4DGYH

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody hcv1, c2 form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
EVQLLESGGGVVQPGRSLRLSCTASGFTFNNYGMHWVRQTPGKGLEWLAVIWFDENNKYYADSVRGRFTISRDNSKNTLFLQMNSLKTEDTAMYYCARDISLVRDAFIYFDFWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of hepatitis C virus neutralization by broadly neutralizing antibody HCV1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords HCV1 Heavy Chain
total genus 46
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2012-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH01
5GZOD 3IVKB 4GFTB 2VH5L 5HD8D 1NCAH 1UCBH 1JWUA 1AXSA 3ULSA 4DVBB 1FDLL 3MNVA 5A16B 3DVNB 4YFLI 5C6TL 3W9EB 1A4JB 3OB0K 4LCUA 4XMLL 2VLRB 3QQ4B 1I1AC 4H0HB 3C8KB 5DJ2A 3D25A 4KK5D 1P7QD 1EXUA 4KUZL 1OAXL 2JELH 4P9ML 1ACZA 3V2AR 2WLYA 2P5WD 1MFDH 3DROB 3JWOC 1WWCA 1Q72H 4GMTL 6CGTA 3TN0A 1ZAGA 3MRHA 1T0NB 3TNNA 1SEBB 2VDNL 4WFFD 4PUBL 3WFDL 2Z31A 5GIRB 3I6KB 4KUZH 1DUYB 1ZLUH 3O4LB 4R4NC 3P4MA 2VQ1A 4JM2C 4RDQG 4HWNA 4YDJB 5E1AA 2X4OA 2YUWA 1VESA 2ICWB 4ZO7A 3BWAB 3QULA 4S10A 4OGXH 4NC1C 3MRDB 3EAKA 1FO0B 4PJFE 4AENA 3DMMC 5IVZA 1B2WL 3BPNB 5HHQB 2VQUA 1XGRB 1SVCP 2KL6A 4KRLB 3QQ9C 4PTTA 3BZ4B 5SWSB 5DR5H 3RNKB 4JZJA 3UAJC 4ODUA 3RJQB 4KUCD 1VKXA 1WV7T 1SEQH 3CD4A 1U2HA 3SKNA 4ONHB 4F2MA 3BXNB 2E9JA 4HWBH 3BVNB 4U0QB 1FYTD 1P6AB 2XQYK 3IF1A 3NCMA 2L7UA 3DX6A 3ES6A 5IEHB 3ZKXB 2PYEB 4JHZA 3UBXA 4BJLA 2DQIL 3IU3B 4QRRD 4G7VH 5D5MF 4KVCH 1LILA 2B1HH 4KKAD 4BFIB 1A7OL 4JM4L 3DX9A 1BJ1H 2IMMA 4O2CB 3ZL4L 2DM2A 5T1DL 2EO9A 4M9PA 1OWWA 4GS7B 4JM2F 2WQRA 4N0UA 2Z8VC 3QUMB 1WCBA 2YPKB 1U2CA 2IALB 1JL8A 1YJDH 4M61B 3TIDB 4NRZA 1XGUB 5CJ8A 3QWRA 4XX1E 1WUNT 5IJKA 4L29B 2I5YL 1CQKA 4YBQD 5BRZB 5DD3L 1HK6A 5EDXA 1N5YH 1RZ7L 4P2QA 2VXQH 3I02A 1BP3B 2HJKB 1K8IB 2FGZA 4LLMA 3WIHL 1NJ9B 5J3HD 4IIQC 5LGHL 2AJUH 2ARJA 4TSCL 4C4KT 2J3SA 1M7IA 4I9WD 4NBXB 1T66C 3FB7B 3W0WB 3U9PL 4BA8A 4Z77B 1GCFA 4X6BA 1J1XL 3H3KA 4ODBD 1QHOA 2DLGA 3REVA 1JZ6A 3PV6A 3HG1B 5C0BE 4QRTA 1MQKL 3PGCB 3QCUL 4X6CF 1QLFA 1DQQB 1T6VN 1XGQB 1IKNA 3JTSA 1JWSA 4Z6AT 3QIBA 1NEUA 2FYYA 2BSTB 1A2YB 1ZV5A 5DJXA 1HH9B 3FFCD 2YPKA 1JNNL 4YH6A 5EU6E 2VIRA 4MSWB 5C08E 4GRMA 5CGTA 2MPAH 2VSDA 4J3VA 4HIEA 1LK2B 4CKVX 3C9NA 1QPXA 3T0XA 3L5XL 1JK8B 1DVFB 1WWWX 5HY9A 1FPTH 2XA8H 2DJSA 3BWUC 3S3PA 5DMIH 3CFIC 3PGDB 4R4BA 5SWZB 2XWJA 1FL5B 1JV5B 2J6EL 3F62A 2YD5A 2QL1A 1NCTA 2N7BA 4JREB 3G5VA 4DAGH 1L7TH 1AD9B 1A9BB 1RIUH 4YXKH 4AL8H 4FQXA 4ZPTB 2CJUH 1TJGL 3BUYB 3F6LA 4B5EA 4NC0B 2DQDH 4W4OC 5DJCB 2B1HL 3VGAB 3O11A 1P4LA 4MNQD 2P5ED 3K8LA 3RDTA 4G42B 5DMJB 5KSUB 3KJ6L 2CUIA 2P8LB 3MRNA 4JFED 3EYFA 4LLWA 5GRYA 4P2YA 2ZCLH 2J4WH 4LQ1A 2A6IA 3MLVH 2X4PA 3NMEA 1BX2B 1MFCH 4Y1AD 3PHQA 4PREB 5EZIH 5IMOB 2CR3A 4GRLD 4TUKH 3T1FB 1U8NA 3S37X 1B0RB 1CZ8H 3K0WA 4XNUL 5DMKA 1TVBB 2FNBA 5DEZA 4QRSB 4Z7UE 3VFGH 5BVJB 2VDKL 3T09A 4M93B 3CFEB 3RWIA 2R4SH 2DQUH 3T1WA 4D2NA 1Q9KA 3U7YL 1DDHA 3TO2A 4FQQB 1Q1JH 1VEMA 1WBZA 4QRPD 1Y18B 5D7KE 3VGDA 2Z91B 1Z6JT 4CU8A 3CXDH 3ZE2E 3G6JF 1Y0LB 5IB3B 4IRZH 4NQDB 4DZ8B 4YDKL 4N8VB 4XCFH 1T03L 5JW4M 1WC7A 2CKBH 5D2LA 4B0MM 5KVFL 4M6OL 4APQB 5BOPA 1EFXB 1HILB 1RZ7H 5EWIH 3NZ8A 1MIMH 4R0LA 5I1KH 5IFJA 1ZLVH 5LCVL 4R6UA 1XH3A 5HI3D 1P1ZA 3O3EA 1TITA 3SCMB 5CEXB 1Q0XL 4M00A 3T0EE 1KB9J 3OAUH 5BVPH 4OGZA 5F6HI 1D6VH 1IGJB 2CKBB 2APWA 3WS6C 2DB8A 1NMAH 3BN9C 1IGIH 3GMNB 4OZGA 4ZD3H 2HJLB 4EBQH 5HVFB 1U95A 3I2CL 2A6KB 5BS0E 4H1LA 1MNUL 1HXMB 4GW5B 5IIEB 1NBVH 1WEJL 2IAND 4FQ2L 5TGBA 3CFKA 1G7QB 3GGWB 2CQVA 2YHGA 3KPPB 5D6DC 3U1SH 4CU7A 5FK9B 1UXSB 3GK8L 3MOAL 5F72S 2PXYD 1M7IB 1CFBA 3W81A 5F3BB 1UWEL 4I3SL 1EHLL 2VXVH 3MRRA 5TDOA 3O2WH 2HRLA 1FSKC 4Q9BA 4P5TB 1KFAH 5IG7B 4IRJA 4PJDB 2D0FA 4FQ2H 4XNQB 3DXAB 1A64A 3MROB 1G0DA 4I5BB 1HHKB 5DVLA 1FPTL 1V8HA 2C26A 3VFWA 2Y25A 2GTWB 2VLKD 5C07D 2NR6D 3B8SA 4H88L 1OTSC 2OQJB 3O41A 2Y5TA 2CLVA 2ITDA 4KWUA 5B22A 3LDBB 4U7MA 1U8MB 2OM5A 1KLGA 5GGVL 4JDVB 2IALA 4KROC 5JNYB 1AGBA 4ODXB 5DRZA 3OR7A 3GHEH 3GMLA 43C9B 4Q6IA 4F37K 3MA7B 2NY3D 1BWMA 2DWDB 4HWZA 1I9EA 3H9HA 3QXDA 5C0DA 3A67H 3BMVA 2E9WA 4QTHB 2XKNB 4L8SB 3WEXA 2VDML 5F7NC 5C07E 5JNYA 5J57B 5KN5B 5CIPH 3QFJE 2R1XA 3VFNA 4JVPA 4UUJA 3PWPA 1RK0A 2NY2C 2YPVH 3O3DB 2OQJA 4LCIH 3EFDL 5DEGB 4XB7A 3CUPA 3BVNA 3TC9A 4ZFOA 5HHPA 1EUUA 2DM7A 2WBKA 3BEWA 4KXZH 2W92A 4PJ8B 5HVWA 3HFMH 4GAJL 3RPIB 3WCYA 2G5BB 1M4KA 2AJXL 3IDUA 1FZKB 3QEQE 4GRLB 5JPNB 1YMMD 3BN3B 1ROWA 4MWFB 5DT1L 4BSWA 4XWOC 5DRXA 5IB5A 1OGAB 5LQBL 1I9JH 1G9MH 5BZWA 4DKFH 5DUML 2NPLX 4EZMA 5DFVC 4GXVH 3ARDD 2PTTB 3GMMB 1WZ1H 3E0GA 3EO0B 5ITBL 2XA3A 2CDEB 5BW7C 3VRIB 4CVXA 4HLZG 3GBML 3MUHL 5J1AA 1SY6A 1IGTA 2VKXA 3V0WL 4CMHB 4FXKA 2FATL 4A2MA 5JW4R 2DQCH 2YWZA 2JTDA 4HH9B 2W9DL 1EUTA 3O6FC 3I6KA 4RGOL 2PYFA 1QFWH 4NJ9L 2XQBH 1AR1C 1CGTA 1UCBL 12E8L 1ZVSA 5CZVH 3AS0A 5C09E 4EVNA 5DJAA 3VXTB 4G80A 15C8H 3STLA 3SDCA 2WUCL 4Y4KD 4APQA 3H8NA 5FGBC 1YDPA 5GGQL 4LPCA 4PJBE 5INCB 1YJDL 1YEDA 5EORH 3S36X 3FN9A 4DN4H 3DMMD 1KIRB 1WIPA 1ZT1A 4LCUB 3UJTH 4AIXA 4MQ7A 3DETD 