RA 3S3IA 3CSVA 4MD9E 5FM2A 4ZTMA 4FF8A 3VUTA 3N4VA 3QUDA 2KULA 3RM6A 4MXZA 1OPJA 4LGHA 4MWIA 5AM7A 3PVGA 5AP5A 4XG3A 3BWFA 4DH7A 4CT1A 4J98A 3JR1A 2YLEA 1BL7A 3PIYA 3R7UA 5A4EA 5I9WA 2XYUA 3LOKA 4NUSA 2UW8A 1Q24A 2XKEA 3MIAA 2H34A 1WBTA 2Z7SA 5CXHA 1IR3A 1HCKA 4EK8A 2W9FB 4XS2A 4ZS0A 3NNXA 5CVFA 3TNHA 5IMXA 4QNAA 1W82A 2RFSA 4PTGA 5EYKA 5HG8A 1WCCA 3RNYA 3WOWA 4QTCA 4YLJA 3LFSA 2JIIA 5DEWA 1FVRA 4GCJA 2G9XA 2ZMDA 3NNVA 1RDQE 3CQUA 1AQ1A 3QRKA 3OFMA 4GFGA 4QMXA 4ZSEA 4ASZA 2O3PA 4BDIA 4F7SA 4YO4A 5LWNA 3G6HA 2QOLA 4HVHA 3BQCA 3LJ1A 1JKKA 4MHAA 1U5RA 1IRKA 4UMQA 2YWPA 4OTPA 3ZEWA 3II5A 4V0GB 4U6RA 3TJCA 4WG5A 3W18A 4BDFA 1UNLA 4O82A 1DAWA 1JPAA 4A4XA 5LVOA 5BVKA 4QMSA 5F4NA 4DEDA 2CKOA 4H05A 4W4YA 4A7CA 1A48A 3MVMA 5IISA 1YI3A 3HECA 4O22A 4I0SA 4DCEA 2WELA 1ZOEA 4FEXA 3AC2A 2CCIA 3WARA 1IA9A 4FYOA 4F6SA 1YDRE 3SXFA 4H3QA 4ID7A 5CAOA 4ZLZA 3VNTA 3A7GA 4N70A 5IA4A 1KOAA 3BGZA 4WD5A 3BIZA 5JRSA 5I9ZA 4F7JA 2VX1A 4AT3A 3OCGA 3VAPA 2AC3A 3EMGA 4B9DA 5CEPA 3PXRA 4NW6A 3EQHA 2XK7A 1PMVA 3QUEA 4U5JA 3ZO4A 4IADA 3TWJA 4MXXA 4PP9A 5CVHA 3GXLA 5DN3A 3L8VA 3SVVA 2C6IA 2UZBA 4BYJA 1ZY5A 3DB8A 4I6FA 4I5PA 3G2FA 3HMIA 5C26A 3OT8A 3A7HA 5M53A 5AMNA 4EUUA 3E5AA 1XBBA 3QU0A 2PVLA 4QQTA 2R2PA 4KS8A 3R1YA 1V0OA 4L44A 4CT2A 4IVAA 1P4OA 2IPXA 3DDPA 4F99A 4AAAA 4NH1A 2OKRA 3FMMA 2OH4A 4MF1A 2BRGA 3DBQA 4NEUA 2OF4A 2PHKA 3EL7A 1R0EA 3F5GA 2ITQA 4RWKA 4GIIA 3RAWA 2ZV7A 4GW8A 4KUJA 4F0GA 4AGWA 5E8YA 2J0JA 4L8MA 4OT5A 3LFFA 3ZBFA 2R3IA 4GIHA 4K33A 3HMNA 2OU7A 2A1AB 3S2PA 2DYLA 2PZ5A 1GZOA 2XNMA 5CXZA 2OJIA 3IW8A 4L00A 3NIEA 4DGLC 3K5VA 3TTIA 2Y9QA 3ZU7A 1IG1A 2Y6MA 3VS3A 4C4IA 3TNWA 4E8AA 3OEZA 5B7VA 2PUNA 4NL0A 2X8DA 3U6IA 4AUAA 4F9YA 2ITWA 2Y4IC 5GZ8A 1T46A 4YR8A 4GUBA 4TNBA 5M4FA 3LLTA 3PSCA 3NAYA 4ZOGA 4ORKA 2R3LA 2GQSA 3TM0A 3ZMMA 3EZRA 4OW8A 5IKWA 5FEDA 1H0VA 2W5HA 2UVXA 2WMUA 3E8CA 2BAKA 4MVFA 4V05A 3VQUA 5CF6A 2Z7RA 3QA0A 2XIZA 3NVKI 5E90A 4EOKA 3D7TA 2J0MB 4FTMA 3ULZA 1J91A 4EL9A 4CLIA 3IS5A 3Q2MA 4FKUA 4FV1A 4TZRA 2OLCA 5EW9A 2UVYA 4EHZA 3VBVA 3S95A 4EOIA 3L8XA 2VRXA 3P86A 1UU9A 4RX9A 3HUCA 3WIKA 2Y6OA 1SMHA 4J96A 4OTGA 2QR7A 4RIOA 1Q5KA 1G8SA 3OZ6A 3DNDA 4IZ5A 5IQEA 4XLIA 5L2QA 4YPDA 4RFYA 5D9HA 4EEVA 1KOBA 5DNRA 5DVRA 2VU3A 3ZLSA 4JBVA 4U7ZA 3UBDA 3VUGA 5CI7A 4ANBA 2BZIB 3PUPA 4CMUA 3Q2JA 3ERKA 3TV6A 5AAGA 4BVUA 3DA6A 5H8BA 3HP5A 3DJ7A 3EQFA 3PXYA 3P78A 3W16A 3DBDA 4AF3A 5EHYA 5IEYA 1LEZA 1F0QA 5FG8A 4JAJA 2PVJA 3VBTA 4AT5A 2BKKA 3COKA 4NTSA 2W17A 2XIYA 1XKKA 1F5QA 3O8PA 3OCSA 2CKEA 2C3IB 4R8QA 4FT3A 5EW8A 4E6CA 4O84A 3UOKA 3TZ8A 5BYLA 4IC7A 3ODZX 3IGGA 5HKMA 4KAOA 3W32A 4XV3A 1PMNA 4L3PA 2VUWA 3BYVA 3E7OA 4PF4A 2W99B 2J90A 4ZTHA 5J1WA 3QC9A 3EN4A 1TQPA 3VUKA 1GOLA 4EC8A 2X2MA 5HQ0A 4IAIA 5KMLA 4FL2A 4V01A 1Y6BA 3HRFA 5ANEA 3RINA 1Q41A 4LRMA 2JAVA 3CPBA 2XCHA 3U9CA 2C69A 3KC3A 2WMXA 3FBVA 5HESA 1Y8YA 3Q9YA 3ETAA 4ANNA 5EQEA 4IHPA 5CU2A 4QP1A 3B2WA 3LCKA 4R5SA 4U9AA 4XBRA 1G5SA 4J52A 4YZMA 4I5MA 5DBXA 5E8WA 4CZTA 4QP9A 1VYWA 3L9LA 2YM6A 3FZTA 1APME 1Q99A 3IQ7A 4G3GA 4L42A 4FKQA 2ZM4A 1WBVA 3ZXTA 4EH2A 2YIQA 2R3RA 5LMAA 3L9NA 3R28A 4V0GA 5ETCA 2RKUA 4YPSA 5KKRC 3FYJX 1OBGA 1ZYDA 5T3QA 5LMKC 5M4CA 2B9HA 4OBOA 3EN6A 3TUBA 4JT3A 2B1PA 1H1WA 4LMUA 3O17A 3EH9A 4E4MA 5DR6A 1Z9XA 3F5PA 3UVQA 4MQ2A 2B55A 4MQ1A 5IUHA 1R3CA 2Z8CA 4TYEA 4YGAA 1TQIA 2WXVA 3R9DA 4IVCA 3LXPA 2YA9A 2GTMA 4GFMA 3WZDA 2B53A 2IW9A 4EC9A 2ETRA 4FTKA 4BKYA 5H8GA 3VBXA 2ZV9A 3VO3A 3UJGA 5HE0A 3AT3A 2Z02A 4ITIA 4OTRA 3UVPA 4MXOA 5HBEA 3RJCA 3REPA 1PXKA 4RWIA 4TT7A 3T9TA 2YZAA 3PLSA 3PXFA 5LCJA 3ZH8A 3LQ8A 4EK3A 3VBWA 3KVWA 3H0ZA 4MXAA 2YJRA 4NK9A 3ZS5A 3WE8A 4RVMA 2QONA 3FHIA 3KVXA 5DH3A 5I0BA 2VTJA 3QAME 3HGKA 4DA5A 3A99A 4GVJA 1P14A 2OXXA 3IW4A 4BIBA 3AXWA 4KIKA 5EHLA 5FP5A 3FKNA 5L6WL 3BYOA 5AUVA 3U4WA 1JKTA 4BCNA 5ANJA 4FTLA 4R3PA 5BUEA 3UIUA 3NZ0A 3BE2A 3F69A 4FVPA 2PWLA 4JIAA 4U43A 1SYKA 1FGKA 3AD6A 3ZEPA 3TIZA 4FKJA 1BMKA 3TUCA 2Z60A 4WSQA 2GCDA 1CSNA 5AP2A 2BZJA 1O6KA 4DTBA 4U3ZA 4EQCA 1ZRZA 4LRKA 1JBPE 2XCKA 5AV3A 5TR6A 2VWUA 4HCTA 5BYZA 1KUTA 3ORPA 4FZ6A 3COHA 4GG7A 4GT3A 4JBOA 4UWBA 5JFVA 1H27A 3ATSA 5HE3A 4IX5A 3OMVA 3NX8A 1Q3WA 3MWUA 1OL7A 4TYGA 2XNGA 2ZYBA 3G51A 4XG8A 4F65A 4IFCA 3U55A 2X9FA 3NUAA 2NRUA 4RJ5A 1TVOA 3QLGA 3UDBA 5HU3A 2B7AA 4RJ6A 4W8EA 2EXMA 4FIEA 4LMNA 3UPXA 4U79A 3TKHA 5CU0A 5AUYA 4F63A 4L46A 1YWRA 4QYGA 5AUXA 4F1TA 5HTIA 2CN8A 2DWBA 2JIVA 4IFGA 3R1SA 1FPUA 1JWHA 3NWWA 5HTCA 2BZHB 