4DGZA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dgzA00
1NUCA 4K8IA 1A2TA 1KABA 4ZQ3A 1JOKA 4B9XA 1TT2A 3H6MA 3C1EA 3EROA 4TRDA 1SYEA 5EKKA 4J6HA 2F0TA 2LKVA 4K2LA 3MXPA 5F2DA 4OL7A 5JAVA 1KDAA 1JOOA 1SNOA 2F0UA 4NDXA 5KRUA 5DEHA 1EY5A 3OMCA 1ENAA 3QOJA 3NHHA 4G57A 1STBA 4ID6A 2WACA 2RBMA 4KD3A 2KHSA 5CV4A 1STGA 1U9RA 4H7BA 3TP7A 5KIXA 3D4WA 4RKBA 3P75A 1TQOA 3S9WA 2HQEA 4IALA 4ZUJA 3MZ5A 4LAAA 5C5LA 2EYPA 4F8MA 2PQEA 4QMGA 5HURA 1JOQA 5CV5A 5KGUA 4B9WA 2SNSA 5C3XA 3NUCA 4KJOA 3TP5A 2EYJA 5CGKA 2F0QA 4KV6A 3HZXA 5JOBA 2F0HA 5C3WA 3RUZA 3BDLA 4DF7A 5KYIA 5IGEA 1ENCA 4EQNA 3SK8A 1EY9A 3BDCA 1A3TA 1EY0A 4WORA 1EYAA 2OXPA 3EJIA 2F0SA 4IZ8A 4DFAA 4EVOA 2F0MA 2PYKA 3QOLA 5IOCA 2KQ3A 3D8GA 2RKSA 2PW7A 2EY1A 2SOBA 2F0KA 5KEEA 5CV8A 4EQPA 4RKLA 1F2MA 1STYA 2EY2A 2F0WA 4KHVA 1KDCA 2F0VA 4KY5A 1A2UA 5I6WA 4NMZA 4HTHA 1F2ZA 5C6AA 4YIJA 3OWFA 5J39A 1EY4A 3MHBA 3VA5A 3SXHA 1EY7A 3T16A 5CV9A 5KYLA 2ENBA 2F0FA 3C1FA 2O4XA 1EQVA 5I6YA 5I9OA 3OSOA 5CR3A 2EY5A 3E5SA 5C4HA 2F3VA 3SK4A 5IGGA 1EZ6A 4IUNA 4ZUIA 5I9PA 1A3UA 2F0LA 5IGCA 3P1HA 1EYCA 1NSNS 1SYCA 3U9OA 5J22A 5HGTA 1A3VA 2F0OA 1KDBA 1SYBA 3NP8A 4K14A 4K2KA 1KAAA 1TR5A 3T13A 5C4ZA 4HMIA 2EYOA 3HEJA 3LX0A 5IIFA 2PZUA 5CV7A 4ME5A 2F0IA 4QB4A 5IGBA 2OF1A 1JORA 2F0NA 3D4DA 4K5VA 3DMUA 4KJNA 5K5PA 2EYLA 1SYGA 3ERQA 3QB3A 5E1FA 5E3FA 3SR1A 5C5MA 4I65A 1SNPA 3D6CA 4J1MA 5EGTA 4F7XA 4EQOA 3ITPA 5ISRA 3PMFA 5CC4A 3NQTA 5J1ZA 3MVVA 1SYFA 2F0JA 4S3SA 1AEXA 1EZ8A 2SNMA 3MEHA 4ODGA 2OEOA 2EYFA 4E6IA 4HMJA 5IGDA 3NXWA 3OMGA 4NP5A 1II3A 1IHZA 1EY6A 1SNDA 2RDFA 1SNCA 1F2YA 3EVQA 5IGFA 5IODA 3R3OA 5M9OA 2F0PA 3TMEA 2F0EA 2EYMA 4N9PA 5NUCA 3TP6A 2F0GA 2QDBA 4KY7A 4DGZA 3V2TA 2F3WA 2NUCA 3SK6A 2PZTA 5CV6A 4K5XA 3NK9A 4N9TA 2EY6A 3TP8A 1SNMA 1SYDA 4PNYA 4PMBA 3SK5A 4WRDA 1STAA 4K8JA 1EYDA 3DHQA 2EXZA 2PZWA 4KY6A 4MIUA 4NKLA 2EYHA 1RKNA 1SNQA 4KD4A 1STHA 4KTAA 3SHLA 4K6DA 1EY8A 5DAUA 4DU9A 5EKLA 2F0DA 4R8NA 4QF4A 4PMCA 2PW5A 2M00A 1STNA 4K5WA
chains in the Genus database with same CATH superfamily
4DAMA 3L0OA 5ELDA 1HJPA 4J6HA 4KKTA 5ELOA 3S1NH 2RCNA 1SMYC 4B9XA 4CKEA 2XN9C 1GKHA 2B2TC 4A3FH 1JOQA 1SBBB 2SNSA 2KECA 4GN3B 1L0WA 1Y69U 1V1PB 1K73C 4XT1B 5C6AA 2NZ1D 1EIHA 5BN3A 2MFIA 1DONA 5IYCG 1Y1VG 2PW7A 4A3JB 1MI2A 1EWHA 1VQIA 3WDNA 1IL8A 4K6LA 4X6AH 4FDBA 4PG3A 1EY7A 2VQEL 3CRKC 1C0AA 2KUMA 2ZM6L 3TQYA 4ZUIA 2ZXRA 4BXXG 1YBYA 2F0LA 2VB2X 3NENA 1RL2A 1SYCA 1LTRD 1PYSB 4R4OA 2JA9A 2ZTDA 3OIQA 4RCOA 4OO1I 4JI5Q 4IFDG 4A3CH 1WTWA 3KK7A 2K5WA 3ERQA 2XIWA 5E1FA 1IKMA 2IPKD 4AH6A 2XTIA 4F7XA 3HOWG 5K36H 3NPPA 4HIMA 1ET6A 4YCUA 3CP0A 4ZKBB 3MEFA 1S5BD 3K5NA 3K8AA 1YJWA 2A6EC 3NXWA 2EJMA 1ESFA 3G7LA 1SNDA 2MO1A 2NB0A 4HJ8A 1XXGA 3TMEA 3L7ZC 2E2IH 4LF4L 1LT3D 4R8IA 2NBFA 1Z47A 4NW2A 2KHJA 1P8LA 4DV1L 2E75C 1NBWA 1ENFA 3K58A 4MIUA 1SAPA 1J6QA 2KCTA 1CM9A 1SNQA 4KD4A 3PIP3 2CKZB 3MFGA 1Q1BA 1HZCA 2K03A 1H9KA 4RWSC 1PTOD 2YYZA 5LMNQ 3WOFA 2FINB 2M00A 4C3HH 3K57A 4GOPB 4OIKA 1OXXK 4LF8L 2NZHA 2ZJQA 1TWFB 3HOVB 1PMRA 3UE0A 1B9NA 1TWGB 3EA6A 4DAPA 1X9NA 5KNBA 3RN5A 4X3TA 4UHVA 1RHPA 1IBLL 4A3GB 3P75A 4IALA 2JE6I 1NMFA 2PQEA 4X65Q 4NXML 2L1BA 3URYA 4JV5L 5AJ3L 5GAGC 1NR2A 2AQ3B 4DR1Q 2F0HA 3ICEA 3EIVA 3GTLH 2OXPA 1VDZA 4LFAL 1BKBA 1SFOH 4B3ML 4RHRA 1JQYD 1HNXL 4BBSB 1UEAB 2QEJC 1PXUA 3H91A 1HR0Q 3SXHA 1EQQA 2NTSA 5IP7G 3E9HA 4FYDA 1E1OA 2UXBQ 4GOPC 3IFDA 2Z8LA 3CPFA 2D2CC 2B8FA 4M8AA 4A3FG 1R9TB 3HKZE 1WD1A 1I3QB 1MBYA 1MSGA 1RF2D 1FNWA 2IX0A 2NVXH 3J81L 1UE1A 1YZ6A 1TWAH 3E9IA 4QJFA 3BS1A 4XXEA 1OXVA 1Z7TA 4A3IG 3S17H 4DR3Q 1Q90A 3GTQB 1PDQA 2WIIB 1QZGA 1FVIA 3EFXD 2E2JH 2NN6I 5T1GA 4F87A 3RLFA 5FJ8G 5C3EB 1F2LA 4DK0A 1XPOA 3D6CA 2OCEA 2JA6H 4HIOA 1OXSC 2C5CA 2K05A 1IL2A 5ELNA 1N36Q 1PYWD 3PGZA 2RSNA 3A8JE 3HRZC 4DPGA 5G3LF 3W5OA 1HNWQ 1EIFA 4JG2A 1EFID 5D3IB 2N78A 4HEDA 4GKJL 2OWOA 1U0LA 3BDOA 3GTGH 1V1OA 3A7LA 4A3CG 1OO9B 1S4ZA 4KTAA 4B3RQ 2Y0SE 2QF7A 2I0QA 4UY8C 4R8NA 4P73A 3J7A5 1YJNA 4ZQ3A 3RR5A 4HN7A 3I4LA 1WTXA 1HNZQ 2VUMB 2JA7B 3EROA 3CU7A 3FPUB 2BE5D 3K59A 4LUZA 1LACA 1EY5A 1Q3LA 5CV4A 2RQXA 3TP7A 3TS2A 3D6WA 3FMCA 4RG1A 4C3IB 1U4LA 2JJQA 1XPRA 1E0BA 1MJEA 2Z0SA 1I4XA 3H0GH 2B2VA 2F03A 2DJFC 5CV5A 1JT8A 1S3OA 5M3MB 3TP5A 1XMQQ 2D9UA 1C4QA 3M4PA 5IGEA 4C3HG 2F0SA 3VYUA 2D0PA 4IPCA 4BBRB 3QO2A 5GAEC 1T9HA 3KUPA 4BY1H 2Z6KA 1JC7A 1XX8A 5C4JH 2F0KA 1DGSA 1STYA 2ALYB 3J80i 4JI3Q 3F2DA 1DXMA 2RCFA 2WKDA 5LHY1 2NVTB 4DR7L 2E2HH 1CI3M 3VA5A 3EQLC 2LSSA 5ELCA 1DZ1A 2MQHA 3HKZG 1B1ZA 1K28A 3PO2H 5I9PA 1PH8A 5IWAL 1VQ7A 5E4WC 1FJGQ 1AE2A 5J22A 4AQYQ 2A6HD 4RGOS 4DV4L 3A56A 4DA2A 2KBNA 4K2KA 1TWHH 3CW2C 4FXKC 4LJZC 2N3SA 3HEJA 2LS01 2P5ZX 4DV3L 4CDDC 1VQ5A 4ILWA 4DV7Q 1WVLA 3M4OH 1GUNA 1HFNA 1YNJD 2BH8A 1BNZA 4UPAA 4B3SL 1F9SA 1CQFA 1LABA 5EGTA 3PSIA 2MO0A 1JB3A 4N8FA 2PNHA 1QZHA 4GLVB 3S1QB 4S3SA 4QCLA 4A93H 5IGDA 2UUCL 1LTTD 3R3OA 2ATWA 3VYRA 4AIMA 2MUYA 2QDBA 3PUWA 1YI2A 3CCRA 4OX9L 4P71A 1UE6A 3OTOL 4FF1A 3VYTA 1VMCA 2DY8A 1B4OA 4RFBA 2A69C 2B2YA 5EJWA 1LV9A 2Z4HA 3QIAA 2K28A 3OOCA 1ONLA 1FGBD 2QKIC 2B2WA 2Y0SG 4G7ZC 5EKLA 1PZKD 1G6PA 1PRTD 2JA6G 2R7ZH 2AHOB 4QY7A 3S1RH 4DV5L 3AB9A 2PQAA 3DEPA 2BCOA 3BU2A 1Q7YC 1K0SA 4KN4C 3A74A 4BS9A 3RZDB 2UXCQ 2WAQB 3KYHC 5IY0A 4YHHL 1AH9A 1IBMQ 4K2LA 4A3MH 2F3IA 3IRBA 4P72A 1H9JA 1IW7C 3OMCA 3PUZA 1ENAA 1IYJB 1WJJA 1JB7A 1V8QA 2KHSA 1STGA 3LWEA 1B3QA 3I4NH 4IQZA 5A2QE 4A3KH 1WTRA 2CW0C 2PMZE 1I94Q 3BG3A 4MZ9A 1BCPD 3TRZA 4AYBE 1VF5C 2NN6H 4WORA 4IZ8A 2CQAA 1ZKOA 1EOVA 3RN2A 1PH1A 1SRUA 4BA2I 2K5NA 3A8KE 1UE7A 5I6WA 2E5LL 1SMXA 4O0AA 1S5FD 2KCMA 4OXPA 5KNCA 4DXFA 3CAMA 3PO3H 4JI8Q 3EN2A 2KA7A 1N34L 3H0GG 2BDNA 1YEZA 3K5OA 3C46A 3DWPA 4OO1G 1EYCA 1S72A 2L11A 5IP9H 2RHSB 1SDFA 1E7ZA 4DV2Q 1I6HB 3T13A 1K8AC 2VQFL 1J8IA 1AE3A 1JJGA 2F0IA 5LMUQ 4X66L 3PUXA 2B2VC 2K6AA 4RHSA 3VDYA 3I4MH 1QNUA 3FHWA 3UE1A 3T53B 5C5MA 1I4PA 5JJIA 3ITPA 4B08A 3MVVA 2F0JA 1AEXA 1I4RA 5M3FH 3PO2G 5M9OA 3MFYA 2J0TD 3I56A 1HQMC 4KY7A 1ZXTA 2R93H 1H95A 4XIGS 3S16B 1HRJA 3CHBD 2EY6A 1N33L 1LTGD 2B3GA 4HR7B 1PTOH 1PH2A 3D3RA 1EYDA 3NTKA 1WTVA 2L15A 1NTGA 5EKIA 1TWCB 2DY7A 2JA8H 3BVMA 3T1YL 5C44H 2JEAI 2UXDL 1XMOQ 4IPDA 3PCOB 1PH3A 4RH6A 2PNRC 3Q23A 1EYGA 1JJCB 4ZAIA 2H4OA 2PQAB 2KCNA 3S15H 1QE6A 2DGYA 3S24A 4FNFA 4IN3A 4X64L 3H15A 2F0UA 3EBEA 4NDXA 5ELEA 1B8AA 4JYAQ 1MIUA 4HCEA 1KAWA 2KHIA 2L4NA 2TMPA 1Y1VB 3A55A 4IUUA 2K01A 4R4CA 1TQOA 1WYDA 3MZ5A 4LAAA 4QMGA 2EDGA 2QGQA 2L9HA 1CA6A 2J4XA 3S2HB 3BJUA 4JC0A 1FR3A 3NELA 3NUCA 4TVAB 2ZTEA 2Q8TA 4KV6A 4AYBG 3DLLA 3ZYYX 2NZOA 5C3WA 5JVH3 1GUSA 1EY9A 3FDTA 3D8GA 2B2YC 5KEEA 3T1HQ 3R2TA 1U5KA 1K83H 2R61A 2FMMA 2B2WC 1S40A 3GTPB 4DR4Q 4YIJA 1VQOA 1F9QA 1YVCA 5C0XI 1VQFA 4DV6L 1O7ZA 4WJ3M 1RD9D 3I4NG 1DOKA 4JBWA 1LTBD 2EPBA 5JEAG 4BXXH 2AQ2B 3K5LA 4A3KG 1KC8C 1XNQL 3NP8A 2NN6G 3NE5B 1NAPA 3Q0AA 1Q86C 2KEDA 4RMFA 3VR2A 2AUJD 1VS0A 3HFZB 4IFDH 2OF1A 1A63A 1ML0D 4U68A 2UU9L 1KTKA 3U58A 2OQ0A 2JXMB 3HOWH 5M5YH 4I65A 3PO3G 1X65A 3FVQA 5CC4A 1VQHA 1CKOA 1Q1EA 3DM1A 4JCVE 3IKJA 4RGMA 3CCUA 2V4DA 1CSQA 5IODA 2GN5A 2IW3A 5NUCA 1VQ8A 2ZM6Q 3FRPB 3V2TA 2N49A 4DNTB 4Y7NH 2NYZD 2HQLA 4X3KA 2TSSA 3J80c 3KLWA 1WTHA 4H13C 1B70B 1KRSA 2EXZA 2PZWA 5IYBG 3I4MG 4JI7L 4TSSA 4RGTA 2VXWA 3SHLA 3TREA 4A3EH 1OTCA 4GZYC 4PMWA 1VQGA 2ID0A 1GD7A 1LT4D 5JJZA 1PFBA 4KI0A 5L37A 4POGA 1Q82C 3S2DH 1RJTA 3FKIB 4X3UA 3GTJB 4TQUS 4N8X1 5EQ0A 1SJHD 2VL6A 3I2ZA 3ND8A 3ONAB 3HOZH 1PH6A 3FPPA 4KKUA 4DV0L 2RDHA 4LF4Q 3P20A 