5KSVA 2WBWB 3ARQA 5K9OB 2LQRA 1Y18A 1ETZA 5GZND 4PJHA 3HI6H 1MUJA 1JWUB 3G9VA 5INCA 4JM2D 5HYFA 2OZ4H 4J3WA 1KTDA 3MJ9H 5HGHA 4WCYH 4R4ND 3JV5A 5CLTA 3PXJA 3VG0H 1KT2A 4L8CA 3UJTL 1HNGA 3FL7A 2AW2A 3DSFL 3T3MF 4D94A 3MJ9A 3NFNB 3RFZC 3DX8A 1KJ2A 4NFCA 2EDHA 3T1FA 3CMOL 4LPVA 4ELMA 2PYFB 5DURB 5I16A 2DS4A 3C08H 3V4PL 4ZO9A 4HHAA 1LEGA 5K93A 2H32H 5JIIA 2NYYD 3L5WB 2EXWD 3O6FB 4LASL 1TPXC 2UVFA 4D9LH 2X4PB 5GPRA 3FO9B 3O4LD 1OAZH 4RZCB 5FGRA 3ZZ1A 1KBGL 4WHCA 4UT9L 3EGSA 4WTZA 3I9GL 1IBGL 4KUCF 5F1NB 4E42B 5EUOF 3QPXH 3VD3A 1Q9OB 1PX3A 2FSEA 1CFVL 4JZOA 2ATPB 4LSPL 2QQKL 3MYJB 5KW9H 3MV8B 3IDIB 3JTTB 1K8DB 1YEFH 2VZSA 3SGEI 2XPGA 1YNTB 4DQOL 5EU7C 1MJ7L 1OP9A 5C0AA 3I9GH 2HLFC 4PLNC 4JFQA 3PGFH 3SBWA 2E27L 3C87A 1QQDB 1SJEB 1QLEL 5D1ZC 2BMKA 1ZGLM 1U3ZA 2HVJB 4K07A 4PJDA 4JFQB 3KPRB 1NEZG 3BGAA 2VWEC 3VXSD 1K2DA 4NN6C 1UXSA 3GDBA 5I73B 2MCG1 3TO4B 3EHBC 2YZ1A 3T65A 4K3GA 1QRNB 5CJ5A 1LK2A 4ZO8A 4JJ5B 4Y4KA 4YFDB 1HXMA 3K8KA 4GW5A 5IIEA 1OLZA 4Y4FA 2FLBT 1YPZB 3H42H 3FO9A 4K7FB 5FM5M 1DN0A 1AD0B 3EO9H 2E8YA 4KPHL 4J3UA 2O26U 3K46A 4ODHH 4ZPVA 5KSAC 4TVPL 4IOFD 1HHIA 5IF0B 3VXNB 5ISZB 1NLDH 4X99A 4U49A 2F54D 3MLSH 4YC2C 1AY1L 4ELMB 1NEZA 1GGTA 4NNXA 3FQWA 4I5BA 1HEZA 4LSQH 4MA1B 1A1MB 4YHZL 4P5TA 1LWRA 1T1ZA 3OJ2C 1X3DA 2YPLA 5K9JH 1LP9B 1KXQE 4L4TD 4MCZA 4OIAA 4PB9H 4N0YL 1HILA 1IT9H 2XN9D 3SDAC 1QOKA 4YXLL 5JDJA 3QI9D 5IVNA 1KTDB 3VFMA 4KI5E 4HK0A 2A9ML 3EYSL 5D7LE 2RBLA 3LKPA 5KZCD 3WKNA 4JQVC 3HMWL 3KS0H 4HUWB 2EDOA 1DSFL 2FB4L 1X4ZA 5EORL 1WSST 3I6LD 3NCEB 3PXHA 1JZ2A 3CXHJ 1KLFA 1TMCB 5GRJH 4CRPA 5DK3A 3HR5A 4L8BA 3SY0B 2CH8A 5SWZE 1KF9B 3N50A 4J7RA 1UENA 1FG2B 1XH3B 4N0UE 1I8IA 3L3OA 4P3DB 1RHFA 3BI9X 4GMSL 3LMJL 1JTTA 2JIXA 4AEFA 1LO3H 2WBJA 1XR9B 5J13B 4D3CL 4QOKB 5FKPB 2Y07H 1U42A 3CX5K 4YO0A 3EBAA 3CC5A 3VWJB 5TH2B 1NUGA 1R5WB 2BVPB 3IT8D 3DVFA 5JDSB 4QEGA 2JB5L 2V17L 4KTEL 3UTQB 4F7PB 5C0ND 1Y0LA 4OLZL 1YQVL 5EFIB 4MA7H 4O51B 3SKNB 2MJWA 5D7LA 2BZDA 2QQQA 4OLUL 3MREA 1JBJA 4GRWE 4DGVL 3BDYL 3QDMA 3I3EA 5F9JB 2RGSA 1IBGH 4G6AD 2D03H 5DJYB 3L5HA 2YK1L 1N3NA 3MJ8A 2ICWJ 3RA7L 1YYML 5EG6C 3T0EB 3HRZB 3ARBB 4BKLB 1MFCL 5IHZB 2D7PA 2RQ8A 2AXHA 5E9DD 5BRZE 5KW9L 2JJTA 4HKJA 2EECA 4A6YB 1JN6B 5SX5H 1I1YA 3QHFL 5IQ9A 3V79C 1NCDH 3TPKA 1R5WA 4X8XA 3N1PC 1NC4D 2GITB 1C5CH 3TCXA 1BLNB 1DQJB 1VFAA 1DL7H 3OXSB 1YYLH 4O9HH 4Z5RB 2P8LA 4ZTPL 2XTJD 1YA5A 2R2BA 4ODWB 5F1SA 3OR7B 3RKDC 2IADB 4ZODA 5DJCA 5D6CB 5CHNA 2GI7A 4JO3H 2IAMC 1MFNA 4ZTOL 5L2KE 5LGJA 2CIIA 2FEEI 1FGVL 1XGQA 3JTSB 4PGEB 1ZWIA 2SEBB 3H42L 3RQ3A 4FMKA 4PPTA 2PETA 5E6IC 5HGAA 3ZHLA 1JGEA 2WM0A 4WRLA 1NCWH 1DBBL 4F8TA 4H5SB 1GC1L 2LABA 4M6MH 5H35A 1MCJA 4XVSH 4XZUB 4XVJL 4F7CA 3S5LB 4Z18A 3MCLH 1YNLH 1HZHH 4JN2B 3G5YB 3VMPA 1K9TA 1B90A 4NOFA 5CD5C 5IBUB 1PZUB 2ZUXA 4JFZL 2NLJA 4OLVH 4GRMB 5CJQL 1L0QA 2MPAL 4M3KB 4X98A 4GXVL 4XCFL 1CICA 4XBGB 3U46A 4MXQD 4XMLH 5EWIL 2FATH 3QUMA 4Y1AB 3ARGD 4Z7UA 4OCMC 4UV4H 5DK0B 3GSVA 3QXAB 4W6XB 2H32B 3ZSSA 3G6AA 3NIDE 5GGUA 5C9KA 1RY7B 5CZKA 4R0LB 1BZ7B 1YMHB 3BP7B 2IAMD 4U05A 3QQNA 4PD4J 2D7QA 1EEYB 5L8KB 1QLRB 5BJTA 3KYOB 3CGTA 3P4OA 1FIEA 4ERSL 3TA3C 1IAII 1T04B 4XPHL 4MAYB 1SVZA 4GG8A 1JHLL 8FABB 4WW2A 3V6ZB 1BQSA 2B1AL 2QSQA 3CVHB 1V3MA 3C5ZB 4HC1L 5KOMC 1AQKL 5C0RH 4K8RC 1NDGA 1HI6B 2VL5A 2D2OA 3P9MB 3KS0J 4HGWA 3VXQA 3HC3H 5J4MA 4M7ZB 4Y89A 4JKPL 3NFSH 1I1FA 3UJJL 4E5XB 1F11A 2VAAA 1T6WA 1EHLH 3D0LA 4W70A 4DOHE 3QCVH 4E41B 5GRVL 3T2NL 3IDXH 1WIUA 4KHXH 5EBMA 4M48L 4Z5RA 5E0QA 4TUKL 2AV7B 4JRYA 4HWEL 1UB6A 1Q9WA 1BLNA 1AKJD 3L7EB 3OKEB 1V7NL 2J8UE 1FZOA 3P9WB 2CLRA 2GITA 3UTOA 4U1SB 3UBXB 2IPKA 2X4OB 3EZJB 3KYKH 1DVFC 4BQ9A 3N9GH 1FG9C 4GG6A 1WAAA 3MV7E 4Q9RL 1SEBA 2IPUK 4PRHE 4D0BA 5FUCC 5CZXD 3TGXA 4L5FH 5C0FB 2CRZA 3NBNA 4HC1A 2WIMA 4EDXB 4JY6A 2W0FB 4AIOA 3ECBB 5KVGH 4XP5H 2FX9L 1YYLL 1A1OA 3ARFD 2QHLA 2DI7A 4LSUH 3T0EC 4HX1A 3MRLB 1CGXA 1T21A 1X5YA 5F1IB 4YGAB 3LSOA 2D0GA 2EH8L 5DQJA 5BO1L 2E6JA 1WZKA 2VR9A 1REIA 4AENB 2IG2L 3D18A 1MIML 1QLEH 4YDLC 5I71C 2FZ3A 3BIKA 4YO0B 4TNVF 2A9NL 3UP1A 5DD6B 3V8CA 1P7HL 2PUQT 2YRLA 4IRJC 3MJGX 3MRHB 5EZOL 4I3GA 3G6AB 2XKUA 2HT3C 3EDKA 3ZKND 1CLCA 3LRGA 1N8ZA 3QIWD 5TQ0L 1MH5B 3MR9B 4M6OH 3OPZH 2KDGA 3NH7H 1JTOA 1LE9A 1SHMA 3C8DA 4XNXL 2YD1A 4G8FB 1QSED 2EEDA 3V6OC 1ORSB 3SOBH 4TSAL 5FHBL 3MODL 4J8RA 4H25B 3RDTD 1A6WL 2Q20A 5D7KD 3LEVL 4I48B 3D3VB 3DVNA 1MAML 4ZFZB 3AREB 3ULSB 4FQXD 3HZVA 4YK4B 4PRIE 5E56A 1P84K 3D39E 4KMQA 5F7MC 4XNMB 3N1QC 4K71C 4KZDL 2FIRT 4HIIB 2R2EB 3P4NA 5KS9B 4G8IB 1TENA 3C08L 1KELL 1ORQA 3V4PH 3S35H 4X6CB 1U8HA 2WV3A 4AQOA 2O5YH 3AS3A 5DYOA 5DO2D 3P40A 4G8GB 3EYUH 1BBDL 1BPVA 4PRPB 3VXNA 2RHEA 4MA1C 3CZJA 1MY5A 4JG1H 4ZS7H 1IEBA 3D69A 4OM1H 2X1QA 1YMMA 4MAUH 5FM5O 1CDIA 5C0JB 5D6CA 4KV5E 1KPRA 4Z7NF 4AZ8A 5B4MD 4LKXA 4GSDL 1B4JL 1RIHH 4MX7A 4X5LA 5FYKU 2Q3AA 5CIPA 5F7FA 5MP6L 2I26N 3MRBA 3WDHA 2KZ1B 3GUTB 3NA9L 2GUOB 4JKWA 4EDWH 1HINH 4M02A 1AGFB 3LS4L 1XCTB 1YNKH 2XYCA 3VFPB 1FFQA 2FR4B 1G7LA 4NKIL 3ES6B 3RUGF 1QP1A 1MJUH 1NGPL 3LS5L 1I85C 5A2JH 4U1GB 1DJSA 3QFJB 1HHGA 