4DGYH

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody hcv1, c2 form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
EVQLLESGGGVVQPGRSLRLSCTASGFTFNNYGMHWVRQTPGKGLEWLAVIWFDENNKYYADSVRGRFTISRDNSKNTLFLQMNSLKTEDTAMYYCARDISLVRDAFIYFDFWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of hepatitis C virus neutralization by broadly neutralizing antibody HCV1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
molecule keywords HCV1 Heavy Chain
total genus 46
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2012-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH01
1WFOA 3ULSA 5D70L 3MRQB 1IGJA 5ITBH 3MROB 5GGQL 4WEBL 4JCLA 3QEQD 3O2DH 1CGYA 4NJ9L 4Z18A 4JFEA 5GRUH 3U4EB 1WFUA 4Y5YA 1FGVH 1LQSR 1WEJH 1O5DT 4Q6YA 4WHYG 4ODUB 2R8SL 1KELL 1F00I 3QUMB 3LKRB 1KCKA 3FONB 2QQKH 1DVFC 4NKIL 4D94A 5A2KH 1MNUL 1T3FB 1I9RL 3GSVB 1KLGB 3CK0L 1BLNB 4NQVA 1X6NA 5SX4H 1F90L 3QNZA 2H32B 3MRQA 2ORBL 3NABL 1BFSA 4IRJA 1NEZB 1CFNB 4BSJA 1YPZE 1KENL 2OZ4A 2GSGB 4I3SL 4LL9A 1OSPL 2YHGA 5DJZA 2ZCLH 3NOIA 3RWEB 1TXKA 2YWZA 4S0TD 2VITA 3HFMH 3BPLC 1DUZA 3DO3A 5C0BB 35C8L 4ODHL 5DFWH 4PJBE 1W0WB 4I3SH 2P5EE 3IJYA 3DVGA 4OFKA 3G5ZA 3VG9B 3TBVB 4HLJA 1SJVA 4GW1A 5DMKA 3VFRA 4KRLB 3MRJA 1RPQA 1WVZA 3KJ6L 1JNHA 2W07A 3BH8A 4X7TB 2HWZH 2PYEA 5J0BA 3T1FA 1X5JA 2H26B 2AXFA 4M7LT 2XQYG 3O11B 3EDKA 3OKNB 3QJHA 4J4PC 2JTDA 1MHCB 4L8SA 3S6CA 4KFZC 4M8QA 4FTVD 2OR7A 4HMCA 1RVFL 1U92A 5GRUL 1HH6A 4HKJA 2VQUA 3KYMA 4G7VL 4KUZL 5DFVD 4P2QA 2YD2A 4PG9A 2ADIB 5D70H 4YZFF 1IEAA 2Y06H 2XPGA 5JOFA 1CD8A 3IDUA 5GGVL 5ID0A 1XCTB 2W0FB 2X4QB 4YHNB 4ODTL 1HK6A 4KGLA 2WIIB 3SQBA 3INUH 3S37L 3MODH 2BHZA 3TZVC 4HGWB 4Y5XC 3THML 1FYTD 4UTAH 3TA3C 2C4XA 4Q9RH 1ZS8B 3W81A 1S9VA 1S78D 5CD3B 4LSDA 1EA9C 4ZUSB 3BKCL 2WV3A 3ROLA 2GYSA 3MUGB 4GW5B 2W59A 4NKMB 4EUPB 5BZDB 4JDVA 3I6LE 4QHKI 3RPIA 1FIGH 1JWSB 4KHTL 4UU9B 4ZO9A 5E6IC 5EN2B 1UADC 4OGYH 4JFFA 3QCUL 5HYQA 5D1ZA 4L8BA 1NEZA 3MRNA 3ZTNL 3TBWA 2OTUB 4LP4A 4OT1L 4D0CA 3ET9F 1Y6MR 5DUMH 3QT2A 1U8PB 5D6CA 4L5FH 3DMMA 4BKLA 5L0QB 3PABB 1A14L 5I19L 1ZT7A 4YWGL 1QBAA 1OLLA 4XWGH 1NFDA 5AUMB 1U41A 4GKNB 4JN1H 3UPAA 4HIEA 5ANMB 1CGSH 3OWEA 5A2IH 2C9AA 3BOVA 5DS8A 5L8KB 2M26A 3HAEG 5BQ7B 3ZL4L 4JQIL 1JUFB 2UWEA 4XNZB 4UT9L 3BEWB 1F3DH 2YZ8A 4HBCL 4EN3C 3KYAA 3DARA 5JIIA 3QNYA 5BRZD 1T80A 2K7PA 3TYFA 6CGTA 4MYWB 4QHLB 4PJCE 4BH8A 1DBKL 5SWSB 3MCG1 3OXSA 3TPUA 3E8UL 5FUOH 5CEZL 1BFVH 1EO5A 4LSRH 4LBEA 2AV7A 2CR3A 3OF6D 4K8RD 5GGTL 2HMIC 4ELKA 1OTUC 3GMOB 3ZKMC 5IB2A 5DRWA 4M4RA 4Y19E 3S7GA 4GBXD 3QEQA 5I1CL 1Q9KB 3FQUB 1GIGH 3CC5B 5HD8C 4D0DA 2CH8A 5ALCL 4BH8B 3MV11 4HBQA 3U30C 1I7RA 2VDMH 5GJSL 3D1MC 2UZYB 3ROLB 3QXAA 3STBA 1I1FB 5E08H 1U8MA 3OJVC 3SKNA 4PJXE 5LBSL 2IC2A 4QHUB 1I3UA 4R26H 1CFSB 3I02A 3MROA 1P4IL 3KPPB 4KK9C 3QWRD 4X98B 3VA2C 5HXMA 2APXA 3GMMA 4LU5L 4O51A 2AXGB 1MHCA 4HIJA 4OIIL 5J7CC 2FZ3A 1U3JA 2O5XL 3WSQL 2VWEC 1OAXH 4A6YB 1BD2A 5I19H 4NO5A 1AKJD 2UY7A 2BFVL 1F4XL 1ONQA 2XKSA 4HMDA 5IJVA 4YDKL 5IWLC 5DUML 5BS0B 3RBSA 4O5LL 4EVNA 5J13C 3HNTH 3OJDA 4GG8A 5HHXL 1HQRB 1QRNA 4CN1A 2OR9L 1A1NB 4UTBH 3MGOA 1IGML 5J1SC 2X6MA 5I16A 3R0MA 1CL7I 4X7SL 3JWOC 1OGAB 5C0CE 4ZFOB 4KRMB 5FO8B 4PPTA 3U1SL 3BH9A 5BRZA 1MFBL 4Z0XB 5FYKL 4JFDB 3S8WA 4DZBB 3DI2B 4FQIH 1MPAL 1E4JA 4PRPD 2E27H 4UOW1 1ZGLB 4YC2B 1FG9C 3SOBH 3UTPE 1BGXH 3DVNB 4ORZC 1ZANH 5CGYD 3WNMA 4Q9RL 1D5MB 4PJAE 2A9NH 4FXKB 3UX9B 1HCVA 2R69L 4UUJA 3TBTB 1OGAA 4TTDD 1J0ZA 1HZHL 3A6OA 4YHIB 2YD1A 1MIML 4FQCH 2M2DA 2IANA 5CHNB 2CO7B 2VLME 4YDIL 3TT1H 1JZ3A 4G80B 1S7TB 3FRPA 3CUPB 3P73B 3QDJA 4EDWH 4NZTH 3NA4A 2DLHA 4Q58C 2YA2A 1RU9H 3DGGA 5IEHB 3MRFB 4DVRH 4YEFA 1Q9LB 3PNWA 1QR1A 2EYTA 4ZXBB 1H3PL 5J1AB 1Q94A 2F54E 1K6QH 4LLDA 1X9QA 4R96B 5DHVA 2VR9A 2XI9A 4PB0H 4QTIL 2Y5EA 3D3VB 3GMMB 5AEAA 4G6FD 3HMXA 1MF2L 4YBQD 5I1AA 1NMCB 1IKFH 4C59B 1M7DB 1EJOL 1WJ3A 1RK1B 3TT1L 2FRGP 3WFDL 5DJ2B 4NHCL 4GG6F 2I9LB 4GKZA 4JPIA 5EPMB 1IM9A 1MFNA 3PF2A 2YSSB 3WLBA 4UT7L 5I15H 4P2RD 1FL6A 3REVB 1G9NC 3QHZL 3GMNB 3L6FB 2AEQL 4LLDB 3IU3B 4FQXD 3V7MA 2R4SH 2ORBH 4JO1H 5B4MC 3HCVB 1INEH 4FTVB 1XGUB 2HTLC 3X13B 1HKFA 3WIHH 4ZS6C 3BESR 3WDJA 2ZUXA 1V3JA 3AXLB 5TDPB 1X7QA 4JQXC 4OGZA 4XZUB 1QSVA 2ADJA 5FUZL 3LH2H 3U7WH 1TPXC 1IT9H 2Q76B 3SKOA 1HNGA 1UM5L 1X5GA 1F4HA 2VDRL 3EO1B 1FNSH 3JVGA 1CFTA 4NRZB 2XZCH 4HPYL 3L6FA 1DQJB 4NJ9H 3UTSE 4ALAH 4JHZA 4TUOA 3D39B 4EI5C 3ULUE 4AEEA 5F1OB 4U1GB 3MLXL 3V95A 4PJGB 2OXHA 4YQXH 3QDMB 3HZMB 4YDKH 4KHXL 4GLRI 1UM6H 3DGCR 3IDYB 2HRLA 4NO5B 1LE5B 2G75A 1PG7H 4GRMB 4R4FL 4LKXA 1RZKH 4QRPE 5HDBF 4FMFA 5JW3L 3VFNB 1QRNB 4ONHA 1JGDA 1H15A 1WWBX 3SY0A 5JPMA 2APFA 4I2XE 3PWJA 4GAYB 1UM4L 2QQLH 2ADIA 4DKEL 5I1EL 4DKAA 3QWOB 1B4JH 4M61A 5DR5H 4F7EA 4JG1H 2H32A 1ZHBB 4F7MA 5DJXA 5C0JB 3LEXA 2JJWA 5J12B 3IFPA 1FC2D 4U1SA 2NZ9D 5F3HA 5IQ9A 4W4NA 1TVHA 5I17B 1MCOH 4HEME 3DVNA 6FABL 1KCRL 2R0ZH 3RZCD 3EYFB 5D2NC 1BZ7A 2X5PA 5J6GB 1KPUA 2AEIT 3VGHA 3Q1SL 4OLWH 4M1DH 4F7EB 1T66C 1GL4B 2VLRA 4FN0A 1N64L 4OQTL 4GQPH 4IMKC 5MERA 1Q8MA 3CZFB 2HH0H 1XGQA 4JFFD 3MLTB 