2K75A 1TU2B 5HURA 1BXTA 3S1NB 3DM3A 3MAQA 5H1SE 1O78A 2GVAA 1HA5A 3MWYW 3WOEA 4DV1Q 1XJVA 2LMCB 2MHVA 2BE5C 3QWNA 2JA8G 2IWHA 1CKNA 5KYIA 3HZXA 5C44G 2JA5H 3NBHB 4DR5Q 4A3FB 4JI4L 2B63G 1GJXA 1JMCA 4A76A 1AZQA 2EY2A 5IYDG 2Z6BA 3OIPA 4LF8Q 3H3VC 4OWXB 3W1BA 4LFBL 2HIVA 5IP7H 5J39A 2RSOA 3PF4A 1U4MA 2MP1A 3HOYG 1SJED 2JN4A 3RMHA 4JBJA 2CHBD 3BYTB 3UDFA 1KDBA 4DR2L 4K14A 1TR5A 4A3IH 4PZ8A 1SEBD 5CV7A 4ME5A 2O5IC 1IZ6A 5IGBA 3D0FA 5G3LD 5FJ8H 4LFAQ 3DXJC 3KJPA 1CQVA 4B3MQ 1FNUA 2A6HC 2F1MA 1BBXC 1HNXQ 2B2UA 5M5WH 2EZVA 1HTPA 1PRTB 4JI6L 4NB3A 3R2IA 5JPNC 4MN3A 1SE8A 5IE8A 4NP5A 4WFN3 1ASYA 2IL8A 3TEHB 1YNJC 4C3JH 3H94A 5D65A 2PZTA 5CV6A 3G6EA 3R93A 2A73B 5DNFA 3ULJA 2BDOA 3DUZA 2E2IB 1L0YB 2XRSD 1VQ4A 3J81i 2EYHA 4R1JA 3CCJA 4LF5L 1BCPB 1DJRD 3D4WA 1KQSA 4H02A 1KABA 1GOZA 3SDZA 3H6MA 4LF6L 1QJOA 3S1MH 4CJ0B 5JAVA 2CWPA 1SNOA 4C3HB 5DEHA 5C4XG 2G5DA 3QR8A 1PRTC 1GM5A 1PH9A 1I50H 4XQJA 1B44D 1EWIA 1RCVD 4GKJQ 4A3EG 1CHPD 1FD7D 1EIGA 3RUZA 4UAIA 4DUZL 1CKNB 3MTSA 1ENCA 4I7AA 4LUOA 3HKZB 3HOUH 5IOCA 1QILA 2R3ZA 1ESRA 4OEMB 5M5XH 1HZ9A 1A2UA 3HOZG 1BCPC 1SFOB 1XNRL 2K52A 3G6JB 2DNCA 4O2DA 5KYLA 1VQKA 2X69A 3JAML 3C1FA 2O4XA 3B6YA 1PFSA 2EY5A 2KVMA 3VR3A 1R4QB 5DM63 2VS1A 3SK4A 3P1HA 1CHQD 1E22A 3GTKH 2JA5G 2F0OA 1D5MC 3M9BA 2N8NA 2L55A 4MTKA 2EYOA 1HFGA 2IT1A 4FP5D 2NVXB 1X54A 1TWAB 2M9VA 5IT9L 1TXYA 4Q0FA 3SE0A 3KJOA 3S17B 3O13A 3OYYA 1E2ZA 1U4RA 3CQZH 2E2JB 2NVYH 1H9MA 2BA1A 1EZ8A 2J7ZA 2HCCA 1G8ZD 3OMGA 1ZYRC 1Y1WH 1VQNA 2JA6B 3J7AV 4WJ4A 3MXNA 3NQIA 4N9PA 1IYVA 3TP6A 1WTPA 3KF6A 5IWAQ 1IBKQ 2HDMA 4A3BG 2ICEC 4XTCS 3K5MA 1ICWA 4P74A 4DV4Q 5AFWA 4J8QA 4IO9A 2XWJB 1FL0A 2A68D 2UUAL 2DN8A 3A8IE 4PZ7A 1LYLA 5TSSA 3TZDA 4KLKA 3PF5A 2A74C 2LFNA 4JI5L 3GTGB 4B3SQ 1STNA 1NUCA 1Q81C 4OWWB 1JOKA 1G2TA 1VQJA 3RNUA 3TBIB 3CCVA 3QJYA 3S14H 4FXGC 3K0XA 1A8VA 1W6JA 4C3JG 1DOMA 2K33A 5KRUA 1QUQA 3KF8A 2WACA 3ND9A 2B2UC 1B7YB 4H7BA 1S5ED 4OX9Q 2CH4W 3J80E 5C3XA 1GXDC 2K50A 3U50C 2X6LA 4MHEA 3H0GB 2Z1CA 1BBWA 1EYAA 1EEID 1EEFD 3OW2A 4NXNQ 1QVGA 4DV5Q 5C0XG 2CH4A 4EGVA 2NWGA 4L5RC 2Q2UA 4A4IA 4YHHQ 4BY1B 1EY4A 4KN7C 2R7FA 2I07B 5C4JB 3CC7A 4DUYL 4XYQA 1J5EL 4CDFC 1BO0A 3I91A 5CR3A 5IGGA 4BY7H 4OO1H 2E2HB 2JYOA 2FFKB 1EOTA 1NSNS 1HTLD 4L6TB 3KFUA 1KAAA 2CFMA 3HOUG 2OQKA 1D8LA 3PO2B 4X65L 4QIWE 1TS3A 2WINB 1K8GA 2K7VA 1ASZA 5LL6X 1YIJA 1TWHB 2EVBA 1SMYD 2E5LQ 3M4OB 1E1TA 3X3NA 2E76C 5GAHC 3CC4A 1TY0A 2XRQD 3WWVA 4FO2A 1F2YA 1YHQA 2EXDA 1UAPA 2DJGC 2EYMA 1HR0L 3TS0A 2KJXA 4CBVA 3OHXC 4A93B 1RDPD 3KF6B 1CUKA 4CDCC 4PNYA 1MD2D 2VQFQ 4XQQA 5GADC 2UUBL 3M3YH 4K6DA 3DEOA 3D4RA 3HOVG 3CD6A 2PW5A 4K5WA 2HD3A 4C2MH 4NPSA 2PMZB 1W6KA 1L0XB 1G2SA 4R4IA 5CORA 1XTCD 3T56B 4K0KL 4AYBB 3CCLA 1YNND 1Y1WG 2R7ZB 1DCZA 1X3GA 2B8GA 2V1CC 1AP0A 1T5EA 5E4XA 1QUQB 1U9RA 3KF8B 2HQEA 5C5LA 4HJ9A 4A3MB 3VR5A 3F2CA 2WV6D 4B9WA 2HCIA 1CZGA 1HQRD 2KOLA 1KD1C 2EYJA 1DOLA 3C2PA 3I4NB 3BDLA 4DF7A 4DK6C 1CT1D 4JI0L 1A3TA 1EY0A 1O7LA 2R7DA 3T1YQ 3K7AH 4A3KB 4LF7Q 3QOLA 1SR3A 5GQOA 4JI1L 2UXDQ 2EY1A 4KK7A 4B3RL 2A6ED 4EQPA 4C1NI 3KLSA 1D7QA 4ZCKA 3OWEB 3AEVA 3S1QH 4OONA 3RD4A 1LUZA 1DYQA 4GN5A 2L0CA 4X62L 5CV9A 4X64Q 1KNAA 4M1UB 3J81c 5JEAH 1I5FA 1GUOA 3N52A 4LFCL 3CMAA 2QEXA 1CKMA 1QB5D 3F8TA 3PO3B 4FVMA 3SEBA 1SE4A 1D5ZC 1SROA 4HMIA 2GVBA 4YWKA 4H44C 4RAUC 3K80C 1GHJA 5C3EG 2X6GA 3M7NA 4KJNA 1XYIA 1STEA 4YY3L 3K0YA 3PV0A 1C8CA 3AYHB 1D6EC 5CBAE 3I4MB 1N32Q 1YHBA 3GV3A 1OXUA 1ILQA 2SNMA 4IFDJ 3A7AB 1X32A 4JI3L 4FF2A 2AWOA 1QVFA 1SNCA 4BY7G 1AZPA 4UP8A 2KEEA 2NUCA 1UE5A 3BZCA 3UDIA 1P16A 5M3FB 1SNMA 3GTMH 2ZXOA 4K8JA 5IYBH 4JBKA 1PLFA 3CCQA 4DR6L 2R93B 3HG9A 4CJ2C 2VUMG 1CTMA 3MXGA 5JVG3 1PTOB 2UU9Q 4OIJA 4PMCA 3T4AC 2OT2A 4KKSA 4BA1I 4C1NK 4DV7L 1D2BA 4DAYA 1VF7A 2JA8B 5C44B 5EKKA 2NVQH 5FK9C 3VA7A 1I4HA 1WCMH 4C3IG 4HIKA 2YU9H 2PI2E 4OL7A 1KXLA 1KDAA 1JOOA 2FHTA 1G291 1KRTA 4ID6A 4QL5A 2XGTA 3S15B 5M3MG 4OHJA 4B3TQ 1VQ9A 3RZOB 2CVRA 3H09A 4CKCA 3A54A 4BBRG 1U4PA 1TY2A 2RA4A 3K81C 4KHZA 1X3PA 2ASBA 2B63H 2PPBC 4JI2L 5BR8Q 1PA6A 2RKSA 4CHTB 1L1OA 5IYDH 1E3PA 4F88A 4KY5A 2NTTA 5CBEE 4HTHA 2PCFB 1PTOC 1EU4A 1Q8KA 3AU7A 1RTNA 4I7ZC 4RCNA 2UXCL 3HOYH 1K83B 3K6OA 2M2LA 2IX1A 1IBML 4LF9L 5LMNW 4QQBX 3I8ZA 3CRLC 3Q22A 4KMUC 1LTID 1RODA 2G9HD 1WI5A 4UDUC 2K5QA 4IPGA 4A3DH 5FO9B 4A3LH 1C9OA 1GHKA 2F0NA 1PH5A 1I94L 5ELBA 4CJ1B 4OELB 1L2FA 3U4ZA 1SYGA 2I5HA 3NEMA 2IX3A 4LWCA 4DK3C 4J1MA 1QOHA 4APVA 1I4QA 4H0LC 4LK1C 3NQTA 5J1ZA 2BOSA 4OGQC 5JPMC 4TKOB 3M85A 1DM0B 1X6OA 2EYFA 3HOWB 5M5YB 3P7JA 1HA6A 2F52A 1PYBA 2F0GA 1EWCA 2E2DC 4JI8L 1UEBA 1VQ6A 2WB1E 3QG1A 1M90C 1JWSD 3S2HH 1O7YA 3IL8A 1EIYB 2EIFA 2WP8J 3C3LA 3GV6A 4RGNA 1SYDA 1GUWA 1HR0W 5BN4A 2R6GA 2AQ1B 4A75A 4Y7NB 4DV2L 4HJAA 5JJLA 3UDGA 1PV4A 5A2QL 1Z9FA 3KBGA 2YV5A 1Y14B 4GNXA 2D5DA 2EOTA 5LMUL 3I73A 4K8IA 5FKAC 4A3EB 1KLGD 2VQEQ 3CCSA 3GTPH 3HS0C 3A0JA 3X3MA 4DAYB 4YCWA 1H9SA 2OTLA 4JI6Q 3G4SA 4IPHA 5FOBB 3GTOH 3TSSA 5C4XH 3L3OC 1JJ2A 3QOJA 4RKLA 3S2DB 1STBA 2R92H 4GLAC 4CDEC 1NCVA 4MTNA 2EYPA 3KBXA 1WTOA 3HOZB 4POFA 4L5TA 1TS4A 4CGYB 1WFQA 1TKWB 4V0BA 4HJ7A 2AWNA 4EQNA 3BDCA 1C7YA 4YWMA 2PYKA 4LF5Q 2YTVA 4ALPA 1EQRA 2SOBA 2JA5B 3VR4A 1L1OB 1WCMG 4KHVA 5HGQA 2F0VA 2VW9A 1F2ZA 1XMOL 4LNQA 4LF6Q 3AFQA 3T51B 1X3QA 3SGIA 1UNSA 4R4QA 1NNXA 4YCVA 3GO5A 1B50A 2HUGA 4P2CB 2ES2A 1R4PB 2CWAA 4IJHA 1Z6HA 4R4TA 5HY6A 1BVSA 4ULLA 2HIXA 2PO4A 1K8MA 2EQSA 3I55A 2EYLA 1B3AA 2K5HA 4A3IB 5E3FA 1SLJA 4GLXA 3SR1A 1IW7D 4GN4B 2VZAA 1FNVA 3PMFA 1QG7A 3RLNA 1SYFA 3FEWX 1XNRQ 3T1HL 1PH7A 1Q8IA 1IBLQ 3J81E 3D31A 4JOIA 3HP3A 5EPJA 1L1OC 2RDFA 5M5WB 4DR4L 4NXMQ 2CW0D 3HOXH 4JV5Q 5AJ3Q 3GDEA 4A3BH 2F4VL 2WB1G 4LMQD 4A3DG 2B39A 1MKHA 4DN4M 3JAMi 5E7NA 3NK9A 4DNIA 4A3LG 1K9MC 1LO5D 4C3JB 4X3SA 4NKLA 1DD2A 1STHA 4L63B 4DXGA 2CCZA 1ZEQX 2QDLA 2IHFA 2JQOA 4GNXB 1GO3E 5FO7B 1EU3A 4JK1C 4XYOA 5KNDA 1WTQA 4KHPL 1K3RA 2D0OA 1XPUA 1H9SB 4FF3A 3F1ZA 3CKIB 4KD3A 3T16A 3I7FA 1HUNA 3S1MB 1BF4A 4U673 1OXTA 1YNNC 1PHJA 2A19A 4GKKL 4IUPA 2UUAQ 1TS2A 3BVZA 2F0QA 4A3JH 2QW7A 1B53A 1A0IA 1TIID 4DK1A 1I50B 2K4KA 4DFAA 5EPLA 2F0MA 1HUMA 2Q8RE 1PH4A 2KQ3A 4IUTA 1LTSD 1K0RA 4Y52H 5C0XH 2KCCA 3JC66 1KDCA 2JP1A 1VQDA 3HOUB 5EBCA 2WKCA 4R9WA 4OWTB 2R92G 1MGSA 3PUYA 3CXCA 4GNXC 1YNXA 1BUVT 1VQPA 2RF4A 3GD7A 5M5XB 2O5JC 3OSOA 4L5QA 1VMPA 3E5SA 1E2WA 1VCIA 1EZ6A 2LXKA 1LT5D 5HGTA 1A3VA 2SEBD 4PV1C 3CCMA 3W3AA 3L2PA 1J9OA 2ZT9C 2H1EA 3LWUA 4HSPA 1EUJA 3GTKB 2XVSA 3ER0A 3GTLB 1FGUA 1ILPA 4DR5L 2HHHL 1T5XD 5D3DA 4EQOA 1HZAA 1H9RA 2L5TA 4G4KA 1UWVA 4ODGA 4DUYQ 4E6IA 1JR0D 1QCBD 1J5EQ 3M7GA 1II3A 4IUVA 1EY6A 4L5SA 2ICIA 3CQZB 2F0PA 2NVYB 3J7ZC 1LTLA 3J81j 4FXDA 4HAEA 1RTOA 1AN8A 2LY7A 2F4IA 1Y1WB 4XT3B 3SK5A 4WRDA 2FMCA 3DHQA 1ICFB 1TWFH 3HOVH 1SN8A 3I3CA 1TWGH 4DU9A 2F0DA 3FKIG 1QNKA 4DR7Q 3GP7A 1A62A 2Y0SB 1A6XA 2VB3X 4TRDA 1N9WA 4G7HC 5FLXc 4XDXA 4FF4A 4A3GH 3HOXG 1V9PA 4XQNA 5FLMH 5I6YA 2H5XA 4IOAA 3CMEA 3Q6SA 3S14B 3E0JA 1BQQT 1F9PA 4DV3Q 4JOIC 1E2VA 4KJOA 3AMUA 5CGKA 3AQQA 2UUBQ 5BN5A 1HHVA 4ZK9B 4BBSH 1KL9A 3EJIA 4ME3A 4Q5VA 3ERSX 5DM73 5GROA 2UUCQ 1PZID 4IJLA 4K0KQ 1R9TH 4QIWB 3OWFA 1I3QH 3I4OA 3E0EA 2ENBA 1S5DD 4RA8A 2OTJA 4G7OC 3OTOQ 4EX5A 3GQBA 1BOSA 1CK1A 2MNAA 3NWSA 3GTQH 2A5HA 4A3JG 3I70A 5J3BA 2L12A 1GUGA 4PQXA 4BY7B 5C3EH 5IIFA 5JEAJ 1PVOA 4JI0Q 1I6VC 3N6RA 4K5VA 5K5PA 4JI1Q 1PFMA 2YTXA 3KLSX 5LMNL 1VQMA 3QB3A 1VQAA 3AFPA 3STBD 1SNPA 3HKSA 1WOCA 2FJ2A 5K36G 2Q2HA 2K14A 3J7AF 4X62Q 5I2YA 3OW7A 3FP9A 4PZ6A 