4DGYH

Structure of the hepatitis c virus envelope glycoprotein e2 antigenic region 412-423 bound to the broadly neutralizing antibody hcv1, c2 form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
226
structure length
226
Chain Sequence
b'EVQLLESGGGVVQPGRSLRLSCTASGFTFNNYGMHWVRQTPGKGLEWLAVIWFDENNKYYADSVRGRFTISRDNSKNTLFLQMNSLKTEDTAMYYCARDISLVRDAFIYFDFWGLGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV1 Heavy Chain
publication title Structural basis of hepatitis C virus neutralization by broadly neutralizing antibody HCV1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 46
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2012-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dgyH01
1BGXH 3M45A 1BOGB 3ZKXB 5JNYB 3C2AH 4EVNB 2ZKHH 5EU4A 5GS1A 1A6VH 1WCQA 1X6NA 3KPNB 1JGEA 1RZFH 3OKOA 3ARGB 1RQ5A 5DK0B 5F8RC 2OL3B 2Y5EA 4CMMB 3BZFB 5GS0L 4HXBH 1GZPA 5JZ7D 2XXCB 1Q9KA 2D4FA 4D9QD 3W9DA 3GNML 4ZXBA 5MERB 5I1IL 4JZJC 2AABH 4M1GL 4JQXA 3IFLL 4TUJB 2VLRE 4Y19E 1OAQL 4MJ6B 1P84J 5I8OH 3GSWA 5IFAH 1HINL 3BDBA 3SN6N 2GW5A 4B7LA 2B1AL 3PWNA 3K8MA 4P59H 1AD0B 3BE1L 5JMOC 1R3LA 4UUJB 3ULVD 4ZUWA 3IDJB 2DMKA 4MNQB 4BKLB 4X98A 4ZPTA 5FAAA 4BH7A 4EUPB 1UWXH 2IFFL 1PW3A 1A9EA 1KJ3L 1FZKB 5J56B 3BPLC 2G5BB 5B38B 5D7LE 3I6GA 3PQYA 1U9KA 1CZ8H 3L5JA 5EO9B 1FIGH 2QSCL 3T2QA 5CZKA 4LSPL 1X5XA 1RIVH 2P49B 5J1AA 4RAUA 1F3JB 3VFTA 1ZT1B 4BFGA 1HYSC 1OCWH 2VMFA 1C08B 3KPRB 5DUMH 2PO6D 3KPOA 2NTFB 1G6RA 1BREA 4QNPE 4KRLB 4Y88A 4HMEA 1J0KA 3QB7C 2XQYG 4JN1H 3GB7B 1M7IB 1SBSH 2GQHA 1JWSB 3EYQD 5EU7E 2Q8BL 1D6EA 4U1GB 1FJ1B 5I1HH 3QJFA 5D7IE 1YEJL 4DGYL 5C09E 4MXWH 3QQ3A 1FE8H 1J9CT 4OKVB 4XX1E 3QDGD 1C5CL 1Q0XH 4OZFB 4R96A 4U4BA 1A1MA 4U33A 2I9TA 1GOHA 3ESVF 5E99L 4P46D 3S96B 2FO4A 3JWDC 5SWSE 4R4FH 1DBAL 3QRGH 1KBGL 2YC1A 1T0MA 1GIGL 1WBZB 3OWEA 5DJZB 5FGRA 3GJFK 2IAMB 3AS2A 4GW4A 4X7SL 3BO8A 1IVLA 1YEEL 2EDYA 4L3EA 3MFGB 2VN4A 1T03L 4U0RB 3HCVB 5DS8B 1HE7A 1S7SA 1YEHL 3BQUB 3P11L 5ENWA 1P9MA 3HR5A 4JQVC 4P57B 3SBWA 1SJHA 4ZNCD 2NXZB 5KSVB 3T04D 4EBQL 1MEXL 5HI4D 2JKXA 2ERJC 3RIAF 4G8GE 2AXJA 4YK4B 3MLTB 1B0GB 4NHUA 1LP9A 2Y06L 4EI5D 1D5BA 2QL1A 3MRQB 5K9JL 4WNQB 5F9WC 1JWMB 4M02A 1P7KB 4C54A 1CCZA 5LKNA 5LQBH 1LK3H 1ZK9A 1IC4H 2YUVA 3IYLW 3KPMA 1KB9J 5BZDA 4F9PC 3FO2B 4NUGH 4UQ3B 1FNLA 4D9RD 4Y2DB 4QGTA 3HAEA 4APQA 3IS0X 5C0RH 3P4MB 1N0XL 2HJKA 3LN5A 3DROB 3PG2A 4WVRA 3OJMB 4QXWA 4XRCB 4X9HA 1UGNA 3X3FL 1J1OL 4YFEA 4GKNB 2I9LA 3GSXB 5MP6L 4DVRH 1KTLA 2DLIA 4I9WE 3BIBX 2VLRA 4LEXL 2K3TA 2XRAH 1KXTB 3ZTJH 4NQXA 2MQ0A 4KMTL 3RGHA 2XFXB 2NY5C 3BWUC 3BXNB 2BVEA 3U9UB 1YEDB 5FYLH 1I3GH 2QHRH 3L7FB 3QI9A 3LRHA 3IFOA 4G5ZL 1FL6B 4J1UB 3TV3H 4DOHE 3LKNA 1J18A 4LSUH 1SEBA 3GMPA 4YXLL 1S9YA 4PBVC 1YJDL 2CIIB 2PXYA 1M6OB 1MVUA 4AMKH 2BHYA 2HT4C 5D7LA 4OBRA 4F2MA 3FAWA 5IB5A 3TBWB 4XB8A 1ZMYA 1K3ZA 3BKJL 3SDCD 5SX5K 4WY7H 2UUDK 1TDQA 4F7MA 1D5ZB 3HNVL 5C0IB 3FQXA 4M9OA 1RZ8B 1W8OA 4OF0A 1KV3A 3VRJB 5JIPA 5JOFA 3VFSB 4CADB 3KLHC 1I1FB 1WT5A 4PGBA 1ZLUH 1JPFB 4HUKB 1ZHNB 4RGNB 4GKSA 2VR5A 4JPWH 5FKAA 2Q8AL 5D7JA 2PKDA 5DUPL 2XN9D 3A67L 5FIEA 3MBXH 1OAZH 2OCFD 4HIJB 3QRFM 4UILL 5I15L 3QUZB 5EUKB 4V2BA 2DTMH 4D0DB 5HYSA 2Q1EA 3ULVL 3FJTA 2AP2A 5D7IA 5FOJA 1KGCE 4EDWH 4RGOL 1JF5A 3AB0B 1S7RA 2FB4L 3MGOB 1E6OL 5EC2A 5TQ2H 4NFCA 3H2WA 5CKAA 3IDIA 1KENL 3GZKA 2V2XB 1IRAY 2GAZB 4JY6B 3G6JB 3FT4A 2R56L 4A6YA 3Q5OA 3SKOB 3CDFA 4XCNB 5TQ0H 4PJGB 4S1DC 2NY1B 3QULB 4YBHA 3QHFL 3AU1A 2R69H 3B3IB 3IXAB 4XXCC 2ORBH 2HMID 4OZHE 3NPSB 1KIQB 3TBVB 1VGKA 2OMBA 1J5OH 2R9HC 1IZJA 1H5BB 5E5UB 3ES6A 4U6YA 5EU3B 3OBAA 4N90D 4OCLC 1UC6A 3UMTA 5I6XC 1JGLH 3F58H 4LCCA 4HIHA 1ZLSL 1K8IB 2RBLA 3CLFL 1ZVYA 5BV7C 1YEGH 1PG7H 3PP3K 4FQHA 4GBXC 2J2ZA 5GGTH 4ODVH 3ELAT 5EN2A 5EO1A 1PGRB 2VZOA 4XNQA 5IFHH 3SPVB 1P7QB 1KIPA 2BVQB 4MDJB 4YR6A 2PYEE 2VLJA 3N9GH 4PJBB 4MB3A 2XNAB 3VFMA 4RGMB 1MH5B 2LFGA 2FD6H 2GJ6B 2AVGA 5DFWH 1NL0L 1FHGA 1D9KB 4PD4J 5E0QA 3PDOB 2DQEH 4RNRB 2GKIA 4OKDA 5HYQB 3BDYL 3AAZA 5FM4A 5E24E 2X4TA 3DMMD 4OV5B 3CH1A 4U6HA 4ODUB 1R5WA 1FYTD 3TJHC 3QXVA 4V1DD 3RDTD 3P4NB 1KEML 3H9YA 5IBLD 5CP3H 4YJZL 1EBPA 4YX2L 1XGUB 4F9LA 1UYWL 2DQFA 4XBEH 2QV2A 5C92A 4E42A 3ARZA 3MLVH 3VFVB 3Q6GH 3HC4H 3O0RH 4LCIL 2ARJQ 1H3PH 3LKPB 3GJFA 1RZGA 1CU4L 1E4KC 3DXAD 1LK2A 1AGDB 1IBGH 5KVGH 4GMTL 3V4PL 3OF6A 3TZVB 3S36L 1KLUA 3GBML 1JTTA 5GRXG 5LCVH 2MFNA 4PIRF 4PY7B 1BD2E 2H3NA 3BSZH 3EJZD 1IT9H 4P2QE 1GZQB 3MRJB 4NO0A 3STBA 1G7IA 3FB8A 2CLZA 4WHTA 2EEBA 3IU4L 4I2XA 4LGSB 5E6ZA 3NFNB 4JFEE 2VL4A 1LEIA 1QPPA 5MENB 1JF6A 1N3NB 4Y7MA 3ZE2E 3LCYA 3WN5A 3K1DA 3VWKD 1K5NA 1KB5L 1UH4A 4Z7WE 2DWEB 4MWFB 5J11B 5JDJA 4XPFH 3ARBB 3O8XB 4RMSA 4L29B 3DV4B 3OJVC 3F7YB 2EE3A 4HEME 2PW2B 4OSUH 4KKAD 1CLOL 3QG7L 4P23B 3SDDB 1YY8A 1KCVH 1KG0B 4FFWD 3MUZ1 4P3DA 4FQ1L 4RMQA 3IFNH 4X7TA 4OZIE 2B4CH 3G5ZA 4GG8B 4Y4HA 1J05A 4WO4A 4QF1A 3VG9B 2CDFA 3H9SB 5IB2A 3G5XB 4P5MA 1F4YH 1FSKB 2Y72A 2YD2A 4IDLA 5K9QG 5ACZB 3PWPE 1AGBB 5F9OL 5CAYB 3N85H 1IFHH 3QPXH 1MIMH 4MXVF 4AL8H 4MX7B 1WC7B 2NNAA 2AJZA 2F58L 2JCCA 3AY4A 1OGTA 4J4PC 