2C7UA 3SE9L 3QULB 3X3GL 4RAHA 4F3FA 5DHXB 3OR6A 4CU6A 1AO7B 1ZOXA 4WW2B 3PDOB 2BNQA 3LKSA 4KKAC 3SE9H 3NA9H 4LPVA 2E8ZA 4YDJA 3S3JA 1FVEB 1AKJA 1WT5A 2P5EA 3RHWF 4ZFZA 2FIRT 3ALPA 5CGMA 3IDXL 1JUFA 4WV1B 3DJ9A 3ESVF 1KEGL 1Q0YH 3VFUA 1KACB 2Y7QB 3NIGE 3GBMH 5D1XB 2A77H 1KIRB 1LEKA 2HJLA 4F3FB 2F5BL 4WV1C 5KAQF 5IGXH 3QI9B 3KNBA 1CDBA 3QSKB 3G6JA 3GKWH 1NKRA 3I84A 4XPGL 3WNLA 4NCDA 1NUDA 3RVXC 1E28A 4CVZA 4H1LG 3V8CA 3RX5A 4LLWB 3STLB 3WFEH 2EDWA 1ROWA 1EV2E 1OGAE 2E8YA 3I6GB 5SWZA 4M3JA 4OZ4A 1QQDB 1RFDH 4LP5A 1T0MB 4XGZB 3B2VH 5EWIL 4OF0A 2R1XB 3WD5L 4V1DD 5BOZG 5H94A 3O3EB 1WISA 2Z31B 3EYSH 4FHBD 4DCQA 4KI5E 4XVUD 5F3HB 3CXHK 4D0DB 2NXYB 4DEPB 5LGHL 3WL9A 3D0VB 1JZ5A 3OB0K 5I1GH 4BKLB 3TZVB 4NQCB 3QUYD 2FL5B 1LVEA 3WFCH 4XAKE 3JWOH 3V5HB 3BP7A 5GJTL 4XXCC 3FQXA 1W2KT 1ZLUH 2GK2A 5FGCB 1JPSL 3MZGB 2UV3A 3CSYB 4Y16C 4P2YA 3TIEB 3U9UB 3UZVB 5GGUA 3B9KA 3F5WB 1II4E 4PJHE 3MLXH 3QCTH 5AZ2L 2BOCA 3M17B 4R7DB 3OB8A 4XCNA 3CNKA 4FQXA 1OAQH 3P4NA 3SDXF 4ALAL 1DVFD 2VL5B 1IEBA 3V6OE 3EO9H 2HN7A 3I3DA 2W0PA 1XFPA 4RA0C 2FX8L 5C0AA 2C1OA 1NJ9B 1R3IL 4ZUTB 2QL1A 1U93A 5KS9A 1H3XA 2HJKB 3TN0B 3OV6A 1A3LL 1A7PL 1KN4H 2NX5D 1C1EH 1RUQH 4G6JH 4ZTPH 4QHNB 2G9HA 3KJ6H 3F5WA 1G84A 4XPBH 3C5SB 3P4OB 2R4SL 4BSWB 3GJEB 4J12A 3L95A 5D1ZB 1UA6H 5E5MB 1U3HB 4FG6D 1CR9H 1N2RA 1CI5A 2V7NA 4XPAL 4YUEH 2UWEF 3DMMB 3T1FB 2FWOB 3C08L 3KDMB 4O02L 2DLFL 4YIQA 4JPKH 4HIXH 4XBEH 5GGRB 3FZUC 3PJSA 4XMLH 5AAWA 5DS8B 2NXZD 2PUQT 3FT3A 3CDGA 1JPGB 3U0WL 5E6IA 4GRLC 3NABH 4UUJB 1YUHA 4CAGA 2F9BT 4Z78B 1NH6A 3HZMA 3B9EA 2W0FA 1INDH 2X4QA 4JCMA 4J3UA 4HULB 1SJXA 1FYTA 4NQEA 2BVOB 2BXYA 4PD4K 1EEUA 2HFEA 3BO8A 3LD8C 1RU9L 1I8KA 3AU1A 4OLYH 4NZTL 4MCYA 1YC8A 5D5ME 4MNGB 3MRPB 4LCCB 5I8KH 3H7LA 4EBQL 1A8JH 3VFWB 3X11A 3L3OA 3LVEA 3GIVA 1JIBA 3KLAA 4IEFB 1CE6B 3RVWC 2QSCL 2PF6A 5F7KC 4PJDA 5INDA 3VRJB 1A3RL 3KXFD 5FKAA 2HT4C 1RV6X 3IJHA 2EDOA 3VWJB 2YPLD 3PNWB 1WBYA 3QUXD 2AS5M 3U0PB 5IB3A 3GK8L 5IVXA 4IBLT 4PP2B 3SBWA 1EXUA 1EFXB 3VWJC 1ZA6A 5C0JA 5CGTA 3C5ZC 3FFCE 4JDZB 1QO3B 1MELA 1IRAY 4FP8H 3O0RL 3C9NB 1FNEA 3DYOA 3MCKB 1U8JB 4JM4H 2J8HA 3IFLH 4Y4KD 3V79C 3U4BL 5K9OA 4XP4H 5CJQH 1A6TB 1FCGA 2R0WL 1CU4L 3W39B 1KJ3H 3MR9A 3UTSB 4WFFD 5DJ0B 3GBNH 5GGSA 4L3EE 4NN7B 4OLUL 3LDBC 3OSKA 4JB9H 3DVFA 4KVNL 1BBJB 4LNRB 5T3ZL 4UDTA 4NNPL 3SEPA 2ZJSL 1CCZA 2GW5A 4B50A 2V17H 1LO3H 4NJAL 3MUY1 3K8MA 5IF0B 1F4WL 5AZEH 4RRPA 3R8QA 2ILLA 3UC0H 4MHHI 1OAXL 3H9ZA 4RX4A 3BZDA 1IL1B 3MCLH 4YX2H 1RQ5A 3P73A 3LKPA 4Y19D 4KDWA 1GGCH 3EYUH 4TOYH 2A6DA 1VEOA 2P5EB 4TQEL 3OX8A 2ZOLB 4JN2B 4BFGA 2FJHA 4LSVL 4MNHA 4RRPG 1IEBB 4H5SB 4OJFH 4H1LH 5B8CA 3RTQA 2IFGA 5ENWA 2GEEA 5C0AB 4NDMA 5HDLA 5CKGA 1CG9B 4HKXB 3GSNB 2ZKHH 5C0DB 5CWSB 2VXVH 4XNUL 2F53D 1N6VA 4H8WH 3D9AL 1J5OL 2DTML 1T04B 2IQAA 1EUUA 1MCLA 1W8NA 4DN4H 1KBGL 3MRMB 4KTDH 2UVEA 3NFNB 3MBEB 4N5UA 3T3ME 1KB5H 3BJ91 1HQ4B 5C0BD 2NY2D 2BRQA 4WI9A 2PYFB 5BCAA 3L95B 1QKZH 2X4UA 1PKQE 5FOJA 4PV8B 4HS6B 5GISH 3LEVL 5HYJE 1IGIH 1DQDL 1MFCH 3WJJA 4YHIA 4ZXBC 1LDPH 4Q9QH 3ZE2E 4DN3L 1VFBB 4MD5A 4Z7UA 5CINH 4FFZL 4PJBA 2W9EL 1CFVL 4QHLA 5KSBA 2APVA 5EA0H 2DTMH 2DL9A 3U36B 3V5HA 3HAEH 3T0WA 1T7VA 2QTEA 4PJ5D 3VFOA 3AM8C 4J3XA 5HTSA 3LCYA 2APWA 2ENYA 2YZ1A 5I74C 8FABA 4WFGD 4P49A 2X4SB 4WHDA 5LQBL 1U2CA 2CLVB 3VXPA 5A3IC 4PJDE 4KTEL 2JIXB 3QI9D 4UDTB 3ZL4H 5D71H 4AIZA 1F3JA 1N4XL 1UH2A 3BZEA 3CFJA 2XKNB 1GGCL 3IDIA 1R5VB 2M8XA 2JCCF 4B5EA 4DK6A 3KWWA 2BZDA 3VXSD 4KMTH 4EOWH 2G5RA 5FDWB 1A1MB 4YHML 2AJXH 1BVLA 1C16B 1KJ2B 4HS8H 1OAKL 3V5KA 3VWJA 1CXKA 2ADGA 4MVBC 1Q9OA 3B9AA 5D1ZC 4FQJL 1YNTA 4U0RC 2WLZA 2A6DB 4X6CF 4LSPH 3GHBL 1PLGH 5I76B 3KJ4B 2H1PL 4IMLA 5D7LB 3ZYJA 3E6HB 3LHPH 5CUSL 3CLFL 4S1DD 5F1NB 3RVXD 2ATPA 1AGCB 3ARED 4WO4C 5K9JH 2NXYD 3QWOA 3SKMB 1SYSB 1DQTA 4C4KO 2BY1A 3EDFA 3KPTA 3U46A 5HVHC 4KC3B 1HYSC 1RIHH 2DQDL 2NTFB 2C3XA 3DVIA 4KZDL 4HS3A 5CWSA 2IG2L 2FHCA 5CMAA 4OCYL 5C0GA 3QUKA 1YEDB 1CZ8H 4NUJB 2H45A 2E7HA 4TVPE 1XIWC 1PZ5A 5F71A 4KVCH 5HHOB 5D7LA 3O2DA 4ZG1A 2RR3A 3RIFF 5FUCC 5CJ5A 3O41A 1OAYL 1CDCA 2AKRB 1ACYL 1D6EA 2R2CA 4LVEA 4OCXH 5IQ7H 4KUZH 1FFNB 2WUCH 3TH2T 1ES0A 1ULVA 5I66A 3I9GL 3GMLB 5JNYB 3PP4L 2XFXB 1ZLWK 3D0LA 4YEEA 5KSBF 1IL1A 4RDQG 3ILPA 4Z5RB 2YK1L 4L4TD 3NFPA 4EI6A 5K33A 4I5BA 4GRWE 1VKXA 1FPTH 2PO6C 1I8MA 1P84K 4ZOAA 5DUBA 2CKNA 4IRSD 3KAAA 4MAUH 4PG9B 3X3FL 2YD6A 1XR8B 4MDJA 1D6VL 1KULA 3HNVL 3RIAK 5GGUB 2XRAL 3JUZA 1FVEA 4K8RC 3MTRA 1A7NH 1LO0H 1VGKA 3CDCA 1D6EB 3VE0A 1J1PL 2YPVH 3QA3B 3GMLA 4UNTA 3K81A 3T2PA 4JREC 2YD4A 3LDBB 5GS1C 4L29A 2DQEL 3CPLB 2F74B 3S88L 4NM4H 4XPHH 5I17A 3BE1L 1Y6KR 1MI5E 4FG6C 4DW2L 2JCCB 3G5XB 2CMRH 1IM3A 3BW9A 3L7EA 4RAVB 4OB5L 4ZPTA 4J4PD 1DBAH 4K7PY 5EU3A 3ORJA 1OGTB 4M5ZH 2NCMA 5DEFB 1FGNH 2RQ8A 3T2NH 1A1OB 2OSLB 3VI3F 1PZUB 3F7VA 5FGSA 1UB6B 4MXWL 1BQHB 2HYMA 4LRIA 3AAZA 4XPBL 4ELMA 3QDMA 3L3GB 3CK0H 2IFFL 3VJ6B 1N2RB 3SQOL 3PQYA 4G9DA 1IGCH 4LKCB 4W70A 2C3VB 3WDHA 5C2UB 2IAND 1P53A 2ID5A 3F12B 3PIQA 4QXWA 3K1DA 5GGRA 2DRUA 5C08B 1PVHA 5LXGL 4APQC 1I1AA 1XR9A 2VDKH 3ZYZA 5GHWH 5D5MA 