2XZZA 5FDWA 3LKOB 4JY5L 2B4CH 4HKJB 3HMXA 4PY7B 1UA6L 1G6RL 4ZFFB 4DKFL 5C09B 1IGFH 1E28A 4X6CA 1T0MB 4NT6A 5C0AB 4HJJL 4QHKJ 4OJFH 1OCWH 5B4MC 1MI5A 4CNIA 4OFKA 4J6RL 1MHCB 5F44A 4AH2A 4ELME 3OKKA 4NP4H 5DURD 3W0WE 2XG4A 3CMGA 1F4AA 1B0GB 1VFMA 3FFCE 5IEKB 1KCLA 3RVTC 3MV01 4U2ZA 4OZGB 1ADQA 3WN5A 4HLJA 3RX7A 1JZ8A 1EO5A 5GZNC 1BOYA 5SWQA 4ZUUA 4RIRA 1F5WA 3ARFC 1H0DA 3WHE0 4OD2B 2B0SL 1G7JB 1NBZA 4OZFA 4OM0H 3QJFA 5EZLA 4P4KC 1Z9LA 5IMKA 5CZXC 5MHSE 1GGYA 2IWGA 3KR3L 4JFDA 3BKJL 3LKQB 3DRQA 4LHUB 4QHUB 1KYOK 3SJVE 3W39B 2DIBA 5L8JB 2QADB 3QUYA 4ZXBA 3D25B 3ELAT 3FRPA 3H9SA 2DDQH 4S1DC 1MCIA 4Y19B 5HJ3A 4PRDA 3O6FD 2YD4A 4OSUL 3QNYB 2JJSA 2R0LL 3T0VA 4GQ9H 2WWMD 4HXAH 5C2UB 1CI5A 3C60A 2EYTA 1JWMA 3EFFB 2C7UB 2ESVB 3LKSB 3ECBA 3B5HA 3TZVA 2ZSWB 4PJ9B 1JI1A 4G6KL 3ZTNL 5EUOE 4XX1G 4Y5YC 5TFSH 4HMEA 3IDYC 5DHVB 4UNVA 3W5MA 3G5ZB 3WFCL 3KLAB 3VG0L 3PL6D 1P69B 5EOTA 4DGIL 2FJHA 5IMMA 2WSKA 4OCSH 2YXMA 2NW2A 3QDGA 2IEPA 5E6IA 4JN1H 3L7EA 1R3JA 3ZDXE 3AAZB 4FQCH 4OLWL 4P5TC 4HKXA 4O2FB 1BVKA 4N0RA 4XPTL 4NQXA 7CGTA 3MGOB 1T4KB 4I4WA 4P2CG 4G3YH 4RX4D 1A3LL 5K9KA 4WWKB 1NSNH 4CADB 5A2LH 5EU5B 1R3IL 3DXAD 4ZFGH 1CF8H 3P0VH 3MRGB 4FQXB 3F6IA 4XC1H 1I4FB 1VPOH 5I6XB 4PJ5D 5BZDB 1D9KD 3P9MA 3VXQB 1NFDA 2AP2A 2G5BA 1OAKL 3X11B 4G5ZH 1IEAA 2ADJB 3TV3H 1QYGH 5ISZD 1GGIL 1SYVB 3CLEL 1JPGB 4D0CB 5SWZA 1UJTA 3O3DA 5HYIA 1C1EL 5JHDB 4OD3H 1OTSD 3D0VB 1RZJL 2XWBB 4QRRA 4AEEA 4HIXH 2GW5A 2VLJB 5DQ9A 4NQVA 4OUOA 4C55A 4OJFL 1QYGL 2DWDA 4HWZB 3DI3B 4LEXL 5ETUA 4E42A 3QJHA 4F9LA 3LHPL 2HFTA 2IPTL 1J8HE 2HFFB 2GSIA 1CT8B 5IBUG 4RGMB 1YY8B 2NX5E 2P5WE 4ZS6C 2DL9A 3ZO0A 5IMLA 1AFVH 1LEGB 3MBXH 1C08B 1MY7A 1ZHNB 2HJFB 2VDOL 1UM4H 1CDBA 3B9KB 3PGCA 4X9GA 3FO2A 3MXVL 2DLFH 5D72H 1TQCC 2IAMB 4WHYH 2RFXB 5CINL 3O81A 2NY4C 3AB0C 4ZUSA 2QHRL 3RWJB 1TDQA 3MRJB 3MLRH 4FZEH 4ZS6D 4LEOA 5DLMH 1JGUL 5DD1H 1KT2B 4HXAL 2P5EE 4L8CB 5M94B 2FO1A 1LO2L 1FV1A 1MCFA 4YZFE 2EDWA 5I17A 1S9YA 4QT5A 3VU2A 5D72L 1ZOXA 5JPMA 2GY7B 3GSNH 4XNZB 4R8WH 1ZVYA 2DI8A 4P57B 3VH8B 1H15B 1NGXB 1GGBH 2IH1A 4LLAA 2WUCH 5BCAA 4WFGD 3C6LC 3EJYC 5FO7A 2JJWA 4XB8A 4K94H 4WI6A 1GL4B 1IT9L 2NY5H 3FQUB 3WFCH 1K3ZA 1AO7E 2CR6A 4HWUA 4PRHB 4XXCA 2XI9A 2E7LC 4C57C 3MLUL 3WNOA 3U0PA 1IGML 1PEWA 5FUCE 1S9VB 5CEXA 2ICCA 3P0YH 4EI5C 1XEDA 2A73B 2B4CC 1U6AH 2V5SA 4YC2B 2PCPA 4WFEE 4S1RH 2FJFB 5FUZL 1Z3GL 3CH8A 3GI9L 1ZA6B 3KXFD 2CUMA 1KCSL 5DI8B 3BKCH 1WFNA 4YHML 4PG9A 3FQRB 2IBZY 4YR6B 1UC6A 4WHTA 5C8JB 1O7SA 1LD9A 5H37G 3H0TB 1E0OB 3PNWB 3HUJF 4GLRH 1GZQA 5ALBL 2R23B 5J13C 1H3GA 2J8UB 3R4DA 5C0GB 3O2VH 1NMBH 3B9DA 5B38B 3PL6C 1EFQA 1CGVA 4EUPH 5ESQA 3PJSA 3RGVA 3IXAB 3MBEC 3LKRA 2Y06L 4MNHA 1R3KA 3W5NA 1DLHA 4HK3J 3M1BA 3WFHB 2HMID 1P2CA 2XICA 5HHXH 1CBVL 3LCYA 4LIQL 2AJYH 4EXPX 3WUWG 1P5UA 1PEZA 3BEWB 1FVEA 5I8KL 3TWCH 3TYGH 2NQCA 5I1CH 1IJ9A 1JF1B 1EK3A 3QXWA 4JHAL 1JUFB 3P73B 1TJHL 5EO0A 4G5ZL 1SMOA 4RFNB 5KN5A 2IFGA 3RVXC 2CIKA 4X4YA 1IC5H 3KPNA 4QHNB 4XP5L 4OZIF 1D5BB 4NRYA 4RMVA 3QXDB 5EBMB 2LVEA 4Z78B 1FN4B 4APQD 1LDPL 1NCCL 5KS9E 3C6SB 1MLCA 1DZBA 5DRZB 3WLWC 4AQ1B 1F11B 1R3KB 2R69H 3QHTC 3IDGB 5KBNC 1T89C 3GSXA 3P0GB 1QO3B 2VNCA 5FGCB 1WT5C 3H7LA 5FO8A 2H2SD 1G7MB 25C8H 1AQDB 2ZUQC 4GAYA 4LQFH 2EH7L 3UTSB 4R4FL 5FO7B 4Q6IC 3TBSA 1K4CA 1XCQA 2IH1B 3QEQA 3VFOA 2V9TA 3MNVB 3GI8L 1T1XA 2DQJH 3B4NA 4M1DL 4ZTOH 2W07A 5T33H 4XP9L 5I8OH 1LMKA 4LSQL 5GS1B 5FK9A 4WUUB 4R4FH 4NNYB 2A74A 3A6OA 4PJEB 1G7QA 2YKLL 5I1HH 2H9GA 4TULH 2YMXH 2C1OA 2FHBA 5CAYB 4J2XA 1F4HA 1H3XA 1LO4L 1KN4L 1ADQL 5GGUB 4PP1C 2VIRB 2NMSA 4Y1AA 1S9VA 3HNSH 3MLTB 3BO8B 3SDYH 1KCRH 3AY4A 4JQIL 2J12B 3MOBH 1OSPH 4PRHA 4FOMA 3WS3A 3QG6B 5LWYH 2VLKB 3MRQB 1RD6A 3OL2A 4QXUL 2PKDA 4L4TB 3JV4B 2O61B 4JJ5A 4X6BB 2BVOA 3MGTA 3CDYA 3RZCA 2WZPD 4X5XB 3TH4T 5HHNB 1LNUB 1IGYB 1QEWA 1EFXA 3PP3H 4WV1B 4GO6B 2H26A 5ICXB 4PTUA 1U41A 2W9LA 1G7PB 1LDSA 4P23D 2CGRH 2NYYC 1HYRC 3P30H 2BVOB 1KPUA 3MGTB 3SGJC 1BIIA 1U91A 4WJ5A 3VXOA 1J1OH 1CD8A 3U9UB 2NXYC 3GSOB 1MJJA 4Z7VF 1FH5L 4PGEA 1S78D 2P8MB 3ILPB 1RZ8B 3QUXA 4ONOA 1FFNB 5E4EC 5AYUH 5AZ2H 1MCQA 4UAOC 1T5XA 3QRFM 1K8DA 3MLTA 3IKKA 4M43L 4M7KL 5E4IA 1MJ8L 4WW2C 4L3CB 4YPJA 2GHWB 4XP6L 5D7IA 3UX9B 3IAQA 2F74A 3ILQD 3OKOA 1AGCB 4NPYA 5D2NB 2ED7A 4KKBC 2VLJA 1D7FA 43CAB 4X4YB 5F9DC 1OGAD 4IMLA 5LAXB 3ZYIA 2AJVL 1RZIB 3AMKA 1KPVB 3KXFE 4QLRA 3FOLB 3OGCB 2HLFD 3B9EA 2VXUL 3E6FA 5GGVH 3SPVB 3B8YA 4ZO6A 3HC0A 3WS6A 2AV1B 1OARL 4LLWB 3UROR 1E4WH 3AFLA 3O6KH 5KSUA 2H2PC 1A7BA 3Q5TA 3GJFK 3SDAB 4OQ1A 5HYQB 4GKNA 4PJAB 5CILH 5CCKH 1RV6X 1AE6L 1IC5L 3IJYB 3BZEA 4OF3A 2OTPA 4YHOH 3LKSA 4HAGA 1DBAL 3VFSA 2BVQA 3DUSB 5F71A 3B5GA 4YDIH 1E4XH 5B38A 3PWPE 2KBGA 5T1DH 3ZYJA 5CEZD 1VSCA 1ETZB 1E4WL 1ODAA 3BDBA 4Z78A 5D7LB 1UEYA 5JOFA 4C54A 2C9AA 5HYJB 5JW3H 1YMME 3ARDC 1JGDB 1T1YA 1JV5A 2NY6B 1OB1B 2F8XC 4YNYA 5CEZH 4MQXC 2GT9B 2WAHA 1FNSH 4LVHB 1IARB 3MX0A 1C16A 4NZTH 3IDMB 1JF1A 5GXBB 1WLHA 4UILL 4RFOH 5DMGC 3L1OH 4UT6L 4JM2B 4WFHE 4L1HA 1KXVC 3DSNA 5DHVA 3QIUC 3HE6A 5ITFB 3S9DB 5TQ2L 2DQGL 5D93B 5E24E 3GJFH 3HNVL 1QD0A 