5DLQE 1QVCA 1YJ9A 3EVQA 5IGFA 1N8RC 1D1IA 4LFCQ 1KHIA 3BZDB 1LLRD 1V43A 4K5XA 4EQ5A 2PI2A 3TP8A 4L8JA 4WJWA 5COYA 3TN2A 1YITA 4DR1L 3E6ZX 1JE5A 1RKNA 2C35B 2VUMH 2JA7H 2I5MX 4MNOA 3F2UA 1HZBA 4YY3Q 3VYSA 2HDLA 4HSVA 4ZYSA 1A2TA 3M3YB 4QUFA 1TT2A 1X55A 3BZKA 1N34Q 4C3IH 4HCSA 3I72A 5F2DA 2LKVA 2K04A 3MXNB 2UXBL 4C2MB 2I46A 3NHHA 4G57A 2RBMA 5M3MH 4RKBA 1Y8NB 3IFTA 2AUKA 3S9WA 1M1KC 2Z9HA 1PTOF 5T1IA 3SVMA 4BBRH 4X66Q 1S5CD 4DR6Q 1IBKL 4ZRZA 2Q2IA 4DR3L 1CSPA 1M4VA 1F77A 2N88A 3HGBA 1SXTA 3J7YW 2NVTH 1JWMD 3UDXA 3PIOA 5JJKA 1VQCA 4A3GG 1A15A 3S1RB 3MC0B 2K5DA 2N55A 3JAMc 3K7AB 5FLMG 1C48A 3MHBA 1Y8OB 4LUVA 1K8OA 3ULLA 2MJ8A 1N36L 1EQVA 3PQIA 1N33Q 2ZJRA 2F3VA 2KENA 1YHAA 2Q8IB 4JPBW 1HNWL 4UP9A 3ULPA 4BBSG 2EJFC 5IT9c 2XSCA 5A35A 1JORA 3A5ZB 1MJCA 4JI2Q 3MA2B 2HT1A 5D14A 3R8BA 4BWGB 5LL6S 3V96A 4IFDI 2EJGC 3CF5A 1HNZL 3DWQA 5ISRA 2Q2TA 4IUQA 4NXNL 2AKWB 4P75A 1BBUA 1NR4A 1VQLA 2OEOA 4HMJA 1F9RA 1G51A 1MSHA 1NMGA 1VQEA 2F0EA 4IURA 4HIDA 3KLRA 1CZWA 2JK8A 3G71A 1HH2P 4LF9Q 1B2TA 2Z4IA 3V05A 4PMBA 1ET9A 1HPCA 2FXQA 1XMQL 3W2DA 2GA4B 1X56A 1HXYD 4C56C 2IHEA 4GS3A 1EY8A 3RZDH 5DAUA 3J80L 3GTMB 1PZJD 3E3XA 4DV6Q 2XWBB 3LGJA 1W2BA 1E24A 1VQBA 2F0TA 4JBMA 3MXPA 1UUPA 4DNRB 5CYUA 5C4HA 1JWUD 1XNQQ 1BDOA 5KIXA 2NVQB 2WFWA 1WCMB 2YU9B 1FJGL 4AQYL 5FO8B 3H3VI 3LNNA 3NSWA 1SE2A 3Q24A 2DNEA 2JA7G 3W1GA 2E8GA 2WAQE 1TVXA 5EBDA 3U4VA 1PFNA 2AMCB 3K7UC 1NE3A 1HCZA 4O1NA 4BY1G 2E74C 5CV8A 1F2MA 5I4DA 5FLXE 3M4YA 1CFMA 2BH2A 1ZYRD 2B63B 1D5XC 4CKBA 2XNAC 4DKAC 2QILA 1I6HH 1D1KA 1SE3A 1AW7A 1JCKB 2JSOA 2ZXPA 1A3UA 5IGCA 3ZJYC 2Z6KC 4JI7Q 2JEBI 3M4QA 1SYBA 3HOYB 1Q46A 1SSOA 3LX0A 4QB4A 3U9SA 3D4DA 2ZTCA 3L9AX 2WB1B 4A3DB 1XWEA 4O42A 1AFPA 2CQOA 1QWYA 3TDQA 4LF7L 3PIO3 2B2TA 2BA0A 1K3BC 2O2LD 3MEHA 4DV0Q 3S16H 3KDFA 1IHZA 1XTDA 2EE1A 4A93G 3RLOA 1W3SA 3RZOH 1TWCH 4N9TA 3I90A 1Q12A 3CC2A 4JI4Q 1STAA 5CMDA 1JE4A 1BR9A 3A5UA 3NBHA 4QF4A 4LFBQ 1EQTA 2R7ZG 1LT6D 1I4GA 3NBIA 5IYCH 1Y1VH 3C1EA 3KOJA 1SYEA 2DUDA 1O80A 1KIXA 1EL0A 2MPMA 3F2BA 4J15A 4A3MG 1X3FA 1N32L 2QCPX 4V190 1X3EA 4DR2Q 3Q8DA 2F4VQ 3GTOB 4ZUJA 2ZJPA 1LM0A 4F8MA 3CPWA 1PRTF 5C4XB 4DAVA 5KGUA 3TZUA 2IJ0A 2R92B 1KNEA 1IKLA 1V1PA 2WAQG 5JOBA 3MXUA 3VR6A 3SK8A 4ZLTF 4EVOA 1WD0A 2A68C 1RIPA 4ABNA 5EPKA 2F0WA 2I5LX 4NMZA 1TS5A 4QUCA 3G48A 4KHPQ 1IYUA 2G9DA 2F0FA 5I9OA 1BCPF 1V1QA 2K5VA 1NJIC 2K32A 5C0XJ 1Y8PB 2YTYA 4IUNA 1IXRA 2VY3A 1KLUD 3DWAA 1MHWC 1CA5A 1G6ZA 3U9OA 4ZKCB 5I2XA 5ELFA 5IP9G 2A1AA 4GKKQ 5C4ZA 3PIPA 4UP7A 1M8AA 4B3TL 2IY5B 2PZUA 1G91A 2RVLA 2RHQB 1JICA 4JVZA 3DMUA 1FYCA 3JAME 1EFWA 1B9MA 4JW0A 4Z9CB 3CCEA 5BR8L 2K1BA 2RDGA 5EAYA 2A69D 2QA4A 1O7IA 3BYYB 2B29A 3PUVA 3NTIA 2A8VA 1GUTA 4JYAL 2SDFA 3KDFB 2VNUD 5M3FG 4IOCA 3UI2A 1GVPA 4DGZA 2LXJA 3NTHA 4HJ5A 2F3WA 2C9OA 2D62A 3SK6A 3STBC 2R93G 5FLXL 4DUZQ 5IT9E 3H3VH 3BVGA 3HOXB 4A3BB 4KY6A 1LTAD 2MGSA 3OPOA 3IAYA 4QGUA 3FKIH 3GTJH 3NWTA 4LW1A 4GOPA 1NY4A 2HHHQ 4YWLA
chains in the Genus database with same CATH topology
5ELDA 4J6HA 4KKTA 1SMYC 4B9XA 4CKEA 2XN9C 2B2TC 1JOQA 1SBBB 2SNSA 2KECA 1Y69U 1V1PB 4XT1B 5C6AA 2NZ1D 1EIHA 5BN3A 1DONA 2PW7A 4A3JB 1MI2A 1EWHA 3WDNA 1IL8A 4K6LA 1EY7A 3CRKC 2KUMA 4ZUIA 2ZXRA 2VB2X 2F0LA 1SYCA 1LTRD 3OIQA 4RCOA 4OO1I 4IFDG 1WTWA 3KK7A 2K5WA 3ERQA 2XIWA 5E1FA 1IKMA 2IPKD 4F7XA 5K36H 3NPPA 1ET6A 4ZKBB 1S5BD 3K5NA 2A6EC 3NXWA 2EJMA 1ESFA 3G7LA 1SNDA 2NB0A 1XXGA 3TMEA 3L7ZC 1LT3D 4R8IA 2NBFA 1Z47A 4NW2A 2E75C 1ENFA 3K58A 4MIUA 1SAPA 1CM9A 1SNQA 4KD4A 3PIP3 3MFGA 1Q1BA 2K03A 1H9KA 4RWSC 1PTOD 2YYZA 3WOFA 2FINB 2M00A 3K57A 4OIKA 1OXXK 1TWFB 3HOVB 1PMRA 1B9NA 1TWGB 3EA6A 4DAPA 5KNBA 4X3TA 1RHPA 4A3GB 3P75A 4IALA 2JE6I 2PQEA 2L1BA 3URYA 1NR2A 2AQ3B 2F0HA 2OXPA 1VDZA 4RHRA 1JQYD 4BBSB 1UEAB 2QEJC 1PXUA 3H91A 3SXHA 4FYDA 2NTSA 3IFDA 2Z8LA 2D2CC 2B8FA 4M8AA 1R9TB 1WD1A 1I3QB 1MBYA 1MSGA 1RF2D 1FNWA 2IX0A 3J81L 3BS1A 4XXEA 1OXVA 1Z7TA 1Q90A 3GTQB 1PDQA 2WIIB 3EFXD 2NN6I 5T1GA 4F87A 3RLFA 5C3EB 1F2LA 4DK0A 3D6CA 1OXSC 2C5CA 2K05A 1PYWD 2RSNA 3A8JE 3HRZC 5G3LF 1EFID 5D3IB 4HEDA 3BDOA 1V1OA 3A7LA 1OO9B 1S4ZA 4KTAA 2QF7A 4R8NA 4ZQ3A 4HN7A 3I4LA 1WTXA 2VUMB 2JA7B 3EROA 3CU7A 3FPUB 2BE5D 3K59A 1LACA 1EY5A 1Q3LA 5CV4A 2RQXA 3TP7A 3D6WA 3FMCA 4C3IB 1U4LA 1E0BA 1I4XA 2B2VA 2F03A 5CV5A 5M3MB 3TP5A 2D9UA 1C4QA 5IGEA 4C3HG 2F0SA 3VYUA 4BBRB 3QO2A 3KUPA 1JC7A 1XX8A 2F0KA 1STYA 1DXMA 2WKDA 5LHY1 2NVTB 1CI3M 3VA5A 3EQLC 5ELCA 1DZ1A 1B1ZA 5I9PA 5E4WC 5J22A 2A6HD 4RGOS 3A56A 4DA2A 4K2KA 4FXKC 4LJZC 3HEJA 2LS01 4ILWA 1WVLA 1GUNA 1HFNA 1YNJD 1BNZA 1F9SA 1CQFA 1LABA 5EGTA 1JB3A 3S1QB 4S3SA 4QCLA 5IGDA 1LTTD 3R3OA 3VYRA 2MUYA 2QDBA 3PUWA 4FF1A 3VYTA 1VMCA 2DY8A 1B4OA 4RFBA 2A69C 2B2YA 5EJWA 1LV9A 2Z4HA 3QIAA 2K28A 3OOCA 1ONLA 1FGBD 2QKIC 2B2WA 4G7ZC 5EKLA 1PZKD 1PRTD 3AB9A 3DEPA 2BCOA 4KN4C 4BS9A 3RZDB 2WAQB 4K2LA 1H9JA 1IW7C 3OMCA 3PUZA 1ENAA 1V8QA 2KHSA 1STGA 3LWEA 4IQZA 5A2QE 1WTRA 2CW0C 3BG3A 1BCPD 1VF5C 2NN6H 4WORA 4IZ8A 2CQAA 1ZKOA 4BA2I 3A8KE 5I6WA 1S5FD 5KNCA 4DXFA 2KA7A 2BDNA 3K5OA 3C46A 3DWPA 4OO1G 1EYCA 2L11A 1SDFA 1I6HB 3T13A 1J8IA 2F0IA 3PUXA 2B2VC 2K6AA 4RHSA 1QNUA 3T53B 5C5MA 1I4PA 3ITPA 4B08A 3MVVA 2F0JA 1AEXA 1I4RA 5M9OA 3MFYA 2J0TD 1HQMC 4KY7A 1ZXTA 4XIGS 3S16B 1HRJA 3CHBD 2EY6A 1LTGD 4HR7B 1PTOH 3D3RA 1EYDA 3NTKA 1WTVA 5EKIA 1TWCB 2DY7A 3BVMA 2JEAI 4RH6A 2PNRC 3Q23A 4ZAIA 2H4OA 2KCNA 1QE6A 4FNFA 4IN3A 2F0UA 5ELEA 4NDXA 4HCEA 2L4NA 2TMPA 1Y1VB 3A55A 4IUUA 2K01A 1TQOA 3MZ5A 4LAAA 4QMGA 2EDGA 2L9HA 1CA6A 2J4XA 3S2HB 1FR3A 3NUCA 2Q8TA 4KV6A 3ZYYX 5C3WA 5JVH3 1GUSA 1EY9A 3FDTA 3D8GA 2B2YC 5KEEA 3R2TA 2R61A 2FMMA 2B2WC 3GTPB 4YIJA 1F9QA 5C0XI 1O7ZA 1RD9D 1DOKA 4JBWA 1LTBD 2EPBA 5JEAG 2AQ2B 3K5LA 3NP8A 2NN6G 3NE5B 1NAPA 3Q0AA 2KEDA 3VR2A 2AUJD 4IFDH 2OF1A 1ML0D 4U68A 1KTKA 2JXMB 4I65A 3FVQA 5CC4A 1Q1EA 3DM1A 3IKJA 4RGMA 2V4DA 5IODA 2IW3A 5NUCA 3FRPB 3V2TA 4DNTB 2NYZD 4X3KA 2TSSA 4H13C 2EXZA 2PZWA 4TSSA 4RGTA 2VXWA 3SHLA 4GZYC 4PMWA 2ID0A 1LT4D 5JJZA 1PFBA 4KI0A 1RJTA 3FKIB 4X3UA 3GTJB 4TQUS 5EQ0A 1SJHD 3ND8A 3ONAB 3FPPA 4KKUA 2RDHA 3P20A 1TU2B 5HURA 1BXTA 3S1NB 3MAQA 1O78A 3MWYW 1HA5A 3WOEA 2LMCB 2MHVA 2BE5C 3QWNA 2IWHA 5KYIA 3HZXA 4A3FB 1GJXA 1AZQA 2EY2A 3OIPA 3H3VC 5J39A 2RSOA 1U4MA 2MP1A 1SJED 3RMHA 2CHBD 3BYTB 1KDBA 4K14A 1TR5A 1SEBD 5CV7A 4ME5A 2O5IC 5IGBA 5G3LD 3DXJC 1CQVA 1FNUA 2A6HC 2F1MA 1BBXC 2B2UA 2EZVA 1HTPA 1PRTB 3R2IA 5JPNC 4MN3A 4NP5A 4WFN3 2IL8A 1YNJC 3H94A 5D65A 2PZTA 5CV6A 3R93A 2A73B 5DNFA 2BDOA 3DUZA 2E2IB 1L0YB 2XRSD 2EYHA 1BCPB 1DJRD 3D4WA 1KABA 1GOZA 3SDZA 3H6MA 1QJOA 4CJ0B 5JAVA 1SNOA 4C3HB 5DEHA 1PRTC 4XQJA 1B44D 1RCVD 1CHPD 1FD7D 1EIGA 3RUZA 4UAIA 3MTSA 1ENCA 3HKZB 5IOCA 1QILA 2R3ZA 1ESRA 1A2UA 1BCPC 1SFOB 3G6JB 2DNCA 5KYLA 2X69A 3JAML 3C1FA 2O4XA 2EY5A 2KVMA 3VR3A 1R4QB 5DM63 3SK4A 3P1HA 1CHQD 2F0OA 1D5MC 2L55A 2EYOA 1HFGA 2IT1A 4FP5D 2NVXB 1TWAB 2M9VA 5IT9L 4Q0FA 3SE0A 3S17B 3O13A 1E2ZA 1U4RA 2E2JB 1H9MA 2BA1A 1EZ8A 2J7ZA 2HCCA 1G8ZD 3OMGA 1ZYRC 2JA6B 3J7AV 3MXNA 3NQIA 4N9PA 1IYVA 3TP6A 1WTPA 2HDMA 2ICEC 4XTCS 3K5MA 1ICWA 5AFWA 4J8QA 2XWJB 2A68D 2DN8A 3A8IE 5TSSA 3TZDA 2A74C 2LFNA 3GTGB 1STNA 1NUCA 1JOKA 1G2TA 3TBIB 3QJYA 4FXGC 1W6JA 4C3JG 1DOMA 2K33A 5KRUA 3KF8A 2WACA 3ND9A 2B2UC 4H7BA 1S5ED 3J80E 5C3XA 1GXDC 2X6LA 4MHEA 3H0GB 2Z1CA 1EYAA 1EEID 1EEFD 5C0XG 4EGVA 2NWGA 4BY1B 1EY4A 4KN7C 5C4JB 2I07B 4XYQA 1BO0A 3I91A 5CR3A 5IGGA 4OO1H 2E2HB 2JYOA 2FFKB 1EOTA 1NSNS 1HTLD 4L6TB 1KAAA 3PO2B 1TS3A 2WINB 2K7VA 5LL6X 