4O4YH 2N4IA 3BZ4A 5DI8A 3O3AA 1P7KA 3NTCH 4KMQA 3RVVC 4LFHD 1NDGA 5MEPB 3O41B 5KVMC 4Y19A 4U4BA 3IFNL 1K2DB 1A6ZA 3UTZA 1CE1H 4IRSA 2IBZY 2NY7L 1IC4L 1RZKC 1T21A 4RNRB 3DUSA 1UZ6E 1WZLA 3T65A 2BSSB 3QIUC 2H3NA 1I8KB 3AU1B 4M48H 1ZMYA 3W0WA 4Z7QF 1G7MA 2R0LL 3HUJE 2DLTA 5DVNA 5L8LB 4OZHA 2NY5L 1EAJA 1ZHLA 1X4YA 4P46C 1HHJB 4C57C 4KV5E 1W0VA 1AE6L 4FTVE 4BZYA 4OD2A 5IVXF 3BMVA 5IB2B 2V5SA 2CIIB 1Z9OA 2EZ0C 4LCYB 4UILH 1NAMB 1UENA 5H94B 3GJEA 3WE6B 3STZB 2WIIA 3V0VB 2QQNH 4U6TA 1Q0XL 4PJ5E 1XGQB 2RHEA 1OSZA 3CDYA 3O9WB 2DWDB 2XTJC 2F74A 4HWBH 4K7FB 1RZJC 1KTLB 3FO1A 5A2FA 3U36A 2Y72A 1NAML 1YECL 1AO7A 1J1OL 1NFDE 5DC4B 4Z7WB 3QQ3B 4ZPTB 5FYJH 2R56H 1N7ML 3DBXB 2ZCHL 3MFFB 3BPNC 4WUUD 1Q0YL 3PWVB 1G9NH 4F57L 1MFDL 4JPWL 1NAMA 4XNQA 5HDOA 3HZKB 2R2EA 1KFAH 4KK8D 1N0XH 5L9DH 3RA7L 1JNHB 1FFPB 5LWYL 2DQFA 4S1SL 1RZ7L 1SHMA 3MBED 4HCRL 3FT4A 1UXSA 1LILA 1FIEA 1V3LA 3DROA 4MJID 5JA9A 2F53E 4GKOA 4CUCA 2VYRE 3GSNL 1W72H 3SGKA 4PRHD 4G5ZL 3AB0B 3HLAB 4LIQL 2GUOA 1L0QA 4YHLL 5IT2H 4PGDB 4KRPD 5I2IB 1TCRB 4NN5C 1KJ2H 4X5XA 4BQ6A 2NY4C 4XP6L 4D9LL 3S4SA 5MEPA 4X0KB 2L7JA 3Q1SH 3KYOB 2EYRA 3G04A 1J8HD 5J3HD 4JLRA 5E6YA 5SWZE 4HS3B 5DMJB 1AP2B 2G60H 2O93L 1OL0A 4L4TA 3W0WB 1F6FB 1CK0L 1PZ5B 5ADPL 1WFNA 5IFJA 4EDXA 1DEEA 5IW1B 1JRHI 2BVPB 2PW1B 3DV4A 4X6EA 3V0WL 4S2SA 1TCRA 4I13B 2OJZL 3P2TA 4LSQL 5IR1A 1G7LA 1M71B 1G7PB 2L4OA 5IVNA 3O6KL 3WFHB 4JY5H 4BSVB 4LAQL 2V2WB 3IVKA 1Z9LA 2QBWA 2AJYL 1IARB 5E24E 1KPVB 3C6LA 2FBJL 3P40A 1NKOA 4F15C 5E7FA 4MA1B 3S96A 1IGFH 4HDIA 5HPMA 5J1TC 5JHDB 5IFJB 5EU7E 1REIA 3HUJB 4JREB 1QHOA 3DXAA 2DMCA 2LQRA 1Q9LA 3VXQB 1JJUA 5EU6A 4CU7A 1EBAA 3DHJA 4XGZA 3GUTA 2DTSA 2VLJE 4PTTA 1A9BA 4EIZC 4YQXL 3O3BA 3VE0B 4Z7UF 2XACC 1FL5A 2YPLE 2IH1B 3HI6H 1JF5A 3BGAA 3SKJL 4HUMB 3NCBB 3ZDZE 2XWTA 4UIKL 3FMGL 2IANE 5I6XB 2XKUA 3K8KA 4X4ZA 4OKVA 3A6BL 1CN4A 3WIHL 2HMID 3X17A 4G6KH 4N8VG 1F4YH 1MJUH 4Y7MA 2PYFA 3JV6B 1MCRA 5CSZB 5GIRB 5IB5B 4WUKH 5CJ8A 4JE4B 1RULH 2ZWLT 1KPRA 4LMQE 1LEKB 1NEZG 2ED8A 5BRZB 1ND0A 2QADB 4QWWD 2DWEB 4MJ5A 1HILA 4NHCH 4DZBA 2QV2A 2C3HA 4NOFA 2H8PA 2PYED 3CLEL 2AW2A 3LZFL 5DWUH 4R97B 2I07A 5MEQB 2VIRA 5C2BL 4QHNA 5EORL 1VFAB 1LDSA 4FXKA 2WAHA 4FFVC 4WHYH 3ZDXE 1A4JA 5EU7C 3IJHB 5C0RH 3WXVH 2P8LA 5TDOA 4Z7WE 1EO8H 2AV1A 5TH2B 3TF7C 3EFFB 5B38G 1KB9J 3TEUA 3UJTH 4NZUH 1A7BA 1U3HC 4X6CB 3AY4C 4WHCA 5FYLL 4DKFH 4QCIA 3CFJB 4GJTB 5DC0A 5IMMB 4L4TE 4ZFFA 2AJ3B 4OUUA 2IADB 3MCKA 4HK0B 4QNPF 1ZVSA 2EE2A 3LRSB 2VDLH 1WIPA 3C6SA 4TTDC 4YHZL 2H2SC 4HWUA 1HXMA 3O9WC 2IAMA 3BKMH 1GPOL 3MRFA 1U58A 4NQDE 3V8OA 4KJPD 1NANI 3ARGC 3BIAX 4RMTA 1MCPL 4K7PL 3RL2A 3IXTB 2A6IA 5DF0A 2PNDA 4JGMA 4F7TB 5BOPA 2D7OA 1Q72H 2Z4QA 1KIUA 3K74B 5D1QB 2GFBA 4D3CH 2B2XH 3ZMRA 4RGOL 1GGUA 4OFYD 3HI5L 4DKDC 4ZSOE 3CC5A 1A6UL 2AJUH 2EXWD 5LAXA 5JW4M 1OY3B 2XXCB 1BGXL 3UPRB 3ZHLA 1EAPB 1QFPA 4P5TD 3V9FA 5I1HL 5D4QA 4NQEE 4UQ3A 4E0RB 3QPXL 1FNHA 1IM3B 3L7EB 4RFEA 3H3BC 1H5BA 1V7ML 3WFBH 4ORGA 5IB3B 4JFXA 3TO4C 2G9HB 5ESVB 3EW3B 2Z4QB 1CICB 1D5IH 4KZEH 5EZOL 1B88A 5IK3B 1IAII 4X98A 1IGMH 3HZVB 4I2XB 5EFIB 4K7PX 5CEYB 1MFEH 2CDFA 4JDZA 3AAZB 1OTSC 4KKCD 4BQCA 1S9WA 1TZIA 5AWNH 5HHQA 4M6OH 2XG5A 4R0LC 2LU3A 4W6WB 3SJVA 1KOAA 3VA6A 4PJEB 4J8RB 4GUPA 1SM3L 4NHUB 1HSBB 1MHEA 3MUHL 2VDQL 2W91A 1WCQA 1HXYB 3QQNA 4WWKA 2C26A 4KDTA 5HYJD 1OP9A 4F33B 2J6EH 1RI8A 1KXVC 5KJRH 3S35H 4A2MA 3ZKXC 4I48A 2F15A 1A6PA 5HHPA 1WV7T 3OKNA 5E0QA 5TE7L 4HXBH 5BO1H 1D5BB 1ED3B 1GJIA 4OUUB 5FCUH 5I1AB 4LHUD 5ALCH 1WF5A 2NW3A 4BK4A 4YZFE 3SO3B 3U7YH 5EU6D 1KT2B 5CZKA 1I1FA 4FFYH 4I0PD 1TFHA 5C9JB 1D5ZB 1IC7L 1NQBA 4JM2B 4OGAD 5B22A 3TC9A 3P11H 4KROD 1IAKA 2PR4H 5E56A 1SBSL 1MLCA 1S7QA 1XF3B 5B21A 4F58L 4NFBA 3RPKA 2H8PB 3O9WA 4LDLB 4QRSB 1F2XK 1QVOA 1A6TA 1G0YR 4XZUA 1OHQA 4PRNB 3BP4B 5DUBB 1JZ6A 4ELME 3DMMD 2YD7A 3F7PC 3GB7B 4HEPG 4HH8A 3JTSB 4HXAH 3NAAH 3ZKQD 4UIMB 4UT9H 1MUJA 2CRIA 3L3HA 3O3BB 5EUKB 4S1QL 4X83A 1FJ1A 1UVQA 1NCUA 4JQIH 4Y16D 5FHAL 1ETZA 1NL0H 3I3BA 3H7BB 5CEYA 2CUMA 4FNLL 2VL5A 3RX8A 4L4VA 2P48B 3Q48A 5DJCB 2R15A 2A1WH 4QHMA 3S4SG 1JL8A 2JELH 5I30L 2ZSWB 3OKDB 4NPYB 1E4XH 1S7RB 5HI5C 4HKZB 2N1KA 2WM0A 1MHEB 3JXAA 4XCCL 2OL3H 3CIQA 4L5FL 1I3GL 2E7CA 3VFGH 4PRPA 1D5MA 4Y88A 3RIFK 3QFJA 2Z92A 2ZCKH 1HHHB 3OX8B 5I74B 2IGFL 3WNPA 1OM3H 4APQB 4OIAA 2XKNA 2X7LA 4MGXA 4QHMB 3SO5A 1RUAL 1DFBL 1X5AA 4LCYA 5KTEL 2CJUH 4MJ5B 1S7XB 4Z7OE 4LGSB 1G7IB 3GSNA 1A0QH 4NGHH 4OGAC 4LCWA 1QFWH 1D5BA 1ED3A 1RJCA 3ARVA 2V9QA 5JMOC 2CO6B 1A7QL 2FLBT 3VW3H 3QDGB 3DVGB 4QLRA 2Z92B 4UQ2A 5E6IB 1ZLSL 5IHZA 5KVDL 3ULVC 4Q74A 3MA9L 1QYGH 4EXKA 1DJSA 3RY6C 2X4UB 1UWGL 4OZ4B 4GQ9L 1PW3A 2F54B 3MA7B 3P9MA 1S7XA 4YNYB 3BDXA 5GRYA 3ZHKA 1W0YT 2VLJA 3WHE1 1HSBA 4NWUL 4DFHA 3P4MA 4H8WC 4JRXE 1RZGA 5JIHA 2F53B 2BCKB 2P42B 3VD3A 4OF3A 2NYYD 3UO1H 1YJDH 4Y89A 5TFSL 4R6UA 4OZGA 5DRNA 4ZDHA 4DGIH 4TULL 2L0DA 4QHUA 3H0TB 4JY6A 1CGTA 4UINH 3NACH 3QUYC 4MWFB 4Y2OA 4PRIB 1BQHA 3ZDYE 1FLRL 4Y4KA 4CL7A 4RFOH 5J06A 2FEEL 3UROR 3PL6C 4NO0A 2EYRB 3BAEH 1S9VB 4JRYD 4KJWD 4G7YH 1RK0B 3EDDA 1AH1A 1N8ZB 