3GSWA 3U9PH 5KVFH 4ELKB 4BSVA 2X89A 3QEHB 1CDYA 2GAZA 3BT2H 4DKEL 5IGXL 2QKIB 2V7NA 3T0BA 1CCZA 4ZAKA 5LXGH 2X9YA 5I75B 3GMMA 3W9EA 4U6HA 4CW1B 2IMNA 4C83B 4JQIH 4Z7QE 3LN4B 4O5LL 1OGAA 3QUYB 4ZXBB 1X4XA 3W0WA 3PABB 1WK0A 1MI5B 1GPOH 5F7KC 4YZFF 4X7SH 2K1MA 1NJ9A 5CGMA 3AS2A 3I02B 4K3HA 3LQAH 3MV7D 1XGYH 4UB0H 5GSVA 4UTBH 3SKMB 5CMAB 2EC9U 2NY1C 3FQWB 1F6AA 4HIJA 5F97E 1OAZL 3A6BL 1FO0L 4Q7DA 3T3ME 4UOW0 3S88H 4Y5XA 1X5XA 1WICA 4YHKL 1BFSA 4QRUB 4K94L 3BPLB 2XKSA 5EULV 2D7TH 1HE7A 2EDFA 2O5XL 3Q6FB 2GQHA 4Y4FB 5ID1A 4NRXB 4YHLL 1U92A 2AK4B 1A22B 3DX7A 4R90L 4Q6IB 1A14H 2X41A 3OKKB 5CJBA 4PJ8D 1A8JH 2BFVL 1HQ4B 5HDQL 4MAUL 5IJKC 4I0KA 4HPOH 5L9DH 1J0HA 2HT4D 5D7IF 3DGCR 5T5FH 3IDXL 4KHXL 1R0AH 4UBDC 4P9HH 3VG9B 3ZKMC 3RWJA 1JCKA 5C08B 3U4EA 5DZNA 3ZTJG 1U93B 2J4WL 2RFXA 4ZUSB 3ARGC 1A14L 4L9LA 5DUPL 2BXZA 3F65A 4QRQB 5C0CD 2BSRB 3F5WB 3IJHA 3MMEB 1FFOA 1MRCL 2VXUH 5IG7A 4JG0H 4Y4HC 1U8OB 3DBXB 3KYMA 1BEYL 3HR6A 3MJ7B 1BQLL 2GJZB 1FBIH 2X5PA 2I9LB 4WO4C 4OLUH 2P48B 3C8HA 4I77H 5C0AE 4P2RB 4I4WB 3HB3D 1N59A 2PW2B 5JOPD 2AXGA 4TUJB 1BVKB 4H1LB 1CU4H 2NR6C 4G6FD 1LVEA 3VRLE 2ZOKB 1KIUA 5JHDD 3QDGE 2P5EB 3HI5L 3CLFL 4P2QD 5I8EB 3GSQA 2X4UB 2FJHB 1U3HD 1IEBB 3D69B 1QR4A 1AGDB 2CXKA 4ZOBA 2P46B 1TZGH 2AEQL 5E6ID 3GEWB 1F6AB 2YUVA 4HIJB 1D9KB 1AC0A 3WLWD 2LAGB 4BZ1L 1IAMA 4FRWA 4WTWA 4O4YH 5DD0L 4YHPB 1Q94A 2ZSWA 3SE9L 3MQIA 1F3DH 1D6EA 4J4PA 1HKLH 5F9OH 1IE5A 5GJSL 4ZSOA 1JWMB 3RVXD 5TQ2H 3QAZC 2DWEB 3DRTA 2Q87A 2DN7A 1A5FH 1KC5L 1PG7X 3W0WD 4DK3A 4IDLA 1CDJA 4OFPA 4K3JH 1ZT1B 3GFUA 5HI3C 4JQXC 3S34L 4FFWD 3VWKA 3S96B 4Z7QF 3FAXA 4NDMA 3MRLA 1LE9B 5I0ZA 3JWDH 2HMIC 1INQB 3VG9C 5HHME 1NCWL 1NCAL 1S9XB 1NGZB 5FUOL 4LARL 2LVCA 5J56B 5IT2H 4JRXB 4JPWL 1MQ8A 3MOAH 3K2UL 4OKVB 4JDZB 3MCKA 1VERA 5FA3B 2ZUWA 5EU7E 5F21B 4QGYA 3U82B 1OTTD 5IR1A 4ZUUB 3LVEA 1UYWH 4LF3B 3I75A 2E5EA 2IPKB 1CE6A 4G6KH 3ZTNH 3HPLB 4Q58C 3JSSA 2X70B 5I1JH 3EO0A 4EUPG 1K4DA 4TTDD 4PR5B 5C0NC 3UO1L 4LLDB 3AB0B 4D0DA 2P1YA 3FN0L 5CUSL 3G6DL 3DRTB 1IAOA 4AH2B 1JYVA 3TBVB 4EI5D 4F15C 4M7LT 5AUMB 3X3FL 2BOCA 4G7YL 1L0YA 3O9WB 2IQ9L 3BGFC 5JPNA 1NDGB 2VL5B 4M5YL 5IB2A 4P5MB 5D70L 1PKQE 2YD3A 2VMFA 1R3HB 4KGJA 2X44D 3LD8B 1S9KC 1W2KT 4L4VA 2ITCB 4GW1A 4PJ7A 3U4BH 3FAWA 5DVOA 1AJ7H 3GMRA 2C4XA 5L88H 3DIFB 4PJEF 2CLRB 3CVIL 1QLRA 4K94C 1NFDF 4YXHL 1KNOB 1TZGL 1Q9WB 3HFML 3RA7H 3RVUD 1NC2D 2GUOA 4ZNEA 2MKWA 5B8CB 2V2WB 3Q5OA 2ZUSA 3ZKQD 2PW2A 3CSYB 4FXGB 3PWJA 3GSVB 2VAAB 3B5TA 3QI9C 5JW5B 4R96A 2XZAL 4EQ3A 4JDVA 1HKLL 3D5OF 5C07A 3BPOB 5E94B 2F54A 2M2DA 2E9IA 1AXTH 4UTAL 5D96B 5FYLD 4G8GA 1MRFH 3GKWH 3IFPB 3ZYZA 5C0EA 1TJIH 4FMFA 4QRPB 5CBAA 3G5YA 1NAKH 5D71H 3N0PB 4WI3A 4EOWH 3OAZK 3UDWA 3B6SB 3MLXL 3OKDA 4WNQB 1Z5LB 4M4PA 4S1QH 1CFSB 2D31B 3QXTA 2J88L 1FGVH 2FX9H 5HHNA 3O2DA 3GGWA 3KPPA 2EH7H 1E4XL 2W91A 4FQ1H 2AK4A 2RJMA 5TJWK 4DN3H 4PRNB 1SJHA 2NW3A 1A21A 1YY9D 3UBXI 3O45A 3H3BC 1CL7L 4ZUWA 2EIEA 5IBLC 1N2RA 4FFVD 4U6YB 1KJ3H 1T66D 2FX8L 1FFRA 1NGYB 4FQ1L 1U8QA 1DEDA 5DJDA 4UT7L 2OJZL 1GGCL 1A4KB 1U8HB 4PJXF 4F7TB 4WCYL 5I1DA 3QDJE 3SQOL 1DP0A 5C1MB 3AGVA 5JUEH 2VDLL 5GS1A 2D31A 2VDRL 1AIFA 4LARH 1RZGB 3DMMB 3HC4L 3BH9B 3QA3A 1FLRL 2X1WL 3HE7C 4M62H 2HKHH 1BM3L 3MA9H 3NH7L 2UZIH 5HTSA 2C4FT 1CIUA 4NKDB 4XPFL 3S36H 4QHKI 3F58L 4NN5C 1RUAL 1I3RA 5IP4A 4XNYH 1WBZB 5DQJB 1KACB 5EB9A 2NXYB 3LIZH 3GMOA 5LGJB 4PJBB 2BP3A 4U1KB 5KTEH 3RWIB 5DSCA 2V7HB 1WBYA 2V17H 5F9JA 4JY6B 5DMIL 4QY8B 1QR1B 3IS1X 3KPMB 4KK5C 1XGRA 3JUZA 3TFKC 1CD1B 3C09B 1IAKA 3QUZB 4TYUA 5IMOA 5E1HB 2X4RB 1A6VH 3EOYG 1DQLH 3BKYH 3PV7A 4JQVA 1MCEA 3P73A 1SY6L 1E6JL 3IJSA 5FKPA 4LIQH 1S5IL 3T77B 1K85A 5GZOC 3E2HB 4QTIL 1CGWA 3KPLB 4Y4HB 2NZ9D 4KHTH 5GISL 1J11A 1MEXL 1I8IB 1LK3L 5AYQA 4HX1B 5E8EB 5FYLH 5GRUH 1DBKL 4HKZA 4U3CA 5JW3L 2DQFB 2IC2A 2P24B 5HDQH 4NO0D 3TBVA 5J6HA 2Z93A 2ZCHL 5T33L 1HI6A 3C8KA 5T5FL 2ZOLA 4JLRA 3JZ7A 4Y5XC 3SGKA 1FCCA 4CVWA 1NGPH 3HC0B 3ZE1E 1UWXK 3BP4B 2JLLA 4K9EL 1ZLUK 2ENYA 3LKPB 4LOUD 5DUPH 5EC1B 1OAQH 1AHWC 1BQHG 1A3RH 3QA3B 3BZFB 4TQEH 3F7YB 1J18A 3HG1E 4MCZB 3PHOA 1IFHL 3WXVH 3EYOA 4F7TA 5I1DB 4OF6A 4PB9L 5JQ6H 3TF7C 2A38A 2MTPA 4GKSA 2VRAA 2DQJL 4M1DH 1NGZA 1IKFH 2G2RA 3MGAA 2ZG2A 3TP4A 1EA9C 3IGAA 4JHWL 1BOGB 5ADPH 3RWDA 2E7CA 4WHDA 1YC7A 5EUKA 4XP4L 1OP3H 1R24B 4ZUWB 3QXUA 1QRNE 5KJRL 1T3FB 3V95A 5EO1A 1GJIA 3VXSB 4HUWA 4P59L 5JO5A 1CE1H 3FN3A 2EDEA 8FABA 1G6RB 3ULUE 3NVQA 4IDJH 4M6NH 4JFDE 1UVQA 3VFMB 1T83A 3OKDB 4WV1A 1A0QL 1ND0A 1D6VL 3L3DA 4Z7WE 3EO1A 1Q94B 2VDNH 4HFWB 4LP4A 3D3VD 3BP5B 3NCYS 4NZDA 3RNQA 3F7VB 1QKZL 2VZ3A 5CSBA 4KROD 4POUB 4H0IA 2VLKA 1EO8L 2NY0D 4DCQB 4U6XA 5F3HB 4HBQA 4MNGE 3V5KA 4FA8A 5IVXB 4YHNA 4OGXL 2VLLA 3QR2A 4RAUB 3L7FB 4GUPA 1E6JH 4MA7L 4BFGA 1FORL 1TCRA 4MJID 2WANA 3U7AA 2CDFB 5EUOA 4KRPC 4BQCA 2QQLH 4JFXA 1F4YH 1QFHA 1QRNA 4RGNC 4PJXB 1PAMA 1MCCA 1K2DB 1CLYL 4ETQB 1BJMA 5IQ9B 1RK1B 4JJHA 1ZHLA 4PFEA 4NQCA 2AXFA 2RCSH 4X5WA 3X11A 1ZWIB 5C7XL 4CN4A 1V7NH 1BBJB 2ILLA 4CJ0A 4QHLA 1INDH 1S7RB 4F15B 4ONGH 3WNPA 4DZBB 1DQTA 4TNVK 2Y6SC 2HG5B 3WBDA 3CK0H 