2IWIA 4QP4A 3R1NA 2OIQA 5JKGA 3UP7A 2VGPA 3A2CA 3DQXA 3FL4A 4OTQA 1R78A 4L9IA 4BZNA 3LMHA 4N6ZA 4W4VA 2C6EA 5ACKA 2BKZA 4C3FA 3SKCA 3A8WA 4BICA 3KN5A 5K5XA 2J6MA 5CVGA 4HYSA 4QPSA 5FXQA 5FEQA 1JOWB 1YHWA 4I3ZA 5FDPA 5LJJA 5H3QA 1YW2A 4DFLA 4X3JA 4EH4A 3JUHA 3Q9ZA 1GZKA 3DXQA 1Y57A 1OI9A 3TDWA 2XA4A 3QX4A 4CTCA 2R3OA 2BR1A 4EKKA 2BDFA 2BRHA 2C0IA 5E92A 3SRVB 4O0VA 3GBZA 3MH0A 3OWJA 1PXNA 1PKGA 4IDTA 5IPJA 3SA0A 3ID6C 2YDIA 5EI8A 5FD2A 3H10A 4OBPA 4BY9E 3KRJA 4QMUA 2J7TA 2I0YA 4G3CA 4ZZMA 2W1CA 4GKIA 2PUUA 3F3ZA 1L8TA 1K3AA 3GOPA 1YXVA 5E8UA 3MSSA 4BCIA 3CGOA 3P7CA 4FZFB 5IH6A 3C50A 1QPEA 3PPZA 2I0VA 5ANOA 5BMSA 2ITTA 4XRJA 2F4JA 2WTKC 3HRCA 3F9NA 1Z57A 3OY1A 5M4IA 3SW4A 5EG3A 3G0EA 5IZFA 5K5NA 3UZRA 4JS8A 1IASA 4IWDA 4MH7A 1REJA 5AR8A 4G31A 4CRSA 3ORIA 1JKLA 1BLXA 4RIYB 4U44A 4XV9A 2ZV2A 2IJMA 2PK9A 3VS6A 5LXMA 4RIXB 3PG1A 3KRWA 2JKOA 3QTIA 4LUDA 3UQGA 4CFWA 5F9EA 3F2RA 5CENA 3SQQA 4ASXA 4AZSA 5TF9A 4YLLA 3LFNA 4ZXTA 4HVIA 2FGIA 2O2UA 2WTWA 4FG9A 3S0OA 2EU9A 3E62A 3E7VA 4IJ9A 3PJ2A 1BI7A 5TO8A 3ZC6A 3N4UA 2QD9A 3OW4A 4U40A 1ERKA 5I3RA 4QQ5A 4QMVA 1FMKA 4Y5HA 4FV6A 4EKLA 1W8CA 2YACA 1BI8A 5IEVA 1Q61A 3WI6A 5BVFA 2QNJA 4CMTA 5CF8A 4GUEA 4ZTLA 5GJFA 3KCFA 3G15A 4M7IA 3HNGA 5B2MA 3DFCB 2YAAA 4FA2A 5HLNA 1VEBA 4C4JA 5DYJA 3PWDA 3FPQA 4ZS4A 5KHXA 4QP2A 4IMYA 4XV2A 3S00A 2DUVA 5HIEA 4IM0A 4F0IA 4NT4A 2PZRA 1FQ1B 3F2AA 4FI1A 3FLYA 3QC4A 4V04A 4YTHA 5TKDA 4DG3E 4E20A 3MVJA 5LMBA 1NT2A 3THBA 2WMVA 2VWYA 1H25A 3R63A 3I6WA 4A07A 3TN8A 2EVAA 2VTTA 2GNIA 1CMKE 4Z55A 3DKOA 4MNEA 3DT1A 4A9SA 4C62A 3LJ2A 2GPHA 2HZ0A 2G01A 4IM3A 4TPTA 4FVQA 2PY3A 3ODYX 3R8PA 3RAIA 4USFA 4BKJA 2W1ZA 2J5EA 4FOCA 5JQ5A 4AWIA 4UMTA 4YMJA 3CQEA 2WTIA 3FLWA 2QOBA 3I1AA 3OOMA 3QZGA 3QTZA 4FTIA 4I20A 1B38A 3KMWA 4YZBA 4YC3A 4FSRA 5M08A 3JY9A 4GH2A 3V8TA 3K3IA 5J5SA 4NKSA 3AGLA 3CJFA 4QQJA 3U51A 1LR4A 4D9UA 3JY0A 2W4JA 4YC6A 3T9IA 5KX8A 3EQDA 3FMKA 5DRDA 3D83A 3OVVA 2QLUA 4YP8A 2YZLA 2JDSA 3NYNA 2VTOA 2PMOX 3UC3A 4FTQA 4Y95A 2BUJA 2O0UA 3AC1A 3I81A 5CQUA 4BC6A 3MDYA 4JBPA 4MBJA 3F3TA 4YBKA 3KQ7A 4LRJA 4F1OA 5FEEA 1FVVA 2NP8A 1Q8UA 3VUDA 3I79A 3OCBA 3EQPA 3UMWA 2VX3A 5L3AA 4ACCA 2W1DA 4UEUA 5CLPA 4EONA 3K54A 1P2AA 3ZO3A 2RF9A 3ZXZA 2C6TA 4FGRA 4LFIA 1IAJA 1ZMVA 5C8NA 1ZMWA 2VTPA 3R2BA 4RQKA 3C0IA 5KUPA 3UZTA 3PPJA 5CI6A 3DQWA 3TCPA 4ZJIA 4FNYA 4ITHA 3VS5A 4IAAA 2F49A 1UU7A 4GT5A 4O6LA 5AWMA 4EOMA 5HEZA 5ANDA 1YHVA 4FYNA 5LARA 1UKIA 4K11A 3TV4A 2RFNA 5HHWA 4BBMA 4IZ7A 5J9YA 2XK6A 4AFJA 1PMEA 4ZMEA 4PL4A 3C5IA 1URWA 4NM3A 5ITAA 2GHMA 4GFOA 4R3CA 1UU8A 3UODA 2X81A 3GT8A 3BGPA 3HKOA 1FOTA 2BRMA 3TNIA 4M3QA 5EKNA 4K1BA 2IZSA 4BWKA 1VYZA 4F6WA 4DHFA 2UZLA 2GNGA 3OC1A 4FNXA 2GNJA 3KRXA 4L6QA 3VS4A 2IVVA 2VN9A 3BI6A 2XS0A 4XMOA 5JGDA 1U46A 3W2PA 4DH5A 4FSUA 3E8NA 3FQHA 3Q9WA 1YOMA 1WBNA 4BDKA 4O7LA 2QO9A 2PVFA 4X3FB 1ND4A 4TKSA 2CGWA 4M69B 4KS7A 2WMBA 5DEYA 3C5UA 4OT6A 2XK3A 4I21A 3L1SA 2ZV8A 3DXNA 4HYIA 4UYAA 4XG2A 4PP7A 5A4TA 5JEBA 3FQEA 4QYHA 1JSTA 4LL5A 3W2OA 3QCYA 3W55A 5A4LA 5LWMA 2W4KA 4FG7A 1BYGA 3FXWA 4FIJA 2YCQA 4H58A 4GKHA 4NWMA 3SRVA 3QGWA 4WNKA 5IQBA 5IQCA 4BCJA 4BI0A 2I7QA 1ZOGA 3FZPA 5C4LA 2QOOA 4M68A 4OAVB 1REKA 4YJUA 2W1EA 2YEXA 2UZTA 4GRBA 2BDWA 4LL0A 5IQDA 4APCA 2C47A 4ZAUA 3VUHA 3DY7A 4OBQA 4IDVA 4ZSAA 4DGGA 3NUSA 4LGGA 4CVAA 3WF5A 4GT4A 4DGMA 4JOAA 5L2SA 4HCUA 5EI2A 2VWBA 1DM2A 4FT5A 4CV8A 3ORMA 3QXOA 5CT7A 4MBIA 3KA0A 3OBGA 5B0XA 4X2KA 4QP6A 3RVGA 2JDOA 2WAJA 4O2PA 3RTPA 3FMLA 4AXAA 4DEHA 4I22A 3DGKA 4O7NA 4RFZA 5D7AA 3V6RA 4AACA 2CJMA 3M2WA 3HV6A 4RIYA 1VR2A 2WFYA 5CQWA 3QQJA 5AP7A 1UA2A 2XIRA 3R7YA 4HPTE 5M55A 4EBWA 4Q5HA 1YRPA 3MY5A 2C5XA 2IW6A 1OB3A 2PSQA 5K4IA 3GI3A 4FICA 3ZLWA 4C33A 4BL1A 1H1PA 3VS7A 2YJSA 3BLQA 4PTCA 2WU7A 2EUFB 3NVMB 1YXSA 1H1RA 5IDPA 2YABA 3PSBA 4X6RA 3PP0A 1PXOA 3VJNA 4IAFA 2QHNA 1X8BA 3BHVA 4C02A 5HI2A 2OFVA 3NMUF 4G2FA 3QFVA 3KREA 1NW1A 4BGHA 2ACXA 4HYHA 1M14A 3DK3A 4PL5A 2HWOA 3QTXA 4FKTA 3DKGA 2JKKA 5I4NA 1QPJA 3HA8A 4NSTA 4RX8A 4EI4A 3MFRA 3KXZA 3ANQA 2SRCA 2XK8A 3FKOA 3IECA 3OY3A 4KIQA 4U45A 3S4QA 4PMPA 4U80A 2OSCA 5HVJA 2GU8A 2C6MA 5HE1A 2JDRA 3OUKA 4D1SA 4BYIA 4KSPA 4RWJA 3PDTA 1PXPA 5HNBA 5CU3A 5A4CA 4NJDA 4ZTSA 2H96A 1WMKA 2RL5A 3AD5A 4AN2A 4FV2A 1LP4A 5IQAA 1LEWA 4ENYA 3GNIB 3H9OA 3PZEA 4FT9A 4J8MA 4R1YA 4CD0A 4M8TA 3DLZA 5DOSA 3PJ3A 4AFEA 3KF7A 1H4LA 4PL3A 4WRSA 4FIFA 2PZIA 4C36A 3FQSA 4C4FA 4CNHA 4E93A 1UWHA 4NYEA 3AOXA 3RK5A 4XJ0A 3ROCA 3RK9A 4S30A 