1TWHB 2EVBA 1SMYD 3M4OB 3X3NA 2E76C 1TY0A 2XRQD 4FO2A 1F2YA 1UAPA 2EYMA 2KJXA 4CBVA 3OHXC 4A93B 1RDPD 4PNYA 1MD2D 4XQQA 4K6DA 3DEOA 3D4RA 2PW5A 4K5WA 2PMZB 1W6KA 1L0XB 1G2SA 5CORA 1XTCD 3T56B 4AYBB 1YNND 2R7ZB 1DCZA 2B8GA 1AP0A 1T5EA 5E4XA 1U9RA 2HQEA 5C5LA 4A3MB 3VR5A 2WV6D 4B9WA 2HCIA 1CZGA 1HQRD 2KOLA 2EYJA 1DOLA 3C2PA 3I4NB 3BDLA 4DF7A 1CT1D 1A3TA 1EY0A 1O7LA 4A3KB 3QOLA 2EY1A 4KK7A 2A6ED 4EQPA 4C1NI 3KLSA 3OWEB 3RD4A 1DYQA 2L0CA 5CV9A 1KNAA 4M1UB 5JEAH 1GUOA 3N52A 1QB5D 3PO3B 4FVMA 3SEBA 1SE4A 1D5ZC 4HMIA 4H44C 4RAUC 1GHJA 2X6GA 3M7NA 4KJNA 1XYIA 1STEA 3K0YA 3PV0A 1C8CA 1D6EC 5CBAE 3I4MB 3GV3A 1OXUA 1ILQA 2SNMA 4IFDJ 1X32A 3A7AB 4FF2A 2AWOA 1SNCA 1AZPA 2KEEA 2NUCA 5M3FB 1SNMA 2ZXOA 4K8JA 1PLFA 2R93B 3HG9A 4CJ2C 1CTMA 3MXGA 5JVG3 1PTOB 4OIJA 4PMCA 3T4AC 2OT2A 4KKSA 4BA1I 4C1NK 1D2BA 4DAYA 1VF7A 2JA8B 5C44B 5EKKA 5FK9C 3VA7A 1I4HA 4C3IG 4OL7A 1KDAA 1JOOA 2FHTA 1G291 4ID6A 3S15B 4OHJA 3RZOB 2CVRA 3H09A 4CKCA 3A54A 1U4PA 1TY2A 2RA4A 4KHZA 1X3PA 2PPBC 2RKSA 4CHTB 4F88A 4KY5A 2NTTA 5CBEE 4HTHA 2PCFB 1PTOC 1EU4A 3AU7A 1RTNA 4I7ZC 4RCNA 1K83B 3K6OA 2M2LA 2IX1A 3I8ZA 3CRLC 3Q22A 4KMUC 1LTID 1RODA 2G9HD 4UDUC 2K5QA 5FO9B 1GHKA 2F0NA 5ELBA 4CJ1B 1SYGA 2IX3A 4J1MA 1QOHA 1I4QA 4H0LC 4LK1C 3NQTA 5J1ZA 2BOSA 4OGQC 5JPMC 4TKOB 3M85A 1DM0B 2EYFA 3HOWB 5M5YB 3P7JA 1HA6A 2F0GA 1EWCA 2E2DC 3QG1A 1JWSD 1O7YA 3IL8A 2WP8J 3C3LA 3GV6A 4RGNA 1SYDA 1GUWA 5BN4A 2R6GA 2AQ1B 4Y7NB 5A2QL 3KBGA 2D5DA 2EOTA 3I73A 4K8IA 5FKAC 4A3EB 1KLGD 3HS0C 3X3MA 1H9SA 5FOBB 3TSSA 3L3OC 3QOJA 4RKLA 3S2DB 1STBA 1NCVA 2EYPA 3KBXA 1WTOA 3HOZB 1TS4A 4CGYB 1TKWB 4V0BA 2AWNA 4EQNA 3BDCA 2PYKA 2SOBA 2JA5B 3VR4A 4KHVA 2F0VA 1F2ZA 3T51B 1X3QA 1UNSA 3GO5A 1B50A 2HUGA 4P2CB 1R4PB 1Z6HA 4ULLA 2PO4A 1K8MA 4A3IB 2EYLA 1B3AA 5E3FA 3SR1A 1IW7D 1FNVA 3PMFA 1QG7A 1SYFA 3FEWX 1Q8IA 3J81E 3D31A 3HP3A 5EPJA 2RDFA 5M5WB 2CW0D 4LMQD 2B39A 4DN4M 3NK9A 1LO5D 4C3JB 4X3SA 4NKLA 1DD2A 1STHA 4L63B 4DXGA 1ZEQX 5FO7B 1EU3A 4JK1C 4XYOA 5KNDA 1WTQA 1H9SB 4FF3A 3CKIB 4KD3A 3T16A 1HUNA 3S1MB 1BF4A 4U673 1OXTA 1YNNC 4IUPA 1TS2A 3BVZA 2F0QA 1B53A 1TIID 4DK1A 1I50B 4DFAA 5EPLA 2F0MA 1HUMA 2Q8RE 2KQ3A 4IUTA 1LTSD 5C0XH 2KCCA 1KDCA 2JP1A 3HOUB 5EBCA 2WKCA 4R9WA 1MGSA 3PUYA 1BUVT 3GD7A 5M5XB 2O5JC 3OSOA 1VMPA 3E5SA 1E2WA 1VCIA 1EZ6A 1LT5D 5HGTA 1A3VA 2SEBD 4PV1C 3W3AA 1J9OA 2ZT9C 2H1EA 3LWUA 4HSPA 3GTKB 2XVSA 3GTLB 1ILPA 1T5XD 5D3DA 4EQOA 1H9RA 2L5TA 4G4KA 4ODGA 4E6IA 1JR0D 1QCBD 3M7GA 1II3A 4IUVA 1EY6A 2ICIA 3CQZB 2F0PA 2NVYB 4FXDA 4HAEA 1RTOA 1AN8A 2LY7A 2F4IA 1Y1WB 4XT3B 3SK5A 4WRDA 2FMCA 3DHQA 3I3CA 4DU9A 2F0DA 1QNKA 3GP7A 2Y0SB 1A6XA 2VB3X 4TRDA 4G7HC 4XDXA 4FF4A 4XQNA 5I6YA 3Q6SA 3S14B 3E0JA 1BQQT 1F9PA 1E2VA 4KJOA 3AMUA 5CGKA 5BN5A 1HHVA 4ZK9B 3EJIA 4Q5VA 5DM73 1PZID 4QIWB 3OWFA 2ENBA 1S5DD 4RA8A 3GQBA 1BOSA 1CK1A 3NWSA 2A5HA 3I70A 2L12A 1GUGA 4PQXA 4BY7B 5IIFA 5JEAJ 1I6VC 3N6RA 4K5VA 5K5PA 1PFMA 3KLSX 3QB3A 1SNPA 2FJ2A 5K36G 3J7AF 5I2YA 3OW7A 3EVQA 5IGFA 1D1IA 3BZDB 1LLRD 1V43A 4K5XA 3TP8A 4L8JA 4WJWA 5COYA 3TN2A 3E6ZX 1RKNA 3F2UA 3VYSA 2HDLA 4HSVA 4ZYSA 1A2TA 3M3YB 4QUFA 1TT2A 4HCSA 3I72A 5F2DA 2LKVA 2K04A 4C2MB 2I46A 3NHHA 4G57A 2RBMA 4RKBA 1Y8NB 3IFTA 2AUKA 3S9WA 1PTOF 5T1IA 3SVMA 1S5CD 4ZRZA 1M4VA 1F77A 2N88A 3HGBA 1SXTA 3J7YW 1JWMD 1A15A 3S1RB 3MC0B 2K5DA 2N55A 3K7AB 1C48A 3MHBA 1Y8OB 1K8OA 2MJ8A 1EQVA 2F3VA 2Q8IB 2EJFC 2XSCA 5A35A 1JORA 3MA2B 5D14A 3R8BA 4BWGB 5LL6S 3V96A 4IFDI 2EJGC 3DWQA 5ISRA 4IUQA 1NR4A 2OEOA 4HMJA 1F9RA 1MSHA 2F0EA 4IURA 3KLRA 1CZWA 1B2TA 2Z4IA 3V05A 4PMBA 1ET9A 1HPCA 3W2DA 2GA4B 1HXYD 4C56C 1EY8A 5DAUA 3J80L 3GTMB 1PZJD 2XWBB 2F0TA 3MXPA 1UUPA 4DNRB 5CYUA 5C4HA 1JWUD 1BDOA 5KIXA 2NVQB 1WCMB 2YU9B 5FO8B 3LNNA 3NSWA 1SE2A 3Q24A 2DNEA 1TVXA 5EBDA 1PFNA 1HCZA 4O1NA 2E74C 5CV8A 1F2MA 5I4DA 5FLXE 3M4YA 1CFMA 1ZYRD 2B63B 1D5XC 4CKBA 2XNAC 2QILA 1D1KA 1SE3A 1AW7A 1JCKB 2JSOA 2ZXPA 1A3UA 5IGCA 2JEBI 1SYBA 3HOYB 1SSOA 3LX0A 4QB4A 3U9SA 3D4DA 3L9AX 2WB1B 4A3DB 1XWEA 4O42A 1AFPA 1QWYA 3TDQA 3PIO3 2B2TA 2BA0A 2O2LD 3MEHA 1IHZA 2EE1A 4N9TA 3I90A 1Q12A 1STAA 5CMDA 1JE4A 1BR9A 3NBHA 4QF4A 1EQTA 1LT6D 1I4GA 3NBIA 3C1EA 1SYEA 1EL0A 1O80A 2MPMA 2QCPX 4V190 3GTOB 4ZUJA 4F8MA 1PRTF 5C4XB 4DAVA 5KGUA 3TZUA 2IJ0A 2R92B 1KNEA 1IKLA 1V1PA 5JOBA 3MXUA 3VR6A 3SK8A 4ZLTF 4EVOA 1WD0A 2A68C 4ABNA 5EPKA 2F0WA 4NMZA 1TS5A 4QUCA 1IYUA 2G9DA 2F0FA 5I9OA 1BCPF 2K32A 5C0XJ 1Y8PB 4IUNA 1KLUD 3DWAA 1CA5A 1G6ZA 3U9OA 4ZKCB 5I2XA 5ELFA 5C4ZA 1M8AA 2PZUA 1G91A 2RVLA 1JICA 3DMUA 1FYCA 3JAME 1B9MA 4Z9CB 2K1BA 2RDGA 2A69D 3BYYB 3PUVA 3NTIA 1GUTA 2SDFA 2VNUD 3UI2A 4DGZA 3NTHA 2F3WA 2C9OA 2D62A 3SK6A 5FLXL 5IT9E 3BVGA 3HOXB 4A3BB 4KY6A 1LTAD 2MGSA 3OPOA 3IAYA 3NWTA 4G7OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NUC A;  4K8I A;  1A2T A;  1KAB A;  4ZQ3 A;  1JOK A;  4B9X A;  1TT2 A;  3H6M A;  3C1E A;  3ERO A;  4TRD A;  1SYE A;  5EKK A;  4J6H A;  2F0T A;  2LKV A;  4K2L A;  3MXP A;  5F2D A;  4OL7 A;  5JAV A;  1KDA A;  1JOO A;  1SNO A;  2F0U A;  4NDX A;  5KRU A;  5DEH A;  1EY5 A;  3OMC A;  1ENA A;  3QOJ A;  3NHH A;  4G57 A;  1STB A;  4ID6 A;  2WAC A;  2RBM A;  4KD3 A;  2KHS A;  5CV4 A;  1STG A;  1U9R A;  4H7B A;  3TP7 A;  5KIX A;  3D4W A;  4RKB A;  3P75 A;  1TQO A;  3S9W A;  2HQE A;  4IAL A;  4ZUJ A;  3MZ5 A;  4LAA A;  5C5L A;  2EYP A;  4F8M A;  2PQE A;  4QMG A;  5HUR A;  1JOQ A;  5CV5 A;  5KGU A;  4B9W A;  2SNS A;  5C3X A;  3NUC A;  4KJO A;  3TP5 A;  2EYJ A;  5CGK A;  2F0Q A;  4KV6 A;  3HZX A;  5JOB A;  2F0H A;  5C3W A;  3RUZ A;  3BDL A;  4DF7 A;  5KYI A;  5IGE A;  1ENC A;  4EQN A;  3SK8 A;  1EY9 A;  3BDC A;  1A3T A;  1EY0 A;  4WOR A;  1EYA A;  2OXP A;  3EJI A;  2F0S A;  4IZ8 A;  4DFA A;  4EVO A;  2F0M A;  2PYK A;  3QOL A;  5IOC A;  2KQ3 A;  3D8G A;  2RKS A;  2PW7 A;  2EY1 A;  2SOB A;  2F0K A;  5KEE A;  5CV8 A;  4EQP A;  4RKL A;  1F2M A;  1STY A;  2EY2 A;  2F0W A;  4KHV A;  1KDC A;  2F0V A;  4KY5 A;  1A2U A;  5I6W A;  4NMZ A;  4HTH A;  1F2Z A;  5C6A A;  4YIJ A;  3OWF A;  5J39 A;  1EY4 A;  3MHB A;  3VA5 A;  3SXH A;  1EY7 A;  3T16 A;  5CV9 A;  5KYL A;  2ENB A;  2F0F A;  3C1F A;  2O4X A;  1EQV A;  5I6Y A;  5I9O A;  3OSO A;  5CR3 A;  2EY5 A;  3E5S A;  5C4H A;  2F3V A;  3SK4 A;  5IGG A;  1EZ6 A;  4IUN A;  4ZUI A;  5I9P A;  1A3U A;  2F0L A;  5IGC A;  3P1H A;  1EYC A;  1NSN S;  1SYC A;  3U9O A;  5J22 A;  5HGT A;  1A3V A;  2F0O A;  1KDB A;  1SYB A;  3NP8 A;  4K14 A;  4K2K A;  1KAA A;  1TR5 A;  3T13 A;  5C4Z A;  4HMI A;  2EYO A;  3HEJ A;  3LX0 A;  5IIF A;  2PZU A;  5CV7 A;  4ME5 A;  2F0I A;  4QB4 A;  5IGB A;  2OF1 A;  1JOR A;  2F0N A;  3D4D A;  4K5V A;  3DMU A;  4KJN A;  5K5P A;  2EYL A;  1SYG A;  3ERQ A;  3QB3 A;  5E1F A;  5E3F A;  3SR1 A;  5C5M A;  4I65 A;  1SNP A;  3D6C A;  4J1M A;  5EGT A;  4F7X A;  4EQO A;  3ITP A;  5ISR A;  3PMF A;  5CC4 A;  3NQT A;  5J1Z A;  3MVV A;  1SYF A;  2F0J A;  4S3S A;  1AEX A;  1EZ8 A;  2SNM A;  3MEH A;  4ODG A;  2OEO A;  2EYF A;  4E6I A;  4HMJ A;  5IGD A;  3NXW A;  3OMG A;  4NP5 A;  1II3 A;  1IHZ A;  1EY6 A;  1SND A;  2RDF A;  1SNC A;  1F2Y A;  3EVQ A;  5IGF A;  5IOD A;  3R3O A;  5M9O A;  2F0P A;  3TME A;  2F0E A;  2EYM A;  4N9P A;  5NUC A;  3TP6 A;  2F0G A;  2QDB A;  4KY7 A;  4DGZ A;  3V2T A;  2F3W A;  2NUC A;  3SK6 A;  2PZT A;  5CV6 A;  4K5X A;  3NK9 A;  4N9T A;  2EY6 A;  3TP8 A;  1SNM A;  1SYD A;  4PNY A;  4PMB A;  3SK5 A;  4WRD A;  1STA A;  4K8J A;  1EYD A;  3DHQ A;  2EXZ A;  2PZW A;  4KY6 A;  4MIU A;  4NKL A;  2EYH A;  1RKN A;  1SNQ A;  4KD4 A;  1STH A;  4KTA A;  3SHL A;  4K6D A;  1EY8 A;  5DAU A;  4DU9 A;  5EKL A;  2F0D A;  4R8N A;  4QF4 A;  4PMC A;  2PW5 A;  2M00 A;  1STN A;  4K5W A; 