4XNXH 1NJ9A 4XVTL 5ESAA 1W72B 1T2QH 3I75B 2GSIA 3F12A 5DUPL 2OQJB 2X1OA 5HGBA 2BY3A 4MDJB 3K1KC 1ZK9A 3MNWA 5DJYA 1MWAL 1CICA 2B1HL 1QLFA 4TUOB 2DLIA 4M7LH 3QHFH 4XXDA 4N0UE 4RA3A 4M43L 2I5YH 4LIQE 3PWUB 1RZ8B 2AEPL 3BH9B 3UDWA 2P1YA 3EOBA 3T8XB 2JJUA 2B39A 1N6QL 4HFWB 3QDME 3HRZB 4KK5D 4PJAF 4M7JL 4YHKH 5GRJH 4L4VE 3RVUC 4WFHD 5A43C 3DYMA 2ICEB 1WEJL 4AIOA 3OTTA 5MEQA 3S9DB 5FAAA 3VRIB 1DBML 2GK0B 3T4YB 4W6XB 4TUKL 5IB4B 5I2IA 5D1QD 3OGCA 1QSFA 2DD8L 3FT3B 4LEXL 1HINH 3TBVA 3HC4H 4XC1L 4V1DB 3SE8L 4MB5A 4Q7DA 4X4XB 4S1DC 3UTOA 5DJXB 1LMKA 3PGCB 4AEHH 4RGNB 4KI5C 1LK2B 4AENA 4P4KB 1EX0A 2AJ3A 2HN7B 4X4MA 4YHYC 3MRPA 4P5TC 4R2GC 3BQUB 1RMFH 3ARBC 1R0AH 2KDGA 1HXMB 2IAMB 4H20L 4P23C 1VFOA 4LPUA 4MA1C 1DDHA 4E9LA 4KTYA 3IXAA 4OZFH 2ESVA 1FZJA 3LS4H 4OF8A 5F1SA 4PJIF 2BNRB 1JMZA 1P2CA 2X05A 1BQUA 4NNYA 2BVYA 4MMZC 2ESVE 1QSED 3FQUA 1ZGLM 2BSRB 3LN4B 3NH7H 3MXVL 3BZFA 5F7EL 1XAUA 1AGFA 2AQ3A 4AQOA 3QO0B 4M7KH 1I7RB 3BXNA 1SEQH 3OG4B 4N0UB 4WI3A 1ITCA 1JPTH 5D72H 1S7SB 2D03L 1DZBA 2A74B 1B3JA 4YDJB 3PP3K 5BV7H 1MUJB 4YPGA 2YPLA 3QUXA 1EK3A 3MMEA 3VGAB 1QRND 3PGFH 3VD9A 5E8OA 3HZVA 3TNNA 3QRGL 2VC2H 2HTKC 1AHWC 2YN5A 4HUNB 1NAKL 2FZ3B 1E6OH 3OKDA 4K71B 4GKSB 4U31A 4KJWC 5JO5B 1OPGL 5I1KL 4HZLA 4WENB 1P4LB 1S5HB 3O8XB 4P46A 3JZ7A 3BKYL 3QYCA 4HF5L 5KSAD 4L8DA 4OFIA 1VADB 1BM3L 2X40A 3TESA 5I0ZA 3DETD 3T65B 4C56D 3QIWB 4P2OC 4OZHF 4AENB 5CMAB 1NCAH 1T20A 4JZOA 4MJ4A 3WL9B 4FABH 3ULVF 3PWNB 3I2CL 4PP1C 5T5FL 1Z9MA 5EZJA 4E42B 5CCKL 5F89B 4YR6A 3V6FB 4ZYKA 1PSKL 5EC1B 1I8LC 3S5LB 1I7UA 4X6DB 2QQQA 3RWHB 2IBZX 3MRLB 1AFVL 4BH7A 3BVNA 1HHIB 3TV3H 5A16B 5KSAC 4PJCA 1TJIL 3N85L 4O9HH 2BY0A 1K5NB 1QFWI 1T66D 4Q9CA 4GSDH 3RTQD 4YAQA 5JIPA 1A6AB 1JHLH 3P4NB 4HJGA 4YHPB 5FCSH 4LASH 2G2RA 4ONGL 3KPOB 3W2DH 5GXBB 2F53A 3KYNB 3KR3H 4R90L 2B4CH 4F9LC 1ZT7B 4XCFH 1DEDA 4Z7WA 3I6KA 3WO3B 3PL6B 4KY1H 4M9PA 4MJIA 1NGPH 4PBWD 1XR8A 1IE5A 4DOHE 1J8KA 1XGTA 4BM7A 1VFUA 5KVFH 3D5OF 5F3BA 5ADOH 5A1AA 3SDCB 3MV7B 4JVUA 5BZWB 2IPKA 4LQFH 1AGEB 1BF8A 3ZYOA 5M7QA 5ICXA 3CZFA 2ENSA 1MJ7H 1FFQA 4O51B 2NTSP 4OI7A 1VPOH 1FNEB 1KC5H 3M8OH 4JFOA 1KEMH 4FQHA 1AO7E 1QACA 3EFDH 4L9LB 4MA8H 1DN0A 5IMLB 3BW9B 3S5LG 2VH5H 1FBIL 5KW9H 2VN7A 1RIVH 2FDBP 4Y1AA 2VISA 2GUOB 3MBEA 5TF1H 4C83A 5SWSA 1JGUH 1IC1A 1R6VA 2EICA 3WUZA 1AHWA 3D69A 2DQTL 3GGWA 4CVWA 3RNKB 4NNXB 3OAZK 4R3SB 4XBGA 4X6BB 4YDVA 4JHWH 5GGRY 1FG2B 4P23D 4ZFOA 3EYVA 2AP2A 1KLUB 3BP5A 5FO8A 1EIBA 4BUGA 4IRZL 5T3XH 2XG4A 3AXLA 3N1QC 3VXUD 3C6LC 5GSVB 4OCRL 4MS8D 3VH8A 1PJ9A 1KCUH 3BI9X 3TJEH 1N0LA 1NMAL 3LSOB 4MS8C 1GRWA 3SPVA 5JTWA 4X6EB 1GGBH 3ECBA 1I7UB 4JG0H 5GS0C 3WEXB 3X14B 4JQVA 3WIHA 2F58L 1T1YB 3QR2A 4KI5F 2VQTA 2OZ4L 2YUXA 3WFHA 3LKOB 1FZKA 1E4WL 4AZ8A 3MLYH 1NCDL 2BX5A 3RDTB 2DYPD 3UTPD 5FKPA 2G2RB 1N59A 3EFDL 5DSCA 5AYUH 1VACA 3TWCL 3LY6A 1FZMB 2PYEE 4N9OB 4Y5VC 5D8JL 4XTRD 3MJ9A 4HDIB 2GJZB 5HPMB 1VPOL 1LO5B 4P59H 1T1WB 3BT2H 1W8OA 3CFEB 1KT2A 4NPYA 4I3RL 1M05B 2VE6B 1CXIA 5KVFL 4ZXBA 3DSNA 4F2MB 3IDMB 1S9YA 4KQ4L 4OLVL 1J9CT 3QFJB 1IQDA 1YQ2A 4ZPVB 2NW2A 4HWEL 2YD9A 4LOUD 1EVTC 3RDTA 1FL5B 4X6CA 4U1SB 3MGTB 3ZLQC 3KPSA 3LAFA 3TT3L 3MLSH 2DI9A 3LS5H 4G8IA 5JOEA 3B2UC 1YEJL 1KTLA 3FO1B 1CLZL 2KZ1B 1BFTA 2MQCA 4J8RA 3P77B 4WTZA 3UMTA 1P84J 1TZGH 4GKZB 5EPMA 3TZVD 4BELD 2FR4B 3BN9C 3JWDC 5ANME 5F9AC 5HGBB 1HXYA 1RUML 3NCYS 3QEUB 3ZKNC 4UIMA 2HFTA 3BPOC 3NCEB 1LEGA 4U6VL 1KIPB 3IYLW 5F7WC 3BYYA 1AC0A 1VGEL 4QRTA 2V9RA 2X70B 5C0IB 3MREB 4K71C 5DDHA 1KTDA 2EDTA 2Z31C 4G8FA 4FS0A 3IU4L 4GH7B 4YE4H 2AKRA 3QULA 2MCPH 4XRCA 5DQDH 3E6FB 3K46A 1G6RA 1GOHA 1CVSC 4JY4B 3HG1E 4MA7H 4PJ9B 3KPNB 3EYQD 4WU5B 4CW1A 2F5AH 3HAEA 4QYOB 2DYPA 2EKSA 4TSCH 3SJVE 3PJSB 1A5FL 3ARZA 3QDHA 4HLZG 1OWRM 3MLVL 2FX9H 5GRVK 3W5MA 1AGEA 1E6JH 1RHHB 1P1ZB 4U2ZA 4JY6B 1SYSA 3OAYK 1V3KA 4I4WB 3E6FA 4K23L 4BUHA 4U6XA 4KQ3L 4L4TB 1YEIH 1C12A 2M1KA 3QWRA 2VDPL 4Q0XL 3VMNA 1EHLL 3S36L 1NAKH 3S98A 2P45B 5HBBA 2EEAA 3SDAC 4DJMA 3JV0A 2CK2A 1A7RL 1RIUH 1VHPA 1I1AC 5DGQA 3U6RA 5F96L 1NLDL 1JGEB 4ZFGL 4GRWB 1RUPH 1C5BL 1KYOJ 3WXWL 4F7TA 4XNYL 4YAQB 3KYKH 1JPTL 5D72L 1AQKH 4NSKB 5HHVL 1C7SA 1ES0B 1WSST 1B6UA 2X4OB 1AXSB 1PY4A 5ILTH 2EXWC 4A6YH 5EBWB 3C9NA 5L2KA 4PRHE 5DJAB 3WIFA 1AGBB 4K2UL 4PREB 4YXLH 2DKMA 4NC1C 4LMQI 5HDQH 2MTPA 4ENED 2W9DL 4JFHE 5E70A 5FHBL 3VXUB 2DL2A 2C1PA 3RWDA 4F9PA 1PEWA 3V4VL 2XY1A 3O6LH 3PWVA 5I76A 3R1GH 4KUCF 5BZWA 1I9JH 4BFBD 5TF0A 5F8RC 3VGGA 4KRNA 4AMKL 1YEFL 3CXDL 1EFXD 1N59B 2XWTB 1OQOA 4PIRF 2CXKA 1UXSB 5TPWL 2DMBA 1IKNA 5A3ID 1I9EA 3DRQB 3QUMA 1D5XB 2X9WA 2B4CC 3QJFA 5ESAB 2BJML 4NZRH 3DO7A 2DYPB 2EKSB 2HP4A 1FAIL 4WWKB 4AG4H 5KZCB 1CIDA 3GSRA 3QXVA 1YEHH 5D7IE 4WY7L 5DJYB 4WDIA 3V5DB 5KAQG 3FT2A 4ONHB 1NBZB 5JR1H 1BVZA 4LEXH 1MQKH 4V2CB 2E9JA 1MREH 1NCNA 5HYEA 3A0OA 2ZUSA 4U1KB 3GJFK 2HG5A 5GZNC 5CD5C 2FWOA 3WUWA 1FFNA 1CL7H 5E6ZA 3T3MF 1FLTX 2EC9T 5DLML 1V8HA 5C0BA 4N0YL 1GGIH 4YO0A 3ZT7A 2AEPH 1OOAA 1LHZA 4ODWA 1OCWL 1BZ7B 5C0CB 1JZ8A 5DRXA 4FQ1L 1IFHH 3DGGB 5IEHA 3NCJH 5HYJB 1F3RB 4P5TB 5EO0B 2J6EA 1EH9A 3HNSH 4PV9B 