2Z7QA 3C4FA 2VTNA 2XBJA 4EOPA 1OM1A 5M06A 2B9IA 3QHWA 2VO6A 4NM5A 4Y5QA 3CXWA 3A4PA 4YSJA 3UOLA 3FMNA 2XJ2A 4RMZA 2PVMA 3QD0A 4P7EA 3D5VA 4L7FA 5BMMA 5FDXA 4BCPA 3QZFA 2FO0A 5JFXA 3ZFYA 3NDMA 2RFDA 4UY9A 4YZDA 4B4LA 3F88A 2JLDA 4IB3A 1UV5A 2FSLX 4JVGA 3CLYA 2W7XA 4KIOA 2B54A 2PE2A 5AAFA 4RX7A 4XEYA 5BNJA 4FNZA 2HZNA 3ATTA 4MF0A 3SAYA 3VW8A 3WF8A 2YCSA 5LVPA 2BRNA 2WEVA 3V5TA 4BFMA 1OKYA 2VTRA 5JT2A 4IACA 3ZO1A 1I09A 3V3VA 2QOKA 1U54B 5AEPA 4C4GA 4GU6A 4FVRA 5DT4A 4CFFA 3GCQA 4XV1A 4WBBB 3R7GA 4RC2A 3ZSHA 1JLUE 3PG3A 1J1BA 4XG4A 4DITA 4H3BA 4DH3A 4E5BA 2WQEA 2YLFA 2X1NA 4BI2A 1JKSA 4RJ4A 4RPVA 1KE8A 2HK5A 2G15A 3K2LA 3QZHA 3CC6A 2YDJA 4O7VA 1MUOA 4Q2AA 3OF0A 2HELA 4I4FA 5H2UA 2ONLA 3PA4A 2A19B 3E87A 3QQFA 4YJTA 4FC0A 4IB5A 1J1CA 2AUHA 3NW7A 3R01A 4X6QC 4HGSA 5AV1A 4GYIA 3PWYA 4G16A 3QTUA 2BROA 3P9JA 4MXYA 4JDJA 5CS6A 5GHVA 5HG9A 5IA3A 2Y4IB 5J1VA 1DAYA 2NO3A 4CCBA 3OHTA 4G17A 1OITA 3FJQE 3HUBA 5ANGA 3SXRA 4F9WA 4ERWA 5ANIA 2ZB1A 4I94A 3MVHA 1PW2A 3Q4ZA 5HOAA 4YTIA 4GS6A 3JVSA 3PVWA 2WMQA 4UB7A 4GV1A 2GSFA 2GFSA 4D4RA 2OZAA 2XYNA 4KA3A 4X3FA 3KK9A 2G2HA 4M69A 4YHJA 4C7TA 3ZRLA 4D0XA 1H26A 4KBKA 4QMTA 4LV8A 4C58A 4F4PA 2QODA 4GG5A 3SOCA 4EH6A 2WGJA 3MH2A 4ANSA 2Q0BA 1MRVA 4K2RA 4A4LA 4USDA 2V7AA 4CXAA 3FLNC 4IWQA 1OIUA 2V22A 5C03A 3AMAA 3O96A 3JYAA 2WMTA 4LOQA 3IGOA 3RAKA 3CP9A 1JSVA 4ANOA 1VJYA 4OAUC 1OL2A 2YM4A 3F5UA 2W06A 4FOBA 1OGUA 3MY1A 4AN3A 4DEEA 4B8MA 1YXUA 4YZCA 5CZHA 1TKIA 1ZYLA 4I92A 1RE8A 4BBEA 3R8VA 4AZFA 3E63A 3MH1A 3QRIA 3F3UA 1JVPP 3OG7A 1W98A 4Y83A 5HCYA 3W2RA 4LYNA 2VWZA 1ZY4A 5FTGA 1J3HA 3EWHA 4QMNA 3KXGA 4ZTNA 2VX0A 3RWPA 4ACGA 3TI1A 2HIWA 3OWPA 4HVSA 2HXQA 2WHBA 5CSVA 4KKGA 3DOGA 4FTJA 5DI1A 4QMPA 5AP4A 5KMNA 3MYGA 3LFCA 4P2KA 3R02A 4GU9A 3CKXA 3V5WA 4FKVA 2W1HA 3VN9A 5C4KA 1H24A 3ORZA 4D2RA 3FI8A 1ZAOA 4FTCA 4XBUA 3QBNA 3DKFA 4AZEA 4CZUA 4XH6A 3ENHA 2ITYA 3IPHA 2WTDA 5KZIA 5CEIA 3D15A 5EH0A 2VTIA 1M2QA 3FLSA 3TKUA 3ZC5A 4CYIA 4YBJA 1A06A 3PA5A 2GHLA 5CTPA 4AN9A 4RLLA 3ZRKA 3PRIA 4QP7A 4OTIA 3R83A 4FNWA 2OO8X 3MESA 2X4ZA 4O38A 4O0YA 3IDCA 4W9WA 4R7IA 5I9UA 4BDBA 3LQ3A 3EKKA 4NFMA 4MEDA 1G8AA 3KCKA 5EHOA 2IW8A 4DC2A 3Q9XA 1RJBA 3UP2A 1O6YA 5JSMA 4KD1A 4UMPA 5HG7A 4MXCA 3ZM9A 3DKCA 4I1ZA 3ZCLA 4O21A 3G0FA 4QQCA 3QD4A 2JC6A 3C0HA 4FK3A 5E8TA 5G1XA 3V01A 2CN5A 5KKRB 3E92A 3KXHA 5B2LA 3F3WA 4BDGA 5CASA 5DT0A 3C51A 4OUCA 4JQ8A 3T3VA 3HRBA 5BPYA 4BDJA 1WVWA 3UG2A 2IZUA 3UPZA 3QQLA 3CCNA 3F66A 3VULA 1Y8GA 4DLJA 4ZP5A 3LE6A 2PPQA 3IG7A 5BVOA 3BCEA 3GCUA 2R0UA 4HW7A 2QHMA 5IMEA 4M84A 4JBQA 2VWXA 3PE1A 2BILB 3FMEA 2C5VA 3AC4A 4IAYA 3BHHA 5LOHA 2IVTA 4YNEA 3DK7A 3FPMA 5T68A 5F94A 1OKVA 2PMNX 3NCZA 4NM0A 4BTJA 4CG8A 3FDNA 5JFSA 3R21A 3IDBA 4ONAA 5AADA 5HBJA 4DFZE 4FODA 4Y73A 1XH8A 3HAVA 5JFWA 3LZBA 5E8VA 5I5ZA 1W83A 4FSTA 3L9MA 5HZNA 5JQ8A 3ZUVA 1XBCA 2DS1A 3PRFA 4P5QA 5AR5A 5EOBA 2W1FA 3LFAA 4QYYA 4S31A 5EM5A 2X7FA 2Y8OA 4EZ3A 1GIIA 1H08A 3NGAA 2OXYA 4F9AA 2C0TA 4X21A 1WBWA 3ZYAA 4JR3A 5FP6A 3IOKA 5K0KA 2C3KA 4P90A 2WTCA 3W8QA 2JGZA 1H1SA 3C1XA 4U8ZA 5IA1A 2Y4PA 4IC8A 1U54A 4AW1A 2WQNA 3NEWA 5ETFA 3Q3BA 2YIWA 4AP7A 2YM5A 1XJDA 2RSVA 1J7UA 1SNUA 3PLAE 4R5YA 4FEVA 4I5CA 3D4QA 2QLQA 5K3YA 3RZFA 4RRVA 4FV7A 4DG2E 4F9BA 3WZJA 2EB3A 3MB7A 3ZFXA 3DPKA 5D10A 4UBAA 1UNHA 4E3CA 2F2CB 4IH8A 3ZBXA 4RA4A 4L52A 1Q8TA 4FKGA 4JLCA 5FXSA 1OKWA 4DCAA 2BVAA 4E7WA 3V8SA 5A46A 4G3EA 5JZNA 3MTLA 5AX9A 4BDHA 5HNGA 1YDSE 3H9RA 2G2IA 3IKAA 5EK7A 2WTVA 4XCUA 3GQIA 4JG7A 4KKEA 3WIGA 3FSFA 3BEGA 1OUKA 3VRZA 4WG3A 4BF2A 4FEQA 3FMHA 3EN9A 4MWHA 4FBXA 4K0YA 4WRGA 2B9JA 4O0TA 2P3GX 4OTDA 3FZRA 4QPAA 3Q4UA 2W5BA 5CU4A 5JRQA 2HY0A 3C7QA 2R3KA 1YOLA 3RK7A 5T6KA 3W8LA 4CFNA 1Q8WA 2ZVAA 1PKDA 1IAHA 3G9NA 3OEFX 4QMWA 2ESMA 4I41A 5EKOA 5GZAA 4Y85A 4EYMA 3Q96A 1M7QA 4CSVA 5IH5A 4S33A 3C4EA 3HV3A 4HPUE 4IVBA 2GMXA 4FKRA 3QCSA 1YOJA 4D9TA 4J53A 3RPOA 5L2WA 3R9RA 4F6UA 2FUMA 4O6EA 4EHVA 4MK0A 3R04A 2R5TA 3UE4A 3HL7A 5A14A 2QU6A 4CGAA 2ZM3A 1ATPE 4O83A 3O50A 3V5JA 1XH5A 3VF8A 4C8BA 3C4ZA 4F0FA 3K3JA 4EZ7A 2HW6A 3U54A 4RX5A 2QG5A 2R3QA 2WB8A 3GCVA 3GU6A 2IZTA 4H1MA 3NYOA 2X6EA 5M51A 5FGKA 1PMUA 2IO6A 1WFCA 4QD6A 5KE0A 4RJ7A 3TNPC 3I4BA 3G9LX 5EOLA 5EM6A 4U42A 2J0KA 4WBOA 3VJOA 3ZLXA 5AR3A 3TXOA 2J0LA 2PVYA 4WG4A 4B6LA 3D5UA 2XB7A 5AV4A 5I9XA 2YIYA 2CMWA 2VZ6A 2GS6A 4K18A 2WTKB 3M11A 2HOGA 1ZWSA 2ITUA 3S1HA 3C13A 5IUGA 2XH5A 2OZOA 3GC7A 3RKBA 4LV5A 3ZDIA 4O96A 1JQHA 2YIXA 4CFVA 1DS5A 1CKIA 