2BVOB 5I16A 1BIIB 4PRDA 4HQQL 5BQ7A 3MBEB 4Q9QH 1VFUA 2A9NL 3WLWC 1OW0C 3IFPA 4GO6B 5AUMA 4WHYG 2VWEC 2UYLB 2VR4A 4QYOB 5AZ2H 1Q72L 4HC1A 1VFAB 3BAEL 4LLWB 4NWTH 2VITB 3FKUS 4YDKH 4XMKH 5DQJB 2YMXL 4P5TD 5T1MA 1QQDA 2ICWI 5JW3L 2X09A 3DX6A 3RP1A 1U2HA 1VENA 4CVUA 2B1HH 3INUH 1GPOH 5ESQA 5HHME 3NCEB 5IVZB 3JXAA 2AEPL 3Q6FA 4ZTPH 2ESVE 5EZOH 1LGVA 3F7VB 3QJHA 3NCMA 3WE6B 1Z6JT 2PYEA 1QLFA 1LDPH 4ODWB 3OAUH 5EUOF 1YYMH 1A7OL 4QRQA 5E9DE 3C5SB 4WHYH 4M1CC 3O4OB 4ZFOA 3TCXA 3AXLA 3RGVD 3HZVB 2Q6WB 3GKWL 5D7SL 4MD5A 1MFCH 3W0WD 4TNWF 1FL5A 4LU5L 3ARUA 5AAMA 3HZMA 3U0PB 4PGEA 4Z77B 1VESA 5DJ2A 5KW9L 5ESVB 5C2UB 3TYFB 1KLGB 1IC1A 1JJUA 1E4XH 2IFGA 1C12B 4L8DB 2IADA 4JRYD 3MRGB 1A1OA 3P4LA 1EA9C 3CVIL 5CEYB 4D9QE 3BW9B 3SE4A 4NQED 4NO2B 1BPVA 3DSFH 4AG4L 1LO4H 1T21B 3C5ZA 4O51B 4XNZC 3B6SB 1XAUA 3OV6A 4HKXA 1WFTA 3B8SA 2OX5A 4Z76A 4G9FB 5HI5D 5GJTH 1A2YB 4P5KB 1QRNA 3S34L 1A1NA 3G5YA 5FO7A 3L3JB 3EOTL 5DRWB 5GGSY 1BD2A 4JANB 5DYOA 1RIHL 2GT9A 1MFAH 3GK8L 3GSRA 3ZKNC 4B0MM 3ULVE 4CVXB 4FOMA 3RL1B 2BJMH 4LHUD 1I8IB 3TVMC 1AGCB 3WFEL 5J13C 5J6HB 5JQ6H 1UG9A 3LN4B 5IVXE 5HDBE 1I8LC 2X4SA 5EDXA 1ZT4A 2YPKA 3HPLA 4XVUC 2W65A 4FXLA 2P42B 1Y6MR 4XBPA 5EU4B 5GS1B 3ZKMC 1QFOA 1TMCB 4TTDD 4AQOA 4JFXB 5ALBH 4K3EL 4LF3A 1JGEB 3FL7A 3OKOB 4YLQT 4JFFA 2MPAL 4K23L 2FJFB 1ED3A 5HGDA 1LO0L 3TBTA 1GZPB 3GGWA 3U0WL 2CIKA 5SWQB 1Q9KB 4OZIA 3W9DB 4OGYH 1WJ3A 2DBJA 1NEUA 3T0EB 4HG4K 5EBWA 2SEBA 3WEXA 1G84A 2ICEA 4G42B 4L4TD 4JDTL 1ND0A 4I8DA 3WHE0 3GSWB 4GOSA 5GZNC 1MRFL 4M61A 1QYGH 3PWPA 4JR9H 4W70A 1CFNA 3PWNB 3UTTD 3S37X 3QDGE 3TC9A 4POUB 3MJGX 5HY9A 4GXVL 2EDBA 5FUCE 3HKFA 1EZVY 4J12A 1R3LB 4Y5VA 5JR1L 4KI1A 4ZUWB 4NRYA 1O7VA 4X98B 3W5NA 4ZPTB 3P9WB 5I1JL 3QIWC 4BH7B 1IJ9A 1A9EB 1WF5A 2A1WH 4PJ8D 3EAKA 2NW2A 4F15C 3DO3A 5K93A 1XCTA 3WFZA 2DKMA 3I6GB 3CMOH 3PQYB 3B9DA 2P8MA 3K80A 1B4JH 1V3KA 5IROC 3FB5A 3ZL4H 1W72L 1CFTA 1TNMA 2VXVH 4QRRD 2E9WA 3BIAX 5J1AB 4RAUB 5C07A 3MCLH 3VFTB 4EDXA 3D48R 1MVFA 5D2LE 4JO3L 1XR9A 2DQDL 3KPOB 1G6RB 1PSKL 1CXIA 1KJMA 4NJ9H 4Q9RH 1OP5K 1VHPA 4IJ3B 3ESUF 3U0TA 4PGCA 5BXFA 3I50H 3QHZL 4YFDB 1DJSA 5JXEA 4WW2C 3TBSA 1URLA 4XPBH 4Q9BA 1D6EB 1EGJA 1F02I 3WS6C 2CJUH 4FG6C 5L6YL 3MLYH 5D70L 3SO3B 4ORGA 3OG4B 3VXPA 5IGXH 1MCRA 1U95A 2A9ML 2VDRH 3FAXA 3T2PA 1WAAE 3B9AA 4R96B 4YXHL 1A1MB 1N5AA 4NZDA 2I9TB 4HZLA 5JORA 2DQIL 4D9RE 4WUUD 3QIUC 2YC1B 2XZCL 2IANA 1T0MB 4O02L 3IAGC 2VN7A 2LAGB 4BUGA 2RFXA 5D96B 4GW4B 2PN5A 3BO8B 5IBTL 1JVKA 4L3EB 4PJFE 2QQKL 5F7HA 1AXSA 2EKJA 4XPTL 3CXDH 1S7SB 4LAJH 5ENWB 1OWWA 5TE7H 3RI5F 1KTDA 3SDXE 4XHJC 1V7NH 4FNLH 1SJHB 4YE4L 4OLUH 3VG0H 2XI9A 5JOEA 3T4AA 1UWXK 1BBDL 1UT9A 5EB9A 2YA1A 4PRPA 1AHWA 3TO4A 5DMYA 3UYRL 3OKMA 2HTLD 3O6KL 5TDNA 2WWKT 3D2UD 4ZAKD 1INEH 4NHUB 1CG9A 1LP9B 2D0FA 1DVFC 1D5BB 1JHTA 2D7PA 1NLBH 1YPZF 4Z7VF 3ULUH 4DAGH 2EO1A 3KPMB 4Z7OF 5BZDB 1KTKE 1WISA 4N8CL 5B39G 4UI2A 3UXFA 3HAEB 2AGJL 4S1RH 4APQB 3I6KA 2HJKB 2V2WB 4LMQI 4NDMA 3LN5B 3LEVL 2ZJSH 4LVEA 4R90L 1I7UA 1R3IL 3DOSA 2XN9E 3QFDA 4NN6C 2I9LB 3ZSTA 4JQIL 5KS9F 1U8LA 2JE8A 4X99B 2X4QA 1P84K 1KTLB 4FQQA 2VLRB 3MLRL 3QUMA 3PDGA 5E94A 5IQ7H 2ICWA 4NQXB 2Z31A 2BNQA 1JCKA 1J1PH 4U1NA 1CE1H 4XI5D 1FAKT 2XXMB 4UNTA 3NABH 2XA3A 3QI9B 1MFDH 4M7LT 3IFOB 3HZYA 4POZD 2MOVA 1NGPL 4OCXL 4YBLC 3SGEH 2XQYK 4P46A 3LKNB 3GMPB 4PB9H 5I1EL 1S9YB 4Q2ZA 2RIKA 2PXYB 1MVUB 1T66D 3MRDA 5TPWL 2EC8A 2AK1H 3NN8A 3CK0H 4GT7A 5D7LB 3WXWL 1I3RA 4F2MB 1S7UA 5IB5B 3LHPH 5F7WC 1YC7A 1R3HA 2DQGH 4N90E 4QCIA 1BFOA 5FUZL 3MRRA 3HTLX 1DLHA 4F7MB 1ZHBA 2FEEL 3FQXB 4IRSC 4I1NB 2KQMA 3OKKA 1P69B 5D2LA 4KJYA 1IAOA 3LH2L 4OM0L 2ADJA 2X05A 4CKVX 2XG5A 4PGBB 3IXTA 4GKSB 2VAJA 5FKAB 5FCSH 1FVEA 1R5IA 5D7JB 5DMJB 4DQOL 4QWWC 3BRFA 4HIXL 4JPKH 1T2XA 2YXMA 5KVDL 4HWZA 4TNVF 4HJJH 4PTTA 4YPJA 1KFAL 4MLIA 4W4OC 3W81A 5D7IB 1BFVL 4OFYD 5T5NF 1FYTE 1S7RB 4V1DE 5IKCA 4DEPC 3ZHLA 5EC2B 3CGTA 3BKCL 1N6UA 3IDIB 3CVHL 4EXPX 1U3JA 4MNGA 3S7GA 5GSRA 4KRPC 1NMCC 2N7BA 3FT4B 4A6YB 4HH9A 2QADC 1CD8A 3HNSL 5I73C 1FFPA 2JIXD 3AFLA 5HVHC 4UT6H 3DXAE 3AU1B 3IDYC 1D5IL 5HJ3A 3EKCA 8FABA 4QRPD 2E27H 4YO0A 1F45A 1VGKB 1UA6H 4PJFA 3ES6B 5IMLA 1OQXA 2UV3A 4P2OA 4LCCB 3U7YH 4HIHB 4D8PA 4JFZH 1BLNB 1MHPL 1NBQA 4FQHB 4IIQC 1NMBL 5T1DH 2D3VA 1Q94A 3RVXC 5EN2B 4NKMA 1XF1A 5LBSH 5EO1B 3E2HB 4XNQB 1MOEA 4M1DH 1KIPB 2MTPA 3UTOA 4YR6B 1R0AL 2VLJB 3BN9D 4HPYL 2UZIL 3VFMB 1CD9B 3L1OH 4IRZL 3NZHH 2QQLL 3D3VA 3AAZB 4UZGA 5HYEA 2HFTA 5AYUL 3SDCA 2X4TB 3CH1B 1CGVA 2OJZH 1R5WB 4PGZA 4U6HB 1TQBB 4AEHH 1RJCA 4IRJD 1ZLUK 3WIHH 2AJYH 2EZ0C 1R3JA 3EHBC 4YC2C 3QQ9D 1F58H 2DQFB 1U91A 3KJ6L 3THMH 5DEGA 4E42B 3EYOA 3DV6A 3DYOA 2BFVL 3HB3D 2HT3C 3JWNC 1RZGB 2R4RL 1RK0A 2OTPA 3CFBA 4G7YL 5CILL 1JFQL 3WD5H 4JDZA 1JPSL 1JGDA 1NKRA 1LK2B 2XN9A 5E7BA 1L0XA 2I27N 5F6IC 5JO5A 1HHIA 5GXBB 3MGAA 3ABZA 1KLUB 5HHVH 2DLFH 3CFCH 1KCUH 5D5ME 1OGAD 4F57H 4GH7B 4NM4H 4XPHL 2H3NB 3QUYC 2DKUA 1ES0A 4NO0B 4M93C 1G7IB 3FB8B 2CLZB 4WHTB 3OHXA 2O5YL 4I2XB 2YKLH 1P4LA 1FCCA 4J3UA 4U1LA 4EN3D 3UTSA 1F4XL 4DOHB 1LEIB 3QXUA 4LARH 1YQVL 4HT1L 3KPTA 3ULUD 4OFKA 4HV8A 