3MLWH 2HFGH 3P0VH 4N5EC 4Z95H 1N5YH 4HJJL 5DUPH 2ZPKH 3DTXA 3O11A 3TYGH 5CJOH 2W60B 5KN5A 4NBZB 4ZFFB 2FD6L 2CRZA 5EB9A 4QYOA 2FECL 1G7JB 4I9WE 1QD0A 3BD3A 3QIUB 4RDQF 3EOTL 3GI9L 3IFOB 2D7NA 4XHQA 5C0CA 3BGFC 4PY8I 1FL3A 4RQQA 3QXAB 4PJ7F 5EIIA 1JGVH 2EYSA 3KS0H 3VXTA 4OLXH 3VDCA 4AQ1B 1YMMB 5I8CA 2LE9A 3FTGA 3MPCA 1IEAB 1LP9B 3AGVA 3QB7C 1MCSA 1MRDL 1SY6L 4M1GL 4CKVX 3QWQB 4N90D 1YDPB 4RISL 4PRAA 2MPAH 2J88H 3OKMA 1C7TA 1JHKL 1AXIB 3GSOB 7FABL 1MRCL 5DHVH 2J8UE 5DMGC 5E2JA 4JFOB 5C7XH 4K7FA 4EKXA 4LKCA 1EGJA 4LLVB 4M93B 5JUEL 4PRHB 4X6CE 5ACMA 1S7RA 2RCSH 4K3JL 5HVFB 5JXAL 3BN9D 4JDTL 4W68A 1CBVH 1H5BB 1KJMB 4UI2A 2DJUA 3P0VL 1S8DB 3ALXA 4QRUA 2MCG1 1EZVX 1X5YA 3H9HB 4YFLF 3HNSL 4CVZB 1OTTD 3H2WA 1IFHL 5F1NA 4HAFA 4GS7B 1KN2L 4X6BA 4YDVB 2X7LB 1G9MH 4KAQH 1MEXL 4UB0L 2ZOKA 2D0HA 1YQVL 1XZ0A 2A6KB 4PGJA 4RWHA 1IC5L 2B0SL 1FH5H 2OP4L 1IBGL 4PYGA 3D2UD 4P57B 3FN0L 5ECJE 4K55A 3FOMA 2R4RL 4L3CA 4HZLB 2QKIB 3A6CL 4QT5A 4JGUA 5FO9B 1AD0A 1MREL 3ARDB 2Z8SA 3WMSA 4GG6B 1B0WA 1NMCC 1AIFA 3HMWL 5C3TA 2YEZB 4Y8DC 5ITFB 3OAUH 3SGJA 1BX2B 1EBPA 1OP5H 2KPNA 4PGZA 4DGVH 4H88L 4APQD 3MLRL 4X6DF 2EE9A 3MV9B 3IFPB 5E1AB 1JGLL 4TVPD 4WW1B 5EU5B 1AP2A 2XFXA 5TPWH 4MCYB 5MP6H 1DSFH 3FOLA 1A02N 3PWPB 4U0RB 1G1YA 1DANT 2HJKA 3TN0A 4PJDB 1MAJA 5L6YH 3VXTB 3HE6A 2R0KL 5HHOD 1GZQB 4EN3B 4HG4K 3WJJC 5J9PB 2F19H 3FO2A 3G08A 4HS6A 2AABH 4XH2B 1LD9B 1K4CB 1BBDH 5DMIL 4OZFA 4F37K 3BGMA 4ODSL 1JYVA 4F9LA 5IG7A 5DEZA 1BOYA 3KPQB 3AS1A 4UV7H 2PXYA 1BEYH 5L2KD 2J8UA 1T22B 4OCWL 2LABA 2V5TA 4GAJL 3Q5OA 4AJ0A 5HHVH 3VI3E 2AI0L 4Y5YC 5FECA 1DUZB 1XGYH 4UV4L 5EU3B 2I07B 4KK5C 1CLOH 3FB8B 2IAMC 4L9LC 5ALBH 3SCMC 2Y9RT 2XA3A 3NIDF 3EJYD 5TGBA 1I1RA 3FQWA 5I18L 3PP3H 2W65A 25C8H 2XQBL 4IRSC 5TDNB 1A2YB 1KTDB 5DJCA 1TIUA 3CCHB 4LGPB 3RUGE 1RUKL 3MJGX 4G43A 1UWEH 4FTVA 4TUJB 4U1IB 3V52H 4P4RB 4AEFA 3EOBB 1BZ9A 1BVKB 4OFPA 2J8UB 2VSDA 4RBPH 2ATKB 1F6LL 4NRXA 3S34H 1TQCB 2Q87A 4LAJH 2O5ZL 5SX4I 3HAEB 1LWRA 1YNTB 2HFFB 3V52L 3WHE0 5J8OA 3GSRB 5BVPL 4DGYH 1DQJA 3SE3C 2CLZB 3OKLA 3KLHC 2FNBA 1FV1B 1U58B 1I7ZA 4PRBB 3MBXH 4NQSA 3VXRD 5MI0C 3OKMB 1HSAA 3OMZA 5HGHA 2O5YH 1I7TA 4OD3L 2AI0H 3SGJC 5C0BE 3TO2A 5MEOB 3TVMC 4JANA 3NBNA 3RDTC 3F58L 4OIBA 3ARXA 1C5CH 3MRMA 4OD1H 1IQWL 1QPXA 5IVXE 2Y36L 3VWJD 1TJGH 4OQTA 1AQDA 3QO1B 4ODSH 1ZLVH 1F13A 3Q2CA 3VRLF 4HGMA 3ECBB 4LLAA 5I1JH 1LO2H 3UTQB 1W0VB 1HEZA 5C6TH 2X4RA 3DXAD 3QCVL 1JGEA 3LV3B 1ZEAH 4EIGB 2XNAB 4UDUA 3H3KA 3NCYP 1ZWIB 3V0VA 5C9KA 3K80A 2VLJB 2E9BA 5I1HH 1I75A 2WK2A 4OM0L 2K1MA 5EU4B 3OG6B 4F8TA 1WTGT 1K3IA 2NY2C 4QT5B 4ODUA 1B0GA 1AXTL 1R3KA 4ZAKD 3QHTC 1PBYA 3FFDA 1T7WA 5F7NC 1OP3H 5FECB 1LEIB 3SE4C 1FSKC 3DBXA 5DA0B 3FFCD 2DDQH 4JFQB 3QI9C 2DKUA 5BMFH 4BZ1H 3IDMA 2CIKB 3O4LD 2KKQA 3L3IB 3QNZB 4Y4FC 1FJ1B 1BREA 1CDYA 2P5WA 4AL8L 1Y0LA 1S9KC 5E1AA 1NGXA 4R3SA 4XBGB 3VGBA 1U8OB 4TUJA 1HYRC 4U1IA 1MJ8L 1YEGH 5F9OL 3GI8H 4WU7B 1ND0B 2CDEA 4PRHA 3RY5A 3O9WD 3SDAD 1ZHNB 1MHHB 5IW6A 2I9LA 1WQVT 1IBGH 2OR8A 3B5HA 3OBAA 2OQJA 3QG7L 3J7HA 1JV5B 3HLAA 5A40E 2ADGB 1TETH 4JPVL 4P3WA 2K9UA 4M6NL 2FHFA 4P4KD 1JFQL 3QP3A 4L8CA 1GGBL 3VCLB 3OZ9H 1Y0LB 3JUYA 4Z0BL 3IGAA 3VJ6A 4C56E 5GGVY 2XZQH 2HLAB 3KGRA 1L7TL 3SGEH 3WYRA 3RKDD 3O2WH 5GS2H 4NO2B 2H32H 4QXGL 5TJWK 4MNQE 5IBLD 1GHFH 3GRWA 1E27A 3FB8A 1U92B 1TNNA 3ROOB 1JHKH 3QEGL 2CUHA 4XVJL 5IBUG 4Y4HA 3MOAL 1NEUA 2ZZUT 1GC1H 4MQTB 1G7LB 1R3HB 3T3PE 1WBYB 4BA8A 4KRPB 1Q9WA 1BAFH 2FJGB 1ORSB 1QSZA 1U2HA 2J7LA 2A6IB 1J11A 4LPCA 2R1XA 3VXPB 2DQUH 4PJCB 3TCLA 4YHNA 3P9MB 3GNMH 1TPXB 3DNKA 1JGVL 3LKNA 2ATKA 4RWYH 3VFPA 4JHAH 4LPTA 2NQCA 2BVTA 4PFEA 5B38B 2EH8H 3H9SD 2DIJA 1T2JA 4OZHB 4ZFOL 3UPRA 3EAKA 3FOLB 5FO7B 4U1GC 3SKJH 4CU8A 4NCC2 1LK3H 4TVPL 2D7MA 1NCBL 3BIKB 4P3DB 3W39A 1VB9A 4MQ7A 4NN5B 2HKFH 5K93A 5IJVB 1JTPA 1PY9A 5CLWA 5CBEB 4N68A 2CIIA 3ZDZF 5BMFL 1SMAA 4Z77B 1LD9A 4I0CC 4MSWA 2OI9C 1UFUA 3G6JE 1LO4L 1S7QB 2YC1A 3RWGB 4JANB 1K4DA 2NX5E 5MEND 4LSUH 5DJAA 5D2NE 2OCFD 3DETC 12E8L 3PABA 4LSSH 2WMPA 4MA3B 5DJ6B 2IQ9L 1ZGLA 4KI5D 4ZUVB 5F6HI 5JHDD 4O9HL 5DD0H 4C56B 3QUKB 5EZIH 2X4RB 4M4PA 2B1AH 2YMXL 3KLSA 5E2VH 2V9TA 2NY1C 3MRBA 3VD5A 5C6TL 1A3QA 2EC8A 1OARL 1RZIA 5CSZA 5I1JL 2W65B 3MV8E 2VZVA 4L4VB 1JMXA 4CVXB 1L7IH 2AK4E 4OD1L 4AH2B 4J3WA 1KLUA 1JYNA 3DSFH 1ADQL 4O2FB 3N06B 5BS0E 4HUVA 4F15B 5DJDB 3PWPD 3FHQA 4OGXH 2G60L 2D9CA 5JNYA 2NY3C 3RX7A 3ZDXF 2CK0L 4E41E 1ZHKB 1FAKT 4WGWB 3QUZB 3LN9A 3GMRA 2ITDA 3VXMA 1EUTA 3P4LA 2EDDA 4PGDA 1HIML 1MIEL 3MBXL 4RGMB 3CFCH 5FF6B 5IMKB 3BEVB 2EYTB 1PGRB 4LLMB 4JKLA 4WFGE 4ZS7L 3QDMD 4NWTH 2KH2B 1UB5B 4QNPE 5DRWB 3ULUH 4WW2C 3FFCB 3FO0H 4WJ5A 3WJLC 2YOCA 4NO0D 3FZUD 4OAWA 3D3VA 3MJ7B 1MFAH 4PRAB 4MD5B 4WCYL 5JPNB 2N56A 1KGCE 5BW7A 2ERJC 4M6ML 1L6XA 3LRSA 2YKLH 4XP1H 2OYPA 1G7MB 1UWEL 5KVEH 2YN3A 5IW1A 3QRGH 5F21B 3RUGA 2B20A 3VMOA 3CX2A 4ZAKA 4E5XB 1OVZA 1Z9SA 1J0YA 2YSSA 3WLBB 4MNGE 1XGRB 1JNNL 2VRAA 3IETB 3QXDB 2R56L 4YC2C 1FSKB 5DD1L 4KKLD 2WBWB 2AK4A 1C08B 3ZHDA 4F8QA 2Z31A 1IAMA 2DQJH 2QADC 2WUBH 2YA0A 4MB3A 3VD7A 3JTTA 1NCTA 4TNVF 5D6DC 