3AC3A 3GOKA 3JPVA 3R7EA 4AU8A 4Z7HA 4RIWB 3HEGA 4DG0E 1GJOA 4QMLA 4CMOA 4CCUA 4TXCA 4XLVA 3BU6A 4N57A 2LGCA 3A8XA 1CKPA 1L3RE 4XG7A 2PZPA 3MB6A 3TJDA 4DYMA 4BBFA 2OICA 3FZ1A 3R9NA 4YJRA 1WAKA 4EJNA 4F70A 1E9HA 4LQMA 3F6XA 5FWKK 5HLPA 1SZMA 3CTHA 5IH4A 3NW6A 4ENXA 3NW5A 3FL5A 2FA2A 1ZYSA 3OOGA 3FWQA 4H1JA 3O7LD 3EFLA 3QRUA 4J95A 4CFMA 4UMRA 4A4OA 1KV2A 4IX3A 3ZFMA 5E8SA 3D5XA 4AS0A 1MRUA 1UKHA 4JQEA 3OS3A 4FMQA 3JXWA 3Q6WA 4BHNA 4EWQA 4O7SA 4IWPA 1OKZA 4W9XA 5CAPA 4D2SA 3BX5A 4WKQA 1M2PA 5EDQA 4BI1A 3ACJA 1Q3DA 3VVHA 4C2VA 3D94A 4E73A 3BZ3A 2VO7A 3KF4A 4YTFA 3EL8A 2PVNA 4LGDA 3A7JA 3TG1A 3EKNA 4KNBA 5AA8A 3GENA 3PY3A 3W33A 3PIXA 4FEWA 3LCSA 5FXRA 1I44A 2VGOA 3H3CA 4USEA 5JMSA 3MN3A 2OJJA 3TNQB 3R8MA 1XR1A 2Z2WA 3QD2B 4GK3A 3R30A 2XMYA 4ZMFA 5A6NA 4C0TA 2PYWA 1E1VA 1H0WA 3F5XA 1ZZLA 3HP2A 4ARKA 3ORKA 2J2IB 2QQ7A 2HZIA 1YI4A 1DI9A 4JX7A 3GU7A 2UV2A 2JDTA 3RNIA 3ORLA 4H39A 3RZBA 5CEQA 1HCLA 3F7ZA 3GC9A 5EYMA 2ITXA 4EH5A 3D14A 3Q52A 2G1TA 4HYUA 3SV0A 3QKKA 3PY1A 4YUQA 1O6LA 3AMBA 4O91A 2ZDUA 4RGJA 1ZXEA 3IDPA 4CYJA 4A9TA 3I7CA 3H30A 4C37A 3DFAA 3FSKA 5H8EA 2VTAA 2ZJWA 3R7OA 2GNFA 1J7LA 4MD7E 2GDOA 4XYFA 2C5OA 5JK3A 3G33A 3VIDA 4RVLA 4L68A 4HGLA 1OL5A 4DEBA 4QP8A 3IW5A 3QA8A 4JG6A 2NNWB 4FV0A 2DQ7X 2I6LA 4D2PA 3OBJA 3ELJA 3FMDA 2A0CX 3BRBA 3I0OA 5HO6A 5AP1A 1Q62A 3RBWA 4CLJA 2OK1A 3EHAA 4KSQA 4PX6A 3OXTA 4G9RA 3KK8A 5DR9A 3Q32A 1H00A 3R9OA 4CKJA 1QMZA 2VV9A 3QRJA 2GS7A 3BELA 5K4JA 3UC4A 2ETMA 3TKIA 4FKIA 5C8MA 3SX9A 2GQRA 3LKMA 1H28A 2F7ZE 2OFUA 4P4CA 3BKBA 3EQRA 2GQGA 4EOLA 4PPAA 3MH3A 4PWNA 1SVEA 2PTKA 2WOUA 2XNPA 3GU5A 4HZSA 4X2GA 4CKIA 1RQQA 5E9EA 2HCKA 1SVGA 3OW3A 4GYGA 4PQNA 4ASEA 4E6DA 3EQGA 3V8WA 3E3PA 1WVXA 5BUJA 1LUFA 4D55A 2I0HA 3NR9A 4FTNA 4O1OA 4L3LA 3NUYA 4QMYA 5CZIA 3I0QA 3BYMA 4WA9A 4BB4A 4YURA 2F7XE 5J9LA 2ERZE 4I4EA 1FINA 3WZEA 3WZKA 3ZZEA 4Z3VA 3RPYA 1BUHA 3PVUA 3QWKA 4XP3A 4DGOA 2ERKA 3AGMA 3VHEA 4OGRA 3G5DA 3R8LA 4EK4A 3PXZA 3V6SA 3CQWA 2XNEA 3CPCA 2W1GA 3FC1X 4K8AA 1XH7A 3TDVA 5M09A 3VS1A 2OXDA 3BE9A 1CTPE 4AW2A 5AR2A 3EB0A 3VS2A 4EH3A 3UO6A 4ANMA 1SVHA 2VTHA 2X0GA 3UYSA 2C30A 5CAVA 5CX9A 4A06A 2BFXA 5E8ZA 5ICPA 4O7ZA 5GIPE 4F1MA 3LIJA 4C2WA 4DFYA 1OUYA 3W2QA 1H01A 5I9VA 4C38A 3VBYA 3V5PA 1ZARA 2WPAA 3MVLA 1STCE 3KKVA 1OL1A 3DZOA 4PDPA 4UYNA 3LVPA 4WNOA 5D1JA 3EQCA 3AD4A 5AV2A 5L2IA 4H3PA 2XBAA 4MBLA 4BDCA 2WMAA 3VC4A 2WD1A 3W1FA 4ANLA 3LPBA 4FSNA 2XIXA 3TZ7A 4FZ7A 4M13A 2WEIA 4E4NA 1UWJA 1W84A 3UNZA 2UW9A 3A62A 5L6PA 3QCXA 4EORA 3NAXA 2OIBA 3DS6A 4UWYA 4C4HA 2J0IA 2O64A 4DAWA 2CDZA 3KULB 2UVZA 2V0DA 1S9JA 2NRYA 5BVWA 3N51A 2UW6A 3QQHA 5FTQA 5IQHA 4IZAA 2R3JA 4OTWA 4TWNA 5LVLA 2FYSA 2B0QA 2XK4A 1NXKA 4Z7GA 3NYVA 4CG9A 4FIGA 3R9HA 5HCZA 4J8NA 3ORXA 4XP0A 5EM7A 4LI5A 5EDPA 5FQDC 3HLLA 1F3MC 4AZTA 4ZSJA 4E4LA 3PJ8A 3MFUA 4D4SA 3V51A 3SG9A 3Q5IA 4BZOA 3BLHA 4M67A 5ANKA 4KRDA 2JKQA 4TWPA 3VQHA 4YU2A 3CTJA 3F3VA 1IA8A 4BRXA 2CSNA 1FVTA 5HO7A 1OIRA 4G6OA 4D0WA 3UO4A 4YZNA 2CKPA 2EXCX 2A4LA 4AW5A 2CNUA 5AUZA 5KO1A 2X39A 4C3RA 3DCVA 3ZOSA 1KE5A 3G6GA 3ZO2A 5CNNA 3V5LA 4FSQA 3HZTA 1MRYA 2WQBA 3R2YA 4AOIA 3LMGA 2PVKA 2V55A 3KEXA 4KKHA 4LOOA 4UMUA 2X9EA 5BX0A 5CAUA 2RG6A 4FIHA 3LFEA 3DZQA 1K9AA 1YWVA 2R0IA 4N4SA 4UX9A 3OTVA 3PIZA 4M15A 2HWPA 2Y7JA 4DH1A 4RIXA 4JNWA 4PUZA 2VNYA 4O1PA 5M56A 3ENMA 4M12A 2CNVA 3FV8A 4BCFA 4PDOA 4ZY4A 4E26A 2ONLC 4BDDA 3G90X 5F1ZA 4CFUA 1UU3A 2WQMA 4PMSA 1Q8YA 5KZ0A 5CF5A 2J4ZA 4IX4A 4X0MA 4IXPA 3QHRA 5EM8A 5HGIA 4ZY6A 1PXIA 4YJPA 4AGUA 3CY3A 5JGBA 2R3PA 4XOYA 5DPVA 4D2TA 3L9PA 2PZYA 2VD5A 3FAAA 4FTAA 2BPMA 4PPCA 3EYHA 2QC6A 4BZDA 2JIUA 4DN5A 1R1WA 5CU6A 4F9CA 2Z7LA 3DAEA 3FI2A 3OWKA 4ACDA 4AGCA 4BIEA 4YSMA 5AUUA 4UZDA 3FXXA 5L8LA 4X3FC 3QTRA 3FEGA 4J97A 3ORTA 2X2KA 3R8UA 4CRLA 2J51A 2YCFA 5CAQA 3PZHA 5CSHA 4RA5A 1OIQA 5I9YA 4JXFA 2R3HA 2CGXA 3EFJA 4PTEA 4JQ7A 4KRCA 4BHZA 2V7OA 4L53A 4DEAA 4F7NA 3QCQA 5AX3A 3DBEA 3QALE 4L01A 5HX8A 4AA0A 4KABA 2PU8A 4DBNA 4GK2A 3NNUA 3I5ZA 4NFNA 3KMMA 1XH4A 3DAJA 5C8KA 3LMIA 4FV8A 3HYHA 2E9OA 3R7IA 3OXZA 3SD0A 3DU8A 3CIKA 3KL8A 3O8TA 3ZRMA 5KBQA 3LHJA 4YJQA 2YWVA 3DXPA 1XWSA 3I7BA 3NLBA 3D9VA 2C3LA 3LLAA 3KY2A 4G5JA 4EH9A 3GC0A 4GJ3A 2OJ9A 3MPAA 2VTMA 4AZVA 2OG8A 1BL6A 4EJ7A 3LXNA 4KINA 3CY2A 3P4KA 2ZMCA 5HO8A 1BKXA 3UYTA 3D5WA 4D1XA 1PRYA 2YIRA 2YERA 3BWJA 3TACA 4EUTA 3O71A 1Z5MA 4IANA 3SDJA 4FK6A 5KMOA 1R0PA 2HY81 4S2ZA 2UW3A 3V5QA 4QMQA 1QCFA 3MY0A 2OGVA 4JRVA 3N4TA 4IB0A 4BDAA 4D4YA 4NCTA 