4KK9D 2XZQL 3WN5B 5C9JA 1NKOA 4YUEH 2VDLH 1K5NB 4D94A 2RCSH 3BPNC 3WIFA 2W38A 1X7QA 5L0QC 1BX2A 3EYSH 3MA9L 4U7KA 1T83C 5ITBH 4I4WA 1ZANH 1FLRL 5HGGS 4KROD 3JVGC 1V3JA 1YY8B 4X7TB 4P3DB 3HE7A 4BQBA 1RUMH 1KF9B 2I60L 3G5ZB 1Q1JH 1Z5LA 4Y4HB 1J05B 5IWLA 4DJMA 4N5EC 4WO4B 4GS7B 4QF1B 4OM1H 2CDFB 2QJDA 4PTUA 5IB2B 2JB5H 2F5AH 2W91A 4WFED 4P5MB 5GZOC 1LEGA 1L9NA 4ERSL 4GKOA 1C16A 1ZEAH 3MLZH 4OQTL 4U6VL 2R29L 3W0WE 2A6KA 4X6EA 5JW4R 4OTXL 4TPRH 2NNAB 3DMMA 2AJZB 5CJQL 2JCCB 4BZ1L 1FYTA 4JM2A 4IS6A 1I9RL 1OGTB 4WCYH 4V1DA 4M43L 3RDTA 1E6JL 5I16B 4PRDB 4PJEE 2I5YH 1JNJA 5BQ7B 4JRYE 1BBJA 1XF4A 2CKBL 3IFPB 4N5UA 3WHXA 2AQ3A 4GW5B 3U82B 2B2XH 1MNUL 4PJ9A 1DL7H 4NQEE 1UH3A 5E4EB 4A2LA 3ARFA 5T1MB 1QQDB 2IG2L 3DX6B 3V4VH 4H0IA 4OZHB 5FGSA 5GRVL 2Q7YA 5CZVH 5EO0A 1I1RA 4FQ2L 5C0DA 5ESQB 1T20A 4R0LA 2BERA 1F8TL 3Q6FB 3P0VL 2ZUYA 4JKWA 3N1QC 4ODHH 3QJHB 1QRKA 2PYEB 4OAWA 1QLFB 4K8RH 2NPLX 4X4XA 4C83A 5K9QI 2FGWL 4QRQB 3QIBD 4KAQH 1FNGA 4PD4K 4YHMH 4ZFOB 3AXLB 1U6AH 5GGVL 2OBGA 5A3ID 3MJ9H 4MD5B 1FL5B 5B8CA 3HZMB 4RWHA 4PGEB 2NY4D 4WWKA 4NPYA 2PTTB 3KYOA 5ICXA 4FABH 3QDJD 4OLVL 1X4ZA 2NY6C 2AAVA 2IADB 1FNHA 3ZTNL 3RIAK 1A1OB 4NCC1 3BD4A 4JKLA 4NN7C 1UM4H 4FP8H 4ZMAT 5JIKA 1S3KL 5ELIA 3C5ZB 5I8KL 1H0DA 4HKXB 5AG8A 4L4TE 1E4XI 1FCGA 1OSPH 4Z76B 5DVKA 3K8LA 3ARDA 5T33H 2EDRA 4C4KO 1ZHLA 1UENA 4BA8A 1AH1A 1QRNB 2VH5H 1K9TA 1A1NB 1UB5A 3UTTE 4XC3H 3G5YB 1FGVL 4DN3L 1XGTA 2F8VA 1BD2B 2IMMA 5DYOB 1UWGH 3LDBC 4PRNA 1GGTA 2GT9B 1A6WL 3GSRB 3ZE0F 1WV7T 4G3YH 5GHWL 1NBYA 1B3JA 1CBVL 5H35A 5GS0C 1B2WL 2QR0A 3W2DL 4X5WA 4FQCL 2X4SB 1EK3A 3RWIA 1ZT4B 3NTCL 3OG6B 3OTTA 2WWMC 2YPKB 2XT1B 3HPLB 2W65B 2C3GA 4QRRE 3QWRD 1J8HA 4XBPB 5IJKA 4ZUVA 2VC2L 2MCPH 3DUUA 2R0KH 3JSSA 4OCSL 2GHWB 5JTWA 2IGFH 2W60A 4LF3B 4PLKC 4Z7QF 3BPOC 4JFFB 3H6JA 1ED3B 2YK1L 5HGDB 3TBTB 5B3JF 1KSRA 3KLAA 3GGWB 1MCJA 2CIKB 4MZ3A 1BJMA 5IVOA 4OZIB 3VRLF 1H3XA 4JZOA 5EBWB 2SEBB 3WEXB 4C55A 4CU8A 4AEIL 1OPGH 1ND0B 2FRGP 3M1BA 5EBLB 5IESL 2J88L 4M61B 1PG7X 1UH2A 4YEFA 3RGVA 3PWPB 3B2VL 3I3EA 3LPGA 1CFNB 3QEGH 4X9BA 3WHE1 4X6DE 1U2CA 4J3XA 5HY9B 3LEYL 4NJAH 3T65A 4ZUSA 4JGJA 1BQUA 3UROR 2H26A 1KPUA 3TBYA 4Y5VB 1A64A 3BMVA 3QCUH 4Q6IC 4NRYB 4PJEA 2DQJH 3OKYA 4WUUE 4XH2A 5ADPH 4JRYA 1DLFH 5F1NA 1EJOL 2NW2B 1XCTB 4J3VA 1QD0A 3G6JF 5K9OB 5BO1H 2P8MB 4NQEA 3TN0C 5BOZG 2DDQH 3GRWL 3FB5B 4LPWA 4ODSL 4PJGF 1CFTB 3BI9X 2E9JA 4NFDA 2D31A 5DO2D 5GGTA 3TYGL 1GCFA 4Z7UA 5C07B 1AQKH 3CPLA 2OLDA 4EDXB 2H8PA 4JDVA 3ZYIA 4F8QA 1FIEA 5D6DC 1XR9B 5CEZH 2DD8L 3ROOA 4HMDA 2DTSA 3CFDA 1KJMB 4F37K 2Z8WC 3U0TB 5BXFB 4PGCB 3R1GH 3GBNL 4RWYL 3TBSB 1VGEH 5JUEH 5F1IA 1CDJA 3S5LG 3RKDD 4PJBF 3EGSB 3GKZA 5F7NC 5CP3A 4ORGB 5DJ0A 3VXPB 1VCAA 1U95B 2C1OA 2AJXH 4UIKL 1N5AB 4UV4L 1YY9C 4HZLB 5JORB 4P49A 1GGCL 2X9YA 2Y23A 3U7WH 3MLXL 2IANB 2NZ9C 4M6NL 4C58B 3AGVA 2YPLD 5JPNA 5HYJA 3ARTA 4HKZA 2E7LC 2RFXB 5FB8A 4CU6A 3L95A 1AXSB 2XY1A 2NR6C 4XPAL 4L4TA 5CGTA 3MRPA 3FQWA 4KY1L 4QO1A 4DGVL 2OP4L 1KTDB 2X4OA 5HDLA 5E2UL 1SYSA 3UTTA 3BYYA 1L7TH 2WINA 4OCRH 1DDHA 3T4AB 2DBLL 4H26A 5CIPH 4K71B 3W11C 5E95B 5IMKA 1AHWB 5C0FA 3TO4B 2AS5M 3OKMB 5TDNB 4LP5A 4KKLD 2NY5H 3IDXH 4CU7A 2WBKA 4M7JL 5IW1A 3SJVA 2C3HA 1CG9B 5IVXB 1T2QH 3E8UH 4LLQA 1FNSH 3JTTA 1JHTB 1CLZL 4GW1A 4QRRA 4GSDH 1CS6A 4HCRL 1PKQE 4J7RA 1T7WA 4DUXA 2W0KA 1ZLWH 3QCVH 3SGKC 2ZNWA 1U3HC 3QXWA 3I6KB 1N4XH 4NDMB 1I7UB 3WXVL 4M7KL 4UB0L 3QFDB 3P2TA 1H3VA 3U36A 3S35L 1U8LB 3NIFE 4NKDA 2RJMA 5GRJL 2X4QB 1YJDC 4FQQB 3QUMB 4CUCA 5E94B 3O6LL 2ICWB 2Z31B 5JXAH 1OAKH 3BGFC 2BNQB 1FL3A 5C6TL 3RRQA 4U1NB 3K2UH 4TSAH 1NDGA 4KJPC 4N0YH 3G08A 3HMWH 5GRUL 1NCAH 1IMHC 4ZTOL 4JHWH 5HGHA 1IKNC 4KVCL 3HZYB 4ZFGH 1CF8H 3TIEA 1TJIH 4UNVA 3WJJC 4P46B 3GO1H 4G6AC 1L6ZA 3AROA 4WUUA 1WFOA 3MROA 5C0CD 3MRDB 1A21A 1YEKH 2H2PD 3NN8B 4LPCA 1I3RB 4FN0A 4MA7L 1I1AD 1S7UB 4RQQA 2ZPKL 4QRPE 5C08D 3SGEI 5F3HA 1OWRM 4QCIB 1BFOB 5H8DA 3MRRB 3U2SA 4HKJA 1DLHB 1G9ML 1ZHBB 2R23A 1K6QL 3OKKB 3ULVC 5D2LB 3V7MA 4XNUL 2ZUXA 4KJYB 1IAOB 3V6OE 1MLCA 1P4BH 3OB8A 4UT7L 2ADJB 1DQML 4O5LL 3STLA 2X44D 3IXTB 4I0KA 2FJGA 3IDGA 5DD1H 5LVEA 1FC2D 2DM4A 1FVEB 4LVOB 1HHJA 1R5IB 2VZ3A 1NCDL 3MNVB 5AZEL 4OIIH 2O93L 4PP1C 5E2JA 3D2UA 4MQ7A 4NIKB 4R8WH 4HWZB 3SCMA 4Q97A 4CVWA 4PTTB 1YECH 5DMIH 5AWNL 2PO6C 4RX4A 2ARWA 2W9DH 1GRWA 5F93C 3LS4L 3ECBB 5DD6A 3VMOA 5IKCB 2LVEA 3EW3B 4RIRA 4U1IA 4WWID 5C0NC 5M94B 3C09C 4MNGB 2FLBT 5FGBA 5GSRB 4LLDA 3EBAA 2Z4QA 4HH9B 3SKUD 1DCLA 3RZCD 4X5XA 5LXGH 1FFPB 4H1LG 2XQBH 3IJHA 6FABL 3PWUA 1TITA 5HJ3B 1QLEH 8FABB 2CRMA 3LQAL 1OOAA 4YO0B 1JNNH 5TF1H 3L5IA 4LSQH 4PJFB 4PYHA 4R4NC 4UINH 4P2OB 2KDGA 3C6SA 5FUCC 1OGAE 3EFDL 2Z91A 3VFPA 1CL7L 1TCRA 1TXKA 4D8PB 2CO7B 4PUBH 1Q94B 5J06A 4NKMB 4NP4H 2PETA 3WV0A 2F53D 1CGWA 3IAPA 3PUCA 3UC0L 1UXWA 1A6TA 1SVZA 1XIWA 4XMLL 3NAAH 3CFIC 1D9KC 3MOAL 3MUJA 3ULUE 2H9GA 1RMFL 2RGSA 4NQCD 3D3VB 1KPVA 1A5FL 4H1LH 5FO8A 1B6UA 1YDPA 1FNAA 4PBWD 3SDCB 1NFDA 4ACPA 4QXUL 5D71H 1PKQA 1X5GA 2OXGA 1R3JB 2BVTA 3LKOA 1HXMA 1U91B 3QH3A 5DEGB 2FX8H 3P30L 4J3WA 5HI4C 2XWTA 3EYOB 5E7FA 5DD0H 3DV6B 3V4UL 