3QZWG 3QDJD 1Y6KR 2I27N 2G9HB 5JLZB 4NWTH 3UJIL 3CJJA 3QUKB 3CZFB 1D5XA 3TT1H 4D9RD 1JGVH 5GRUL 3QNZA 5FOJA 3BHBA 4U4BA 2A77H 4MQ7B 3SDXB 3STZA 1U58A 3PDOB 2AJ3B 3BEVA 4Y88A 2MQCA 5D96C 2FX7L 3CC5B 4KJWC 2Z35A 3JXAA 1G0XA 3EW3B 4JRXD 4PJCF 5GIRA 1TVHA 1Z0NA 2P49B 4F57L 4P49A 1UM5L 2EDXA 3QWRD 3BYTA 3T2PA 3RWFA 1YPZE 2A6DA 4R7NA 4OF0A 1WZ1L 1CFQA 1VFUA 4KK6C 4N5EC 5EN2A 4QXTA 4L4VD 3PABA 5ESQB 2YD2A 3I50L 3LEYL 2DQCL 1G9NL 2C3VA 1OTTC 2XFXA 1M05B 1U8LA 1ULVA 2HTKD 3BDXA 4KQ4L 1HSAB 4LCWE 4U6HB 3HNVH 4NQTA 4F7PA 1KXTB 4R7DA 5C0IA 3DTXB 3LQAL 1HIML 2I60H 2BVPA 3L3HB 5BOZG 5LWYL 4OZHB 4U1NA 2DWEA 2G75B 4ZNCD 3QUZC 5IGXH 2YC1B 3SOBL 4X7EC 2X42A 1GXEA 4U1MB 1D6EB 5DGQA 4PGDB 3RWHA 1JI2A 3TH3T 3QJFB 5EZLB 5H8DA 2VABB 3HMXL 1GIGL 3ULVF 3TBTA 1FDLH 4R26H 2F19L 2R56H 4UMGA 1TVHB 1G84A 3MBED 2YPLD 4HH9A 1EJOH 4FQCL 4OLWH 3RKPA 4RIRB 1OSZA 3K4DA 3UO1H 2FLRT 4C58B 1WTLA 4RRPA 4KK9D 5H37H 4M1GH 5J1AB 2RAMA 5DC0A 1G0YR 4ISVA 1KTLB 4G6JL 1OAXH 1X5FA 2YUZA 4P46B 5DVKA 2VITB 3RTQB 1BVLA 4G7YH 4FABL 1R3IH 1S7SA 1AO7D 1EFXD 1PLGH 3F7RA 1G7IA 1KIQB 3OX8B 5D70H 1L6ZA 5EBWB 1CN4A 1UADC 3PDDA 4HT1L 3U1SL 3W11D 2VOTA 1ZXQA 4YPGB 1V7ML 4UINH 3PF2A 2Z0BA 4R90H 3NZHH 4NWUH 3K4AA 3KHOA 3KDMA 1NC4B 2BY3A 4L9LB 2OTUB 3H3PH 5DJZB 3FFDB 1UWEH 5ISZA 3LS4H 4OZ4A 5FYKL 3SPVA 4RWYL 5A2FA 1QSZA 1ZHBB 1J05A 2XZQH 2BNRE 2C3WA 1I8KB 5C86A 2HA1A 3KVQA 2GSIB 1IC7H 3HZKA 1LP9F 3EJYD 1NGWB 3QDME 4IM8A 3UYRL 3OX8A 3EZ8A 3VWJD 1HSBB 4Q9CA 2ATPA 5C0DB 2DYPD 1G9MC 3P77B 5DD5H 1KGCD 3MA7A 5HGGS 4YWGH 5HHXL 2OX5A 1HSBA 3T65B 1RZFH 3V5DB 4FFYH 2NTFB 4OQTL 4JGJA 5F88B 3MRPB 2ICEA 2XWBA 4IOIB 5J3HC 2VDPL 5I1CL 1NGQH 2Z9TA 2IQAB 2HVJA 1TJHH 1HCVA 4NIKB 3FRPG 3PQYB 3QO1A 3REWB 2Q8AH 3TZVD 4ONFL 2XQYG 1WAAE 1MFBH 3MLWH 2GKIA 4JR9H 5FM8A 3J7HA 5I2IB 1H5BB 4KAQL 2BRQA 4RFOL 5HSFA 4JPIA 4WWKA 3CFDA 4I13B 4P3WA 1UVQB 3T4YA 3KJ4B 4ONFH 3L3HA 2Z4QB 1XR8A 4L4VE 4BZ1H 3MGOA 1QACA 4FQLH 4R7DB 1EERB 1MVFA 3JV4A 5KSVB 1GH7A 3KPSA 1PSKL 2HN7A 3SE9H 1U8LB 1QPPA 4F3FA 3O6ML 3V0VB 4DUVA 2MFNA 1MJUL 3SGEH 5E5MB 2GAZB 3ARUA 3EDEA 3UC0H 3IGAB 3VRLF 4R97B 1M7DA 4PRIB 3SCMA 4XCNB 1S5HB 2VDRH 2UVEA 2AGJH 3GMPB 3WFEH 1I8LA 1DQMH 1YEJH 2H9GB 5GGRB 3DECA 2R1YA 2YXFA 4NO5B 4JZNA 3PHOB 4XCNA 2M26A 3LEXB 1JNLH 4MNQB 1S3KL 5DD6A 2YC1A 4D9RE 1K5NA 5AG9A 2EXYC 5HGHB 4G8GE 1RMFH 5EO9A 2RB8A 3E3QE 4D8PA 3MLUH 1UXWB 4UV7H 2IH3B 2HT2C 3THMH 1V7MH 4UINL 2V5MA 5SX4H 1ZGLA 3D18B 3VD7A 1NC2A 4YHKH 3K2UH 4XVTL 3C2AL 2BVEA 5ALCL 4NNPL 2CK0L 4MXWL 3KPSE 1A1OB 4YHLH 3D39A 4FTVE 2OI9B 3ETBF 4NUGL 1VA9A 3HS0A 3L5XH 4CVUA 1TVBA 4OIIL 3CAFA 3GRWA 3U48A 2XA8L 4Z7WF 5F7EH 1KB5L 4XPHH 2VR5A 3UTTD 1B2WH 3U0WL 1QG3A 1TQBB 5J6GB 5ACZA 3GRWH 4UQ3B 1DTUA 5FA4A 4HKBB 4PIRF 2GSGA 2GYSA 3SDDB 3R0MA 1I1AD 4LCCC 3VMOA 1W8OA 2ZWLT 4K55A 4XMKL 5K9QG 2K7PA 2CDEA 5FAAA 5D7IE 3HC3L 1ZHKB 3SDAD 3V5DA 43CAA 1FVEB 4QTHA 4S1DD 1MREH 4UDUB 2L0DA 5F7LB 4IIQA 3G5XA 4C56B 1P4BH 4BZYA 5JLZA 5EA0H 5F89A 4ODXA 4MNHB 4WUKL 3ARBD 5CGYC 3B2VH 2CUHA 1RAMA 1BD2B 1UG9A 5JMOC 1LEKB 2ITDB 5HGDB 4HGWB 1JZ3A 2J8UA 2QQKH 1FFOB 5ITBH 2DLHA 1DEEB 2GEEA 5TDNA 1CGUA 4PV9B 3F7VA 1LO5A 4KKCD 4KZEL 1PG7L 5I9QB 3QH3B 1HN1A 1E6OH 4GG8B 5DVMA 1HHJB 2X4TB 4HH8A 3BH8A 4XNUH 3B2VL 5EH1A 3FMGL 2JK5B 5B39G 2V5TA 1D5MA 1JP5A 3VFGL 5HDBF 3ARPA 1X5JA 3CFCL 1MI5E 2H1PL 4OV6F 3R8BB 4KDWA 2YD6A 3DX7B 3WIHA 4XBEH 5GGTL 3C6LA 3SJVB 2DLEA 4KXZI 3RTQA 3ROOA 4PG2A 3QXVA 5BO1H 1A47A 2A0LC 1TCRB 2VXQL 1MFAL 3WFBL 3GSNA 2F53B 5JXAH 5LG1A 4KVCL 2ZUUA 4RAUA 4YXLH 4TTGA 4JFYB 4QRUA 2E7HA 2MNUA 2GK2A 4AIZA 3Q1SH 5I8OL 1RJZB 4S1SL 4NRZB 1IM9D 4IHOA 3ZL4H 1BZ9B 4NQED 3O3EB 3MROA 3NFPB 3AXLB 3DI2B 4JGUA 4XCYA 5H2BB 3WE6B 1RZKL 2AAVA 3MRRB 5TDOB 3U0TA 1G6VK 3C2AH 1HWGB 1XF5A 4J3OC 4OCYH 5ELIA 1FAIL 5F3BA 4Y1AE 4NO3B 4ZG1A 1N7MH 5IW1A 5EPMA 2PNDA 1F8TH 1WQVT 5LKNA 4M7LL 2O5ZL 1BQUA 1DE4A 3DTXA 3MV9D 3ULVD 2DL2A 5JO5B 2Z8SA 3RVWC 3BPLC 1F6FB 4QYOB 1SMAA 2E7MA 2SEBA 1A6WH 3WO4C 2CMRL 1T2QL 4PP1D 5DHYB 6FABH 3GSRB 1VGEH 5HGDA 1GZPA 2OZ4A 3BJLA 2BHZA 5LJYH 4J3XA 4XTRC 1N4XH 2OSLA 2LTQB 5E8EA 5I19H 2DRUA 2A6DB 2CGRL 4R7NB 4MDIB 1NUNB 4OLZH 1XGPB 3RHWK 3RWFB 2MCPH 1FN4A 4X7SL 4Y4HA 1KELH 1I1AA 4KI1A 1U8NB 3LH2H 1JZ5A 4MGXA 4DQOH 4X7TB 5L6YL 2MQ0A 4DOHB 4E0RB 1AKJA 1L4IA 5KTEL 4MAYD 1HNFA 1JNNH 3MYZA 4MJ5A 3B9VA 2JJSC 4HBCH 1KJVA 4PUBH 3WFDH 1E27B 4AT6B 5EU6D 5HYSB 3TVMD 4KJQD 4A6YA 2X7LB 5HDOA 4G42A 2DQHH 4PLKC 5EZJB 4PJ9D 1AC6A 3MJ8B 3MRGA 4MDJA 1KIPB 3CU7A 3PWUA 2H3NA 4YEEA 2ID5A 5DJYA 5E08L 3M17A 2OL3A 1IQWL 5MEPB 3WNNA 3QRGH 1J12A 2J5LB 4RQQB 1OWRM 4P0DA 2MKLC 2HT3D 5EZJA 3DUHA 1FNHA 35C8H 1F00I 1NFDE 1MCHA 5I1EH 5EZIL 5HHQA 2OL3H 4IRJD 5F8RC 4ORZC 1A4JA 4U6VH 4Y5YA 4K2UL 5C70A 4F57H 2DBLL 1UZ6E 2PO6B 3H3PL 1IL1B 1D5IH 1BF2A 3MC0A 4LCCB 3ULUC 5KVGL 1IGFL 4YR6A 2AEIT 4YX2L 3TN0D 3Q6GL 25C8L 1FBIL 3KJ6H 4QRRE 4H8WH 5HVHC 4GKZA 3GM8A 5KJRH 3WNMA 1ZANH 2KQNA 4YQXL 5DFTA 4LSTL 3T0ED 4PJCE 4U1LA 5KANG 1S5HA 3AS1A 3BGFB 4LDLB 2XG5A 1T5XB 1J8HA 2C7UA 4U1HB 2X89D 4HS6A 1F8TL 3DGGB 3VXUA 1YPZF 2NY2D 1DR9A 1A9BA 1CVRA 