5DHJA 3PFQA 5J87A 4Z16A 1B39A 3QYWA 2XP2A 2YISA 5L8KA 3W2SA 4FKLA 3M1SA 5DMZA 3SC1A 5CEOA 1WBPA 4RQVA 2R9SA 2G2FA 4IZYA 1T45A 3K5UA 2P4IA 5EI6A 4O7WA 5DIAA 4C4EA 5AP3A 3U6JA 3AMYA 5E7RA 4CFXA 3QQUA 4CV9A 2HAKA 3PSDA 1JSUA 3OWLA 4G3DA 3SHEA 3CE3A 4DFUA 4BCGA 2XEZA 3WILA 2PULA 3DJ5A 3RALA 3ZUUA 2ITVA 1U5QA 2UZWE 4QPMA 2Y0AA 3EJ1A 3OROA 5AR4A 3UIBA 5D12A 4WT6A 4A9RA 2XF0A 2BDJA 5FRIA 4NM7A 2W0JA 4DFBA 4PV0A 2EB2A 1KSWA 4QMMA 4AE9A 3R00A 3HV5A 3CKWA 3QL8A 3MFSA 2IZRA 4U0IA 2C1AA 3MJ2A 3U87A 4O0UA 1ZOHA 4Y46A 4ZJVA 3RI1A 4X2JA 3PY0A 5D41A 4RC3A 4ZZOA 5D11A 4FZAB 3RPSA 3FYKX 4L67A 3CTQA 1E1XA 3KULA 5IA2A 2PUIA 2JDVA 1J7IA 4FSWA 4M0ZA 4RC4A 1IEPA 2ZAZA 3OD6X 3UG1A 3BBTB 1V1KA 3GFWA 4ZSLA 4WUNA 5F20A 2R7IA 2UZNA 4O7TA 3UO5A 1P4FA 3VW6A 2BALA 4DTKA 5GJGA 3EFWA 4CZYB 4TWOA 3HDMA 3PPKA 3UMXA 2YAKA 1XHAA 3KRLA 3OT3A 3GGFA 4ZLOA 3QWJA 2OW3A 2JITA 5GJDA 3ZHPC 4APPA 3EOCA 2JKMA 3LM5A 3C0GA 1P5EA 3KGAA 4FL3A 3GQLA 4YJNA 4UN0C 3QLFA 2FH9A 4K6ZA 3MBLA 5KNJA 3Q53A 3PTGA 1NVSA 4D4VA 1OVEA 5J7HA 3BQRA 4PY1A 5KCVA 3O8UA 3A7IA 3QKLA 4RZWA 4KIKB 4B7TA 4EHEA 5A6OA 2I0EA 5CEKA 4KB8A 4E5WA 5AIRA 4FSMA 2A2AA 2VO3A 3EFKA 5JN2A 1GZ8A 4FZDB 4MD8E 4PMTA 4PNIA 4S32A 2WIHA 3NUUA 4R78A 1PYXA 4R6VA 1OPLA 4FKOA 5IF1A 1O9UA 3Q4CA 1M17A 5HIDA 2JFMA 1B6CB 1KE9A 2CLXA 3RPRA 1V0BA 4G9CA 3A4OX 5CSXA 3UNKA 4W4XA 3QTWA 3SLSA 3FY0A 4J1RA 3E88A 4QP3A 4RJ3A 4O0RA 4IVDA 3ALNA 4O7RA 4JR7A 4OR5A 2R4BA 3R6XA 4MTAA 4EHGA 4L3JA 5DFPA 2CHLA 4BR3A 4GK4A 2YITA 2ZOQA 3QGYA 2WOTA 4BGGA 4RLKA 2CPKE 2QOQA 4AZWA 3AT4A 5HD7A 4KBAA 4BWXA 4C35A 1PJKA 2YHVA 3E8DA 4BCQA 4FT0A 4ZEGA 5C9CA 4LG4A 2QOHA 5AR7A 5HVYA 3ITZA 3O2MA 2ITPA 3P7AA 2QO2A 2B52A 4XHKB 4DEGA 4IEBA 3P1AA 4P5ZA 4IQ6A 5FUTA 3R0TA 1H07A 1GAGA 1Q4LA 4C34A 5HVKA 3BHTA 3GCPA 1GNGA 5JZJA 3GCSA 3LW0A 3MS9A 4FIIA 2VO0A 4X2FA 2H8HA 3R8ZA 2I1MA 2VTSA 4N6YA 3HA6A 3B8RA 4BCOA 4JIKA 5ETAA 4JL9A 4MAOA 5L4QA 5GIOE 5LCKA 4EH7A 4AOTA 4JJRA 3QUPA 4JDHA 4ZTRA 1GIHA 3W2CA 1YKRA 4Y72A 2BRBA 3BHUA 4OTHA 4UWCA 4E6AA 1MQBA 3FMJA 2QKWB 3Q60A 3LFDA 2YM7A 5LQFA 3VF9A 2WIPA 3DLSA 5BVEA 2ETKA 4GJ2A 4CEGA 3SG8A 2ZM1A 4EOJA 3EZVA 4O0WA 4YO6A 3NSZA 2XJ1A 1WBOA 3WF9A 4WOVA 2ITNA 3O0GA 3P5KA 4G5PA 2V62A 4EZ5A 4TL0A 2ZDTA 4U97A 3B8QA 5HBHA 2KTYA 3NUPA 3OXIA 4IIRA 5KMKA 2O5KA 2UW0A 5AIKA 4TRLA 3IONA 4O0XA 3P7BA 3HMOA 3C4XA 2FVDA 3Q04A 2JD5A 3QRTA 4L43A 5HX6A 5J5TA 4RVTA 2F7EE 2EWAA 2WTJA 3SXSA 2GTNA 3MA6A 1DI8A 2JAMA 3LXKA 2ZB0A 4FUXA 4IB1A 3U4UA 1Y6AA 2HW7A 2OJGA 3LCDA 4LOPA 5HG5A 1YXXA 3AC8A 5HNIX 3AT2A 3RHXA 4RBLA 4D1ZA 3MPMA 4GSBA 1YHSA 5AJQA 3ZLYA 4TYJA 4K77A 3EQBA 1KWPA 4CTBA 5A9UA 3FI3A 4AQCA 3FKLA 3GU8A 3WZUA 2PMIA 4BWPA 3GFEA 3D7ZA 4AE6A 4EOOA 2UZUE 4WIHA 5DRBA 1W7HA 2CNQA 2YCRA 5HORA 1FGIA 3ZDUA 2OWBA 4E1ZA 2VWWA 3BGQA 4EYJA 3UQCA 5GZ9A 5CALA 5AP0A 3BV2A 3KN6A 3CD3A 2GHGA 4JG8A 4M0YA 4BCMA 3HX4A 4RVKA 2BMCA 3ULIA 2VAGA 2WMSA 2X7OA 3NNWA 4C57A 3HVCA 3JS2A 4ACHA 4G1WA 3MJ1A 4O86A 4D2WA 4AG8A 2BTRA 3Q5ZA 1SNXA 4C3PA 3PE2A 4MX9A 4U81A 2P0CA 3LM0A 2W5AA 5CSWA 1OECA 4DGNA 4R7BA 2UW5A 3UTOA 2XIKA 1YXTA 4I24A 4Y8DA 5TOZA 4EH8A 3C9WA 4MNEB 2O65A 3COIA 1ZZ2A 2RIOA 4ZIMA 1H8FA 4YHTA 4DF3A 4W4WA 5A3XA 4QOXA 2XM8A 5K0XA 1XBAA 3UVRA 3I60A 2P33A 3QQGA 4NIFB 4R7HA 3TT0A 3WBLA 4DH8A 2CGVA 2JBPA 2UZVA 4RZVA 4ACMA 4UZHA 2QI8A 4S34A 2XNOA 4R77A 5IA0A 4PNKA 4J71A 1VZOA 2C6KA 4GVAA 2UW4A 2ITOA 3VUMA 4WO5A 5FBNC 2HENA 3VUIA 2BIKB 4FX3A 3FHRA 3E64A 1OBDA 4FKPA 3RCJA 2LAVA 3ROYA 3D0EA 4QMOA 2XK9A 2GNHA 3EQIA 4X7QA 3D2KA 4HVDA 3ANRA 4JDIA 4WHZA 5M4UA 4UXLA 3I6UA 4YNOA 4WNMA 2WU6A 2R3GA 4FTOA 3KXMA 4FV4A 4II5A 5KHWA 1WZYA 2X2LA 3RM7A 3OCTA 2W96B 2I40A 5DA3A 5DR2A 4ERKA 4AX8A 4U41A 4IBMA 3I5NA 5J8IA 3U8WA 5F95A 3T8OA 3EIDA 1CKJA 3QD3A 4O81A 2XNBA 5HIBA 4G6LA 4RFMA 4U3YA 5EQPA 1FMOE 3COMA 3UIXA 4AT4A 1NVRA 4EK6A 4I6HA 5FTOA 4ITJA 2PMLX 2OBJA 4DFNA 4E6QA 4FE2A 2VNWA 3IW6A 2C6OA 1URCA 4IE9A 5JH6A 4AGDA 2C68A 5BYYA 3DTWA 2XKCA 4IAZA 5E8XA 4FL1A 3TEIA 4BCKA 5BVNA 1YVJA 2AC5A 1CM8A 3DK6A 5EFQA 3GVUA 2W9ZB 2EXEA 5I3OA 3QTSA 3O23A 2BHEA 4NJ3A 5IA5A 3RWQA 3LXLA 3MPTA 2F2UA 3B2TA 4XX9A 4DE4A 2JFLA 4Q9ZA 5AP6A 5DLSA
chains in the Genus database with same CATH superfamily