#chains in the Genus database with same CATH topology
 4DAM A;  3L0O A;  5ELD A;  1HJP A;  4J6H A;  4KKT A;  5ELO A;  3S1N H;  2RCN A;  1SMY C;  4B9X A;  4CKE A;  2XN9 C;  1GKH A;  2B2T C;  4A3F H;  1JOQ A;  1SBB B;  2SNS A;  2KEC A;  4GN3 B;  1L0W A;  1Y69 U;  1V1P B;  1K73 C;  4XT1 B;  5C6A A;  2NZ1 D;  1EIH A;  5BN3 A;  2MFI A;  1DON A;  5IYC G;  1Y1V G;  2PW7 A;  4A3J B;  1MI2 A;  1EWH A;  1VQI A;  3WDN A;  1IL8 A;  4K6L A;  4X6A H;  4FDB A;  4PG3 A;  1EY7 A;  2VQE L;  3CRK C;  1C0A A;  2KUM A;  2ZM6 L;  3TQY A;  4ZUI A;  2ZXR A;  4BXX G;  1YBY A;  2F0L A;  2VB2 X;  3NEN A;  1RL2 A;  1SYC A;  1LTR D;  1PYS B;  4R4O A;  2JA9 A;  2ZTD A;  3OIQ A;  4RCO A;  4OO1 I;  4JI5 Q;  4IFD G;  4A3C H;  1WTW A;  3KK7 A;  2K5W A;  3ERQ A;  2XIW A;  5E1F A;  1IKM A;  2IPK D;  4AH6 A;  2XTI A;  4F7X A;  3HOW G;  5K36 H;  3NPP A;  4HIM A;  1ET6 A;  4YCU A;  3CP0 A;  4ZKB B;  3MEF A;  1S5B D;  3K5N A;  3K8A A;  1YJW A;  2A6E C;  3NXW A;  2EJM A;  1ESF A;  3G7L A;  1SND A;  2MO1 A;  2NB0 A;  4HJ8 A;  1XXG A;  3TME A;  3L7Z C;  2E2I H;  4LF4 L;  1LT3 D;  4R8I A;  2NBF A;  1Z47 A;  4NW2 A;  2KHJ A;  1P8L A;  4DV1 L;  2E75 C;  1NBW A;  1ENF A;  3K58 A;  4MIU A;  1SAP A;  1J6Q A;  2KCT A;  1CM9 A;  1SNQ A;  4KD4 A;  3PIP 3;  2CKZ B;  3MFG A;  1Q1B A;  1HZC A;  2K03 A;  1H9K A;  4RWS C;  1PTO D;  2YYZ A;  5LMN Q;  3WOF A;  2FIN B;  2M00 A;  4C3H H;  3K57 A;  4GOP B;  4OIK A;  1OXX K;  4LF8 L;  2NZH A;  2ZJQ A;  1TWF B;  3HOV B;  1PMR A;  3UE0 A;  1B9N A;  1TWG B;  3EA6 A;  4DAP A;  1X9N A;  5KNB A;  3RN5 A;  4X3T A;  4UHV A;  1RHP A;  1IBL L;  4A3G B;  3P75 A;  4IAL A;  2JE6 I;  1NMF A;  2PQE A;  4X65 Q;  4NXM L;  2L1B A;  3URY A;  4JV5 L;  5AJ3 L;  5GAG C;  1NR2 A;  2AQ3 B;  4DR1 Q;  2F0H A;  3ICE A;  3EIV A;  3GTL H;  2OXP A;  1VDZ A;  4LFA L;  1BKB A;  1SFO H;  4B3M L;  4RHR A;  1JQY D;  1HNX L;  4BBS B;  1UEA B;  2QEJ C;  1PXU A;  3H91 A;  1HR0 Q;  3SXH A;  1EQQ A;  2NTS A;  5IP7 G;  3E9H A;  4FYD A;  1E1O A;  2UXB Q;  4GOP C;  3IFD A;  2Z8L A;  3CPF A;  2D2C C;  2B8F A;  4M8A A;  4A3F G;  1R9T B;  3HKZ E;  1WD1 A;  1I3Q B;  1MBY A;  1MSG A;  1RF2 D;  1FNW A;  2IX0 A;  2NVX H;  3J81 L;  1UE1 A;  1YZ6 A;  1TWA H;  3E9I A;  4QJF A;  3BS1 A;  4XXE A;  1OXV A;  1Z7T A;  4A3I G;  3S17 H;  4DR3 Q;  1Q90 A;  3GTQ B;  1PDQ A;  2WII B;  1QZG A;  1FVI A;  3EFX D;  2E2J H;  2NN6 I;  5T1G A;  4F87 A;  3RLF A;  5FJ8 G;  5C3E B;  1F2L A;  4DK0 A;  1XPO A;  3D6C A;  2OCE A;  2JA6 H;  4HIO A;  1OXS C;  2C5C A;  2K05 A;  1IL2 A;  5ELN A;  1N36 Q;  1PYW D;  3PGZ A;  2RSN A;  3A8J E;  3HRZ C;  4DPG A;  5G3L F;  3W5O A;  1HNW Q;  1EIF A;  4JG2 A;  1EFI D;  5D3I B;  2N78 A;  4HED A;  4GKJ L;  2OWO A;  1U0L A;  3BDO A;  3GTG H;  1V1O A;  3A7L A;  4A3C G;  1OO9 B;  1S4Z A;  4KTA A;  4B3R Q;  2Y0S E;  2QF7 A;  2I0Q A;  4UY8 C;  4R8N A;  4P73 A;  3J7A 5;  1YJN A;  4ZQ3 A;  3RR5 A;  4HN7 A;  3I4L A;  1WTX A;  1HNZ Q;  2VUM B;  2JA7 B;  3ERO A;  3CU7 A;  3FPU B;  2BE5 D;  3K59 A;  4LUZ A;  1LAC A;  1EY5 A;  1Q3L A;  5CV4 A;  2RQX A;  3TP7 A;  3TS2 A;  3D6W A;  3FMC A;  4RG1 A;  4C3I B;  1U4L A;  2JJQ A;  1XPR A;  1E0B A;  1MJE A;  2Z0S A;  1I4X A;  3H0G H;  2B2V A;  2F03 A;  2DJF C;  5CV5 A;  1JT8 A;  1S3O A;  5M3M B;  3TP5 A;  1XMQ Q;  2D9U A;  1C4Q A;  3M4P A;  5IGE A;  4C3H G;  2F0S A;  3VYU A;  2D0P A;  4IPC A;  4BBR B;  3QO2 A;  5GAE C;  1T9H A;  3KUP A;  4BY1 H;  2Z6K A;  1JC7 A;  1XX8 A;  5C4J H;  2F0K A;  1DGS A;  1STY A;  2ALY B;  3J80 i;  4JI3 Q;  3F2D A;  1DXM A;  2RCF A;  2WKD A;  5LHY 1;  2NVT B;  4DR7 L;  2E2H H;  1CI3 M;  3VA5 A;  3EQL C;  2LSS A;  5ELC A;  1DZ1 A;  2MQH A;  3HKZ G;  1B1Z A;  1K28 A;  3PO2 H;  5I9P A;  1PH8 A;  5IWA L;  1VQ7 A;  5E4W C;  1FJG Q;  1AE2 A;  5J22 A;  4AQY Q;  2A6H D;  4RGO S;  4DV4 L;  3A56 A;  4DA2 A;  2KBN A;  4K2K A;  1TWH H;  3CW2 C;  4FXK C;  4LJZ C;  2N3S A;  3HEJ A;  2LS0 1;  2P5Z X;  4DV3 L;  4CDD C;  1VQ5 A;  4ILW A;  4DV7 Q;  1WVL A;  3M4O H;  1GUN A;  1HFN A;  1YNJ D;  2BH8 A;  1BNZ A;  4UPA A;  4B3S L;  1F9S A;  1CQF A;  1LAB A;  5EGT A;  3PSI A;  2MO0 A;  1JB3 A;  4N8F A;  2PNH A;  1QZH A;  4GLV B;  3S1Q B;  4S3S A;  4QCL A;  4A93 H;  5IGD A;  2UUC L;  1LTT D;  3R3O A;  2ATW A;  3VYR A;  4AIM A;  2MUY A;  2QDB A;  3PUW A;  1YI2 A;  3CCR A;  4OX9 L;  4P71 A;  1UE6 A;  3OTO L;  4FF1 A;  3VYT A;  1VMC A;  2DY8 A;  1B4O A;  4RFB A;  2A69 C;  2B2Y A;  5EJW A;  1LV9 A;  2Z4H A;  3QIA A;  2K28 A;  3OOC A;  1ONL A;  1FGB D;  2QKI C;  2B2W A;  2Y0S G;  4G7Z C;  5EKL A;  1PZK D;  1G6P A;  1PRT D;  2JA6 G;  2R7Z H;  2AHO B;  4QY7 A;  3S1R H;  4DV5 L;  3AB9 A;  2PQA A;  3DEP A;  2BCO A;  3BU2 A;  1Q7Y C;  1K0S A;  4KN4 C;  3A74 A;  4BS9 A;  3RZD B;  2UXC Q;  2WAQ B;  3KYH C;  5IY0 A;  4YHH L;  1AH9 A;  1IBM Q;  4K2L A;  4A3M H;  2F3I A;  3IRB A;  4P72 A;  1H9J A;  1IW7 C;  3OMC A;  3PUZ A;  1ENA A;  1IYJ B;  1WJJ A;  1JB7 A;  1V8Q A;  2KHS A;  1STG A;  3LWE A;  1B3Q A;  3I4N H;  4IQZ A;  5A2Q E;  4A3K H;  1WTR A;  2CW0 C;  2PMZ E;  1I94 Q;  3BG3 A;  4MZ9 A;  1BCP D;  3TRZ A;  4AYB E;  1VF5 C;  2NN6 H;  4WOR A;  4IZ8 A;  2CQA A;  1ZKO A;  1EOV A;  3RN2 A;  1PH1 A;  1SRU A;  4BA2 I;  2K5N A;  3A8K E;  1UE7 A;  5I6W A;  2E5L L;  1SMX A;  4O0A A;  1S5F D;  2KCM A;  4OXP A;  5KNC A;  4DXF A;  3CAM A;  3PO3 H;  4JI8 Q;  3EN2 A;  2KA7 A;  1N34 L;  3H0G G;  2BDN A;  1YEZ A;  3K5O A;  3C46 A;  3DWP A;  4OO1 G;  1EYC A;  1S72 A;  2L11 A;  5IP9 H;  2RHS B;  1SDF A;  1E7Z A;  4DV2 Q;  1I6H B;  3T13 A;  1K8A C;  2VQF L;  1J8I A;  1AE3 A;  1JJG A;  2F0I A;  5LMU Q;  4X66 L;  3PUX A;  2B2V C;  2K6A A;  4RHS A;  3VDY A;  3I4M H;  1QNU A;  3FHW A;  3UE1 A;  3T53 B;  5C5M A;  1I4P A;  5JJI A;  3ITP A;  4B08 A;  3MVV A;  2F0J A;  1AEX A;  1I4R A;  5M3F H;  3PO2 G;  5M9O A;  3MFY A;  2J0T D;  3I56 A;  1HQM C;  4KY7 A;  1ZXT A;  2R93 H;  1H95 A;  4XIG S;  3S16 B;  1HRJ A;  3CHB D;  2EY6 A;  1N33 L;  1LTG D;  2B3G A;  4HR7 B;  1PTO H;  1PH2 A;  3D3R A;  1EYD A;  3NTK A;  1WTV A;  2L15 A;  1NTG A;  5EKI A;  1TWC B;  2DY7 A;  2JA8 H;  3BVM A;  3T1Y L;  5C44 H;  2JEA I;  2UXD L;  1XMO Q;  4IPD A;  3PCO B;  1PH3 A;  4RH6 A;  2PNR C;  3Q23 A;  1EYG A;  1JJC B;  4ZAI A;  2H4O A;  2PQA B;  2KCN A;  3S15 H;  1QE6 A;  2DGY A;  3S24 A;  4FNF A;  4IN3 A;  4X64 L;  3H15 A;  2F0U A;  3EBE A;  4NDX A;  5ELE A;  1B8A A;  4JYA Q;  1MIU A;  4HCE A;  1KAW A;  2KHI A;  2L4N A;  2TMP A;  1Y1V B;  3A55 A;  4IUU A;  2K01 A;  4R4C A;  1TQO A;  1WYD A;  3MZ5 A;  4LAA A;  4QMG A;  2EDG A;  2QGQ A;  2L9H A;  1CA6 A;  2J4X A;  3S2H B;  3BJU A;  4JC0 A;  1FR3 A;  3NEL A;  3NUC A;  4TVA B;  2ZTE A;  2Q8T A;  4KV6 A;  4AYB G;  3DLL A;  3ZYY X;  2NZO A;  5C3W A;  5JVH 3;  1GUS A;  1EY9 A;  3FDT A;  3D8G A;  2B2Y C;  5KEE A;  3T1H Q;  3R2T A;  1U5K A;  1K83 H;  2R61 A;  2FMM A;  2B2W C;  1S40 A;  3GTP B;  4DR4 Q;  4YIJ A;  1VQO A;  1F9Q A;  1YVC A;  5C0X I;  1VQF A;  4DV6 L;  1O7Z A;  4WJ3 M;  1RD9 D;  3I4N G;  1DOK A;  4JBW A;  1LTB D;  2EPB A;  5JEA G;  4BXX H;  2AQ2 B;  3K5L A;  4A3K G;  1KC8 C;  1XNQ L;  3NP8 A;  2NN6 G;  3NE5 B;  1NAP A;  3Q0A A;  1Q86 C;  2KED A;  4RMF A;  3VR2 A;  2AUJ D;  1VS0 A;  