2DQTL 4DCQA 2DTML 1QLFB 1I3RB 5I1IL 3PV6B 4A2LA 4MXQC 1CL7H 4WEUD 1ACYH 2QQNH 4I3RH 4RMTA 5F7YC 1U91B 4WJ5B 4HPYL 4NJ9H 3WLBB 2XWJB 1XIWB 3HAEB 1DVFD 2Z4QA 4NM4H 4ZOAA 4MVBD 2MSPA 2P4AB 3LQZB 4QT5B 4ZSOB 1RZGA 4X9IA 3HMXH 1Z5LA 1QA9A 4H26B 3IVKA 1CIDA 1OW0C 5C0CE 1DUZA 5JR1H 4LEOB 5LXGL 4XCYB 3V8OA 2H8PA 1ZS8A 4JFHD 1MAMH 4LVOB 3MNWB 1T3FA 3I3BA 5IF0A 1VADA 4KTDH 2BSTA 3VGGA 3MPCA 5T3XL 1QSFE 3N1GC 2XTLA 3MV9A 1UGNA 2X4QB 4IOSD 2GFBB 1XIWD 2G2RB 1YPZA 2EDJA 4MJIE 4MZ3A 4N8CL 1ES0B 5L8LB 1BZQK 1EVTC 3OAUL 4XPBL 2EKSA 1FAKT 2EYRA 4YLQT 2GY5A 3O4LE 2JF1A 1RJLA 1RUKL 1D5MB 3LN5A 3IU3A 4QHMB 3B6SA 5K9QI 3MV7B 4D9QE 3DIFA 4KK9C 4M8QA 4TUOB 1T1XB 2JCCA 2ESVD 1T0MA 2ATKB 5I76B 3IFPA 3RIAK 4PRAA 5ESAB 1XIWC 2JKXA 3CX5J 5KZCB 4ALAH 3GIVB 4OZFH 4PJGF 1FC1A 3FT2B 5IHUL 3IAGC 3B2UC 5FYJU 1HDMB 3NAAL 4PGJA 1WWAX 3AUVA 1WBXB 5EU5A 5IFHH 5L9DL 5A3ID 2VLRE 3EOBA 3BZ4A 3QUZD 4I0PA 2HLAB 4GH7B 4HUKB 2B20A 3KPQA 2ADGA 1S7SB 3RY6C 1TJGH 2BNRD 1KNOA 2YN3A 2EDKA 2I5YH 5L0QC 5IV2B 3TESA 3U0WH 1DBMH 4YDJA 1JFQL 4WWKD 2DQTH 3O4LA 2ZCLL 4L4VB 4M5ZH 4WFHD 4TTDC 1A7PL 4YEFA 3GI8H 4HWBA 1JTPA 1HOCB 4RA3A 1E4KA 2DKMA 4XBPA 4NSKA 1S7TA 3RVVC 3RWHB 2R2EA 1MSPA 4P3CH 5KS9A 4NQDD 5EBLA 4G43B 1S9XA 5DHVH 3DLQR 5AWNL 1N6UA 1RIVL 1WBYB 5BV7H 2NX5B 3DO3A 3LKRB 4PJGA 2GK0A 5HHOA 1X5LA 2K9UA 1B9ZA 3B83A 1QFWL 3CDGB 1T7YA 5KVMC 2B0SH 2VDOH 1LD9B 4PRDB 1OP3K 1KIRA 2X70A 3CVHL 3EIFA 2C3VB 3H9SB 1GIGH 4WHTB 4PRID 1U8JB 5D1ZB 4FNLL 2DIJA 4P48A 1GHFL 4RMWA 1TIUA 4ESKA 4BSVB 2DKSA 2WQ8A 4X9BA 4HV8B 5DUMH 1EBPA 4NSKB 1A5FL 1KC5H 2CKBL 3PQYD 1H8SA 4F80A 5F7HA 4OB5L 3MXWH 1NGYA 3Q3GB 1FLTX 3HR5B 2YA0A 1OY3B 3QFJD 4MQTB 4WHYG 3GSQB 2NNAA 3BPCB 2GT9A 2N1KA 4XMPH 3TM6A 1S8DA 3WKMH 1J0KA 2IFFL 3NGBC 5IM7B 2FBJL 5KSAD 1T22B 1Q72L 3LSOB 2OJZH 3R0NA 4KH2A 2G9HA 3OMZA 4DK6A 4KRPD 5GJTH 4FHBD 3Q5YA 4XPAH 2KH2B 1Z3GH 1H3VA 3FO1B 2I07A 4OGYL 4S11A 1B4JH 4YHMH 3PWNB 4FQJH 2I24N 1AJ7L 3FT2A 2JB6A 4U1JB 1OAYH 3TH2T 1ZMYA 1A1MA 2NY0C 4C56E 3UCRA 2WIIB 5SX4I 5MP6H 4Y16B 4LPYA 1XGTB 4LU5H 32C2A 4PJ7F 4XTRD 2HJFA 1UCTA 1MCWM 4N0FB 5ALCH 3VWKD 2Y9RT 2OMNA 1KFAL 3E6FB 4UUJB 1F90H 3QFDB 4Z8FL 4Y4HD 4IOIA 1FYHB 1JFQH 1CT8A 3TCLB 4NZRL 4LVHC 4W4NA 5C0AD 4Z7OF 5D1ZD 5C7XH 4L8SA 3FHQA 3PWJB 3ULVC 4XI5C 3VE0B 1ZGLP 4ONGL 3FOMA 1I9RL 1AE6H 2MQ3A 3U7WH 4LHJB 4NO0B 4HZLB 1J1PH 1ZTXH 5CKGA 2VLJE 1WFTA 1ZT7A 1YMMB 3KXFA 5T3ZE 4N0FA 1RI8A 3DHJA 4F8QA 5MI0B 4JVUA 4HF5H 1HHKA 4ZNEE 3L3JA 4YPGA 1GAFL 4EIZC 3PHSA 1OPGL 1CXFA 4LSRL 2I07B 1MJ7H 5FV2A 1DFBH 4PTUB 3LN5B 4QHMA 1YJDC 1E4XI 1BQHA 3SJVD 4G8EA 2BOCB 3A0OA 2ORBH 1NAMA 5K9KB 1HQ4A 3RX5A 4CUCA 3WIIL 5EOCJ 3RL2A 1T22A 5KAQG 1ZT4B 1ES0A 1TTGA 1MWAB 4BH7A 3RY5A 5TF1H 1UKQA 1M71B 4ZAKB 2R4RL 5IB4A 2NNAB 4WI4A 2CKBA 1R3LB 1KENL 1KTKE 4RAVA 5EU4A 1U3YA 3IDNB 1RU9L 3D9AL 4U1LB 4IS6A 4FQXC 4MVBC 4F37F 3L5JA 3OHXA 1FIGL 4NKMB 5SX5K 3SE3C 5CGYD 2UZIL 3OJMB 1DSFH 5D2LF 1O0VA 4AMKL 2AABH 2L7JA 1OT1A 1JPSL 2A1WH 3MV11 4NDMB 1I3UA 1MHEB 4CU6A 3DSFH 1MFDL 2FEDD 2BX5A 5DD3H 1CGYA 1JNHB 4P23A 1HSAA 5DMGD 3IU4L 4OCXH 4OCLC 4OIIH 4FS0A 2HKFL 4ZUVA 1RZKH 4ZUTB 3RU8L 4P59H 5F1IA 3UTTB 3GI9H 4RWHA 4HGKC 5D7JD 2R2HB 2FO4B 2GK0B 5HHOB 4HD9A 4Z7WA 3BZEB 3FZUC 3HE7A 5BVJA 1B4RA 3NIGE 2FDBP 4EDXA 4JKMA 3V6FA 2GJ6E 3CFJA 2QJDA 2PF6A 3MJ9L 4YK4C 2BJML 1P9MA 4PLJD 4N5UA 1UH2A 3GB7A 1MAKA 1ZSDB 5E2VL 3GJEB 5TDPA 4LIQE 3CIQA 3A6CL 1JZ4A 4LSSH 4OV5B 5DR5L 5CFHA 1JUFA 3IRPX 3OAYH 1IM3A 1BX2A 1UACL 2PR4H 1FNEB 4HEME 2YK1H 2XRAL 4YXKL 4AL8L 4OAWB 4Q0XL 2PN5A 4ZMAT 5AZ2L 4NQEE 3FJTA 2AV7A 4JKPH 1SEQL 2DQDL 1N5AB 1T7WA 3BW9A 2ZCHH 2R0KL 4FG6D 3WJLC 1XFPA 4N8CH 5D7IB 2HLAA 1P2CB 1CXIA 5F93C 2UUDH 3KJ4C 5MEPA 1I1FB 5MEQB 3B9AA 4U6VL 3STBA 5TE7L 3VFUA 3WNKA 3KGRA 1Q9LA 4ZYKB 2A2QT 5I30H 3ZDZE 3KYMB 3CSPA 2R15A 3O8XC 1A1NB 5C09A 5IWLC 5IK3B 5AAMA 1H5BC 4MAYC 2X4SB 1UH4A 4QTIH 1YEFL 5M7QA 2H1PH 5FCUL 3WDJA 3RUGB 3V6ZA 1ZHLB 3GBLA 1ZVHA 1BIIB 4PGBA 2GJ6A 3RZWA 3PGDA 3OXRA 4ODVL 5DXWA 3P4OB 4LK4A 4RFNC 1L9NA 5HY9B 2CXGA 3PP4H 5E2TH 1QFUH 2WINA 2W59A 4LHQB 3C9NB 4M93C 3C2SA 4LSRH 2BK8A 4JFOA 4HIEB 2F74B 3L9RB 2W65B 4XWOD 1KULA 2X9WA 2OR7A 4PY8I 3QXAA 1FG2A 4I8DA 5F6HJ 3O2DH 4WUUE 1KPRB 4KKLD 4L8BB 4MLSA 3LAFA 4X0KB 2DBJA 2QQNL 1IGCL 2MMXA 3QWOA 3EYSH 4XCCL 4L9DA 3BGMA 4U6XB 5CJXC 5DHYA 5F3HA 1N7ML 4GT7A 4J23A 5DA0B 2W1NA 3OF6A 3HG1A 1SBSL 3SDDC 5E8OA 1CK0L 3MTRA 3VXOB 4CVZA 1NDMA 1OHQA 2A74B 4P5KA 3NPSC 4NHUB 3SDYL 1WFOA 1VACB 5KSAA 1QA9B 1L6XA 4QO1A 1ZLVK 1W0VB 4MZ2A 4NKOA 5TFSL 5I8CB 1F3DJ 1DLFH 1LP9A 1OD9A 5GSRA 2YBRB 2NY3C 2X4TA 3SO5A 2BNQD 1XIWA 3HAEA 4YAQB 1JHKH 2DLIA 3D3VA 2BJMH 3SQOH 4RX4A 4DGIH 4LMQE 1KYOJ 3QPQC 4EBQL 5E2VH 3BGMB 3KWWA 2AK1L 4QF1B 3BQUB 1GGBL 1NANI 3VGFA 3HA0A 4OCXL 2F58H 3S5LG 4RA0C 3UZEA 1ERNA 3BRFA 1W72L 4ACPA 3C6SA 3RU8H 2C1PA 4B7LA 4ODWA 4GKSB 1IZKA 1H8NA 3Q0HA 3NABL 2DKUA 4QOKD 4LAQH 3W11C 4YUEH 4PJEA 3WL9A 3GNMH 3OKMB 5DQ9B 1Q0XH 2FWOA 1L7TL 5JIPA 1JVKA 3WXWH 1I85A 3KLHC 5CSZA 5A40E 2VL4A 1XF4A 3SDXF 5D2NE 5IEHA 2N7AA 3WDIA 1IGIL 5DFWH 3NFSL 1HHJA 2Q6WB 3UJJH 4OZGF 4Y16C 