4FTRA 5GINE 3KFAA 3DB6A 1A9UA 4ZY5A 4GL9A 2Q83A 2PL0A 3DTCA 2XRWA 2C3JA 3GP0A 3LJ0A 1OL6A 3BLRA 3IK3A 3ZM4A 2AQXA 4AW0A 5LMKA 3E3BX 3TUDA 4W8DA 5ACBC 4RG0A 3WF7A 4F64A 2VTLA 3TZMA 2HXLA 3W0NA 5CY3A 2BIYA 2IVSA 4QRCA 4G3FA 1ZYJA 4QTDA 2XVDA 1AD5A 1XQZA 3Q6UA 4IWOA 3BHYA 4YJVA 4AOJA 4DFXE 1MQ4A 2FB8A 3HV4A 5J7BA 2QVSE 5CANA 3NPCA 3CD8A 4HJOA 5CT0A 3RHKA 5L6OA 1H1QA 4I5HA 2C5NA 5E91A 3WE4A 4HCVA 3FZSA 3KMUA 3NYXA 4I0TA 1Q8ZA 2OH0E 4EQUA 2QG7A 3QZIA 3BEAA 1RW8A 3RGFA 4ZLYA 3FC2A 5AM6A 4X2NA 3GB2A 5K9IA 1PF8A 3DBCA 2PVRA 4HNIA 3SOAA 3CS9A 4DBXA 4J7BA 1OPKA 2J5FA 1W2CA 2WNTA 4OTFA 5J9ZA 3A7FA 3RAHA 5E1EA 2J50A 3WYXA 3BYUA 1UVRA 2QR8A 3QQKA 4TTHB 4XUFA 2UUEA 1XO2B 5CWZA 4FEUA 3F2NA 3EN7A 5IUIA 2XZSA 4QO9A 4YHFA 4CQGA 2HYYA 4ASDA 4DINA 5HICA 5ETIA 2XNNA 2OJFE 4UV0A 4D5HA 5IDNA 1OMWA 3W10A 4HGEA 4B8LA 1KE7A 1U59A 2BZKB 5C27A 5TE0A 1U4DA 4CQEA 4F09A 4L45A 3ZONA 5A54A 1JAMA 2QURA 4NU1A 2XJ0A 1XMLA 3KU2A 2VWVA 2IVUA 2CKQA 2P2IA 4BGQA 4F08A 2X8EA 3HMMA 2X6DA 5IQGA 4IAKA 2NPQA 4A9YA 4ALUA 2R3FA 2X0PA 2YM8A 4EBVA 4DT9A 2XUUA 4FKSA 4IM2A 4FV3A 3LFQA 2O63A 3MW1A 3MI9A 4Q9SA 4ZK5A 5BUIA 3MV5A 4I6QA 5JGAA 1ZLTA 2V5QA 1OZ1A 5KMJA 3NS9A 3MGYA 4QYEA 2W4OA 3OUNB 4GMYA 4TYHB 5HD4A 4FTTA 3TL8A 2IG7A 4O27B 4G34A 2PVHA 3GU4A 3E8EA 4QTBA 2WQOA 3AC5A 3PJ1A 3O51A 4QYFA 4MNFA 4LUEA 4I23A 3KB7A 4HNFA 4B0GA 5L8JA 1G3NA 2XKFA 4ANQA 4QT1A 2H9VA 2X8IA 5M57A 4EOQA 3IO7A 2OIDA 4XNEA 3QXPA 1YQJA 5E1SA 2A27A 3TV7A 4EWHA 4J99A 2CLQA 2UW7A 4TYIA 3CJGA 5CEMA 2XM9A 4UALA 5FM3A 3SW7A 2C4GA 3F82A 5EQYA 3KXXA 4TWCA 5M44A 3HAMA 2C6DA 2PE0A 4PRJA 4RWLA 3UGCA 5DE2A 1GZNA 3UOJA 4KIPA 3MTFA 4PPBA 4NIFA 1UNGA 3NUNA 4H36A 4XP2A 3VS0A 5J79A 5DG5A 2W1IA 4NKAA 3H0YA 1XH9A 4A9UA 4ZSGA 3HV7A 3VBQA 2PUPA 5IQIA 1GIJA 5H9BA 3JVRA 4BKZA 3HMPA 2XAOA 3PVBA 4QMZA 3PXQA 3OTUA 3EN5A 1LPUA 2QKRA 5IG1A 2QU5A 4Z9LA 3DNEA 4K9YA 2FSTX 4EOSA 2WZJA 3F61A 4JRNA 5BQ0A 4FV5A 4C61A 4NTTA 2R3MA 4FGBA 4BTKA 4M97A 4FR4A 4R1VA 4MCVA 1V0PA 2X7GA 4LM5A 2J9MA 1VLRA 3LCOA 1W2DA 3NCGA 5IEXA 4HZRA 1JNKA 5HLWA 2RGPA 2BTSA 2XALA 1MP8A 2P2HA 1BX6A 1NA7A 2AYPA 4B99A 3R7VA 5CF4A 2UZOA 1YWNA 3DJ6A 2IEWA 1M2RA 2ITZA 2X4FA 1M7NA 5AFVA 5AUWA 3O7LB 5C1QB 2H6DA 2PE1A 3DBFA 4RIWA 4BCHA 3FXZA 5IU2A 2XEYA 3GEQA 5KBRA 2QCSA 4EK5A 5EW3A 1GY3A 2YN8A 4F7LA 2E9PA 1QPCA 4WSYA 3MFTA 3TIYA 4D5KA 2C0OA 3UNJA 3KXNA 3H9FA 5EDRA 3CGFA 4ZZNA 2BFYA 3P23A 3UIMA 4HOKA 5HCXA 4XOZA 3CBLA 4L7SA 4OLIA 1PYEA 2O8YA 4G6NA 3BBWA 3FUPA 3QTQA 5IQFA 2GFCA 2BHHA 5DT3A 5LVMA 2OF2A 2C1BA 4C59A 3V04A 5A4QA 4F78A 4TN6A 4DTAA 3VWAA 5B2KA 2QO7A 4ALVA 4KWPA 1FBNA 4RSSA 1W0XC 1ZMUA 3LQ5A 3NIZA 2JEDA 4FT7A 2REIA 4D2VA 2VWIA 4FV9A 2JBOA 3UQFA 1PXLA 3HDNA 2E9VA 2FSMX 2OI4X 4FTUA 4XG6A 3GC8A 3T3UA 3ZSIA 4IW0A 5KMMA 1EH4A 3QF9A 4BTMA 4E4XA 2OZAB 3BV3A 3UZPA 3CR0A 5LVNA 3FLZA 2YFXA 5BVDA 5DGZA 3TZ9A 3SGCA 2C5YA 5E4HA 5AAEA 3OP5A 3UOHA 5M07A 3ZSGA 4CKRA 4IJPA 2QOIA 4JI9A 3FI4A 3LFBA 4MYGA 4NCTC 2XRUA 3VRYA 4FSYA 1HOWA 2R3NA 5HE2A 2Q0NA 2YDKA 3PJCA 3QYZA 2GS2A 3POZA 5EYCA 4EQMA 1K2PA 1KV1A 4FKWA 3EYGA 4M14A 1WVYA 3DDQA 5C01A 4GEOA 3POOA 3LCTA 1SM2A 3Q4TA 4DEIA 2R7BA 3P08A 5FLFA 1TQMA 2HZ4A 3M42A 3CEKA 1M52A 1QL6A 5DWRA 3AQVA 4JAIA 4DLIA 3FZOA 4BTFA 3RPVA 3ET7A 3NUXA 3R71A 3RMFA 3PXKA 1OIYA 1KE6A 3C4WA 3BPRA 5CNOA 3MIYA 1ZYCA 4QTAA 3BYSA 2F9GA 3F7WA 5AUTA 4DHZA 4O2ZA 2CGUA 4WUAA 2BCJA 2XKDA 5CYIA 5J95A 2VTQA 2B4SB 2RG5A 4TY1A 4PDSA 4YC8A 3U6HA 4PMMA 4O0SA 4YTCA 2QOFA 2BAJA 3MA3A 3DAKA 3IOPA 3C4CA 4I93A 4XRLA 3WF6A 4BN1A 3TTJA 5D7VA 3R22A 1CDKA 1PXJA 3PA3A 4O7YA 4I0RA 5KMIA 5HU9A 1NY3A 4N0SA 3QKMA 2WMWA 2E2BA 3FE3A 4ZJJA 2F57A 3E93A 3L8SA 4E5AX 5GNKA 1S9IA 2R64A 1NVQA 3FY2A 3L8PA 4FUYA 2CCHA 2UZDA 2YM3A 4QTEA 1XH6A 4FG8A 3NRMA 3A60A 4JDKA 1PXMA 1AGWA 5AV0A 1Q97A 4M66A 4NW5A 5HTBA 3FLQA 4AXFA 3D7TB 4RT7A 4NZWB 3N9XA 4TW9A 2WO6A 3BU3A 4TYHA 3R73A 3KRRA 4FSZA 4JX3A 3IW7A 5L2TA 3U9NA 1YI6A 3P79A 3RCDA 3RP9A 2E9UA 4TNDA 3ZTXA 4D28A 5AA9A 4DT8A 3H4JA 3D2IA 2B9FA 4WNPA 3A61A 2FSOX 4Q5EA 4BIDA 4I6BA 2C6LA 3PYYA 4AA5A 2GNLA 3P0MA 3ALOA 5EYDA 3DV3A 3ZUTA 1YDTE 2RFEA 4HGTA 3R1QA 2UZEA 2BAQA 3GUBA 4ZTQA 3ZZWA 4QNYA 4RJ8A 4YZ9A 4MKCA 5CSPA 3QX2A 2QOCA 2E9NA 3ACKA 2WMRA 4XG9A 4AA4A 1WBSA 3AG9A 4HVGA 1QPDA 4KBCA 4YJSA 4ALWA 4YJOA 2P55A 4IX6A 3LAUA 3VHKA 3WYYA 4BDEA 1R39A 5G6VA 4D58A 2IN6A 2W05A 5FBOA 2WKMA 3PP1A 2NYAA 4UXQA 3ORNA 1Y91A 4PDYA 1PY5A 5TT7A 1PHKA 3BU5A 4YLKA 4R3RA 3S3IA 3CSVA 4MD9E 5FM2A 4DHIB 4ZTMA 4FF8A 3VUTA 3N4VA 3QUDA 2KULA 3RM6A 4MXZA 1OPJA 4LGHA 4MWIA 5AM7A 3PVGA 5AP5A 4XG3A 3BWFA 4DH7A 4CT1A 4J98A 3JR1A 2YLEA 1BL7A 3PIYA 3R7UA 5A4EA 5I9WA 2XYUA 3LOKA 4NUSA 2UW8A 1Q24A 2XKEA 3MIAA 2H34A 1WBTA 2Z7SA 5CXHA 1IR3A 1HCKA 4EK8A 2W9FB 4XS2A 4ZS0A 3NNXA 