4EI5C 3CFBB 2K1MA 4JDZB 1JGDB 2XN9B 4WFEE 3T1WA 2APWA 1KCLA 5KSUA 2JJSA 5F7DA 5JO5B 1HHIB 1I85C 2NY0C 4ZSOA 4JVPA 3QUXD 4NWUH 3HI5H 3DHJA 4PJIA 4DTGH 4OFYA 1ES0B 5TE4L 1CDYA 4M3JA 3DVNA 4XC1L 4BQCA 2XTJC 3MQIA 3OHXB 4U1LB 2VQTA 2XZAL 1DSFH 1NANH 3UTSB 4TYUA 2VDQH 4JRXA 3SE3A 1F90H 4QXTA 4HV8B 2CH8A 2F15A 4KHTH 5C9JB 1D5XB 1MFBH 5ID1A 4S0TD 2HT4D 3WKML 3W39B 3CXHK 2XPGA 1U42A 5JLZA 1DTUA 2M2DA 4QRPA 5DA0B 4AQ1B 3WIFB 1X7QB 5FF6A 5TF0A 2E9IA 1BX2B 1BM3H 1QSFD 4HWEL 4EIGB 4I4WB 3QCTL 2BXZA 3M8OH 3DI3B 2FIKA 1ADQL 2UWEA 3V6OA 1A22B 5DSCA 3KLHD 3HE7B 5H37G 2ZUQB 2FHFA 4NZRH 1CGSH 1JNHA 2M26A 1Z5LB 4JHAH 2AEIT 5TGBA 3SE9H 4NNPH 4PTUB 2W0LA 3P3YA 3VI3E 3CSBA 2YD1A 1LEGB 1AJ7L 2VXUH 1S7VA 4Z8FH 1FH5H 1C16B 1OM3L 4QTIH 4XAKD 4EQ3A 2D7TH 2A6KB 4X6EB 2C9AA 4BSWA 3CLEH 3DMMB 1X4YA 1J0YA 1FYTB 4JM2B 4IS6B 4DUVA 5L8KB 4V1DB 3RDTB 4OT1H 1NMAL 5E1AA 3QDJE 4QEGA 3E6HA 4Y1AD 1CL7I 1CTNA 1BBJB 1XF4B 3WHXB 1TJHH 1AKJD 2DIBA 5J12B 4PJ9B 1BEYH 3GHEL 5L8JB 1MJJA 3WFCH 4S1DD 3ARFB 5H37H 4OLZL 3HMXL 2MCG1 4XXDA 4CMHB 1LMKA 3DXAB 1HSBA 1Y0LA 1JI2A 4L4VA 2J6EL 2R0LL 4FQXC 5IIEA 2Q7YB 1HNGA 2EIEA 5EO0B 4FFZH 5C0DB 1OGAA 2YXFA 1GHFH 1T20B 2AJUH 1NJ9A 1UM5H 3KLDA 4R0LB 4GRLA 1QSEA 5F1OB 4K94L 3D9AL 5LGHH 1KELH 3PHQA 3VDAA 5F9JA 4OAWB 3GMNA 4POYA 4X4XB 5DD5L 4C83B 2HMIC 1HHHA 2BNRD 4ZS7L 2OR7A 1ZSDA 2F9BT 3QYCA 2J8HA 1FNGB 4MAUL 3KYKH 3RU8L 3RWDA 1SJEA 1FZMB 3VWKB 2CPCA 4ZOAA 1AGEA 4KI5F 2JJTA 3TH4T 1LP9F 4U0QB 4MA3A 4UV7H 4JLRA 5HHNA 2IQ9H 3JWDL 2KPNA 1RZIA 3D39D 4L5FH 4WWKB 4LCWD 4NPYB 3RWHA 3TJHD 5I1CL 4R97B 3KYOB 5ICXB 4O58L 4WTZG 5ACLA 2V2TA 3EDJA 3EJYC 2EDXA 4NBYB 1YNLL 5DR5H 1LK3L 1JPST 1QZ1A 1MRDH 4JG1L 4EI6A 2GK0A 3KJ4C 5A2IH 3MRNA 2D7QA 4ZS6D 5L88H 5IJVA 1H0DB 2YPVL 5F7UA 1MRCH 3FQNA 4D3CL 1HK6A 2O5ZH 3ARDB 1ZHLB 3VW3H 1UB5B 4UOW1 2NCMA 3MRBA 1XGTB 1UCTA 3QNXA 4GRWE 1X6LA 2XRAL 3N50A 4M5YL 4PRNB 1UWEH 5B39A 3EOBA 3OR6A 1K8DA 4S2SA 4BM7A 3WNPA 3BGMA 1N6QH 1NBYB 1AIFA 1FN4B 1IGTA 4KDTC 5H35B 1ZHKA 1RURL 2QR0B 5IR1A 4X5WB 1KC5L 1YEIH 2IWGA 3RWIB 2H45A 4M62L 1AGFA 1OF2A 1SM3H 7CGTA 4X7FC 4DKEL 1J8HB 3GHBL 1DBKL 4ZUVB 4AMKL 2B0SH 3DUUB 3GSNH 1UXSA 3SGJA 4YBQD 2W60B 3B8YA 1G9EA 3S3JA 1T04A 4KU1A 1JGUL 4H20H 4L1HA 4ZXBC 3KLAB 4PJ7A 4HFUL 3TFKC 1XGYL 1QSVA 5EIIA 3QEQA 2DI8A 4P9HL 4ZUUA 5HHPA 2NXYD 4QNPF 3LOWA 4JZOB 3DRQA 3NCYS 4R2GD 4YWGH 3RWFA 1C5BL 5KJRH 3M1BB 2OTWA 3RGVB 5HXMA 3MX0A 4PJCA 3MRHA 1P6AB 4KKAC 3C9NA 5MEPB 3T65B 3FHQA 2BY0A 4ZUSB 5D7IF 5KVFH 2H26B 5IHZA 1KPUB 1RK1A 3O3BA 5I1KL 1H3GA 5IFJA 1G7QA 4PJEB 4OGAC 1U8JB 5JQHC 1G7LA 4XH2B 5E2WL 4JRYB 4W6WB 5HVWA 4J8RA 1UJ3A 5F1NB 2YPLE 5ABDE 2XZZA 2DMBA 5D1ZC 1VEPA 1OTUD 1ZE3C 4YDJA 5KANG 4NQEB 5CGYD 3HHRB 1LO2L 2VJXA 4XP1H 4JKPH 3K81A 4MHHG 3QO1A 5ICYA 3UJTL 2D31B 1QNZH 5CHNA 1CXFA 2XKSA 2WIIA 4Z7UB 3CPLB 1ITCA 1U8OA 1TCMA 1A9BA 4KUCF 2H8PB 4JDVB 4NZTL 4YDLC 3FT3A 3KVQA 3DUSA 2X4PA 4TSBL 3ROOB 3CFDB 3O9WA 1RJZA 3V0AC 4OLWH 1K2DA 1FORH 5CSGA 2Z93A 5DQDH 2LV4A 4P5TC 2AEWA 3O11A 3PXHA 4M6MH 5F1IB 4H0GA 3EO0A 2GYSA 3MV9A 3GMRA 4WI4A 2NZIA 3T0DA 1EMTL 4I18C 4D9LH 1SHMA 1YQ2A 5DJ0B 3WIHA 1ROWA 1KYOJ 2C1OB 1RAMA 2BSTA 2ZUVA 1AY1H 2DQUH 3QWRA 3LMJH 4PJXA 3UO1H 5EOTA 4NM8L 2EDQA 1ZWIA 1N7ML 2EE9A 1QA9A 1G6RH 2OS7A 4HWNA 1PEZA 2FX9H 2VQUA 4P3WA 5JA9A 3O3AB 5SV3A 5JPNB 1A7BA 4LGRB 3UYOD 5HYJB 4HKZB 1MFEL 1S7QA 3U30C 2WBJC 5FB8B 1UB6A 3ZSSA 3L95B 1BQHG 1FV1A 3RX5A 1P9MC 4L4TB 3MRPB 2XACC 3FQWB 1QFWL 3SBWC 3B9KA 1OQOA 1KACB 2X4UA 2X4OB 1SYSB 1CXLA 3QA3A 4WV1A 3UTTB 1C5DA 4IOSD 2YA0A 2WINB 1DDHB 4Q0XH 2M1KA 4H26B 4MLSA 5GSVA 4J3TA 1IEAA 5IEKA 4I77H 3ZKND 5IMKB 5C0FB 4Z6AT 3NZ8A 4PJDE 3WO3B 4AYFA 5C0CE 1NCTA 3TVMD 3GDBA 3GMOA 4WTXA 5IW1B 1HWGB 3SJVB 5FYJH 5HI5C 5K9KA 1V3LA 4LLQB 5C08E 3JTTB 4I3SH 5E6ID 4XVUD 4GW1B 3U9PL 1MHEA 4QRRB 1YUHA 1IZKA 1XFPA 3ZKMD 4NSKA 5I1GH 4ELKA 4FFVD 4BQ6A 3LY6A 4GAGL 4MJ4A 4FZ8L 5GIRB 4Q6YA 5I9QB 2R2EB 4ESKA 2FH8A 2L4OA 4G80A 1U8QA 2EYTA 3QFJA 5KSAA 1KUMA 2JELL 3HC3H 3U36B 4NKDB 5GRYA 4U49A 2W92A 4R3SA 3R0NA 2YSSA 3GM8A 3LS5L 1FL3B 4HK3J 5D7KD 3KAAA 4RDQF 1NDGB 4AZ8A 3VJ6A 2GITA 3WNMA 2BSSA 1AFVH 3G08B 1IM9D 4ZDHA 3VFOA 1S9WA 3UX9B 4E41D 5AG9A 2FX7L 3IT8D 3TIEB 2DJ4A 4UT9L 2JCCF 4Y5XC 4WUUB 3RTQC 1KCSH 3MROB 2J12B 2R4SL 1GOFA 1OD7A 3QO0A 3PGDA 1IQWH 4RQQB 1UM6L 3DIFA 2BVPA 2E3VA 2W59A 5C7XL 1A6PA 5F3HB 2YD6A 3AREC 4LIQH 3TT1L 2Y07L 4HKJB 3U2SB 2R23B 4OZHF 2BOCA 4O4YL 1FZJA 3C08H 5I18L 5EBMA 1MLCB 3RKPA 1Y6NR 4IDJL 2WUCL 4CL7A 4PJ8C 3STLB 2F53E 4O00A 4OFPA 2FJGB 3IDGB 3WSQL 2DQCH 4K2UL 1HHJB 1UKTA 4Z95H 4HWBL 3MJ9A 2RHEA 2R8SL 3D2UB 1UCBH 4MQ7B 4NQCE 4FG6D 4OCYL 4WEBH 5AYQA 5F88A 5KTEH 3N0PB 1ZLWK 2IH1A 4XBGA 4ODTH 2PYFB 1L4IA 5DD6B 2CLVA 4J6RH 4RIRB 4P2RD 4NHCH 4U1IB 1QFWI 4JJHA 2VYRE 1V8HA 2QBWA 2Y5TA 4Y16A 1DUZA 3E1F1 4LLDB 1OAUH 5CINH 2Z4QB 5BS0A 3D1MC 5LG1A 4X5XB 3BZ4A 1FBIH 2EECA 3IJHB 4OQ1A 4G43A 4OB5L 5FUOH 3PWUB 3NGBB 3RY5A 2C1PA 5HYFA 3QPQC 1JZ2A 1WTLA 4JZJA 3I84A 3KPSD 4LCCC 4PJAE 4C56D 1M4KA 4YHOL 3C6SB 3MCG1 3GSOA 3VFPB 2Z91B 4PRAA 3UJJL 4KZEH 1TCRB 5IT2L 5EOCL 3L3DA 1JNLL 1NAMH 4HBCL 1QKZH 