3NAAH 3OAYK 4GRLC 3SO3C 4G9FA 4XMPL 2WBJC 1UWGH 2XTJC 2JB5H 5BZDA 5D7JA 1QO3A 3LZFL 5C2BH 2ED8A 3IDGA 3IXAA 1SM3H 2H3NB 3LKNB 3QQ3A 4G6FB 2AERT 4WU5A 1KJMA 4L4JA 4NYLA 2IBBA 3LD8C 5K59E 4IIQB 2UV3A 3PNWA 4J3SA 3VXME 1PKQA 3EFDH 3AROA 1I7TA 1E27A 5I30L 5E6IB 4PJ7E 2BNRA 4PYGA 3S4SG 1WAAF 1AGEA 2EDNA 3ZMRA 3I75B 1X9QA 4PJEE 4MJIA 2XZCL 5FYKH 4QXGL 4PG9B 4LPWA 1FZOB 4DVRL 4U7KA 1JYWA 5EC2B 4X8JB 5ID0A 1YC8A 1PKQB 1KB5A 3OG4B 4RMSA 4JY4A 1T0NA 5EBGA 2R1YB 5K9JL 5D2NA 1JYXA 5HHVL 2X6MA 1T0PB 3HCVB 3FT3B 5EIQA 3KPMA 1KJMB 3PIQB 4Z0BL 4CDGC 3BOVA 2DOCA 3BE1H 2JE8A 4I3RL 3QIBD 2I25N 4E5XA 5E99L 1MPAH 4TQEL 3GHBL 4XVJH 4V2CB 1VGKB 5C6TH 5EU6A 1XF2B 1AD9A 4TULL 5FHAH 5CEZE 4H20H 1IILE 4OGAC 3I85A 3S4SA 3P11H 3R1GL 5ACMA 4XVUD 3WHE1 3MLZH 4MAYA 3R8QA 3MNZB 4JGMA 1XZ0A 3QHZH 3QIWA 2FH6A 3ARGA 4L9LC 1KCUL 1XF4B 4LRNH 4NKOB 3VXMA 2QR0B 4N90D 3CFDB 1EAJA 1SBSH 5EPMB 5BVPL 2RR3A 3BIAX 4OFDA 4HMDA 1GGCH 3KR3H 4EVNB 4WVRA 5FKAB 5I2IA 5F9AC 3U0TB 4HXBL 4ZSOE 4CVZB 5HYSG 4OTXL 4R9HA 1KLUA 4LGPB 4EKXA 4OD2A 2DM3A 3MLPA 5D9SA 1IVLA 3ZHKA 4DEPC 1Z2KA 4DN4L 4R2GC 3E8UL 1ZHNA 3SBWC 1N2RB 4FXKB 2LV4A 3RIFK 2IFFH 2X4UA 1PLGL 2BHUA 5ECJE 2HT4C 1V05A 1M71A 2XQBL 1CGSH 4PJIA 3PWLA 1SJHB 3DV6A 2J5LC 3L5IA 5FF6A 1UFUA 1MLBA 4X6FB 2NCMA 5MENE 2C1OB 3D9AH 4NN6B 4Z77A 4HUXA 3V6BR 3VXPA 3P77A 4ENED 4HQQH 2BERA 5FGSA 5T3XH 1FIGH 1NGWA 5EIIB 4H0GA 1RULH 4E9LA 2I9LA 2XY2A 3T0AA 1H5BA 4Q97A 2CDGB 2BSED 1PKOA 3KPRA 4LGRB 5A2IH 1CDGA 5INDA 1F4YL 3H9SD 3WIFA 3TBSB 4D9LL 5DDHA 2UYLA 5JHLH 4ODSH 1LO5B 1DQLL 3BKYL 4JO4H 1N6QH 3SKJH 5CP7A 5FO8B 3U4EB 4OFYA 3JV6B 5IMLB 2FGWH 3PWPB 4L3EE 5E2UH 2J8HA 1YY8A 1EHAA 1XGUA 5ABDE 3EHBD 4OI9A 4M1CD 1J0IA 5I0DA 1JMZA 4LNRB 5E6YA 5KVEH 1BFVL 3NACH 4OCRL 5J1SC 2G60H 4XHJD 3F8UB 1XMWA 4XVUC 2VLJD 3T3PF 3HZYA 1PZ5B 5FECB 1ED3B 1UA6H 2HH0L 1KUMA 3N85H 3JWOL 3EOAA 2LE9A 3QQ9D 4TRPL 2CLVB 5BV7L 1GAFH 1CXKA 3BJ91 5ACZB 4LSSL 3UTTE 2OTUA 2BC4B 1JHTB 5CMAA 4YBQC 5D7SL 4JKLA 2X4SA 3WUWB 4NZUH 1LE5A 2EDBA 4JPVH 5T1KB 4NKQB 5D1XC 3QHZL 3MRIA 2HWZH 3D2UA 5ANME 1H9VA 3EYQC 1UJ3A 5FIEA 2APTA 2W9EL 4TVSa 3HLAA 2G75A 5B3NA 1DQDH 5I15H 1NLBH 2EE9A 5I1GL 3BE1L 3AREA 4U1IB 2UUDK 4YE4H 4RGNE 3QNYA 4KKAC 1FO0A 4OD1H 4RAHA 4QGTA 2EKJA 1S8DB 3QB7C 4RISH 5JDSA 3SE3A 3NCJH 1TJIL 4KU1A 5T1MB 1L9MA 3WFEL 3FQRA 4PYHA 1JRHI 1YDPB 3P4MB 2VZTA 2A83B 3BX7C 2FIKA 4JFDB 5DI8A 4JDZA 1FZJA 1YECH 2FJFA 1JPSH 1T7XA 5JA8B 1F3RB 4JFPB 3OHXB 3MFFA 4XT1C 1U36A 4X4XB 1F3JA 5KOVC 3WKML 1H0DB 3L3IA 4AEHH 1J10A 1MELA 4HQQL 5BMFL 2R39A 3DROA 2UY7A 4F33A 3U0PB 3V52H 3DYMA 5C71A 3NN8A 5IVOA 3GMQA 3BEVB 1TPXB 3WN5B 2NZ9C 2R9HD 4N5ED 3RY4A 2ERJC 5I1LB 3ULUF 5KVDL 4F9PA 3MUY1 1EMTH 4I1NB 5LVEA 4FQQA 5JZ7C 4BZ2H 3RX8A 4P2OD 1DANT 4WI5A 3NIFF 1DDHB 1MHCA 4BFEA 5DRNB 4Z95L 4S1RL 4JPIB 3OR6A 2XTJB 3UTSD 4NCDA 2W0FA 2CLZA 3BKCL 1MHHA 2Y07L 4Q9QH 2P47B 1LE5B 1YEKH 2DLTA 1HINL 4JANA 2XOTA 3O2WL 3PHQB 4XCEA 2VISA 2XV6B 2VZ1A 4JAMA 4NBZB 2CMRH 3D1MC 1OARH 4MNGA 3X3FH 4J1UB 4Q9RH 3PDOA 1BJ1J 1SYSA 2EDDA 3STZB 1J88A 2FH8A 3EYUL 1ED3A 2K3TA 4WFED 1HHHB 2HRPH 1RJYA 3VMNA 3RUGE 1NCNA 4MJ2A 5CCKL 2YUXA 1N0XL 3VFRA 2D7TL 4JPVL 4RWYH 5IESL 5EUOB 1C7SA 2VYRE 5IHLB 1IC1A 2BNUA 1FVCB 1OTUC 2LFGA 2DMBA 1RIHL 2E9BA 4LBEA 1I8KA 4ZOEA 1WBXA 2VXTL 3OKLA 1KLGB 1UM6L 1H3UA 1JGVL 4Z7UF 2Y5TB 1BBJA 2HRPL 1E28B 1II4E 3F5WA 3IJHB 1N64L 4F58L 3EYVA 2CRIA 4OZIE 1MVUB 1W0YT 2HH0H 3N85L 3RNQB 1CDUA 4GBXB 4NQCE 1L7IH 3WV0A 1I9IH 3EO1B 4ETQA 4XBEL 1G7LB 4GOSA 1IC4L 1FYTB 1YY9C 5AEAA 3RZCD 3IDIA 3JTTA 1IGYA 2DYPA 1KV3A 1YMHA 3RWCB 3RHWF 3VFRB 3ESUF 2ERJB 4JFFB 1QBLH 1RU9H 2NY0B 2YA2A 1U92B 4MSWA 3SE8H 5I1EL 4FQHB 2AQ3A 3QHFH 5HHMB 3V7AE 3QI9A 3QDGB 2X4QA 4HIXL 2YEZA 4LKCB 3O8XD 4UQ2B 1R24A 3SCMC 2EIZA 1DQQA 2A1WL 32C2B 1YEEH 3CVHH 5HPMB 3QWQB 5FO9A 1P1ZB 1QSFD 4JB9H 1RQ5A 3LQMA 3DX8B 4L8SC 5EOQH 1DCLA 4APQC 5L2KB 4JZJC 1HZHL 3D2UD 3S5LA 2AEQH 1CLOL 2KQMA 4I0PC 2HP4A 1R5IB 1S7XA 3OR6B 4XPGH 3K74B 3QIWC 3KPTA 3VXMB 4S0SD 5DRNA 3T8XA 4N0CD 1OQOA 5EU3A 4KROB 2YRZA 4CMMA 1OAUL 1OVZA 3INUL 2ENSA 1IGMH 5BMFH 5DS8B 5C0IB 5HXMA 3FO0L 1K4CB 2NZIA 4B50A 4WEBL 4UT7H 4D9QD 1N5YL 1OP5K 5DK2B 1TETL 4H25A 4LLQB 2ED9A 3C5JA 3OB8A 1MIEH 1XF2A 3L6FB 3P11L 4NN5B 4L29A 5M95B 4M4RA 3JV0A 3W39A 5BV7C 5EUKB 3GHEL 1FL6A 4OFYD 3CFEA 3V9FA 1MH5A 3MR9A 2A6JB 3V4UH 3U36A 4X6CE 3OJDB 4H1LH 1F58L 5TF0A 3RGHA 1N0XH 5CBEA 4FP8H 5DF0A 3H6JA 4LCYB 3KPNB 4QHNA 2VC2H 4BFIA 3HPJA 4UZGA 1CTNA 1PDKA 1T2QH 3MRMB 4K8RH 2AK1H 5J11C 2OK0H 4L1DA 1ITBB 3V4UL 4WENB 4M9OA 1AO7B 2ARWA 5T3XD 2Y1VA 1NMAL 1I1YB 2ADIA 5E8PB 2XT1B 5HYJA 3CDGA 2ADGB 4I2XB 4V1DD 3ARZA 4G9FD 4BKLA 2AJZB 1IQDB 3UPCA 1NBVL 4QY8A 1N3NB 4X7CC 3QQ3B 3V7MA 2HG5A 4L8DB 5CWSA 2D9QB 5HVGB 3D3VE 3O3UN 5J8OA 3BRDA 4Z0XA 4K9EC 3MRIB 3JBG7 1SJVA 4O2EB 4MJ6A 3C5ZA 4P4RA 3WUZA 5EFIA 4FFZL 1U9KA 2P42B 5IW3A 2DM4A 1UWGL 1Y6NR 4M3JA 5FOBB 2DQHL 2Y06H 3PGFL 4QNPF 4HULB 3H9SE 4HGMA 3BH9A 1RJLB 4XXDB 1J9CT 1GGIH 2JJUA 1UB6B 3CXHK 3H9HB 3BD4A 2LU4A 1QFOA 1J5OL 3L3OB 2GIYA 3VJ6A 5KS9F 1I3GH 2DMKA 3WIIH 3PP4L 1FNLA 4U6YA 2IJ0C 