3HFZ B;  4IFD H;  2OF1 A;  1A63 A;  1ML0 D;  4U68 A;  2UU9 L;  1KTK A;  3U58 A;  2OQ0 A;  2JXM B;  3HOW H;  5M5Y H;  4I65 A;  3PO3 G;  1X65 A;  3FVQ A;  5CC4 A;  1VQH A;  1CKO A;  1Q1E A;  3DM1 A;  4JCV E;  3IKJ A;  4RGM A;  3CCU A;  2V4D A;  1CSQ A;  5IOD A;  2GN5 A;  2IW3 A;  5NUC A;  1VQ8 A;  2ZM6 Q;  3FRP B;  3V2T A;  2N49 A;  4DNT B;  4Y7N H;  2NYZ D;  2HQL A;  4X3K A;  2TSS A;  3J80 c;  3KLW A;  1WTH A;  4H13 C;  1B70 B;  1KRS A;  2EXZ A;  2PZW A;  5IYB G;  3I4M G;  4JI7 L;  4TSS A;  4RGT A;  2VXW A;  3SHL A;  3TRE A;  4A3E H;  1OTC A;  4GZY C;  4PMW A;  1VQG A;  2ID0 A;  1GD7 A;  1LT4 D;  5JJZ A;  1PFB A;  4KI0 A;  5L37 A;  4POG A;  1Q82 C;  3S2D H;  1RJT A;  3FKI B;  4X3U A;  3GTJ B;  4TQU S;  4N8X 1;  5EQ0 A;  1SJH D;  2VL6 A;  3I2Z A;  3ND8 A;  3ONA B;  3HOZ H;  1PH6 A;  3FPP A;  4KKU A;  4DV0 L;  2RDH A;  4LF4 Q;  3P20 A;  2K75 A;  1TU2 B;  5HUR A;  1BXT A;  3S1N B;  3DM3 A;  3MAQ A;  5H1S E;  1O78 A;  2GVA A;  1HA5 A;  3MWY W;  3WOE A;  4DV1 Q;  1XJV A;  2LMC B;  2MHV A;  2BE5 C;  3QWN A;  2JA8 G;  2IWH A;  1CKN A;  5KYI A;  3HZX A;  5C44 G;  2JA5 H;  3NBH B;  4DR5 Q;  4A3F B;  4JI4 L;  2B63 G;  1GJX A;  1JMC A;  4A76 A;  1AZQ A;  2EY2 A;  5IYD G;  2Z6B A;  3OIP A;  4LF8 Q;  3H3V C;  4OWX B;  3W1B A;  4LFB L;  2HIV A;  5IP7 H;  5J39 A;  2RSO A;  3PF4 A;  1U4M A;  2MP1 A;  3HOY G;  1SJE D;  2JN4 A;  3RMH A;  4JBJ A;  2CHB D;  3BYT B;  3UDF A;  1KDB A;  4DR2 L;  4K14 A;  1TR5 A;  4A3I H;  4PZ8 A;  1SEB D;  5CV7 A;  4ME5 A;  2O5I C;  1IZ6 A;  5IGB A;  3D0F A;  5G3L D;  5FJ8 H;  4LFA Q;  3DXJ C;  3KJP A;  1CQV A;  4B3M Q;  1FNU A;  2A6H C;  2F1M A;  1BBX C;  1HNX Q;  2B2U A;  5M5W H;  2EZV A;  1HTP A;  1PRT B;  4JI6 L;  4NB3 A;  3R2I A;  5JPN C;  4MN3 A;  1SE8 A;  5IE8 A;  4NP5 A;  4WFN 3;  1ASY A;  2IL8 A;  3TEH B;  1YNJ C;  4C3J H;  3H94 A;  5D65 A;  2PZT A;  5CV6 A;  3G6E A;  3R93 A;  2A73 B;  5DNF A;  3ULJ A;  2BDO A;  3DUZ A;  2E2I B;  1L0Y B;  2XRS D;  1VQ4 A;  3J81 i;  2EYH A;  4R1J A;  3CCJ A;  4LF5 L;  1BCP B;  1DJR D;  3D4W A;  1KQS A;  4H02 A;  1KAB A;  1GOZ A;  3SDZ A;  3H6M A;  4LF6 L;  1QJO A;  3S1M H;  4CJ0 B;  5JAV A;  2CWP A;  1SNO A;  4C3H B;  5DEH A;  5C4X G;  2G5D A;  3QR8 A;  1PRT C;  1GM5 A;  1PH9 A;  1I50 H;  4XQJ A;  1B44 D;  1EWI A;  1RCV D;  4GKJ Q;  4A3E G;  1CHP D;  1FD7 D;  1EIG A;  3RUZ A;  4UAI A;  4DUZ L;  1CKN B;  3MTS A;  1ENC A;  4I7A A;  4LUO A;  3HKZ B;  3HOU H;  5IOC A;  1QIL A;  2R3Z A;  1ESR A;  4OEM B;  5M5X H;  1HZ9 A;  1A2U A;  3HOZ G;  1BCP C;  1SFO B;  1XNR L;  2K52 A;  3G6J B;  2DNC A;  4O2D A;  5KYL A;  1VQK A;  2X69 A;  3JAM L;  3C1F A;  2O4X A;  3B6Y A;  1PFS A;  2EY5 A;  2KVM A;  3VR3 A;  1R4Q B;  5DM6 3;  2VS1 A;  3SK4 A;  3P1H A;  1CHQ D;  1E22 A;  3GTK H;  2JA5 G;  2F0O A;  1D5M C;  3M9B A;  2N8N A;  2L55 A;  4MTK A;  2EYO A;  1HFG A;  2IT1 A;  4FP5 D;  2NVX B;  1X54 A;  1TWA B;  2M9V A;  5IT9 L;  1TXY A;  4Q0F A;  3SE0 A;  3KJO A;  3S17 B;  3O13 A;  3OYY A;  1E2Z A;  1U4R A;  3CQZ H;  2E2J B;  2NVY H;  1H9M A;  2BA1 A;  1EZ8 A;  2J7Z A;  2HCC A;  1G8Z D;  3OMG A;  1ZYR C;  1Y1W H;  1VQN A;  2JA6 B;  3J7A V;  4WJ4 A;  3MXN A;  3NQI A;  4N9P A;  1IYV A;  3TP6 A;  1WTP A;  3KF6 A;  5IWA Q;  1IBK Q;  2HDM A;  4A3B G;  2ICE C;  4XTC S;  3K5M A;  1ICW A;  4P74 A;  4DV4 Q;  5AFW A;  4J8Q A;  4IO9 A;  2XWJ B;  1FL0 A;  2A68 D;  2UUA L;  2DN8 A;  3A8I E;  4PZ7 A;  1LYL A;  5TSS A;  3TZD A;  4KLK A;  3PF5 A;  2A74 C;  2LFN A;  4JI5 L;  3GTG B;  4B3S Q;  1STN A;  1NUC A;  1Q81 C;  4OWW B;  1JOK A;  1G2T A;  1VQJ A;  3RNU A;  3TBI B;  3CCV A;  3QJY A;  3S14 H;  4FXG C;  3K0X A;  1A8V A;  1W6J A;  4C3J G;  1DOM A;  2K33 A;  5KRU A;  1QUQ A;  3KF8 A;  2WAC A;  3ND9 A;  2B2U C;  1B7Y B;  4H7B A;  1S5E D;  4OX9 Q;  2CH4 W;  3J80 E;  5C3X A;  1GXD C;  2K50 A;  3U50 C;  2X6L A;  4MHE A;  3H0G B;  2Z1C A;  1BBW A;  1EYA A;  1EEI D;  1EEF D;  3OW2 A;  4NXN Q;  1QVG A;  4DV5 Q;  5C0X G;  2CH4 A;  4EGV A;  2NWG A;  4L5R C;  2Q2U A;  4A4I A;  4YHH Q;  4BY1 B;  1EY4 A;  4KN7 C;  2R7F A;  2I07 B;  5C4J B;  3CC7 A;  4DUY L;  4XYQ A;  1J5E L;  4CDF C;  1BO0 A;  3I91 A;  5CR3 A;  5IGG A;  4BY7 H;  4OO1 H;  2E2H B;  2JYO A;  2FFK B;  1EOT A;  1NSN S;  1HTL D;  4L6T B;  3KFU A;  1KAA A;  2CFM A;  3HOU G;  2OQK A;  1D8L A;  3PO2 B;  4X65 L;  4QIW E;  1TS3 A;  2WIN B;  1K8G A;  2K7V A;  1ASZ A;  5LL6 X;  1YIJ A;  1TWH B;  2EVB A;  1SMY D;  2E5L Q;  3M4O B;  1E1T A;  3X3N A;  2E76 C;  5GAH C;  3CC4 A;  1TY0 A;  2XRQ D;  3WWV A;  4FO2 A;  1F2Y A;  1YHQ A;  2EXD A;  1UAP A;  2DJG C;  2EYM A;  1HR0 L;  3TS0 A;  2KJX A;  4CBV A;  3OHX C;  4A93 B;  1RDP D;  3KF6 B;  1CUK A;  4CDC C;  4PNY A;  1MD2 D;  2VQF Q;  4XQQ A;  5GAD C;  2UUB L;  3M3Y H;  4K6D A;  3DEO A;  3D4R A;  3HOV G;  3CD6 A;  2PW5 A;  4K5W A;  2HD3 A;  4C2M H;  4NPS A;  2PMZ B;  1W6K A;  1L0X B;  1G2S A;  4R4I A;  5COR A;  1XTC D;  3T56 B;  4K0K L;  4AYB B;  3CCL A;  1YNN D;  1Y1W G;  2R7Z B;  1DCZ A;  1X3G A;  2B8G A;  2V1C C;  1AP0 A;  1T5E A;  5E4X A;  1QUQ B;  1U9R A;  3KF8 B;  2HQE A;  5C5L A;  4HJ9 A;  4A3M B;  3VR5 A;  3F2C A;  2WV6 D;  4B9W A;  2HCI A;  1CZG A;  1HQR D;  2KOL A;  1KD1 C;  2EYJ A;  1DOL A;  3C2P A;  3I4N B;  3BDL A;  4DF7 A;  4DK6 C;  1CT1 D;  4JI0 L;  1A3T A;  1EY0 A;  1O7L A;  2R7D A;  3T1Y Q;  3K7A H;  4A3K B;  4LF7 Q;  3QOL A;  1SR3 A;  5GQO A;  4JI1 L;  2UXD Q;  2EY1 A;  4KK7 A;  4B3R L;  2A6E D;  4EQP A;  4C1N I;  3KLS A;  1D7Q A;  4ZCK A;  3OWE B;  3AEV A;  3S1Q H;  4OON A;  3RD4 A;  1LUZ A;  1DYQ A;  4GN5 A;  2L0C A;  4X62 L;  5CV9 A;  4X64 Q;  1KNA A;  4M1U B;  3J81 c;  5JEA H;  1I5F A;  1GUO A;  3N52 A;  4LFC L;  3CMA A;  2QEX A;  1CKM A;  1QB5 D;  3F8T A;  3PO3 B;  4FVM A;  3SEB A;  1SE4 A;  1D5Z C;  1SRO A;  4HMI A;  2GVB A;  4YWK A;  4H44 C;  4RAU C;  3K80 C;  1GHJ A;  5C3E G;  2X6G A;  3M7N A;  4KJN A;  1XYI A;  1STE A;  4YY3 L;  3K0Y A;  3PV0 A;  1C8C A;  3AYH B;  1D6E C;  5CBA E;  3I4M B;  1N32 Q;  1YHB A;  3GV3 A;  1OXU A;  1ILQ A;  2SNM A;  4IFD J;  3A7A B;  1X32 A;  4JI3 L;  4FF2 A;  2AWO A;  1QVF A;  1SNC A;  4BY7 G;  1AZP A;  4UP8 A;  2KEE A;  2NUC A;  1UE5 A;  3BZC A;  3UDI A;  1P16 A;  5M3F B;  1SNM A;  3GTM H;  2ZXO A;  4K8J A;  5IYB H;  4JBK A;  1PLF A;  3CCQ A;  4DR6 L;  2R93 B;  3HG9 A;  4CJ2 C;  2VUM G;  1CTM A;  3MXG A;  5JVG 3;  1PTO B;  2UU9 Q;  4OIJ A;  4PMC A;  3T4A C;  2OT2 A;  4KKS A;  4BA1 I;  4C1N K;  4DV7 L;  1D2B A;  4DAY A;  1VF7 A;  2JA8 B;  5C44 B;  5EKK A;  2NVQ H;  5FK9 C;  3VA7 A;  1I4H A;  1WCM H;  4C3I G;  4HIK A;  2YU9 H;  2PI2 E;  4OL7 A;  1KXL A;  1KDA A;  1JOO A;  2FHT A;  1G29 1;  1KRT A;  4ID6 A;  4QL5 A;  2XGT A;  3S15 B;  5M3M G;  4OHJ A;  4B3T Q;  1VQ9 A;  3RZO B;  2CVR A;  3H09 A;  4CKC A;  3A54 A;  4BBR G;  1U4P A;  1TY2 A;  2RA4 A;  3K81 C;  4KHZ A;  1X3P A;  2ASB A;  2B63 H;  2PPB C;  4JI2 L;  5BR8 Q;  1PA6 A;  2RKS A;  4CHT B;  1L1O A;  5IYD H;  1E3P A;  4F88 A;  4KY5 A;  2NTT A;  5CBE E;  4HTH A;  2PCF B;  1PTO C;  1EU4 A;  1Q8K A;  3AU7 A;  1RTN A;  4I7Z C;  4RCN A;  2UXC L;  3HOY H;  1K83 B;  3K6O A;  2M2L A;  2IX1 A;  1IBM L;  4LF9 L;  5LMN W;  4QQB X;  3I8Z A;  3CRL C;  3Q22 A;  4KMU C;  1LTI D;  1ROD A;  2G9H D;  1WI5 A;  4UDU C;  2K5Q A;  4IPG A;  4A3D H;  5FO9 B;  4A3L H;  1C9O A;  1GHK A;  2F0N A;  1PH5 A;  1I94 L;  5ELB A;  4CJ1 B;  4OEL B;  1L2F A;  3U4Z A;  