2IALA 3EYFA 1L7IL 1KULA 1RHHA 4Y2OA 1FVDB 2E6QA 2A2QT 3KPLA 1UXWB 1WFUA 1A6TB 1XIWB 4XP4H 1MJ8H 1HQRA 5F9DC 2MMXA 5CBAA 4WU5B 1A7QH 5I1LA 4PJDA 3GIZH 2YD4A 1V7ML 2H9GB 3VXSA 3VD5A 3RHWK 1LWRA 1UQSA 1IGMH 4IM8A 1KPVB 3BH8A 2XWBA 1PEWA 4S1SL 1DVFD 5FO8B 1GGYA 2V9TA 1YDPB 5C08A 2AJSL 3Q3GA 1NFDB 5C0JA 4LSVH 43CAA 3MA7A 1N8ZA 1IQDA 2ADFH 5HHOD 1QSFE 3FMGH 1MJUH 1M1SA 4P3CH 1PKQB 1G7MA 3LKOB 1X5ZA 5MHSD 3QH3B 2YUWA 2J4WL 3OXSA 2XWTB 4NC1E 4LASH 4ZAKC 4WFFD 2V17H 3HRPA 4DGIH 4YDIH 3ULSA 2FGZA 4OZIF 4LLMA 4Y89A 3DSNA 4S1QH 4WI3A 5F7DB 5KSUB 2PR4L 4ZSOB 4XAKE 3H3KA 5IQ9A 3JV6A 2DF3A 3MLSL 2VDOL 4XNXL 3HFML 4PJIB 4M7ZB 2VR9A 1A6UH 15C8H 1WEJH 3DVNB 1SQ2N 5INCA 5KVEL 3BZEA 1CI5A 4CMMA 5F1KC 4Y1AE 4DKFL 5FYJD 25C8L 2D03L 2WMPA 4QRSB 3V2AR 1A0QH 4RISH 1EEZA 4U1KA 5DVLA 2CXKA 1JIBA 4HS6A 4KVNL 4QXTB 5EU6D 5M7QA 4KTEH 3KR3H 1HXYA 5ID1B 1T6WA 4GLRH 1D3CA 4N8PA 5FV2A 4OLXH 2XPGB 1KJ2H 5JLZB 2A6JB 4QRPB 4JGMA 4XI5C 1OAYL 5FF6B 4DKAA 4B50A 1ZLVH 1AR1C 4NQDA 5TFSH 2XKNB 4IRSD 2FIKB 3IDJA 4JQVA 2FIRT 2UWEB 1EAPA 4YHLH 2EH8L 5DSCB 4GG6E 4MJID 3UYPA 1JNHB 5FECA 2EDJA 5HYIA 1G7HA 3FN0L 3HNTH 4H8WL 5TGBB 2BNRE 5EO9A 1WGOA 2WQ8A 1F2QA 2H6PA 5ALCL 3B5HA 4JFDD 4ISVA 1S7VB 4A2MA 4DZ8A 1J1XH 2HWZH 4JE4B 5DXWA 5JHLL 1NCCL 1QG3A 2VDNL 4BSWB 3D39E 4LCWE 1QBLL 1F4AA 4HW6A 5E1AB 1EUTA 4WGVB 4FZEL 2UZYB 3E6HB 4OD1L 2Y36L 5EWIH 4F9PA 4NZUH 4JJ5A 5T5FL 4LSDA 1FVCA 5DD3H 2OQJA 2QADD 1MJJB 3QXDA 3S5LA 4H5SA 4XXDB 5CWSA 4RMTA 1HSBB 4BZ2H 1Y0LB 3K3QA 4L4VB 4TSCL 5BZWA 1FO0H 1I7ZA 2E8YA 2VXSL 5IIEB 4PJAA 1GC1H 5CIPA 1RY7B 2VXQL 1DBJL 3MODH 2F5BL 4LRNH 1OGAB 4XVTH 3RFZC 3DNKA 2W9LA 4GRLB 2P5EA 5D1QD 3GUTA 2DOCA 4FFYL 3PHQB 3IKCA 1V7NL 3S9DB 5F9JB 3GMNB 4JO4L 1Z0NA 1HHHB 2XICA 1ZSDB 1KN2L 5DS8A 1SJEB 5JHDD 4XNYL 1IGFL 4TVPL 4M48L 1BFTA 1AGEB 3TT3L 5IVXF 4P9ML 4MA3B 2AERT 4JLRB 3DX9A 4OFDA 5HHNB 1KIUA 3FT2A 3T2NL 2ZG1A 5GS0H 1RZIB 3RWHB 3WCYA 1QSFA 3IJSA 4J3SA 3GNMH 3WFDL 2EZ0D 2V2TB 5I1IH 4HUMB 1M05A 4M1GH 3SE4C 3IFLH 2VDKL 4YNYA 1SJXA 1OAQH 1JHLL 4BFIA 1WWBX 4L8CA 2P45B 4EI6B 1HINH 2VKXA 1EFXA 2GK0B 1JPGA 3VXQA 1P2CA 1QVOA 2B1AH 5IJVB 1R5VA 5DFVC 2YRZA 3FQNB 1EHLL 2AI0L 3A6CL 5KVMC 1XGQB 3BE1H 2IJ0C 4JFYA 4IRJC 4NT6A 3MRBB 3MRLA 3QNXB 3SOBL 1DUYA 2IFFH 1KJ3H 5B39B 4JRWA 4MB5A 2BRRL 3EOBB 3L3KA 3OR6B 1K8DB 3HB3C 4S2SB 1CFSA 1J1PL 3C8HA 3BGMB 3DROA 4RMVA 3ZHDA 2QSCH 1AIFB 2Z8VC 3O3DA 4LSPH 4ONHA 3Q0HA 1AKJA 1ZHKB 2P4AB 5IR1B 4UTBL 1AGFB 1OF2B 4XXCA 2HH0L 2Q3AA 4X6CE 3RIFK 3QSKB 3BXNA 3RNKA 4JREC 4KPHL 3L7FA 1UXSB 4EN3C 1T04B 2Q8BH 1CXKA 2ATKA 4GBXA 5D2LF 3PGFL 4PJ7B 3C60C 3VXRD 3QEQB 4ZUUB 4GG6A 5HHPB 3ZDYF 4YHYC 4K3GA 1YEJH 4DGYH 3BOVA 1MAKA 2HYMA 1TNNA 4KXZI 1D7FA 4N5ED 2A6IA 1MWAL 1AD9A 5DHVH 2PW1A 2E6PA 3IKKA 3ZE1E 4LVHB 3RWFB 1C5CH 4NOBA 1NC4D 5LGKA 1TJGL 3LVEA 1X9QA 2OTWB 2NY3C 5E99H 1RI8A 4PJCB 3MRHB 3BP4A 1DBAH 2P8LA 4KROC 3C9NB 1KBGH 4OCWL 5CKGA 4LSTL 2Y25A 3VWJC 5J89A 1GIGH 5F9AC 5IHZB 1RK1B 4RSVA 3O3BB 5IFJB 1G7QB 2NYYC 4C4KT 1ORSA 4X7SH 1G7LB 1YEEH 3FO9A 1AI1L 4J8RB 2VUYA 1UJ3B 5KAQG 1T03H 5GGQL 1VPOL 2V5MA 4YDJB 4NN5B 1YEHH 4TQEL 1HEZA 3P11H 5DZNA 4CRPA 4FTVD 5HGBB 5ICYB 1E4KA 3PV6A 3QO1B 1I9JL 5GGSA 5CHNB 1F3DJ 5C0AD 2WIIB 1U8OB 4JO2L 1A9BB 4PJFF 3WNKA 3FT3B 5E8OA 1HNFA 3DUSB 4EBQH 3MV7D 1MEXH 2VLKD 2X4PB 4MA1B 2QHLA 1ACZA 5D2NC 2V2XA 3O9WB 1RJZB 2E7HA 2NQCA 1K2DB 2V9RA 1NGZA 2Y06H 2NX5D 2Z93B 5K9JH 5K33A 4H1LA 3O11B 5I74C 3CUPA 3VE0B 3MXWL 5GGVY 3EO0B 3MV9B 4N0CD 3GMRB 1HIML 3T3ME 4HAGA 3LRGA 4K9EL 4HAFA 1CE6A 2ZCKL 1D6VL 4LHQB 3QUKA 1EZVX 2FYYA 1LE9B 4N1EA 2BSTB 1LD9B 4PJXB 1N64L 1N0XH 5EOTB 1T22A 1ZWIB 4U1SA 1HKLL 3NCYP 1QA9B 2FATL 3X3FH 5KZCD 1J1OH 1C1EL 2NY6D 5KANI 1QBML 5MP6H 3I75A 4LEXH 3QIBC 4MHHI 2E9BA 2X9XA 5HDQL 1S7QB 4KJWC 4KMTH 3GIVB 1UB6B 4RNRA 5A3IC 2LU7A 4MMZC 1FV1B 3C6LD 3QAZB 5DFTA 3VU2A 4KC3B 2NY4C 5EPMA 3B9KB 4G5ZH 1P53A 2ITCA 2X4UB 1S5HA 4PJHA 1SY6L 5D7KE 1CFQA 3QA3B 2C3VA 4WV1B 1C5DB 2IPKB 4XP6L 3P9LA 4YXLH 2AV1A 4HDIA 4WJ5A 4E41E 1IGYA 1YJDH 5GSVB 1NCBL 5I71C 1IEAB 3O6FD 4NM4L 4J4PA 5T1KA 5IEKB 3CX5K 4QHLA 5CCKL 3NZ8B 4TULL 5E8NA 4HF5L 5E4IA 3BKJH 3GMOB 2GSIA 4MD4B 3FQTA 3MLWL 2AJVH 3MJ8A 3FQRA 4AIZA 3HNVH 5K9KB 4I3RL 4YHNA 2BZDA 2WWMD 4KZDH 3PJSA 1MHEB 5LWYL 2R1WA 2X70A 1YUHB 4X6CA 4NSKB 2VB5A 1JK8A 4ELKB 4GXUM 2Q8AH 1LHZA 4PLKD 5DUPH 1CLCA 3A67H 1TVBA 4UILH 1NDMB 4G80B 4HXAL 4HULB 1U8QB 3QFJB 5KSAB 3ULVH 3NBNA 4MXVE 4RGOH 5ICZA 4I48A 2FB4H 4PLJD 4R3SB 1E6OH 2YSSB 5TE6L 1KENH 5GS2D 4WU7A 2EIBA 3VJ6B 2GITB 2X5PA 2R56H 3I2CL 4P2RE 4ZDHB 3VFOB 5JOPD 1S9WB 1G9MC 4OGXH 3QHFH 3HG1A 3CU7A 4JM2F 4LSSL 3BPCA 3BMWA 4ONGL 2P1YA 2EDTA 3QO0B 1RZKL 3PGDB 5IHUL 3QWQB 4WHDA 1ZLSH 2J8UA 3CLFH 2Y7QA 3DIFB 5FK9A 3TN0D 2BVPB 3KPSE 5E08L 4FXGA 1WICA 1DL7L 4L3AA 4MQXD 4C56E 3KPRD 5BOPA 4QRUA 1IC5L 2BOCB 3LKSA 1FZJB 4K7PL 1FRGL 1CICC 1BIIA 4YAQA 5EBMB 4WI9A 5HTSA 1JZ5A 5DJCA 4C57C 5EUOE 4X4ME 3R8BB 2D7NA 4PB0L 1GYAA 1NL0H 4MD0A 2FDBP 2R39A 4LPUA 5FFLA 3QG6A 3BDYH 3DX8A 3TVMA 2FLRT 3P0YL 5DO2C 3ARVA 1KEMH 2J8OA 2R0ZL 5EZLA 5ANMA 4YX2H 3EO1A 3MGTA 1RFDL 3LQAC 7FABL 2IH1B 4XBGB 