1O7SA 1K4DB 3HPLB 4QEGA 3KWWB 3PXHA 1WZ1L 2P8PB 5A2LH 3MNZB 4ACPA 4KDTC 5DHYA 1FE8L 3NMEA 1NUFA 2VMFA 4P99A 3QIBB 1UGNA 5SX5K 1QBLL 2XTJD 1KJVA 5ESVA 5IESH 2F19L 1MH5B 4ZS7H 1IGJB 3QIBC 4U1LB 1WBXB 2CLRA 3MRNB 4PJHB 3RVTD 5HGDA 3CVHH 5DDHB 1AXSA 3OKKA 4P9ML 3GBLA 2E6JA 4YH6A 1A6WH 1DSFL 3AMKA 5DT1L 3VXNA 4X5LA 3R06B 2R0LH 2IPTH 4TSCL 3WHXB 3TNMB 5K59E 1T21B 4RNRA 2P8PA 2GI7A 2CK0H 1BQLH 5EDXA 3IAGC 4OGXL 2EO1A 4GRMA 2DQHH 3A67L 4BQ9A 2HFFA 1AY1H 3WNKA 1U6AL 1NMBL 4LLQB 2ZUQC 4N0FA 3D25A 4JM2F 3GMPA 2CR6A 4RMVA 1QFUL 3IXAB 1R3LA 1K85A 2VKWA 2YMXH 1U36A 4GAGH 1D9KB 1JNNH 4XI5C 1S78C 5T33H 3SDDD 4JR9L 1JZ4A 2IQ9H 5F72S 1BMGA 1IAIL 2A2QT 1YYLH 4ZMAT 1GAFL 2VDNH 2HKHL 4QRPD 4DAGL 4LSSL 5IQ9B 1FH5L 2OP4H 3CFIC 3MOQA 4K9EH 1QZ1A 2AJVH 5J11B 1TITA 5JHLH 2PXYB 4XP1L 3WS3A 2BCKA 3D39E 3ARGA 1WGOA 3G5ZB 2OL3B 3SGDI 4OCSL 4HK3J 2Q8BH 2O61A 1S7SA 3QEHA 4PJ5A 2PXYC 4Z7NF 1XEDA 1KCSL 3TFKC 3PE9A 1EPFA 4ODBD 2XNAA 1FZKB 1DBAL 4KJQC 4IOIA 4K94L 4K3JH 3HB3D 2X4OA 3W11D 4DZ8B 4U05A 3C2AH 3OJMB 4F7CB 5KBNC 4IOFD 4PJEF 3E1F1 3WKNA 3TWCH 4OSUL 4EI5B 4L4VD 3TPKA 5CZVL 4O00A 5FK9B 2C4FT 1KXTB 2GJ6B 5EU6B 1AR1C 2DQUL 4JFQA 3P9LB 5ACZB 1FVCB 3DYPA 2I26N 4XP9H 2Z0BA 1QLFB 1Z6JT 2X44D 4PJHA 4HLZH 3MOBL 4URTB 2X4PA 5F7DB 3VFUB 4KROB 2BC4A 3RL1B 2EDRA 2EDHA 1KCUL 2RFXA 3HRZA 4OF7A 2NXZC 1URLA 2YRPA 3TYGL 1B90A 3B2UD 2RAMA 5EIIB 3B9KD 5IQ7L 3Q6FA 4JZOB 5AG9A 4OCXL 4BQBA 3BJLA 4AY0A 1UWGH 3PHQA 1LO4H 1NANH 5IK3A 4OBSA 4RMSA 2VTFA 3NCJL 5KVDH 3L5XL 1BIIB 5ITFA 3TNNB 2R29H 2OXGA 3U0TB 3SKMA 3VGAC 1OCWH 3AS3A 4XRCB 1EEZB 1GGIL 3SCMD 5F93C 4HUVB 2A73A 1EFQA 3W0WD 4DAGH 4Z8FH 1INQB 5C6PB 5I1IL 2XWBB 5ID1B 4I3GA 4BJLA 2VSCA 5KTEH 2H6PB 3QIBA 4ZD3L 1KB9K 1S8DA 1K9TA 4EUPH 1MJ7L 3CLFH 1FO0H 2CLZA 4Y4HB 5EOCH 4WW2F 4JVWA 1UYWH 4HPOL 2DQCL 2HLFD 4NC2B 5HVGB 2IGFH 2EDFA 4N1HB 1YYML 5E4EC 5INCA 5AG8A 1ERNA 4HWZA 4WVRA 2AV1B 3RTQB 1K8DB 1U95B 2X1PA 4M61B 1P2CB 3ULSB 2D31A 4CRPA 4NZRL 1JZ2A 1P4BH 1M7IB 4OLEA 4LHJB 4BZ2L 5CJBA 4XCFL 4X80L 3D85A 1U8IB 4U0QB 3FOMB 4NC0B 3EYOB 2I24N 3IFOA 1A6WL 5I1LB 4HWBA 3BXNB 1YY8A 3LEYL 3RJDA 1MCWW 2DBLH 3CVHL 3LKRA 1N4XH 5H37H 1PYWB 4U1NA 5C0CD 2UUDH 5TE4H 2Q3AA 4NQED 5FV1L 2BNQD 1IGYB 3BD4A 2YPKB 1QBLH 3TM6A 2H9GA 4ZPVA 2AGJL 1NGWB 2PW2A 3MLUL 3ULVL 3RI5K 4YGAB 3O3DA 5EZLB 5H2BB 1TQBB 2GTWB 4NKOB 1WZ1H 1M7XA 1FG2A 5FM5M 4LPXA 2A0LC 4ZQKB 4J3VA 1B2WH 1J8HA 5C0FA 2MKWA 4HH9B 1F8TL 3NFSH 4BFIB 4PJ7B 1W0WA 3GIZL 1VFAA 4ZFGH 3I3EA 1YMMD 4LPYA 4O2CB 5DTFB 3MRGB 1WTLA 3DX9B 5IMOA 3CFDA 2D4DA 4PGEB 2IAMD 1DP0A 1F5WA 1I7ZB 3CVHB 2GAZA 2VR5A 4K3DL 2AJSL 4JKWA 1KCVL 3VXME 3TVMD 3TFKD 2YD3A 5CFHA 2Y7QA 4CVXA 3WIIL 1TJHH 1DE4A 3LKQB 5D93B 3RWFA 4OZIB 4KPHH 2O5ZH 2PYEB 4PJGF 2VABA 3D9AH 5EC2B 43C9B 2YUZA 5TQ2L 5D93C 1OTSD 4KKCC 4MJ6A 2AERT 3IRZA 4JFFE 4MHHG 1SJEB 3IDYC 1BJ1J 1BOGA 4C83B 3WNNA 1YN7B 3GDBA 4GG6A 4K8RL 1D9KC 3FCTB 1AR2A 4LLWA 3STLA 1MIEH 1S7WA 4TQEH 4X9FA 3RDTD 2NLJA 5ALBL 2DIBA 4OFDA 4WUUB 3D85D 1F8TH 3HHRB 5J11C 2XOTA 5C0AD 1HYSD 4P9HC 2DQIH 2DB8A 1BFOA 4WJ5B 5CSGA 4AM0A 5HJ3B 3G6DL 3JWDH 3N50A 1D3CA 1UJ3B 2LU7A 1FN4A 3CSGA 4QXUL 4QRRE 1P69B 4Y8AA 2NX5A 3DX8B 2MJWA 3ZE1E 3NIFF 4I0PC 3BQUA 1TQCC 3QFDB 5CD3A 3BP7B 5IHZB 3PL6A 4MJIB 3VXQA 1H3WM 1BBDL 5T3ZE 1JNJA 5F6IC 1YA5A 3BDYH 2ESVB 3FB6B 1QFHA 3QNXA 5GQBA 2HRPL 1JYWA 3JWNC 2B1AL 1J0KA 3PHOB 3OXRB 3B9KB 5CS7A 4YHOL 4QGTA 3IDNA 3T0ED 4FXLA 3QUMH 5JXED 1NBYB 5CGYC 3UYRL 3DX6B 3N1MC 1Y18A 4JAMA 4NKOA 5EUOE 1WWWX 2X9YA 2QJDA 3HC3H 1A6UH 5FK9A 1R5IA 4BZ2H 5F88A 4E41B 4HIIA 3L3JA 1LP9A 1XF4B 1IZKA 2JB5L 3H0TA 4YK4B 3TGXA 2JJVA 1U95A 4LCIH 3MACL 3ULUD 4D9QE 4Z77A 2FX7H 4EN3D 1SEBB 3I50L 2FJHB 2DQCH 1A3RH 1WBXA 2CLRB 2EDEA 3C2SA 4NNXA 3Q3GA 4YJZL 5FOBB 4TUKH 5K9KA 2BMKA 2YC1B 5SV3A 3ZKSD 3ES6B 2VDLL 3V6BR 2PO6B 3VI4E 2R4RH 4G8GB 4F37F 4NO3B 3FN0H 5HYSA 1QG3A 3FFDB 4Z8FL 1UCTA 4CBPA 4JZJC 3QG6B 1E4WH 2B5IC 3U83A 2J4WL 2CPCA 4U6HB 2D0GA 3H3PL 5IFHH 3WXVL 1R3JA 5GS1B 2VXSL 5IFAL 1GC1L 5H2BA 3MOAH 1TZHB 2AGJH 2JJTA 4OZHE 4X9BA 2GJJA 4RGMC 4O58L 3G04B 5JXAH 1DLHA 1MWAA 2J2ZA 3BWUC 5HHMB 3QJHB 5EBWA 3LEYH 4IS6B 2IADA 4ENEC 1BD2E 2V2XB 2J1KA 4RSVA 1CR9L 1BECA 3X12A 2ZG3A 3GIVB 4GMSL 2R2BB 4KK6C 4JFHD 3QEHB 3RWHA 4P2QB 1RHHA 4F80A 1MRDH 4ZTPL 2OM5A 1IAIM 4YXHH 4ETYA 5I73B 4DQOL 2V2WA 4D8PA 2SEBA 1FYHB 1OT2A 2JIXA 4HT1L 5E00A 2AEWA 4HK3N 2LVCA 1UYWL 4HPOH 1G6RH 1DQQA 2PCPA 2R23B 1XCQA 1YNKH 1U9KA 3UP1A 1JF1A 1JTOA 2HVJB 2V2XA 1HN1A 5IW3A 3TNMA 3ARWA 4UIKH 2BNUA 2OK0H 2BHUA 2ICES 3C2AL 2UUDK 5CJOL 2Q6WA 5DURB 2XZAH 4JDVB 1GZQA 4EN3A 1U8QB 4NKMA 1J87A 3U6RB 3QEUA 3AROA 2FO1A 2OMNA 1G0XA 2R29L 1LEGB 2EECA 1BBJA 4LNRA 1C08A 4N8CH 4R97C 4N9GA 5DD3H 2P7TB 3BISA 3HE7A 5B38A 5F7DA 4U1KA 2OTUA 4GMTH 5CILL 4MX7B 2GTZA 3AM8A 4Z0XA 4LLVA 4WO4A 1QFWL 5IBTL 2YBRA 2RCSL 5IF0A 3LIZL 2DICA 3QUXC 2IJ0C 2CJUL 4ODXB 5C7XL 1RJLA 5I8EA 4RAUB 2Z93A 3ARGB 1MRCH 1MH5A 3WLWC 2IMMA 4LSTL 2J5LC 1F45A 2Q86B 3SHSA 5L2KE 1YEEL 2ZCKL 2DI7A 2PTTA 3HG1D 1CDGA 4OZIF 1AY1L 4QRQA 2V2TB 3LB6C 2NNAA 2UYLB 4NDMB 4FFVD 1NSNH 4WIQA 3DTXB 4PRDB 1MVUB 