1SYG A;  2I5H A;  3NEM A;  2IX3 A;  4LWC A;  4DK3 C;  4J1M A;  1QOH A;  4APV A;  1I4Q A;  4H0L C;  4LK1 C;  3NQT A;  5J1Z A;  2BOS A;  4OGQ C;  5JPM C;  4TKO B;  3M85 A;  1DM0 B;  1X6O A;  2EYF A;  3HOW B;  5M5Y B;  3P7J A;  1HA6 A;  2F52 A;  1PYB A;  2F0G A;  1EWC A;  2E2D C;  4JI8 L;  1UEB A;  1VQ6 A;  2WB1 E;  3QG1 A;  1M90 C;  1JWS D;  3S2H H;  1O7Y A;  3IL8 A;  1EIY B;  2EIF A;  2WP8 J;  3C3L A;  3GV6 A;  4RGN A;  1SYD A;  1GUW A;  1HR0 W;  5BN4 A;  2R6G A;  2AQ1 B;  4A75 A;  4Y7N B;  4DV2 L;  4HJA A;  5JJL A;  3UDG A;  1PV4 A;  5A2Q L;  1Z9F A;  3KBG A;  2YV5 A;  1Y14 B;  4GNX A;  2D5D A;  2EOT A;  5LMU L;  3I73 A;  4K8I A;  5FKA C;  4A3E B;  1KLG D;  2VQE Q;  3CCS A;  3GTP H;  3HS0 C;  3A0J A;  3X3M A;  4DAY B;  4YCW A;  1H9S A;  2OTL A;  4JI6 Q;  3G4S A;  4IPH A;  5FOB B;  3GTO H;  3TSS A;  5C4X H;  3L3O C;  1JJ2 A;  3QOJ A;  4RKL A;  3S2D B;  1STB A;  2R92 H;  4GLA C;  4CDE C;  1NCV A;  4MTN A;  2EYP A;  3KBX A;  1WTO A;  3HOZ B;  4POF A;  4L5T A;  1TS4 A;  4CGY B;  1WFQ A;  1TKW B;  4V0B A;  4HJ7 A;  2AWN A;  4EQN A;  3BDC A;  1C7Y A;  4YWM A;  2PYK A;  4LF5 Q;  2YTV A;  4ALP A;  1EQR A;  2SOB A;  2JA5 B;  3VR4 A;  1L1O B;  1WCM G;  4KHV A;  5HGQ A;  2F0V A;  2VW9 A;  1F2Z A;  1XMO L;  4LNQ A;  4LF6 Q;  3AFQ A;  3T51 B;  1X3Q A;  3SGI A;  1UNS A;  4R4Q A;  1NNX A;  4YCV A;  3GO5 A;  1B50 A;  2HUG A;  4P2C B;  2ES2 A;  1R4P B;  2CWA A;  4IJH A;  1Z6H A;  4R4T A;  5HY6 A;  1BVS A;  4ULL A;  2HIX A;  2PO4 A;  1K8M A;  2EQS A;  3I55 A;  2EYL A;  1B3A A;  2K5H A;  4A3I B;  5E3F A;  1SLJ A;  4GLX A;  3SR1 A;  1IW7 D;  4GN4 B;  2VZA A;  1FNV A;  3PMF A;  1QG7 A;  3RLN A;  1SYF A;  3FEW X;  1XNR Q;  3T1H L;  1PH7 A;  1Q8I A;  1IBL Q;  3J81 E;  3D31 A;  4JOI A;  3HP3 A;  5EPJ A;  1L1O C;  2RDF A;  5M5W B;  4DR4 L;  4NXM Q;  2CW0 D;  3HOX H;  4JV5 Q;  5AJ3 Q;  3GDE A;  4A3B H;  2F4V L;  2WB1 G;  4LMQ D;  4A3D G;  2B39 A;  1MKH A;  4DN4 M;  3JAM i;  5E7N A;  3NK9 A;  4DNI A;  4A3L G;  1K9M C;  1LO5 D;  4C3J B;  4X3S A;  4NKL A;  1DD2 A;  1STH A;  4L63 B;  4DXG A;  2CCZ A;  1ZEQ X;  2QDL A;  2IHF A;  2JQO A;  4GNX B;  1GO3 E;  5FO7 B;  1EU3 A;  4JK1 C;  4XYO A;  5KND A;  1WTQ A;  4KHP L;  1K3R A;  2D0O A;  1XPU A;  1H9S B;  4FF3 A;  3F1Z A;  3CKI B;  4KD3 A;  3T16 A;  3I7F A;  1HUN A;  3S1M B;  1BF4 A;  4U67 3;  1OXT A;  1YNN C;  1PHJ A;  2A19 A;  4GKK L;  4IUP A;  2UUA Q;  1TS2 A;  3BVZ A;  2F0Q A;  4A3J H;  2QW7 A;  1B53 A;  1A0I A;  1TII D;  4DK1 A;  1I50 B;  2K4K A;  4DFA A;  5EPL A;  2F0M A;  1HUM A;  2Q8R E;  1PH4 A;  2KQ3 A;  4IUT A;  1LTS D;  1K0R A;  4Y52 H;  5C0X H;  2KCC A;  3JC6 6;  1KDC A;  2JP1 A;  1VQD A;  3HOU B;  5EBC A;  2WKC A;  4R9W A;  4OWT B;  2R92 G;  1MGS A;  3PUY A;  3CXC A;  4GNX C;  1YNX A;  1BUV T;  1VQP A;  2RF4 A;  3GD7 A;  5M5X B;  2O5J C;  3OSO A;  4L5Q A;  1VMP A;  3E5S A;  1E2W A;  1VCI A;  1EZ6 A;  2LXK A;  1LT5 D;  5HGT A;  1A3V A;  2SEB D;  4PV1 C;  3CCM A;  3W3A A;  3L2P A;  1J9O A;  2ZT9 C;  2H1E A;  3LWU A;  4HSP A;  1EUJ A;  3GTK B;  2XVS A;  3ER0 A;  3GTL B;  1FGU A;  1ILP A;  4DR5 L;  2HHH L;  1T5X D;  5D3D A;  4EQO A;  1HZA A;  1H9R A;  2L5T A;  4G4K A;  1UWV A;  4ODG A;  4DUY Q;  4E6I A;  1JR0 D;  1QCB D;  1J5E Q;  3M7G A;  1II3 A;  4IUV A;  1EY6 A;  4L5S A;  2ICI A;  3CQZ B;  2F0P A;  2NVY B;  3J7Z C;  1LTL A;  3J81 j;  4FXD A;  4HAE A;  1RTO A;  1AN8 A;  2LY7 A;  2F4I A;  1Y1W B;  4XT3 B;  3SK5 A;  4WRD A;  2FMC A;  3DHQ A;  1ICF B;  1TWF H;  3HOV H;  1SN8 A;  3I3C A;  1TWG H;  4DU9 A;  2F0D A;  3FKI G;  1QNK A;  4DR7 Q;  3GP7 A;  1A62 A;  2Y0S B;  1A6X A;  2VB3 X;  4TRD A;  1N9W A;  4G7H C;  5FLX c;  4XDX A;  4FF4 A;  4A3G H;  3HOX G;  1V9P A;  4XQN A;  5FLM H;  5I6Y A;  2H5X A;  4IOA A;  3CME A;  3Q6S A;  3S14 B;  3E0J A;  1BQQ T;  1F9P A;  4DV3 Q;  4JOI C;  1E2V A;  4KJO A;  3AMU A;  5CGK A;  3AQQ A;  2UUB Q;  5BN5 A;  1HHV A;  4ZK9 B;  4BBS H;  1KL9 A;  3EJI A;  4ME3 A;  4Q5V A;  3ERS X;  5DM7 3;  5GRO A;  2UUC Q;  1PZI D;  4IJL A;  4K0K Q;  1R9T H;  4QIW B;  3OWF A;  1I3Q H;  3I4O A;  3E0E A;  2ENB A;  1S5D D;  4RA8 A;  2OTJ A;  4G7O C;  3OTO Q;  4EX5 A;  3GQB A;  1BOS A;  1CK1 A;  2MNA A;  3NWS A;  3GTQ H;  2A5H A;  4A3J G;  3I70 A;  5J3B A;  2L12 A;  1GUG A;  4PQX A;  4BY7 B;  5C3E H;  5IIF A;  5JEA J;  1PVO A;  4JI0 Q;  1I6V C;  3N6R A;  4K5V A;  5K5P A;  4JI1 Q;  1PFM A;  2YTX A;  3KLS X;  5LMN L;  1VQM A;  3QB3 A;  1VQA A;  3AFP A;  3STB D;  1SNP A;  3HKS A;  1WOC A;  2FJ2 A;  5K36 G;  2Q2H A;  2K14 A;  3J7A F;  4X62 Q;  5I2Y A;  3OW7 A;  3FP9 A;  4PZ6 A;  5DLQ E;  1QVC A;  1YJ9 A;  3EVQ A;  5IGF A;  1N8R C;  1D1I A;  4LFC Q;  1KHI A;  3BZD B;  1LLR D;  1V43 A;  4K5X A;  4EQ5 A;  2PI2 A;  3TP8 A;  4L8J A;  4WJW A;  5COY A;  3TN2 A;  1YIT A;  4DR1 L;  3E6Z X;  1JE5 A;  1RKN A;  2C35 B;  2VUM H;  2JA7 H;  2I5M X;  4MNO A;  3F2U A;  1HZB A;  4YY3 Q;  3VYS A;  2HDL A;  4HSV A;  4ZYS A;  1A2T A;  3M3Y B;  4QUF A;  1TT2 A;  1X55 A;  3BZK A;  1N34 Q;  4C3I H;  4HCS A;  3I72 A;  5F2D A;  2LKV A;  2K04 A;  3MXN B;  2UXB L;  4C2M B;  2I46 A;  3NHH A;  4G57 A;  2RBM A;  5M3M H;  4RKB A;  1Y8N B;  3IFT A;  2AUK A;  3S9W A;  1M1K C;  2Z9H A;  1PTO F;  5T1I A;  3SVM A;  4BBR H;  4X66 Q;  1S5C D;  4DR6 Q;  1IBK L;  4ZRZ A;  2Q2I A;  4DR3 L;  1CSP A;  1M4V A;  1F77 A;  2N88 A;  3HGB A;  1SXT A;  3J7Y W;  2NVT H;  1JWM D;  3UDX A;  3PIO A;  5JJK A;  1VQC A;  4A3G G;  1A15 A;  3S1R B;  3MC0 B;  2K5D A;  2N55 A;  3JAM c;  3K7A B;  5FLM G;  1C48 A;  3MHB A;  1Y8O B;  4LUV A;  1K8O A;  3ULL A;  2MJ8 A;  1N36 L;  1EQV A;  3PQI A;  1N33 Q;  2ZJR A;  2F3V A;  2KEN A;  1YHA A;  2Q8I B;  4JPB W;  1HNW L;  4UP9 A;  3ULP A;  4BBS G;  2EJF C;  5IT9 c;  2XSC A;  5A35 A;  1JOR A;  3A5Z B;  1MJC A;  4JI2 Q;  3MA2 B;  2HT1 A;  5D14 A;  3R8B A;  4BWG B;  5LL6 S;  3V96 A;  4IFD I;  2EJG C;  3CF5 A;  1HNZ L;  3DWQ A;  5ISR A;  2Q2T A;  4IUQ A;  4NXN L;  2AKW B;  4P75 A;  1BBU A;  1NR4 A;  1VQL A;  2OEO A;  4HMJ A;  1F9R A;  1G51 A;  1MSH A;  1NMG A;  1VQE A;  2F0E A;  4IUR A;  4HID A;  3KLR A;  1CZW A;  2JK8 A;  3G71 A;  1HH2 P;  4LF9 Q;  1B2T A;  2Z4I A;  3V05 A;  4PMB A;  1ET9 A;  1HPC A;  2FXQ A;  1XMQ L;  3W2D A;  2GA4 B;  1X56 A;  1HXY D;  4C56 C;  2IHE A;  4GS3 A;  1EY8 A;  3RZD H;  5DAU A;  3J80 L;  3GTM B;  1PZJ D;  3E3X A;  4DV6 Q;  2XWB B;  3LGJ A;  1W2B A;  1E24 A;  1VQB A;  2F0T A;  4JBM A;  3MXP A;  1UUP A;  4DNR B;  5CYU A;  5C4H A;  1JWU D;  1XNQ Q;  1BDO A;  5KIX A;  2NVQ B;  2WFW A;  1WCM B;  2YU9 B;  1FJG L;  4AQY L;  5FO8 B;  3H3V I;  3LNN A;  3NSW A;  1SE2 A;  3Q24 A;  2DNE A;  2JA7 G;  3W1G A;  2E8G A;  2WAQ E;  1TVX A;  5EBD A;  3U4V A;  1PFN A;  2AMC B;  3K7U C;  1NE3 A;  1HCZ A;  4O1N A;  4BY1 G;  2E74 C;  5CV8 A;  1F2M A;  5I4D A;  5FLX E;  3M4Y A;  1CFM A;  2BH2 A;  1ZYR D;  2B63 B;  1D5X C;  4CKB A;  2XNA C;  4DKA C;  2QIL A;  1I6H H;  1D1K A;  1SE3 A;  1AW7 A;  1JCK B;  2JSO A;  2ZXP A;  1A3U A;  5IGC A;  3ZJY C;  2Z6K C;  4JI7 Q;  2JEB I;  3M4Q A;  1SYB A;  3HOY B;  1Q46 A;  1SSO A;  3LX0 A;  4QB4 A;  3U9S A;  3D4D A;  2ZTC A;  3L9A X;  2WB1 B;  4A3D B;  1XWE A;  4O42 A;  1AFP A;  2CQO A;  1QWY A;  3TDQ A;  4LF7 L;  3PIO 3;  2B2T A;  2BA0 A;  1K3B C;  2O2L D;  3MEH A;  4DV0 Q;  3S16 H;  3KDF A;  1IHZ A;  1XTD A;  2EE1 A;  4A93 G;  3RLO A;  1W3S A;  3RZO H;  1TWC H;  4N9T A;  3I90 A;  1Q12 A;  3CC2 