4YHML 4BH8B 5HHOE 2CLVB 4LCIH 5J1TC 1YNKL 3BP5A 2Y5TB 1NLDL 1CU4H 1JF1A 5DMKA 4Y16B 5MHSE 4PP2A 1DUZB 5GPRA 3WE6A 3O2DL 1FPTL 5BS0B 4ODWA 4NCC2 4GMTH 3RKDC 3V4PH 4WFFE 2NZ9D 3BZ4B 1UZ6E 2IAMD 3C5SA 3S36H 3GBMH 2DM7A 4G43B 5DGQA 1TTGA 1G1CA 3MFFA 4MA8L 2C1PB 3VGEA 1YZZA 4JZJB 2YR3A 2OZ4L 3BQUD 5FYKD 4CW1A 2RAMA 3CFJB 4W4NA 3GSOB 3IU4H 4N9OB 4PRAB 4P4RA 4Z77A 4PRIA 4ZFZA 1VDGA 3Q48A 5C6WH 1OSPL 2CMRL 3L3DB 3EYFB 5CSBA 3T77A 5T33L 4WTZA 1UJTA 1RHHB 4L8DA 5DMGD 1JGVL 2VH5L 2CGRL 1FGNL 1GH7A 5FYJE 5FYJU 1PLGL 3KPLB 2FECI 1HQRB 1KB5H 5CBAB 5CJOL 5I1LB 4PJDB 1IKFL 1T21A 3QIWA 4UTAL 1HSAA 4U31A 3VXSB 2CDEA 3H0TA 5EU6E 3BPLB 1UQSB 2FBJL 3NCJL 3GSNA 2XWBB 4PRHA 3ZYJA 1CLOH 3QG7H 5C08B 1MJ7L 3EZJB 3Q3GB 4LSRL 5C0JB 43CAB 3MA7B 1N8ZB 1IQDB 4FQ1H 5BRZA 4DUWA 5CJXC 5I2IA 3C8KA 3JWOL 1S7XA 5F7LB 1U8HA 3SEPA 1G7MB 1CGXA 1CT8A 1GGBL 3OXSB 1K85A 2MCPL 1U3HD 4MJIE 1Z3GL 2QKIA 4JFQA 4OUUA 5F9OH 3CFEA 5KBNC 3UZVB 4XVJL 2D7OA 3ULSB 4WW2A 1MCSA 4HUVA 2WIMA 1CTOA 1J0HA 4LLMB 4JFDE 2F58H 4P2YA 1G7PA 8CGTA 4HQQH 1WWWX 5IQ9B 3I3DA 3JV6B 1T7VA 5FCUL 4YQXL 4JFXA 2A9NH 3WUWG 3RVWC 3HN3A 4KJPD 2CUIA 4WUKL 3DHMA 2FJFA 5INCB 1HYRC 1Q72H 3BAEH 3BZEB 2P7TA 5BVPL 2YMXH 4QXGL 4Q58C 5SWQA 2YD8A 1IAMA 4U1KB 1EEZB 5E2VL 3DO7A 4HS6B 4G6AD 3T0EA 4PJEF 3QIUA 4LIQE 3LQZA 4G42A 3MO1A 1LE5A 3AM8C 2B5IC 1HXYB 3MREA 5D93C 1NFIA 4KQ3H 2AEPH 5A2FA 2OL3L 3B5GA 1BQLL 1J0JA 4C56A 4N0RA 3GI9H 4NQDB 2D4DA 4FQIL 4ALAL 4DKDC 4Z7UF 3VGAC 4WEMB 4GQ9L 2B7DT 4GLRI 4N1CA 1A7OH 5SX4H 1EAPB 4G6FB 4BYHA 1BJ8A 1GXEA 3B43A 5HDOA 5FECB 1P1ZA 4DW2L 2H2PC 1G7HB 3LKRA 5EORL 3PWLA 1I1AC 3GKWH 1X44A 5D7SH 3TNMA 1JHKL 2A74A 4LU5H 2H6PB 4ISVB 2ERJB 4PP1D 4DZ8B 5KW9H 5JHDE 2K9UA 5C0BD 2AKRA 5C86A 5CUSL 3V7AG 1F4HA 5F9WB 5GJSL 3QR2A 4I0CC 3CVIH 5HHOA 2QSQA 3TA3A 1Q9OA 3MV8A 1IAKA 4P99A 5IG7A 4AG4H 4XMPL 5C0ND 2AQ2A 5BMFL 3KXFD 1YYLL 3LEXA 4JJ5B 4K94C 2NY1D 1FVCB 4F58L 2OQJB 4UBDD 1UFUA 3QXDB 2Y1VA 3S5LB 2YD7A 4H5SB 4NQSA 3S34H 4QHNA 1FDLL 5CWSB 2YHGA 1LILA 4D2NA 3EOTH 2EKSA 5INDA 2EYSA 3ZDXF 5FDYA 3LAFA 5BZWB 1I7ZB 1L9MA 4GUPA 4Z18A 4PJAB 3GK8H 2ZUUA 4R4ND 5CIPB 3PNWA 1KNOA 1GGUA 2HRLA 3WFEH 2P5EB 6CGTA 3ARRA 3GUTB 1P7QD 5AD0A 1JYNA 5E1HB 5BVJA 4AT6A 3RZCC 3SE8L 4XCFL 3IKCB 4M6OL 1H3WM 4QTHA 2GJ6D 3WFBL 1D9KD 1YPZE 4Z7VE 1PY9A 1BQHA 5HSFA 5B8CC 1NAKL 1ZLVK 4K3EH 4WRLA 4KH2A 2MPAH 4K23H 2HKFL 1LO0H 3DX9B 3FT2B 4G9DA 2KBGA 3U0WH 2HJFA 1QSFB 4LPVA 3IJSB 4IRSA 3LV3A 4XTRD 4LDEB 1M05B 1F5WA 5KS9E 4YNYB 4JDTH 3VXRE 3RWEA 4BFIB 4L8CB 2YZ1A 5IB1A 2HG5A 4WIQA 1MRFH 5FYKL 1EFXB 3SHSA 4CGTA 4WGWB 1JPGB 3VXQB 1P2CB 1QVOB 3RJDA 1R5VB 1F2XK 3MNZA 1JI1A 3ARDC 3OPZL 4TOYL 3ETBF 4GXVH 2XKUA 4JFDA 1IM3A 4JFYB 5JR1H 4NT6B 2AEQL 3BUYA 2NY0D 3BP6B 4HUWA 5I1JH 2ILLA 3MRLB 4W4OA 1JZ3A 1DUYB 1OD9A 4ZO6A 3T8XB 4K07A 4MNHA 4X80L 1Z9LA 2HVJA 3L3KB 1B0WA 1CFSB 4WW1A 2XTJD 2V2WA 3HMWL 1W72H 1CLYL 3GI8L 3QZWG 3O3DB 4ONHB 1ZXQA 2J5LC 1AKJB 2VABA 3RAJL 1SEQL 3DX7B 1JN6A 4X99A 1H15A 4KKBC 4P9HC 4BSJA 4FTVE 4Y19A 3QUXC 2DQTL 4JO3H 2DQDH 1MLBA 1PSKH 3O8XD 5C0AE 1EBAA 3FONA 4LHJB 5HGAA 3RNKB 1ZTXL 3HC0A 3MNWA 1BAFL 1H3TA 2HKHL 4P23D 5I6XB 3BH9A 3MV7E 2VLKE 5CLWA 3O81A 3SDDD 3NH7L 3RZWA 3S3SA 5BV7B 4IIQA 2ATKB 4GBXB 2ITDA 5F21B 1PZ5A 5L6YH 2NX5E 2C4FU 4BELD 2IPTL 1JPTL 5D70H 4GG6B 3LD8C 1TENA 4TTGA 2A9MH 2A6IB 1AD9B 1XF5A 2PW1B 3JBG7 1RSFA 4OJFL 2HFEA 4HSQA 4YXHH 4HPOL 3KHOA 2CR6A 3L9RA 4KDVA 4G6JL 4N0FA 1MREL 4RRPG 2GUOA 2DQIH 5FHBL 3O6ML 3BP4B 2P8LB 1FFOA 4N0UE 1CR9L 2XZCH 4O9HL 3NACL 3AMLA 1YECL 3FZUC 4O02H 1MCPL 4NC1C 5C0EA 1MY5A 2DYPA 1WZ1L 2DJSA 1ORSB 4BSVA 2NY2C 4JGUA 3FO9B 4NYLA 5IBTH 1RVFL 2QQKH 4XPTH 2PTUA 3U6RA 1HEZB 3VD4A 2YWYA 3PV6B 5FA3A 4YE4H 5GGSB 3P4OA 1NAMA 3TNNA 5C09A 3NA9L 4F8TA 4FQXD 1BBDH 5C2BL 1ACYL 3UYRH 5E8OB 1A6ZA 2CUHA 2CSPA 3N1MC 3O6KH 4O2CA 3HRZA 1FFNA 3QUYA 3QQ4A 5F8QC 5SWSA 1NGZB 1BZ9B 4F37F 4O2EA 43C9A 4LHUG 2Q20A 3RWJA 4H1LB 3CUPB 3ZT6A 4DN4L 1NBZA 1T1ZB 3FRUA 4XPGL 4M5ZL 1CE6B 2VLMD 4LRIC 3MRKB 4NC2B 4N8CH 3QUKB 4UAOC 2FYYB 4RA0C 2AGJH 3EUUA 3AVEA 1BLNA 1T22B 3EYUL 1NFDF 2HRPL 4U1SB 3LEVH 2IQAA 4R90H 3I3BA 1R3IH 4Y5YC 4MGXA 1WBYB 4JQIH 3EJYD 3JVGA 3I75B 3MLRH 3RPKA 2EICA 5EZIL 1NCWL 1U0QA 3TJEL 4G8GA 4BFEA 4XVSL 2ARJA 4KQ4L 4Y4KA 4RMUA 5KOMC 5EPMB 1NGPH 2A0LC 2ITCB 12E8L 3G04A 1S5HB 2FWOA 4OCXH 4PJHB 5I75C 4Q7DA 1CFQB 3D6GA 2C3VB 3ARXA 4PR5A 1CQYA 3P9LB 2AV1B 4HDIB 4WJ5B 5I1EH 5JOPE 2ZZUT 1IGYB 4PJIF 5TPWH 5T1KB 3D18A 3WXWH 4QHLB 4ELME 2Y9RT 4ZS6C 5E8NB 2H2SD 4HGKC 1KJ2A 5CD5C 1MHHA 2V7NA 2GSIB 5FUZH 3FQTB 3K8KA 4K7FA 4N68A 2EDNA 4X6BA 3MJ8B 5FDWA 1MQKL 3FQRB 4AIZB 3B2UC 4KK6C 3TEUA 1XH3A 1NUFA 1OTTD 1A8JH 4YHNB 3REWA 3LH2H 2CRIA 4OM0H 3PJSB 3KPRE 5CP7A 2R1WB 2X70B 4X6CB 1HQ4A 1F13A 5C6PB 2G60L 1JK8B 5I9QC 4F7EA 3MV7A 4DQOH 3K4ZA 2AK4D 2FSEA 4HIXH 1TVBB 4KK8C 2IMNA 5KVDH 4ZXBD 2UWEF 2NX5A 3TFKD 1J0ZA 1KFAH 4F7CA 1BFVH 5ICZB 1I3VA 1CGSL 4I48B 2Y6SC 3S4SG 3BKCH 4MQSB 2F54D 4D0BA 2W1NA 3SE9L 1MQ8A 3CVHH 4YBQC 4NNPL 5HVFB 1DQJA 4WU7B 1IAIL 1ZGLA 2FH6A 3PWJA 3QWOA 5CS7A 1B4RA 1FH5L 4N0UA 5CJ8A 3HNSH 5KOVC 3HG1B 1Q9WA 2NXYC 5E8DH 