5CVFA 3TNHA 5IMXA 4QNAA 1W82A 2RFSA 4PTGA 5EYKA 5HG8A 1WCCA 3RNYA 3WOWA 4QTCA 4YLJA 3LFSA 2JIIA 5DEWA 1FVRA 4GCJA 2G9XA 2ZMDA 3NNVA 1RDQE 3CQUA 1AQ1A 3QRKA 3OFMA 4GFGA 4QMXA 4ZSEA 4ASZA 2O3PA 4BDIA 4F7SA 4YO4A 5LWNA 3AKJA 3G6HA 2QOLA 4HVHA 3BQCA 3LJ1A 1JKKA 4MHAA 1U5RA 1IRKA 4UMQA 2YWPA 4OTPA 3ZEWA 3II5A 4V0GB 4U6RA 3TJCA 4WG5A 3W18A 4BDFA 1UNLA 4O82A 1DAWA 1JPAA 4A4XA 5LVOA 5BVKA 4QMSA 5F4NA 4DEDA 2CKOA 4H05A 4W4YA 4A7CA 1A48A 3MVMA 5IISA 1YI3A 3HECA 1G8JA 4AXEA 4O22A 4I0SA 4DCEA 2WELA 1ZOEA 4FEXA 3AC2A 2CCIA 3WARA 1IA9A 4FYOA 4F6SA 1YDRE 3SXFA 4H3QA 4ID7A 5CAOA 4ZLZA 3VNTA 3A7GA 4N70A 5IA4A 1KOAA 3BGZA 4WD5A 3BIZA 5JRSA 5I9ZA 4F7JA 2VX1A 4AT3A 3OCGA 3VAPA 2AC3A 3EMGA 4B9DA 5CEPA 3PXRA 4NW6A 3EQHA 2XK7A 1PMVA 3QUEA 4U5JA 3ZO4A 4IADA 3TWJA 4MXXA 4PP9A 5CVHA 3GXLA 5DN3A 3L8VA 3SVVA 2C6IA 2UZBA 4BYJA 4LV7A 1ZY5A 3DB8A 4I6FA 4I5PA 3G2FA 3HMIA 5C26A 3OT8A 3A7HA 5M53A 3ML1A 5AMNA 4EUUA 3E5AA 1XBBA 3QU0A 2PVLA 4QQTA 2R2PA 4KS8A 3R1YA 1V0OA 4L44A 4CT2A 5CAUA 4IVAA 1P4OA 2IPXA 3DDPA 4F99A 4AAAA 4NH1A 2OKRA 3FMMA 2OH4A 4MF1A 2BRGA 3DBQA 4NEUA 2OF4A 2PHKA 3EL7A 1R0EA 3F5GA 2ITQA 4RWKA 4GIIA 3RAWA 2ZV7A 4GW8A 1ST0A 4JMQA 4F0GA 4AGWA 4KUJA 5E8YA 2J0JA 4L8MA 4OT5A 3LFFA 3ZBFA 2R3IA 4GIHA 4K33A 3HMNA 2OU7A 2A1AB 3S2PA 2DYLA 2PZ5A 1GZOA 2XNMA 5CXZA 2OJIA 3IW8A 4L00A 3NIEA 4DGLC 3K5VA 3TTIA 2Y9QA 3ZU7A 1IG1A 2Y6MA 3VS3A 4C4IA 3TNWA 4E8AA 3OEZA 5B7VA 2PUNA 4NL0A 2X8DA 3U6IA 4AUAA 4F9YA 2ITWA 2Y4IC 5GZ8A 1T46A 4YR8A 4GUBA 4TNBA 5M4FA 3LLTA 3PSCA 3NAYA 4ZOGA 4ORKA 2R3LA 2GQSA 3TM0A 3ZMMA 3EZRA 4OW8A 5IKWA 5FEDA 1H0VA 2W5HA 2UVXA 2WMUA 3E8CA 2BAKA 4MVFA 4V05A 3VQUA 5CF6A 2Z7RA 3QA0A 2XIZA 3NVKI 5E90A 2AEGA 4EOKA 3D7TA 2J0MB 4FTMA 3ULZA 1J91A 4EL9A 4CLIA 3IS5A 3Q2MA 4FKUA 4FV1A 4TZRA 2OLCA 5EW9A 2UVYA 4EHZA 3VBVA 4O4CA 1OGYA 3S95A 4EOIA 3L8XA 2VRXA 3P86A 1UU9A 4RX9A 3HUCA 3WIKA 2Y6OA 1SMHA 4J96A 4OTGA 2QR7A 4RIOA 1Q5KA 1G8SA 3OZ6A 3DNDA 4IZ5A 5IQEA 4XLIA 5L2QA 4YPDA 4RFYA 5D9HA 4EEVA 1KOBA 5DNRA 5DVRA 2VU3A 3ZLSA 4JBVA 4U7ZA 3UBDA 3VUGA 5CI7A 4ANBA 2BZIB 3PUPA 4CMUA 3Q2JA 3ERKA 3TV6A 5AAGA 4BVUA 3DA6A 5H8BA 3HP5A 3DJ7A 3EQFA 3PXYA 3P78A 3W16A 3DBDA 4AF3A 5EHYA 5IEYA 1LEZA 1F0QA 5FG8A 4JAJA 2PVJA 3VBTA 4AT5A 2BKKA 3COKA 4NTSA 2W17A 2XIYA 1XKKA 1F5QA 3O8PA 3OCSA 2CKEA 2C3IB 4R8QA 4FT3A 5EW8A 4E6CA 4O84A 3UOKA 4AAYA 3TZ8A 5BYLA 4IC7A 3ODZX 3IGGA 5HKMA 4KAOA 3W32A 4XV3A 1PMNA 4L3PA 2VUWA 3BYVA 3E7OA 4PF4A 2W99B 2J90A 4ZTHA 5J1WA 3QC9A 3EN4A 1TQPA 3VUKA 1GOLA 4EC8A 3AKLA 2X2MA 5HQ0A 4IAIA 5KMLA 4FL2A 4V01A 1Y6BA 3HRFA 5ANEA 3RINA 1Q41A 4LRMA 2JAVA 3CPBA 2XCHA 3U9CA 2C69A 3KC3A 2WMXA 3FBVA 5HESA 1Y8YA 3Q9YA 3ETAA 4ANNA 5EQEA 4IHPA 5CU2A 4QP1A 3B2WA 3LCKA 4R5SA 4U9AA 4XBRA 1G5SA 4J52A 4YZMA 4I5MA 5DBXA 5E8WA 4CZTA 4QP9A 1VYWA 3L9LA 2YM6A 3FZTA 1APME 1Q99A 3IQ7A 4G3GA 4L42A 4FKQA 2ZM4A 1WBVA 3ZXTA 4EH2A 2YIQA 2R3RA 5LMAA 3L9NA 3R28A 4V0GA 5ETCA 2RKUA 4YPSA 5KKRC 3FYJX 1OBGA 1ZYDA 5T3QA 5LMKC 5M4CA 2B9HA 4OBOA 3EN6A 3TUBA 4JT3A 2B1PA 1H1WA 4LMUA 3O17A 3EH9A 4E4MA 5DR6A 1Z9XA 3F5PA 3UVQA 4MQ2A 2B55A 4MQ1A 5IUHA 1R3CA 2Z8CA 4TYEA 4YGAA 1TQIA 2WXVA 3R9DA 4IVCA 3LXPA 2YA9A 2GTMA 4GFMA 3WZDA 3AKKA 2B53A 2IW9A 4EC9A 2ETRA 4FTKA 4BKYA 5H8GA 3VBXA 2ZV9A 3VO3A 3UJGA 5HE0A 3AT3A 2Z02A 4ITIA 4OTRA 3UVPA 3PFYA 4MXOA 5HBEA 3RJCA 3REPA 1PXKA 4RWIA 4TT7A 3T9TA 2YZAA 3PLSA 3PXFA 5LCJA 3ZH8A 3LQ8A 4EK3A 3VBWA 3KVWA 3H0ZA 4MXAA 2YJRA 4NK9A 3ZS5A 3WE8A 4RVMA 2QONA 3FHIA 3KVXA 5DH3A 5I0BA 2VTJA 3QAME 3HGKA 4DA5A 3A99A 4GVJA 3BL9A 1P14A 2OXXA 3IW4A 4BIBA 3AXWA 4KIKA 5EHLA 5FP5A 3FKNA 5L6WL 3BYOA 5AUVA 3U4WA 1JKTA 4BCNA 5ANJA 4FTLA 4R3PA 5BUEA 3UIUA 3NZ0A 3BE2A 3F69A 4FVPA 2PWLA 4JIAA 4U43A 1SYKA 1FGKA 3AD6A 3ZEPA 3TIZA 4FKJA 1BMKA 3TUCA 2Z60A 4WSQA 2GCDA 1CSNA 5AP2A 2BZJA 1O6KA 4DTBA 4U3ZA 4EQCA 1ZRZA 4LRKA 1JBPE 2XCKA 5AV3A 5TR6A 2VWUA 4HCTA 5BYZA 1KUTA 3ORPA 4FZ6A 3COHA 4GG7A 4GT3A 4JBOA 4UWBA 5JFVA 1H27A 3ATSA 5HE3A 4IX5A 3OMVA 4DHJA 3NX8A 1Q3WA 3MWUA 1OL7A 4TYGA 2XNGA 2ZYBA 3G51A 4XG8A 4F65A 4IFCA 3U55A 2X9FA 3NUAA 2NRUA 4RJ5A 1TVOA 3QLGA 3UDBA 5HU3A 2B7AA 4RJ6A 4W8EA 2EXMA 4FIEA 4LMNA 3UPXA 4U79A 3TKHA 5CU0A 5AUYA 4F63A 4L46A 1YWRA 4QYGA 5AUXA 4F1TA 5HTIA 2CN8A 2DWBA 2JIVA 4IFGA 3R1SA 1FPUA 1JWHA 3NWWA 5HTCA 2BZHB 2IWIA 4QP4A 3R1NA 2OIQA 5JKGA 3UP7A 2VGPA 3A2CA 3DQXA 3FL4A 4OTQA 1R78A 4L9IA 4BZNA 3LMHA 4N6ZA 4W4VA 2C6EA 5ACKA 2BKZA 4C3FA 3SKCA 3A8WA 4BICA 3KN5A 5K5XA 2J6MA 5CVGA 4HYSA 4QPSA 5FXQA 