1E4XL 1A7OL 4IOSD 2VZTA 3VH8B 3FB5B 5IGXL 2IPTL 5CSBA 3W5NA 3TYFB 1KSRA 5TE6H 4R4BB 3UZQA 1YN7A 5IHUH 1XT5A 1JK8A 4HSQA 4LCCC 3EZJB 4AIXA 4PRBA 1D7FA 3RGVA 1T1YA 3DECA 3G9VA 4X6FA 4DGYL 4Z78A 5K9KB 5BVPH 3MLWL 3KLDA 5DFVC 3GMOA 2XICA 2CKBH 4AEIL 2BDNL 5C07B 4IIQC 2DLEA 4NZJA 4QCIB 2Q8BL 5IFAH 2VXSH 5HDQL 1DQQB 4OLZL 2P49B 3AFLA 3QG6A 4OZGE 4OCMC 4XP5L 1M7DA 3DRTB 4PJBF 4K3EL 5IJKC 4LLYB 4H1LB 3JV4A 2HH0L 3VFTB 3VU2A 1MQ8A 1GAFH 2VDNL 5DLMH 1YYLL 4GBXA 1DCLA 1QSFD 3WUWG 1A64A 3MX0A 4FZ8H 5IMKA 3UCRA 1MFDH 3DI3B 1G9NL 3M07A 3NPSC 2CLVA 1HHIA 4KXZI 2GCYA 4UV4H 2D03H 4QHKJ 1EHNA 3ZKXB 4LVOC 2BVQB 2KL6A 2YA1A 4WGVB 1V7NL 4YK4C 3I50H 1Y18B 2P7TA 3HE7B 5GRZA 4OCWH 5GS0D 3T4AA 2AXGA 4HWBL 4MX7A 1EMTL 4AG4L 1FAIH 1UKSA 4H1LA 5AYQA 5FDWA 5F1KC 5MENA 3N0PB 4MAYC 4RQQB 1EHAA 4ZNEE 4HWNA 3PIQB 5GS3A 5K9QG 5C0FB 2QKIA 1J86A 4TN9A 3MSPA 1EJ6A 5EOQL 1ZLWH 5I1EH 1CLYH 4IMLB 1N3NB 3CFCL 3CFDB 2P5WB 4CVUA 2XIDA 4PGEA 2CDFB 4APQA 2XN9E 2BSED 1CLYL 4JKMA 4Z6AT 1X5XA 3FAXA 5IESL 4P2QE 4XMPH 2AQ1A 2ED7A 3U46B 2MFNA 3WUWB 4PGBA 3SJVB 4U7KA 1U93B 5MENB 1HKLH 3ELAT 4NRXB 4O2EB 5AD0B 5FXCH 1E4KC 4WTXA 4H88H 4HIEB 5ANMA 3IDGB 4MXVF 4N8VB 3IFNH 4NT6A 4R4BA 5AWNL 5EOTA 3CVIL 3T0EB 3OAUL 2NXYC 2VXTH 3JWDL 1V7NH 1HINL 5JW5A 1IAOA 3PG2A 3KYKL 2DJ4A 3HE6B 4FQQA 2P24A 3NCCB 4WI5A 5CIPB 5DD1H 5GHWL 1U3HA 1NBVL 1IGYA 3KPSE 4U49A 4P2OD 3GMQB 2VDRH 4PJAB 1CD1A 1G1CA 5GS0L 3B4NA 3HE6C 4G6AC 3LIZH 2MNUA 5ESQB 5I66B 1C12B 2X9XA 5I73C 4OQ1A 1YQVH 3C60D 5CILH 1QBML 4D9QD 2ZUVA 1HOCA 3TT3H 4Y1AD 3KHOA 1YEIL 4N0UA 3QHFL 3CDFA 5FYLD 4ZQKA 1MOEA 5TH2A 4AEIH 5HVWA 2NY0B 3T77A 2PTTB 2EC9U 4BQ8A 4GT7A 3N9GH 1K8DA 2PO6D 1GZPB 5DQ9B 4NQXB 5C86A 2BVOA 3M45A 5FKPB 3SGDH 2XTLA 1NCBH 2CRYA 2HA1A 4XVTH 3BT2L 5IJKA 3MV8B 2VERN 1CFQB 1HIMH 4QXTB 5L2KB 1I85A 4G7YL 3BE1H 4HK0A 4NO0B 2FBOJ 5HI3C 15C8L 3RWFB 2GJZA 2CRMA 4U3XA 4S10A 4H25B 1CE6A 4G6AD 2A6JA 1M05A 2Z35A 5DVMA 4U1NB 4XVSH 5HI5D 2FSEB 5ISZA 2C1PB 4DQOH 1GXEA 3BP6A 1WITA 2VLKD 3PGDA 1SY6H 4M1GH 2OZ4H 3FAWA 3IU4H 3G6AA 5HGGS 5D7KD 5E6ID 4ZFZB 5K9QI 2XV6B 4AT6A 3BX7C 2P5ED 4LSTH 3WCYA 2Y07L 4XX1E 3MLUH 3ULVH 1T6VN 3MGAA 1HSAB 5DK2B 4N1CA 1CGXA 1J05B 3JSSA 5CBAA 4OI9A 4X7TA 5CD5D 5BVJB 2YBRB 1BD2B 3P3YA 4OCRH 4ONOA 5D7IF 3O2WL 1X7QB 4FQCL 4Q9BA 4Z7VF 3TN0D 3JVGC 4IRZH 5KSAB 4QOKA 1I1AB 1XR9B 4PJXF 1NLBH 1QLEL 3OJDB 4GG8B 4JHWL 4P5MB 1XGPB 2VLLA 4NZDA 1MHPH 4ZOCA 5DD3L 1JTTA 3VFMB 2IPUK 2R69H 5F7FA 3D39A 5CP3A 2X70A 5C0IA 5D1ZD 5IM7A 4A2LA 4P0DA 1U8LB 1B0RA 4M6NH 4JO4L 3BVNB 3SOBL 4N0YH 3T08A 4NKDA 2B7DT 4NCC1 3SDYH 1JWUA 4DCQB 3VXMD 1I3VA 3ZZ1A 2OK0L 1G7HB 1LE5A 3HS0B 4IIQB 5HYIA 3UJIL 4JZJA 1R5WB 5CUSH 1G6RL 3SDYL 2KQMA 4LQFL 5FF6A 2BSTB 1CIUA 1JPFB 3GNML 4TNWF 3BKJL 4ZSOA 2V5MA 2JB5H 2F58H 2FLRT 4XCNB 2MHAB 2BOCB 4R7DA 1PX3A 3MO1A 5C0DA 5KANG 3TBYB 2XWBA 5ID1A 3DUHA 5JPNA 4XVJH 3HC3L 1AXTH 4PJ7E 1QLEH 2ARJA 2ZUUA 1T6WA 2PTUA 3CUPA 2HVKA 5D7JD 3HKFA 3JV4B 3VFTA 1KPUB 5FO7A 1NGZB 1FP5A 2FATH 1JHLL 1YMME 2GJ6A 2NY3D 1P4IH 2VISB 4PJCF 4O58H 3CGTA 1BLNA 4JKPH 3DX7B 5F97E 1QEWB 1PX4A 4RMWA 1LO2L 4MSWB 4NSKA 1JN6A 3OB0H 5ESQA 3B3IA 1WUNT 1EZVY 4K3GA 4P2RB 4QRSA 4K3HA 4K2UH 1J05A 3SDDC 5TF1L 4UOW0 1BVKA 1KG0A 4FFZH 5IV2A 3AREB 1N8ZA 3QG7H 2VH5L 5ILTL 2ICWI 3BQUC 4LARH 4XT1C 2HT3D 1VDGA 3RWDB 4FXGA 3T77B 2FECI 1TLKA 3M8OL 4QKXB 3OXSB 3VFSB 1N3NA 2L7UA 4YHYB 1OWWA 1SEBA 2Q86A 5FGBA 2Q7YA 4K8RH 3F65A 2N7AA 5SX5H 4K94H 5ADOL 2GTWA 1KB5L 3ARBB 4Y4FB 4DFIA 4LCIL 3BIBX 3S36H 4H26A 4I8DA 1EHLH 3KYOA 4S0SD 1X5HA 4HFWA 3OKEB 5BO1L 1A1MA 1NGPL 5FYJU 2ZKHL 3T0EC 2Z35B 1E6OL 1I1YA 4R90H 3ARRA 1TJHL 5JHLL 1YY9D 1HDMA 1P9MA 1PG7X 3GM0A 3FT2B 2P5WE 3EJJX 3BN3B 5L9DL 2HKHH 4YR6B 5F89A 4ZYKB 1T89A 4Q6IA 1CWVA 3BZ4B 3UYRH 5FKAB 5INDB 2EE3A 2VQ1B 4JPWH 4XVUC 1QQDA 5GS0H 1AJ7L 3I6GA 5SWZB 3KPRD 3GIZH 2HRPH 5CJXC 2CKBA 1DE4B 2EXYD 1EFXA 3QBTB 4PP2A 4ZXBD 3O6FB 1PD6A 2CDGA 4PJXA 1PSKH 3DX6A 4JAMB 4ONFL 1A14H 3IJSA 2EE6A 3CVIH 4ETQB 2X1WL 3MYZA 4UV7L 1WLHA 3UTTD 1C5CL 3KYNA 5D2LA 4QOKB 4H0GA 4YE4L 5JHDA 1HOCB 2NY0C 3NH7L 4LOUC 3S96B 5GSRB 4U1JB 4JFDE 1Q0XH 2QQNL 3G6DH 1HKLL 4Q6IB 4UQ3B 4EJ1C 4E0RA 5DMIH 3QCUH 3U79A 1NC4B 2DQIL 3MUGA 3O45A 4GW5A 5BZDA 4NC1E 1Z2KA 2VXQH 4XMPL 4JM2D 2O5YL 1BM3H 5FM5O 1V7MH 1I8IA 1AJ7H 4G6FB 3KS0J 3OHXA 5C09A 5T1KB 1AD9B 3Q3GB 5FOBA 3WS6C 4LHUA 4HF5H 4QTHA 3LMJL 3P4MB 1CLZH 5EOQH 2PO6A 4MQSB 5MP6L 4J6RH 3THMH 4ZO6A 1FL3B 3NIDE 2B2XL 5D7LD 2RGSA 3ARDC 1NFIB 2Y5TB 2WWMC 4P3DA 3DMMC 3MLRH 4X9HA 4XMKL 1YMHB 1NFDB 3VXUA 4ZDHB 2A74A 2ZNXA 4GOSA 4P2OB 3CH8A 3RUGF 4R2GD 3G6AB 3SE8H 4JN2A 2I9TB 5GS1A 2V7HB 1AO7D 3HMWH 3IB4A 5GIRA 5KOVC 3TBTA 4QRRA 5CBAB 2WP3O 2E7LA 5IHBA 5DK0B 3OR7A 4FZ8L 5BVJA 2A83B 5JO5A 4RAVA 4NZUL 2B0SH 4IS6A 4G9FA 1DLFH 1BEYL 5D1QC 3LSOA 5D1XD 5IHLB 1Q1JH 1G9ML 2Z93B 43CAB 1A4JB 4JRXA 3FCTA 4JG0L 1CFBA 3CDGB 4WI6A 2VWEE 4XXDB 4UZGA 3WEXA 1P9MC 1U91A 3ZE0F 4X0KA 2BDNH 1GOGA 4XMLL 5M94B 1FGNL 3DURB 1RZ8A 3IAQA 5EIVA 1CD1B 2R0KH 3MV01 1ZLUK 4I1NB 4JPKL 4W81A 5E95B 3JTTB 3VGEA 4ETQA 4HKBB 3VRLE 1OSPH 2H6PA 4YUEL 2HT2D 4MMXC 