3BPCB 4OGAD 4E0RA 3PQYD 4R2GC 1FO0A 3BFOA 5D1ZD 4XP5L 3ORJA 1FNFA 2FL5A 2J8UB 2Y7QB 1MI5D 5FK9B 1MHPH 2WM0A 3PDDA 2V5YA 4TRPL 4XNZB 4FXGB 2KZWA 4PG2C 5FYKE 3WFCL 5F7MC 1IEHA 4QRUB 3LKSB 5J57B 1R0AH 5D1XC 4YAQB 2GTWA 5DJCB 4HPYH 2UZIH 4B7IA 4RFNC 4GW5A 4IRZH 5E6YA 1OTUC 3PL6C 4RZCA 4MD0B 1SYVA 2QQLH 3F8UB 4NQTA 5CGYC 4L8BA 3QG6B 4I0PC 3VXMD 3SQOL 3SCMC 3CFKA 3DX8B 5AYUH 3TVMB 5J13B 4U1JA 4OZHA 4Z0BL 5EZLB 5ANMB 3EO1B 3MGTB 3ULUF 5SWZD 1G6VK 1YMHA 4LLVA 3KJ6H 1GJIA 1JE6A 1LQSR 5B21A 1MIEL 1VB9A 2BFVH 3BWAA 3BP5B 3V6FA 1CWVA 2R4RH 1JF1B 5DMKB 4AJ0A 4HGWA 5CILH 4PP2B 3SDAC 4Y4FC 1JPSH 1LO3L 3REVA 3MXVL 3NGBC 5DJYA 1TTUA 5GRZA 1XGPB 5I19L 3HI1A 4YH6A 3MFFB 4XPHH 5DRZA 2WBJD 1SMAA 3T3PF 1BP3B 4CW1B 4NC0B 1IE5A 3ZE0E 2O5YH 4P4RB 1FAIL 4PRIB 3VI4F 2GSGB 2PTTA 1QACA 4ZFZB 1F4XH 2CK0L 3T77B 4WDIA 5BW7C 4XNMA 2HLFD 1YQVH 4KKCC 4HT1H 3DWTA 2XZQH 2PCPA 4R7DA 4JKMA 4Q6IA 4ELMA 1PD6A 1J11A 4EJ1C 3QIWB 4KI5D 1HSAB 2H32H 2CDEB 3H0TB 3SDYL 4F15B 1XZ0A 3DETD 3CX2A 3MA9H 1UKQA 3I85A 4NNYB 3GSNB 2CRZA 2C5DC 1FLRH 4PRHB 3TN0A 3X3GL 3RX7A 4S0SD 2GI7A 5CSZA 5DK3A 4UU9A 5BRZB 1EVTC 5I2IB 2D7MA 3C8KB 3CIQA 1S7XB 2I60H 1U8HB 4P2QA 1DBBL 3I9GL 3VRLE 1CT8B 5D6DA 4CN1A 2O5XL 5C1MB 2EDDA 5DHVA 4ERSH 4JFEA 1GAFL 4L9LC 1DFBL 2QKIB 4JFQB 4L8SC 4OUUB 5KG9A 4OQTH 3MOBL 1HKFA 3CFEB 4OIBA 2R29H 4PJ7F 4WW2B 4HUVB 4OTXH 5E6IC 3GSUA 5CJQH 4BZ1H 1G7PB 2HJLA 2FEDC 4JAMA 1I9RH 3J8F7 4M43H 1E6JH 4Z7WA 4NBXB 5C0BE 3BX7C 5CGMA 3KDMA 3VI3F 4FFVC 3L3OA 4YWGL 4DFIA 2CKBH 1P4IL 2CO6B 4GAJL 2FR4A 2IBZY 3RVVC 4PJCF 1MNUH 2EXWD 3WFHA 4RAVA 3G6JE 3WS3A 2P7TB 2FNBA 2EO9A 2E7BA 3KXFE 2IG2H 3DO7B 3RTQD 3WIIL 1VEMA 3QIUB 3LQZB 3ARPA 3MO1B 2QTEA 1LE5B 2AJ3A 4OFIA 4FQ2H 1U8PA 3VD7A 3MREB 5EBLA 1BZQK 1NFIB 4H8WC 1YC8A 2E7LA 2ZOLA 1G9NL 3U4BL 1F8TH 2BRQA 3T4YA 1TQCC 3P0VH 4C56B 3ARED 4ZOEA 2BHZA 4XWGL 1YEFL 4H88L 1LNUA 3FN9A 2FGWH 4PJ5D 3VCLB 3KHQA 4DK6A 3KYMA 3Q2CA 1P1ZB 5D7JD 1DQTA 3LKRB 5GGVH 5K9OA 3PWLB 2GJ6E 5FHAL 3TNMB 2A74B 4LK4A 5SX4I 5FEBA 5F96L 1AXTL 1YMMD 4R6UA 4G6ML 3EO9L 1MCBA 1JRHL 2AKRB 4OLVH 1DVFB 5D6CB 2UZXB 2YS4A 3RA7L 2V6HA 5KSBE 3ZTNH 4IOFD 2WP3O 5D4QA 5D9SA 3TP4A 3ALXA 5IVNA 5HHOB 1EFQA 4WFHD 3TA3B 2E6JA 1Q9OB 3MV8B 1IAKB 2ESVA 5IG7B 4PJXF 1QFUL 1S3KH 3HI6L 5I8KH 2BP3A 5EIQA 4JB9L 1N5YH 5GISL 3LEXB 3SGKA 2X89D 1U3HA 5DC0A 3DUHA 3WO4C 2YA2A 4NQSB 5E9DA 4QHNB 1G6RL 3EGSA 4ODXA 1FGVH 4ZOBA 4C59B 4DN3H 2EKSB 2C4FT 5C70A 4KHXL 5INDB 2EYSB 3BYTA 2EXYC 3QPQD 4GUPB 4QKXB 1IAIM 4XGZA 1A6WH 3GFUA 2GJZA 3PNWB 3PIQA 4GRLC 2W9EL 5GHWH 1KNOB 4K3HA 2R0WL 3PV7A 1CBVH 5AD0B 1B2WH 3W2DH 5BVJB 1N2RA 4GRMA 4FQCH 5F44A 4AT6B 2VLJD 4FQJL 4MJ5A 1IKNA 2XTJE 4HZAA 1BECA 3BT2H 3H7LA 3NTCH 4QTHB 5MENE 4XP9L 4YBLB 1KPRA 3WJJA 4OCMC 3WNOA 4UDTA 4P4KC 2LTQC 4JHBA 3K4DA 2X9WA 2VC2H 2LQRA 1BQHB 4OCSH 4CVZA 1UZ8A 2YK1H 3OSKA 3NFSL 5JA8B 3T2OA 4G9DB 5LGJA 1IGCL 2HJFB 2YRLA 4ZFFA 4I3SL 4GXUN 5HPMA 4IRSB 3LV3B 5F72S 1DEEA 5E2TL 4X83A 5F89A 5DEFA 1C7TA 4X4ZA 4AEIH 3RWEB 5T3ZD 5IB1B 1HCFX 2HG5B 5IESH 2J88H 3ZDZE 2AXFA 1GGIL 5IVXA 3B2VH 1X5AA 3MNZB 1WQVT 3LEYH 1A14L 1W8NA 1CQKA 3JZ7A 3AS0A 3OF6D 2ADGB 4JFDB 1RUKL 3MUHL 1IM3B 5C0BA 3BUYB 4HUWB 4GMSL 1RUPL 2VDML 35C8L 5GQBA 3O2VL 1UVQA 4NO0D 2PO6A 3LZFL 1EJOH 4UQ2A 4MNHB 4MYWB 3SGDH 2HVJB 4DEPB 4OFVA 4WW1B 4LVNC 2R2BA 3GRWH 4ODSH 5DUBA 1HH9A 2X10A 3KXFA 2ED7A 3HE6C 4KRPB 2VABB 1T1XA 3TYGH 5ITFB 1JN6B 2QADB 1H15B 1IGJA 5I73B 4Y19B 5HVHB 5ERWA 1QHPA 3IDYB 1MCEA 1MLBB 2DD8H 3K74B 3FONB 3NFPA 5HGAB 3SGJC 4CDGC 3V52L 3RVUD 1T89C 4X6FA 3HC0B 3MNWB 3QDGA 1AR1D 3GBNH 4RWYH 3D0LA 3BH9B 1KJVA 1TZGL 5FXCH 3IDMA 3BZDA 1NSNL 5IEHA 2OM5A 4IIQB 4YZFE 2ITDB 3S36X 5DVNA 1PZ5B 4Y4HD 4URTB 1E4WL 2UY7A 2BK8A 4WO4D 2F8XC 2YZ8A 3A6BL 1XF5B 5BCAA 2HFEB 4UIKH 2VLME 4UV4H 3L9RB 3MJ7A 2ENYA 1P5VA 4N0FB 1X5LA 5DURB 5JHDB 2GUOB 1DQQB 1S8DA 4EOWL 1QSZA 4AY0A 1FFOB 3MLXH 5KSBA 1AXIB 4M6NH 4CDHA 4F7TA 3AMKA 1X5KA 3V5DA 4RAHA 5C0EB 2DYPB 4BSVB 4NYLB 4YC2B 1I7TB 3QNYA 4NN5C 1K4CA 4XPAH 5D72L 3MNVA 3U6RB 4KY1H 5C3TA 4MSWA 4DGVH 2OP4H 2VKWA 5E2UH 4EI5A 5B22A 5FA3B 1CGYA 1ZA6B 3P4OB 1NAMB 3V7AE 1AC6A 3TNNB 3E0GA 3UDWC 3R0MA 5C09B 2EDEA 2DBLH 4ZQKB 4K9EC 3VGBA 2OR9L 3ECBA 3D25A 5F6IB 3E6FA 1WAAA 3O9WC 4S10A 1I85A 1A6ZB 5DJDB 1KB5A 3BD3A 4O2CB 3HRZB 1FFNB 4AM0A 3QUYB 4M7JH 3QQ4B 5SWSB 3LRSA 4KDWA 4M93B 4O2EB 43C9B 4OLYL 3RWJB 3P77A 1CLZH 1NBZB 1J86A 3FRUB 4HCRH 4PJDF 2ZNXA 3UBXG 1EO8L 4OF5A 4KUZH 2L7UA 4A6YL 5F7EL 2GCYA 1HN1A 2EIDA 2ZUWA 3B4NA 3BPNB 5D1QC 3SDXA 2XTLA 3G6AA 3W9EA 5L0QB 1F11A 2IQAB 3WXVH 4Z78A 4UB0H 2AK4E 5E5RB 2MKWA 2QEJA 3S35H 5GRJH 5D8JL 3C5ZD 3O6LH 3H3PL 2NY7L 4G8GB 1Z9SA 4NFBA 2XA8L 5C6TH 3EFFA 3T0BA 2ENSA 5L7XL 2A83A 1DBML 2ARJB 1D5MA 4Y4KB 5DFVD 4ZTOH 3HA0A 2F54E 1QRND 3PP4L 3CC5B 5DI8A 3G04B 2FWOB 1RPQA 2VZVA 2KQNA 1KB9K 3LPWA 1A3RL 3VFRA 5A16A 4PR5B 1ZVSA 1NBVL 1TPXC 1RV6X 2LAAA 3D18B 3KPPA 3MRMA 4MA7H 2QQNL 3AUVA 2IBGA 2ZPKH 4X7EC 3PQYE 1KJ2B 1MHHB 2V7NB 4K3JL 2G2RA 4K7FB 4X6BB 1CFVL 5FDWB 1G9MH 1K6QH 4OZ4A 1MI5E 2BC4A 1XH3B 2YN5A 1EIBA 3REWB 3L7EA 5FM5M 4UT7H 1BMGA 1DQMH 4O5LH 5CP7B 3QXAA 