5FEQA 1JOWB 1YHWA 4I3ZA 5FDPA 5LJJA 4O4FA 5H3QA 1YW2A 4DFLA 4X3JA 4EH4A 3JUHA 3Q9ZA 1GZKA 3DXQA 1Y57A 1OI9A 3TDWA 2XA4A 3QX4A 4CTCA 2R3OA 2BR1A 3W0PA 4EKKA 2BDFA 2BRHA 2C0IA 5E92A 3SRVB 4O0VA 3GBZA 3MH0A 3OWJA 1PXNA 1PKGA 4IDTA 5IPJA 3SA0A 3ID6C 2YDIA 5EI8A 5FD2A 3H10A 4OBPA 4MUQA 4BY9E 3KRJA 4QMUA 2J7TA 2I0YA 4G3CA 4ZZMA 2W1CA 4GKIA 2PUUA 3F3ZA 1L8TA 1K3AA 3GOPA 1YXVA 5E8UA 3MSSA 4BCIA 3CGOA 3P7CA 4FZFB 5IH6A 3C50A 1QPEA 3PPZA 2I0VA 5ANOA 5BMSA 2ITTA 4XRJA 2F4JA 2WTKC 3HRCA 3F9NA 1Z57A 3OY1A 5M4IA 3SW4A 5EG3A 3G0EA 5IZFA 5K5NA 3UZRA 4JS8A 1IASA 4IWDA 4MH7A 1REJA 5AR8A 4G31A 4CRSA 3ORIA 1JKLA 1BLXA 4RIYB 4U44A 4XV9A 2ZV2A 2IJMA 2PK9A 3VS6A 5LXMA 4RIXB 3PG1A 3KRWA 2JKOA 3QTIA 4LUDA 3UQGA 4CFWA 5F9EA 3F2RA 5CENA 3SQQA 4ASXA 3O5AA 4AZSA 5TF9A 4YLLA 3LFNA 4ZXTA 4HVIA 2FGIA 2O2UA 2WTWA 4FG9A 3S0OA 2EU9A 3E62A 3E7VA 4IJ9A 3PJ2A 3BL7A 1BI7A 5TO8A 3ZC6A 3N4UA 2QD9A 3OW4A 4U40A 1ERKA 5I3RA 4QQ5A 4QMVA 1FMKA 4Y5HA 4FV6A 4EKLA 1W8CA 2YACA 1BI8A 5IEVA 1Q61A 3WI6A 5BVFA 2QNJA 4CMTA 5CF8A 4GUEA 4ZTLA 5GJFA 3KCFA 3G15A 4M7IA 3HNGA 5B2MA 3DFCB 2YAAA 4FA2A 5HLNA 1VEBA 4C4JA 5DYJA 3PWDA 3FPQA 4ZS4A 5KHXA 4QP2A 4IMYA 4XV2A 3S00A 2DUVA 5HIEA 4IM0A 4F0IA 4NT4A 2PZRA 1FQ1B 3F2AA 4FI1A 3FLYA 3QC4A 4V04A 4YTHA 5TKDA 4DG3E 4E20A 3MVJA 5LMBA 1NT2A 3THBA 2WMVA 2VWYA 1H25A 3R63A 3I6WA 4A07A 3TN8A 2EVAA 2VTTA 2GNIA 1CMKE 4Z55A 3DKOA 4MNEA 3DT1A 4A9SA 4C62A 3LJ2A 2GPHA 2HZ0A 2G01A 4IM3A 4TPTA 4FVQA 2PY3A 3ODYX 3R8PA 3RAIA 4USFA 4BKJA 2W1ZA 2J5EA 4FOCA 3P5JC 5JQ5A 4AWIA 4UMTA 4YMJA 3CQEA 2WTIA 3FLWA 2QOBA 3I1AA 3OOMA 3QZGA 3QTZA 4FTIA 4I20A 1B38A 3KMWA 4YZBA 4YC3A 4FSRA 5M08A 3JY9A 4GH2A 3V8TA 3K3IA 5J5SA 4NKSA 3AGLA 3CJFA 4QQJA 3U51A 1LR4A 4D9UA 3JY0A 2W4JA 4YC6A 3T9IA 5KX8A 3EQDA 3FMKA 5DRDA 3D83A 3OVVA 2QLUA 4YP8A 2YZLA 2JDSA 3NYNA 2VTOA 2PMOX 3UC3A 2X0OA 4FTQA 4Y95A 2BUJA 2O0UA 3AC1A 3I81A 5CQUA 4BC6A 3MDYA 4JBPA 4MBJA 3F3TA 4YBKA 3KQ7A 4LRJA 4F1OA 5FEEA 1FVVA 2NP8A 1Q8UA 3VUDA 3I79A 3OCBA 3EQPA 3UMWA 3W0MA 2VX3A 5L3AA 4ACCA 2W1DA 4UEUA 5CLPA 4EONA 3K54A 1P2AA 3ZO3A 2RF9A 3ZXZA 2C6TA 4FGRA 4LFIA 1IAJA 4QEBA 1ZMVA 5C8NA 1ZMWA 2VTPA 3R2BA 4RQKA 3C0IA 5KUPA 3UZTA 3PPJA 5CI6A 3DQWA 3TCPA 4ZJIA 4FNYA 4ITHA 3VS5A 4IAAA 2F49A 1UU7A 4GT5A 4O6LA 5AWMA 4EOMA 5HEZA 5ANDA 1YHVA 4FYNA 5LARA 1UKIA 4K11A 3TV4A 2RFNA 5HHWA 4BBMA 4IZ7A 5J9YA 2XK6A 4AFJA 1PMEA 4ZMEA 4PL4A 3C5IA 1URWA 4NM3A 5ITAA 2GHMA 4GFOA 4R3CA 1UU8A 3UODA 2X81A 3GT8A 3BGPA 3HKOA 1FOTA 2BRMA 3TNIA 4M3QA 5EKNA 4K1BA 2IZSA 4BWKA 1VYZA 4F6WA 4DHFA 2UZLA 2GNGA 3OC1A 4FNXA 2GNJA 3KRXA 4L6QA 3VS4A 2IVVA 2VN9A 3BI6A 2XS0A 4XMOA 5JGDA 1U46A 3W2PA 4DH5A 4FSUA 3E8NA 3FQHA 3Q9WA 1YOMA 1WBNA 4BDKA 4O7LA 2QO9A 2PVFA 4X3FB 1ND4A 4TKSA 2CGWA 4M69B 4KS7A 4AXDA 2WMBA 5DEYA 3C5UA 4OT6A 2XK3A 4I21A 3L1SA 2ZV8A 3DXNA 4HYIA 4UYAA 4XG2A 4PP7A 5A4TA 5JEBA 3FQEA 4QYHA 1JSTA 4LL5A 3W2OA 3QCYA 3W55A 5A4LA 5LWMA 3W0SA 2W4KA 4FG7A 1BYGA 3FXWA 4FIJA 2YCQA 4H58A 4GKHA 4NWMA 3SRVA 3QGWA 4WNKA 5IQBA 5IQCA 4BCJA 4BI0A 2I7QA 1ZOGA 3FZPA 5C4LA 2QOOA 4M68A 4OAVB 1REKA 4YJUA 2W1EA 2YEXA 2UZTA 4GRBA 2BDWA 4LL0A 5IQDA 4APCA 2C47A 4ZAUA 3VUHA 3DY7A 4OBQA 4IDVA 4ZSAA 4DGGA 3NUSA 4LGGA 4CVAA 3WF5A 4GT4A 4DGMA 4JOAA 5L2SA 4HCUA 5EI2A 2VWBA 1DM2A 4FT5A 4CV8A 3ORMA 3QXOA 5CT7A 4MBIA 3KA0A 3OBGA 5B0XA 4X2KA 4QP6A 3RVGA 2JDOA 2WAJA 4O2PA 3RTPA 3FMLA 4AXAA 4DEHA 4I22A 3DGKA 4O7NA 4RFZA 5D7AA 3V6RA 4AACA 2CJMA 3M2WA 3HV6A 4RIYA 1VR2A 2WFYA 5CQWA 3QQJA 5AP7A 1UA2A 2XIRA 3R7YA 4HPTE 5M55A 4EBWA 4Q5HA 1YRPA 3MY5A 2C5XA 2IW6A 1OB3A 2PSQA 5K4IA 3GI3A 4FICA 3ZLWA 4C33A 4BL1A 1H1PA 3VS7A 2YJSA 3BLQA 4PTCA 2WU7A 2EUFB 3NVMB 1YXSA 1H1RA 5IDPA 2YABA 3PSBA 4X6RA 3PP0A 1PXOA 3VJNA 4IAFA 2QHNA 1X8BA 3BHVA 4C02A 5HI2A 2OFVA 3NMUF 4G2FA 3QFVA 3KREA 1NW1A 4BGHA 2ACXA 4HYHA 1M14A 3DK3A 4PL5A 2HWOA 3QTXA 4FKTA 3DKGA 2JKKA 5I4NA 1QPJA 3HA8A 4NSTA 4RX8A 4EI4A 3MFRA 3KXZA 3ANQA 2SRCA 2XK8A 3FKOA 3IECA 3OY3A 4KIQA 4U45A 3S4QA 4PMPA 4U80A 2OSCA 5HVJA 2GU8A 2C6MA 5HE1A 2JDRA 3OUKA 4D1SA 4BYIA 4KSPA 4RWJA 3PDTA 1PXPA 5HNBA 5CU3A 5A4CA 4NJDA 4ZTSA 2H96A 1WMKA 2RL5A 3AD5A 4AN2A 4FV2A 1LP4A 5IQAA 1LEWA 4ENYA 3GNIB 3H9OA 3PZEA 4FT9A 4J8MA 4R1YA 4CD0A 4M8TA 3DLZA 5DOSA 3PJ3A 4AFEA 3KF7A 3UDSA 1H4LA 4PL3A 4WRSA 4FIFA 2PZIA 4C36A 3FQSA 4C4FA 4CNHA 4E93A 1UWHA 4NYEA 3AOXA 3RK5A 4XJ0A 3ROCA 3RK9A 4S30A 2Z7QA 3C4FA 2VTNA 2XBJA 4EOPA 1OM1A 5M06A 2B9IA 3QHWA 2VO6A 4NM5A 4Y5QA 3CXWA 3A4PA 4YSJA 3UOLA 3FMNA 2XJ2A 4RMZA