2KKQA 2VN4A 1WITA 2VDMH 4OLYL 1DBBH 2H6PA 5DJ2B 1EEZA 4NM4L 5E9DA 4CN6A 4PRPA 1C5BH 3B3IB 4LPUA 2ICWI 2EDYA 3REVB 3LRSA 1A02N 4XNQA 5JQ6L 1O5DT 4L5FL 1ADQH 2CDGA 1TQBC 4G8IA 3QDMD 1IKFL 1DUZB 3ZDZF 3T8XB 2DQGH 1S9YB 3KYOA 5KG9B 4WNQA 1E4KC 4DFHA 3ZT7A 4NO3A 3MUZ1 4LSUL 1WZLA 3CFKB 4KI5F 1LO2H 2A6KA 2B2XH 5FUZH 5I18L 2VH5H 1BVZA 4M1CC 3T0WA 1A3QA 4XP9H 4LAQL 4J8RB 4YFLF 1HHIB 4NBYB 4OD1L 4YBLC 2YR3A 4POZD 2PYEE 4R8WL 4WTXA 1FNFA 1CR9H 2O5ZH 4BH8A 5C09D 5JW5A 2PO6D 1N6VA 3RRQA 2OTWA 5IW6A 1IRAY 4WDIA 1ONQA 4RGOH 3C6LB 4KZDH 4O2CA 3SHSA 1G9EA 4MXWH 4UBDD 5FM4A 4NQVB 3DX9B 1WWBX 4N9GB 2VZVA 2HFGH 1EHNA 2YS4A 4UTBL 1KG0B 1CR9L 1P7KA 2ZUVA 2D03L 5KSBA 2D7OA 4FP8L 3BH8B 1FC2D 4R97C 5DC9B 1ZLWH 4N8VA 5HGAB 1A6ZB 3E6HB 4HCRL 5E7BA 2FL5A 1FCGA 4P4RB 1ZA3A 1WEJH 1IAIH 2ZCKL 3TN0C 3UPRA 3MRKA 4EN3B 1KSRA 3T0EA 3TO2B 4HBCL 4KJPC 4KDTC 5DJ6A 5ICZB 2X4NB 3MRCB 2F5BH 3S97C 3TBYA 5JXEA 1XAUA 5EA0L 3EKCA 5DMKB 3O2VL 1JRHL 2D4FA 1RJYB 5F1NA 4PJHF 4MS8C 3VDBA 2VSCA 5MEOB 3HPLA 2YD7A 3LPWA 1UKSA 3IKCA 1KJ2L 2VKWA 4PLOB 2ZUTA 4OV5A 2PTUA 4OLYH 3DHMA 4GAJH 2PO6A 4WW2F 3GMRB 3S37H 3KLAA 3H9ZA 4OZHF 1A6AB 1F4XL 1OCWL 2WBJB 3FB5A 1EHXA 4LCWD 5KSBE 1IAKB 3R06A 1KB9K 3SKUD 3ME0A 1XGPA 3CXDL 1NLBL 4PJ9A 3VI4E 3TZVB 1RZJC 4POYA 3MRCA 4OFIA 4C56D 3D39B 4XAWH 4ZPTA 3UDWC 4WWKC 4RISL 3ROLA 1FQ9C 1MCLA 4L3AA 3O3BA 4D0DB 3O6KL 3LPFA 4JE4B 5D7SH 4LLUA 1MHPL 4P23B 5MENB 4X7FC 4Y19A 1X5AA 1WVZA 5T3ZD 2Q6WA 2EC8A 3WYRA 1KJVB 3HZMB 4S1SH 4DVBA 5AAWA 1KJ3L 4XP4H 2HVKA 4TPRH 4LCWB 3MRMA 5F7UA 4JO2H 4X7TA 5HHOE 3RVWD 3STLB 3MCKB 4H20L 1QSEA 15C8L 3BP7A 1CVSC 3RWEA 5IMKB 1MHPH 4X4XA 3WE6A 3R1GH 1A6PA 5BS0D 4YHPA 4Y7MA 4ZD3L 4HPYH 5GS3A 3GMPA 4S2SA 4WDIB 4MDIA 2A6JA 5DEFA 4DJMA 1TZHA 2FD6H 5LBSL 2FIKB 4YHYB 3TEUA 1GSMA 5F96L 4ZPVB 4ETYA 5SWQB 3T08A 1T5WA 5IB4B 4KGLA 1DN0B 3V0VA 5EIVA 2NXZB 3GSNB 1JHLH 5JOEA 5IEKA 4PGCA 4QYOA 5D8JH 1C7TA 4Z95H 3VCLA 2VZOA 2ZOKA 3VXSE 1H15A 1NGXA 2XN9E 1XR8B 4OGYH 1FH5H 5GGVY 4PGZA 3FQTA 4OB5H 1OF2B 1N6QL 5DMYA 1DQML 5KG9A 4Y19E 4PJDF 1EPFA 4X6DA 2GJZA 5J1TC 2F5AL 1FZKA 4GRLA 3ORJA 3RPIA 5CEYA 1MWAL 5L6YH 2M8XA 1TCMA 2AEPH 5E8OB 1F2XK 1HHGB 1NEZB 4NNXB 4JHAH 1QFPA 5DO2C 2FBJH 2IQAA 1C08A 5FYLE 4BZ2L 1RK0B 2CIIB 4LPXA 3QPXL 1J1OL 2R1XB 4LL9A 4AEIL 4FTVB 2F5AH 4LVEA 3VFPA 3TJEL 1FNGA 4LSPH 4JPKH 4V2BA 3QCTL 3MV8A 4KKCC 4FQHA 1IAIL 2ZCKH 1X5KA 2B8OT 3ALWA 1J87A 5FDYA 5FCSH 2HTLC 1TNMA 3G5XB 4C56A 1VB9A 5SWSE 1TXKA 2VDQL 3RAJH 4HF5L 1P4IL 3WO4B 4OI7A 1WCQA 1U8KA 5DGRA 1V3LA 3U7YH 3X3GH 3GRWL 4PG2C 5FA4B 4NJAH 5D5MA 2W9EH 5TE6H 5IOPA 3BD3A 1OTUD 3MLVL 4TVPE 4X6DE 2JJTC 5F1KC 4XPTH 3ZKNC 4P5MA 1U93A 3RI5F 3PWNA 2X40A 1HXYA 1A6TB 2R0KH 3OKLB 4OIBA 4NQDE 4LVNB 4JO2L 4DGYH 4M5ZL 5JXED 2E6QA 1YEGH 4P2OB 1ZK9A 1G7IB 3HTLX 2EE3A 4AK1A 4BSJA 1ZGLB 4HAFA 4RZCA 4ISVB 4NWTL 4N1EA 3UJIH 1YEDB 4M6AA 4DGYL 1T2XA 1W8NA 4KVNH 2XTJE 4QOKA 3MODH 1JGUH 5DD1L 4PJ5A 3HPJB 4N0YH 1P7QA 2FEEL 3GSWB 2QBWA 1EO7A 4P2OC 1KLUB 3GIZH 4PLKD 3NCFB 3FTGB 4O5LH 2P5WB 3KYAA 1B0WA 3INUH 2IPTH 5C08D 4U1MA 5BS0B 1MF2L 2W0PA 4NHCH 4WO4A 1INQA 3P30L 1GPOL 4OZIA 4FG6C 1B6DA 3ARWA 4NOBA 1YEEL 4ZUVB 4XH2B 4XCCH 4NQDA 5E4EB 4C83A 3AREC 1MAJA 4JRWA 3ZYOA 4AEHL 4DKEH 3I6LE 1NL0H 2IH3A 4Y4FD 1WTGT 3KNBA 3T4YB 3LPGA 3FQXB 1INEH 4XPGL 4QXTB 2BVQB 3WJLA 4GLRI 5D1XA 1BAFH 4MD0B 3TNMA 1R5IA 1UH3A 4Y8AA 4ZAKC 1KCSH 4Y19D 2I60L 5I71B 4JZNB 5IBTH 4MYWB 4Y2OA 2R29H 4GAGL 4GBXC 4K8RD 4YGVB 4D0BB 4PB0L 1BM3H 3MA9L 1I7RB 1A6AA 3FZUD 1J1XH 4KTEH 2AI0L 3G6DH 3ULVL 3K3QA 4XHQA 2Z35B 4P2QE 2P7TA 4K7PX 5C0CB 3DARA 1AGEB 1MWAH 3CDCA 4JFHE 1U58B 3MSPA 3OBAA 1PD6A 4X4ME 1JGDA 1T1YB 2AEWA 1VPOL 3SKOA 5FECA 4BH7B 3O9WC 1MWAA 1A7QH 1BWWA 1NUFA 2FHFA 4X6EA 1G7HB 4KI5C 5JA9A 3HRPA 43C9A 1F90L 1QSFB 4GSDH 2Z92A 3VFSB 5I1AA 4NZRH 5I1JL 3ABZA 5L2JB 3EDFA 4TOYL 1U8OA 4LVNC 1CDCA 1OL0A 4G9FE 2BSRA 3NA4A 3UZVB 3REWA 2YD9A 3KDMB 1MVUA 1QQDA 4MJ4A 4TRPH 3HAEH 3KG5A 1KPUB 2B7DT 5GGSA 5C08A 1RJCA 4P46D 4NM8L 4M8QB 4TUOA 4CBPA 1JJUA 2FR4A 3L95A 2Q7YA 4M7ZC 1KPVA 4TOYH 1XF3B 5EIIA 1I8LC 1VFBB 1W72B 1BIHA 1JK8A 3MACL 5JW4N 1WT5A 1KN2H 1QEWB 1S7WB 1DBKH 4N9GA 3NGBB 3MBXL 3GUTA 4JO3L 5DRWA 3K80A 4IRSB 2R0WH 3D87B 3MXVH 1MLBB 3DVIA 2V2XA 1C12A 2JIXD 2WP3T 3MRQA 3GMNA 5EOQL 1Q0YL 5C0JA 5D71L 3WS3B 5LQBH 1ZHBA 5IFAH 2DBLH 3MLXH 1KJ2H 1T80A 3T04D 2GTWA 4IEFB 4LEXH 4I18C 1LGVA 5GSVB 3S8WA 3WIFB 3QUXC 2NLJB 4WFFE 1T20A 4PJCB 2JB6B 1J5OH 3SGKC 4NQCD 4PP2A 4RMUA 1U8IB 1MHHB 4F7CB 3L3DB 4LDOB 4WUUA 4TSBH 1E4JA 4AG4H 3QISA 4UI2A 3FB8B 2Q76B 5I9QC 4IMKA 4JB9L 4ZFZA 3VXUE 3DYPA 3JUYA 1MCOH 3P0YL 1OQXA 3PWLB 2E8ZA 1W72H 2VLME 2UWEA 4LMQI 2CPCA 5L7XH 2Z8RA 1LO3L 3NN8B 5DHXB 3HUJE 1UWXH 3BPCA 3H7BA 5GS1C 3TT3H 3BAEH 4OCSL 4Q74A 2OXHA 4YDKH 1T03H 3RWDB 5GHWH 3HC4H 5DJAB 2IADA 3VXTA 3L3IB 3LV3B 1A0QH 3NA9H 3FTGA 4R2GB 4JFOB 5JR1L 3EYOB 3S36L 1EEUA 4G3YL 4N1HB 3RWEB 5J06A 1J7VR 2CK0H 4EN3C 2A83A 4OGAD 3BZFA 2FX8H 3C5SB 3RY6A 3WJJA 3ARGB 1IL1A 3HG1D 4PJIE 3KPOB 1OB1A 3QEQB 3VFOB 4IRSC 5MENA 2CJUL 1KB5H 3MV9E 4KK8C 1BEYH 2CD0A 1FGNH 3QNZB 2W38A 4O2EA