3WUWA 1HQ4B 4FQXA 1B88A 5T3ZL 4JFFD 3VDBA 3BIKA 5EA0L 4F7EB 2FEEI 3G9VA 3MV7B 1NCDH 2FSEB 5J3HC 5AZEH 1JUFA 1U92A 4GRWH 4RCAA 3FOLA 2NX5B 3C60D 5MI0C 3VXME 2JLLA 4F7CB 5AWNH 2X1XR 1D5XA 32C2A 3H7BA 3W39A 3LS4H 3A0OA 4I13B 5DZLA 5L9DL 1JZ6A 1RZKC 2WUBL 4D0BB 5SWZE 5DDHA 2EH7L 1DQJB 4XCCL 5I0DA 1AO7D 2NY3D 1ZGLB 3PWJB 3QWOB 4LGPB 2VUOA 4N0UB 2M8XA 3TPUA 1FP5A 3VWJD 6FABH 4JM4L 1Q9WB 1QUNA 2NYYD 2LABA 3LQAH 2NY6B 4E0RB 3GEWB 1CK0L 3T0XA 4D0CA 5FA4A 3QEHA 5EZJA 1HHGB 4HS8L 3MMEA 1FO0B 4OBSA 3OR7A 1IGIL 1Z9OA 3EFDH 1T5XB 4NN7B 2KH2B 5I30L 1CL7H 2FL5B 1MF2L 3ARQA 5C07D 3OZ9L 2X4NA 4ONFL 3GM0A 4K8RC 3UC0H 4XMLH 3H3BC 1BVKA 4PJAF 2GTWB 3MRIA 2VZ1A 1CDGA 1PVHA 1WCBA 3MOAH 4V2CB 1RJLA 5HHXL 1TVDA 4X9IA 3LDBB 1RMFH 1X5IA 1X3DA 4RZCB 3MUY1 1SYVB 1A5FH 4L8BB 4TUKL 1MY7A 5DF0A 3GSVA 4KI5E 3CFKB 1QHOA 3DXAA 3U1SL 1J8KA 4U1JB 4KDTA 4JPVL 4LFHG 2KUTA 1JV5B 4QXUH 1PKOA 4JO1L 3BESR 4M8QA 1YMHB 1HCVA 4LLVB 3O3EA 4MAYC 4ETYA 3P30H 1T1WA 1NUNB 3DTXA 1QFHA 5EFIA 4HC1L 4Y16C 1A6AA 4OI8A 2XY2A 3BWAB 3B83A 3V4UH 3V6FB 5KN5A 4HGWB 1KEGL 2F74A 2IAND 3BJLA 3BPOB 4X0KA 2AK4A 2EEAA 4X8XA 1A3LL 4N0CC 3REVB 5DJYB 2I26N 1ZA3A 4RFEA 3HI1B 5J9PA 3G6DL 1T0NA 4GAYA 5DRZB 1FZMA 1MPAL 1TETL 3VWKA 4KJWD 5TE4H 3BEVA 4XC1H 4OV6F 2F54A 1F6FB 4FQLL 1RZJL 1T0PB 1JL8A 2XZAH 3VXNA 1S5IL 3BDXA 1W72A 3O41A 2FZ3A 3QQNA 4NKIL 4WDIB 4XNMB 1PAMA 4PRPD 3TO4D 4JPIA 4ZFOL 3JWOC 2LE9A 2PCPB 4Z7NE 1JZ7A 4R7DB 4YHZL 4M7LL 3WKMH 2A77H 2DI9A 4Q6IB 2IPUG 4ELMB 3LIZL 4G8FA 1UEMA 3C6LC 3UAJC 4U2YA 1XZ0B 5D1ZA 4HWEH 4O2FA 3QCTH 4FRWA 4H25A 3RHWF 1TLKA 3TN0B 1MI5A 3OJ2C 1RUQL 1ADQH 3VGGA 3KGRA 5B4MD 3PE9A 5D5MA 5CSZB 4UU9B 1FZOA 4X4YA 5EBGA 3BKYL 5HD8D 2R1YA 4P2QB 3O6FC 3V0WL 2DKSA 4UNUA 5IW3A 2P47B 3IF1A 3BGAA 4JY5L 4WTWA 4PJ5E 5DHVB 4QHMA 1FN4A 1AJ7H 3QZWA 4JFEB 1UACL 4WENB 5KG9B 4JG0L 1OM3H 3ZKXC 3VXMA 1T2JA 4P5TA 4GG6F 3GSUB 1OP9A 2HJLB 4JAMB 2VXTL 2Z31D 2OK0L 1YMME 2BNQD 4HFWA 1NMAH 4Z7WB 1KN4L 3ARGC 3KDMB 4I18A 5LAXA 5SWZA 3L3OB 5HBBA 1BWWA 2I25N 3FTGA 2FR4B 1RIUL 3J7HA 4WFHE 3GHEH 3WFHB 1RZ7L 4RAVB 1EHNA 2IF7A 3WS3B 4OLZH 3HMXH 4YDVA 3BHBB 1EEYA 1OARL 2J6EH 2R0LH 4PLJC 2AJ3B 3LPFA 2ZCLH 1U8PB 2FBOJ 4K7PY 4YXKL 3HZKA 2ZOLB 4YIQA 2WBJA 4RMRA 4RRPA 4K94H 3T4YB 3W0WA 5E8EA 5MEPA 2XYCA 3D9AH 3WYRA 1HHKA 1A4KA 4HEPG 5ADOL 3MV01 5J8OA 1CICD 3TGXA 5DD5H 1OT2A 2WQRA 4ZO8A 5DVOA 1U8JA 1LNUB 2CDGA 4ZS7H 2EIZA 2VLJE 2MSPA 4MAUH 3KYMB 3RU8H 3OAYH 1DQDL 1AE6L 3ZTJG 3IDNA 4WEUD 2ID5A 3JWDH 4MQXC 5I1CH 1RD6A 5ACMA 5TH2A 4O58H 1QR1A 5CBEA 3MACL 5D9SB 4P2CG 1YNLH 5HHMB 5I1DA 1UKSA 1S78C 3TWCH 4JG1H 1S9KC 3UZEA 2BSRA 2ESVB 5T3XD 3L5WA 3L5HA 4U1GC 1ZOXA 2YPVH 4LHUA 2OXHA 4D3CH 3S37L 1U3HB 5T3ZE 3N1GC 1EHXA 1N59A 2EC9T 1EEUA 5E9DB 4W6XB 3X14A 4ODXB 4HJ0D 3KYAA 3NMEA 4LPXA 3P40A 4M5YH 4P2OD 1MAJA 2MKLC 4ORZC 3MRCA 4XGZB 1FFQA 4FMFA 2GJZB 3PIQB 1VEOA 1RJYB 3BGFB 1KLFA 4KTDL 1K4DA 1EGJL 1EAJA 4PJHF 4PV8A 1LO5A 4I2XE 1RURH 1PY4A 2ZCHL 1N2RB 4GRMB 1KC5H 4MJ5B 2F19L 2IAMC 5GRVK 3O3AA 4M62H 1ZKAA 4Y5XA 1Y18A 1KPRB 4UDTB 1ZGLM 4U0RC 4NGHL 3L6FA 3RTQA 4DKEH 3GHBH 1O0VA 5FV1L 1DBKH 2VAAA 3BKML 1EVUA 4PRBA 3D3VD 3BQUC 3KG5A 4CVZB 2E7CA 2HN7A 1JMXA 2BNUA 1RUAL 4HUXA 1UZ8B 1IC7L 3C5JA 2AJVL 1JGUH 2NXZC 1I9IL 5DMGC 5LGJB 5DT1L 1T80A 1U8MA 4HFUH 4TUOA 2Z8SA 3L5XL 1XGYH 3AREA 4ZFFB 3IJYA 4P9HH 4X6CF 5HPMB 5IV2A 4KZDL 3PGCA 1DEEB 1L0YA 4YK4C 5F89B 2WK2A 5DEFB 2HFFA 3SKJL 2DLEA 4PJ5A 1C5BH 4PJ8A 2AXFB 3CDCA 3CVHA 1INDL 3Q5TA 3RY4A 4LFHD 2MNUA 2OR8A 4LDLB 3V6ZA 4IMLA 4LNRA 3CDYA 5LJYH 5I1KH 4RFOL 1YMMA 3VRIA 5C0BB 3ZE1F 2JCCE 4LQFL 4Y2DC 4OD2A 5E2WH 1UVQB 2ATPB 2PO6B 4K3DL 4I5BA 3RVWD 4UQ2B 4N8VG 2JJUA 4HIEA 1A7RL 5GIRA 3UTSD 2R2EA 1RU9L 1LO2H 2R2BB 3RX8A 5DUBB 1HH9B 4MS8C 1DP0A 3C09B 3UJTH 3KXFB 2X89A 2VSDA 1T1XB 3MZTA 4OGXL 1IGJB 2V7HA 4NZTH 3SGDI 5ERWB 3S4SA 4L9DA 4LQ1A 4TSBH 4YHKL 1MAML 3NFPB 2J8UF 4PS4L 1N0LA 4X6FB 4X6DA 2J3SA 3RIFF 3QDGB 3D0LB 5FKPA 1KJVB 4R26L 3IDMB 3HE7D 5IEHB 4LOUD 3QUML 1WITA 3FB6A 3V6BR 1EMTH 2G9HB 3EYVA 4KV5F 1Q0YL 1QBAA 3FFDA 4NM8H 1NGWA 1J7VR 3MJ7B 3FHAA 1N7MH 2VQ1A 3T3MF 1S8DB 2H1PL 3EDFA 4JM2D 1A7PL 5I66A 5JW5B 5KSBB 3BP7A 1KXVC 1MCOL 1UEYA 4M03A 2O26U 4RGNC 4F7TB 3V5DB 1A7NL 1MFEH 2DN7A 4LKCA 3FO0L 5DLML 3QNYB 4PJ9D 1K4CB 4M4PA 3QUZC 5BV7H 4G7VL 1NGQL 3ARFD 1KCRL 1QFWH 5DA4A 3R4DA 4MSWB 5DWUL 4ZAKA 4EI5B 5DTFA 1WIUA 3PF2A 1MCLA 4OD3L 2HFGL 3AB0C 4G6KL 3H42H 1EO7A 3TIDA 4MDIA 1QRNE 2DQHL 4WI8A 2BDNL 2APFA 2PYFA 3D25B 3BD5A 4JFHD 3VFNA 3E6FB 4ZD3H 3BRDA 4MMXC 2NLJA 2NY0B 5MEOB 5IB3A 1KB5B 1CFBA 4U7MA 2CQVA 4AM0B 1OSZA 5K59F 3O2WL 2NY1C 2H32A 4JCLA 1HZHL 3LRSB 1BF8A 3OXRA 4U05A 4UBDC 2XTJB 3HS0A 5ILTL 3NPSC 4W68A 5L8LB 4U3XA 1OAXL 1H5BC 2HT2D 3P77B 3U9PH 4QY8A 3DARA 3WNLA 3RY6C 3VFGL 3V5KA 4I3GA 5T3XL 2WW8A 1IARB 2GCYB 4GAGH 4WWKD 3TESA 4FZ8H 3S88L 3SDXB 3G6AB 4JFFE 4GJTB 3RVTC 3W9EB 3ME0A 3ET9F 1F11B 1FVDA 4KKNA 3MLPA 4LCYA 4OQTA 4Z78B 1PX3A 1T1YA 2JELH 5IW6A 4RGMC 1EJ6A 4WU5A 3FCTA 3EOAA 5DZOA 1RULL 3LS5H 3EFFB 3U79A 5FYLD 2A83B 3ILQD 2CKBA 1U8NA 1D5MB 3ARDD 4WW2F 1F6AA 4LAQL 3TH3T 2FX7H 5DI8B 4XAWL 4UT9H 2CK2A