1FFOA 5EZJB 3BAEL 1QVOB 2DQEH 4E42A 4U6HA 3EZ8A 4X5WA 2GY5A 1IJ9A 3ARDA 4PLJC 2WBKA 4X80H 4RISH 2APBA 3GSWB 2FO4B 4UAOB 3RZCB 1HEZB 3MRDB 4YXKL 5EO0A 5C09D 3QNXB 1GOFA 5ID0B 2NR6D 2LAAA 2WWKT 2XPGB 3HNVH 2XN9B 3NIGF 4Y5XA 1RIVL 4NKIH 1FBIH 5KW9L 4NOBA 1YYMH 3KPPA 4C58B 3H7BA 5SV4A 4NN7C 2GFBB 3D85B 4X7FC 5DD6B 1KPVA 3C6LB 2ARJB 2XZZA 3UJIH 1DBMH 1FGVL 2OTWA 3QZWB 4RIRB 3M1BB 5ETUA 3FQNA 3ARBD 4LLYA 4FQ2L 2ERJB 1AGDA 1HHJA 2NY5C 5I1IH 4YHKL 4RFNB 3BMWA 1WIOA 5IBTH 4E41A 5C0EA 4HX1A 4PY7A 1IC5H 3QXWA 4ORGB 2HFGL 4GQ9H 4Z95L 5HDBE 1ACZA 5BS0A 2JK5B 4R8WL 4UB0H 1MEXH 5F9JB 5IP4A 4WDIB 4RFNC 3V5DA 3H6JA 3MLZH 5EO1A 3GMPB 4JFFB 5C09E 4QRTB 4U1HA 4N8CL 1HWHB 4PRID 3ZT6A 4ZO7A 3CXHJ 4FQ1H 2RIKA 3E6HA 5JW4N 3MLZL 1F11B 4MQXD 1FRGH 4KJYB 3SDAA 1WC7B 3BZFB 4Y2DB 1IGFL 3VW3L 1CZ8L 3DPBA 4YDLC 5JLZB 3L3KA 4M3KB 2FH6A 4ONGH 4ZUTA 4XAWH 4LASL 4PRDA 4F7PA 3DHMA 1UQSB 2H41A 2DQDH 4YDLB 4PJEA 1J8HB 4KJPC 5JUEH 5I9QB 3OL2A 2CGRL 3O45B 4AYFA 1MSPA 4PYHA 5T1MA 3WS3B 4XCEB 1M4KA 1QP1A 7FABH 2EH8L 1QFUH 1G7QA 3Q5TA 2Y07H 1FLRH 1YPZA 3GGWB 5C07E 1ZSDA 3KHQA 4I0PA 3B5GA 5JDJA 4WY7H 4FA8A 1FFRA 4OM1L 4XP9L 4LF3B 1KGCD 1KPRB 4I48B 3HN3A 5T5FH 3WN5B 4DGIL 2PTVA 5D7JB 4PLOB 4P2CG 4HD9A 1MWAB 4XAKD 3VDBA 3GKWL 1LNUA 3U4EA 3X12B 4W6YB 5DT1H 1KEGH 1A6VL 1ZT4A 5CZXC 2R2BA 3FQRB 4V1DE 2LTQB 1R3HA 2ZPKL 4C54A 2APTA 4S1QH 1JPFA 3BP6B 2D9QB 4YHLH 3N9GL 2V2TA 4D8PB 1SYVB 4Z0BH 4HC1H 2VLRB 3GSNH 3QIWA 2CDGB 3B83A 4PJXB 3BPNB 5HJ3A 4M1CC 3G5YA 1AR1D 3H3PH 3QUYB 5IFHL 3LPWA 3RHWK 3MRCA 1Q1JL 2C7UB 2VJXA 4NN6C 3MJ6A 3F7YB 4OF5A 1YY8B 3FB7B 1ZT4B 4QF1B 1A22B 4JR9H 4FQPA 4TYUA 5GISL 4MXQC 4X6FB 1OGTA 1IC7H 3PV6B 1NBVH 3B43A 3L3HB 5EUKA 1F4AA 2H9GB 1ZWIA 3F62A 3RU8L 1QKZL 3KPLA 3AB0C 5CAYB 4BK5A 2DM7A 3C8DA 5KS9E 5IIEB 4Y2DA 4D0BA 1X3DA 4HKBA 1NMBH 1GGTA 3MACH 4D9RE 1XGUA 1T0NB 3A67H 1T4KA 3HZYA 2DDQL 3SE4A 4HMEA 1SQ2N 4WO4B 4G9DB 2UZXB 4XMKH 1INQA 4A6YA 3QI9A 3VGDA 3KXFA 4HIIB 3FO0L 2DQGL 3V4UL 4L8SB 3AUVA 5I8EB 1B4JL 1Q9OB 2DN7A 4PJ7A 3FO9B 4GO6B 2FIKB 2VZSA 5DRZA 5DYOA 1HH6B 3LMJH 3MGOB 1A1NA 3GFUA 5ICXB 5T5NF 5FHAH 2FX9L 1R0AL 2X4PB 4LDEB 1SVZA 3R1GL 3UYPA 5DD6A 2HTKD 5HHQB 3HR5B 1KTKE 1NBQA 2NNAB 2VXQL 4CGTA 4YX2L 3GKZA 4QOKD 5C1MB 3HZYB 1FE8H 3EHBD 2BSSA 5DD5H 3SDXE 1JHTB 4U1MB 2IWGA 1HWGB 3FKUS 4OKVB 5IB1A 4NQDA 2P46B 3QUZA 1FNGB 3ARDD 2NY7H 3QAZB 4YO0B 1ADQH 4KHXH 1LO3L 3EOAA 1EMTH 3FRUA 1L7IL 1HH9B 4ONFH 3C87A 1MCQA 1R24A 1S9XA 2WQ8A 3ARGD 2OX5A 3WFBL 2HLAA 1NLDH 1XH3A 5F96H 5DD0L 3ILQD 2X4TA 4YGVB 1U0QA 2AQ2A 4FFYL 3STZA 4JM2C 5GZOD 1VCAA 5JQHC 1N6QH 4UAOC 4HHAB 2JKXA 3J8F7 4JM4L 3NFPB 4N8VA 4XP5H 3RKPA 4EI6B 3AREA 2VDPH 4Z5RA 3QFDA 2CQVA 4Y2DD 1WCBB 3EGSB 4M02A 2WW8A 3S34L 1JI1A 1R5WA 1OP5K 1H0DA 2DAVA 1CD0A 1TTFA 1FNLA 1S9XB 3X14A 1NC4A 4KPHL 2CKBL 4BFIA 3L5JA 1IILE 2HKFL 3AMLA 2RB8A 1E6JL 4PLKD 4R96A 5DHVB 2XQBH 4MWFA 3CD4A 4KKBD 4WWKC 1GPOH 3MUZ1 2MKLC 5EULV 2BHYA 1FZOA 5CJXA 5D2NB 1EJOH 1FNAA 5E2WH 1QR4A 2GSGA 1CLOL 3C6SB 3FQNB 3OAZH 5HY9A 1E4KA 4OLYL 4X9GA 4X8XA 1A7OH 2NR6C 2YXFA 2NY1D 3BIKA 5D5MF 4QTIH 4XI5D 4YIQB 1KJMA 3U2SA 2IH3B 3NACL 2X4SA 1WAAF 5DQDL 1H3VA 2MCPL 5DRZB 3TVMB 1OB1B 5K59F 4U1HB 1YJDL 4KGJA 4X5XB 4U6VH 4KZEL 3ZE2F 4JFPB 1VADA 5EORH 4JKPL 4PD4J 5FYKU 4MCZB 3CFBA 4NIKB 3MJ8B 3CZJA 3TBSA 5TE4L 4NWUH 1KG0B 4WTZG 1OAZH 5IV2B 5TDPA 1TZGL 4MA3A 2YR3A 1WBZA 3P77A 3W82A 3DWTA 5IB1B 2AXFB 3SCMA 4UNUA 2FATL 2DBLL 3V5KB 3VXRE 3BGFB 1L7TH 1HZHH 2BVUA 3DXAE 1OTTC 3QIWC 4NT6B 3MRBB 5JOPE 3EO1A 3PV6A 1RULL 5IB4A 1QYGL 2GK0A 3T4YA 2PW1A 1U8NA 4I2XA 1P4BL 1FDLL 1J12A 4C55A 2NY2B 4LNVA 4G8FB 1JBJA 4OLVH 2JCCE 1AD9A 1MPAH 1H8NA 3D3VD 4TVPH 3KXFB 1R3IH 3KPRE 5FA4B 1ZS8A 3FMGH 1BOGB 3N1GC 4UQ2B 3DXAB 2BVEA 3HI6L 5IEKB 3BUYA 5B3JE 2O61B 5F88B 2JJSA 4HT1H 3OJ2C 3EDEA 5IBLC 3VFVB 1ORSA 3C09C 4GRWH 4PTTB 1GZPA 5DQ9A 3FFCA 1NGWA 2FEDD 2PW2B 5C0NC 3O6FA 4CMMB 5GJTH 1NGXB 3FQTB 2QEJA 4GMSH 3QEGH 5D2NA 2B4CL 2DMKA 2IF7A 1NLBL 3EOAB 1I8LA 2H2SD 4GS7C 5J6GA 3REWA 1VENA 5BJTB 4KKNA 4QXGH 2F8OA 5DEGB 4Y1AB 2VZ3A 4FXGB 4LAQH 3MFFA 4XX1G 5ACZA 5J56B 3UPCA 1ZEAL 4X99A 3B2VL 4YPGB 3PXJA 1JWMB 1MCEA 5F1IA 4RX4D 3DX9A 1YDPA 1IAKB 1ORQA 1UT9A 2R2EB 5HHNB 5F9DC 4JFPA 3VXSB 2XXMB 2DM4A 3FN9A 3SDAB 5EBMB 3CPLA 1IQWH 4KU1A 1TETL 3MRIB 5KSBE 3MV8D 4M6AA 3OR6B 1DLHB 4XVSL 4Z76A 1CG9A 4OLXL 1GIGL 4X7EC 2R9HD 4ZUWA 3RWEA 3I75A 4GRWF 3Q6FB 2VNCA 1CDJA 2F5BH 4ZUVA 3GI9H 3GB7A 1XF4A 15C8H 4PJFF 5E2WL 5JHDE 1C5DA 1SBBA 5DYOB 4I18C 2ZP0T 5FIEA 4TNWK 3BUTA 5GGTH 1VEMA 2VR4A 3QAZC 4AL8H 1TTGA 4LBEB 3OQ3B 4NQUA 2VQ1A 5FUOL 3LQMA 5CEZH 4JVPA 4RZCA 3QXUA 3U7YL 3PQYD 5IT2L 4P2RA 1KIRA 1UWXH 1CDIA 2A38A 4PJDF 5D1XA 4PV8A 3MRIA 1KCSH 32C2B 4PBVC 2DJSA 2XWJB 5KG9A 4PJ9D 4ZUWB 1ZHKA 2IH3A 1ZT1B 1QBMH 4HBCH 3GMRB 3IAPA 4UMGA 2BOBB 3BDBA 4JZJB 4P2QD 1N0XL 4S2SB 1L9MA 4FRWA 1AIFB 4LSVH 3SN6N 9CGTA 3QUML 5IVOA 1LE9B 2IPUG 1G9MC 1BZQK 3TCXA 4HWZB 1M71A 4LLMA 1YN6B 2Y4SA 4GAGL 4PLNC 4PJAA 4IRSB 5FA3A 3IDNB 5JW4Q 2P43B 4YGVA 4KROC 3MO1B 1KF9B 3MC0A 3O3EA 2ZSVB 3TJHD 3SCMB 1CDUA 5GGTA 4NJAH 1MCOL 6FABH 3DV6A 3HCVA