A;  4JI4 Q;  1STA A;  5CMD A;  1JE4 A;  1BR9 A;  3A5U A;  3NBH A;  4QF4 A;  4LFB Q;  1EQT A;  2R7Z G;  1LT6 D;  1I4G A;  3NBI A;  5IYC H;  1Y1V H;  3C1E A;  3KOJ A;  1SYE A;  2DUD A;  1O80 A;  1KIX A;  1EL0 A;  2MPM A;  3F2B A;  4J15 A;  4A3M G;  1X3F A;  1N32 L;  2QCP X;  4V19 0;  1X3E A;  4DR2 Q;  3Q8D A;  2F4V Q;  3GTO B;  4ZUJ A;  2ZJP A;  1LM0 A;  4F8M A;  3CPW A;  1PRT F;  5C4X B;  4DAV A;  5KGU A;  3TZU A;  2IJ0 A;  2R92 B;  1KNE A;  1IKL A;  1V1P A;  2WAQ G;  5JOB A;  3MXU A;  3VR6 A;  3SK8 A;  4ZLT F;  4EVO A;  1WD0 A;  2A68 C;  1RIP A;  4ABN A;  5EPK A;  2F0W A;  2I5L X;  4NMZ A;  1TS5 A;  4QUC A;  3G48 A;  4KHP Q;  1IYU A;  2G9D A;  2F0F A;  5I9O A;  1BCP F;  1V1Q A;  2K5V A;  1NJI C;  2K32 A;  5C0X J;  1Y8P B;  2YTY A;  4IUN A;  1IXR A;  2VY3 A;  1KLU D;  3DWA A;  1MHW C;  1CA5 A;  1G6Z A;  3U9O A;  4ZKC B;  5I2X A;  5ELF A;  5IP9 G;  2A1A A;  4GKK Q;  5C4Z A;  3PIP A;  4UP7 A;  1M8A A;  4B3T L;  2IY5 B;  2PZU A;  1G91 A;  2RVL A;  2RHQ B;  1JIC A;  4JVZ A;  3DMU A;  1FYC A;  3JAM E;  1EFW A;  1B9M A;  4JW0 A;  4Z9C B;  3CCE A;  5BR8 L;  2K1B A;  2RDG A;  5EAY A;  2A69 D;  2QA4 A;  1O7I A;  3BYY B;  2B29 A;  3PUV A;  3NTI A;  2A8V A;  1GUT A;  4JYA L;  2SDF A;  3KDF B;  2VNU D;  5M3F G;  4IOC A;  3UI2 A;  1GVP A;  4DGZ A;  2LXJ A;  3NTH A;  4HJ5 A;  2F3W A;  2C9O A;  2D62 A;  3SK6 A;  3STB C;  2R93 G;  5FLX L;  4DUZ Q;  5IT9 E;  3H3V H;  3BVG A;  3HOX B;  4A3B B;  4KY6 A;  1LTA D;  2MGS A;  3OPO A;  3IAY A;  4QGU A;  3FKI H;  3GTJ H;  3NWT A;  4LW1 A;  4GOP A;  1NY4 A;  2HHH Q;  4YWL A; 
#chains in the Genus database with same CATH homology
 5ELD A;  4J6H A;  4KKT A;  1SMY C;  4B9X A;  4CKE A;  2XN9 C;  2B2T C;  1JOQ A;  1SBB B;  2SNS A;  2KEC A;  1Y69 U;  1V1P B;  4XT1 B;  5C6A A;  2NZ1 D;  1EIH A;  5BN3 A;  1DON A;  2PW7 A;  4A3J B;  1MI2 A;  1EWH A;  3WDN A;  1IL8 A;  4K6L A;  1EY7 A;  3CRK C;  2KUM A;  4ZUI A;  2ZXR A;  2VB2 X;  2F0L A;  1SYC A;  1LTR D;  3OIQ A;  4RCO A;  4OO1 I;  4IFD G;  1WTW A;  3KK7 A;  2K5W A;  3ERQ A;  2XIW A;  5E1F A;  1IKM A;  2IPK D;  4F7X A;  5K36 H;  3NPP A;  1ET6 A;  4ZKB B;  1S5B D;  3K5N A;  2A6E C;  3NXW A;  2EJM A;  1ESF A;  3G7L A;  1SND A;  2NB0 A;  1XXG A;  3TME A;  3L7Z C;  1LT3 D;  4R8I A;  2NBF A;  1Z47 A;  4NW2 A;  2E75 C;  1ENF A;  3K58 A;  4MIU A;  1SAP A;  1CM9 A;  1SNQ A;  4KD4 A;  3PIP 3;  3MFG A;  1Q1B A;  2K03 A;  1H9K A;  4RWS C;  1PTO D;  2YYZ A;  3WOF A;  2FIN B;  2M00 A;  3K57 A;  4OIK A;  1OXX K;  1TWF B;  3HOV B;  1PMR A;  1B9N A;  1TWG B;  3EA6 A;  4DAP A;  5KNB A;  4X3T A;  1RHP A;  4A3G B;  3P75 A;  4IAL A;  2JE6 I;  2PQE A;  2L1B A;  3URY A;  1NR2 A;  2AQ3 B;  2F0H A;  2OXP A;  1VDZ A;  4RHR A;  1JQY D;  4BBS B;  1UEA B;  2QEJ C;  1PXU A;  3H91 A;  3SXH A;  4FYD A;  2NTS A;  3IFD A;  2Z8L A;  2D2C C;  2B8F A;  4M8A A;  1R9T B;  1WD1 A;  1I3Q B;  1MBY A;  1MSG A;  1RF2 D;  1FNW A;  2IX0 A;  3J81 L;  3BS1 A;  4XXE A;  1OXV A;  1Z7T A;  1Q90 A;  3GTQ B;  1PDQ A;  2WII B;  3EFX D;  2NN6 I;  5T1G A;  4F87 A;  3RLF A;  5C3E B;  1F2L A;  4DK0 A;  3D6C A;  1OXS C;  2C5C A;  2K05 A;  1PYW D;  2RSN A;  3A8J E;  3HRZ C;  5G3L F;  1EFI D;  5D3I B;  4HED A;  3BDO A;  1V1O A;  3A7L A;  1OO9 B;  1S4Z A;  4KTA A;  2QF7 A;  4R8N A;  4ZQ3 A;  4HN7 A;  3I4L A;  1WTX A;  2VUM B;  2JA7 B;  3ERO A;  3CU7 A;  3FPU B;  2BE5 D;  3K59 A;  1LAC A;  1EY5 A;  1Q3L A;  5CV4 A;  2RQX A;  3TP7 A;  3D6W A;  3FMC A;  4C3I B;  1U4L A;  1E0B A;  1I4X A;  2B2V A;  2F03 A;  5CV5 A;  5M3M B;  3TP5 A;  2D9U A;  1C4Q A;  5IGE A;  4C3H G;  2F0S A;  3VYU A;  4BBR B;  3QO2 A;  3KUP A;  1JC7 A;  1XX8 A;  2F0K A;  1STY A;  1DXM A;  2WKD A;  5LHY 1;  2NVT B;  1CI3 M;  3VA5 A;  3EQL C;  5ELC A;  1DZ1 A;  1B1Z A;  5I9P A;  5E4W C;  5J22 A;  2A6H D;  4RGO S;  3A56 A;  4DA2 A;  4K2K A;  4FXK C;  4LJZ C;  3HEJ A;  2LS0 1;  4ILW A;  1WVL A;  1GUN A;  1HFN A;  1YNJ D;  1BNZ A;  1F9S A;  1CQF A;  1LAB A;  5EGT A;  1JB3 A;  3S1Q B;  4S3S A;  4QCL A;  5IGD A;  1LTT D;  3R3O A;  3VYR A;  2MUY A;  2QDB A;  3PUW A;  4FF1 A;  3VYT A;  1VMC A;  2DY8 A;  1B4O A;  4RFB A;  2A69 C;  2B2Y A;  5EJW A;  1LV9 A;  2Z4H A;  3QIA A;  2K28 A;  3OOC A;  1ONL A;  1FGB D;  2QKI C;  2B2W A;  4G7Z C;  5EKL A;  1PZK D;  1PRT D;  3AB9 A;  3DEP A;  2BCO A;  4KN4 C;  4BS9 A;  3RZD B;  2WAQ B;  4K2L A;  1H9J A;  1IW7 C;  3OMC A;  3PUZ A;  1ENA A;  1V8Q A;  2KHS A;  1STG A;  3LWE A;  4IQZ A;  5A2Q E;  1WTR A;  2CW0 C;  3BG3 A;  1BCP D;  1VF5 C;  2NN6 H;  4WOR A;  4IZ8 A;  2CQA A;  1ZKO A;  4BA2 I;  3A8K E;  5I6W A;  1S5F D;  5KNC A;  4DXF A;  2KA7 A;  2BDN A;  3K5O A;  3C46 A;  3DWP A;  4OO1 G;  1EYC A;  2L11 A;  1SDF A;  1I6H B;  3T13 A;  1J8I A;  2F0I A;  3PUX A;  2B2V C;  2K6A A;  4RHS A;  1QNU A;  3T53 B;  5C5M A;  1I4P A;  3ITP A;  4B08 A;  3MVV A;  2F0J A;  1AEX A;  1I4R A;  5M9O A;  3MFY A;  2J0T D;  1HQM C;  4KY7 A;  1ZXT A;  4XIG S;  3S16 B;  1HRJ A;  3CHB D;  2EY6 A;  1LTG D;  4HR7 B;  1PTO H;  3D3R A;  1EYD A;  3NTK A;  1WTV A;  5EKI A;  1TWC B;  2DY7 A;  3BVM A;  2JEA I;  4RH6 A;  2PNR C;  3Q23 A;  4ZAI A;  2H4O A;  2KCN A;  1QE6 A;  4FNF A;  4IN3 A;  2F0U A;  5ELE A;  4NDX A;  4HCE A;  2L4N A;  2TMP A;  1Y1V B;  3A55 A;  4IUU A;  2K01 A;  1TQO A;  3MZ5 A;  4LAA A;  4QMG A;  2EDG A;  2L9H A;  1CA6 A;  2J4X A;  3S2H B;  1FR3 A;  3NUC A;  2Q8T A;  4KV6 A;  3ZYY X;  5C3W A;  5JVH 3;  1GUS A;  1EY9 A;  3FDT A;  3D8G A;  2B2Y C;  5KEE A;  3R2T A;  2R61 A;  2FMM A;  2B2W C;  3GTP B;  4YIJ A;  1F9Q A;  5C0X I;  1O7Z A;  1RD9 D;  1DOK A;  4JBW A;  1LTB D;  2EPB A;  5JEA G;  2AQ2 B;  3K5L A;  3NP8 A;  2NN6 G;  3NE5 B;  1NAP A;  3Q0A A;  2KED A;  3VR2 A;  2AUJ D;  4IFD H;  2OF1 A;  1ML0 D;  4U68 A;  1KTK A;  2JXM B;  4I65 A;  3FVQ A;  5CC4 A;  1Q1E A;  3DM1 A;  3IKJ A;  4RGM A;  2V4D A;  5IOD A;  2IW3 A;  5NUC A;  3FRP B;  3V2T A;  4DNT B;  2NYZ D;  4X3K A;  2TSS A;  4H13 C;  2EXZ A;  2PZW A;  4TSS A;  4RGT A;  2VXW A;  3SHL A;  4GZY C;  4PMW A;  2ID0 A;  1LT4 D;  5JJZ A;  1PFB A;  4KI0 A;  1RJT A;  3FKI B;  4X3U A;  3GTJ B;  4TQU S;  5EQ0 A;  1SJH D;  3ND8 A;  3ONA B;  3FPP A;  4KKU A;  2RDH A;  3P20 A;  1TU2 B;  5HUR A;  1BXT A;  3S1N B;  3MAQ A;  1O78 A;  3MWY W;  1HA5 A;  3WOE A;  2LMC B;  2MHV A;  2BE5 C;  3QWN A;  2IWH A;  5KYI A;  3HZX A;  4A3F B;  1GJX A;  1AZQ A;  2EY2 A;  3OIP A;  3H3V C;  5J39 A;  2RSO A;  1U4M A;  2MP1 A;  1SJE D;  3RMH A;  2CHB D;  3BYT B;  1KDB A;  4K14 A;  1TR5 A;  1SEB D;  5CV7 A;  4ME5 A;  2O5I C;  5IGB A;  5G3L D;  3DXJ C;  1CQV A;  1FNU A;  2A6H C;  2F1M A;  1BBX C;  2B2U A;  2EZV A;  1HTP A;  1PRT B;  3R2I A;  5JPN C;  4MN3 A;  4NP5 A;  4WFN 3;  2IL8 A;  1YNJ C;  3H94 A;  5D65 A;  2PZT A;  5CV6 A;  3R93 A;  2A73 B;  5DNF A;  2BDO A;  3DUZ A;  2E2I B;  1L0Y B;  2XRS D;  2EYH A;  1BCP B;  1DJR D;  3D4W A;  1KAB A;  1GOZ A;  3SDZ A;  3H6M A;  1QJO A;  4CJ0 B;  5JAV A;  1SNO A;  4C3H B;  5DEH A;  1PRT C;  4XQJ A;  1B44 D;  1RCV D;  1CHP D;  1FD7 D;  1EIG A;  3RUZ A;  4UAI A;  3MTS A;  1ENC A;  3HKZ B;  5IOC A;  1QIL A;  2R3Z A;  1ESR A;  1A2U A;  1BCP C;  1SFO B;  3G6J B;  2DNC A;  5KYL A;  2X69 A;  3JAM L;  3C1F A;  2O4X A;  2EY5 A;  2KVM A;  3VR3 A;  1R4Q B;  5DM6 3;  3SK4 A;  3P1H A;  1CHQ D;  2F0O A;  1D5M C;  2L55 A;  2EYO A;  1HFG A;  2IT1 A;  4FP5 D;  2NVX B;  1TWA B;  2M9V A;  5IT9 L;  4Q0F A;  3SE0 A;  3S17 B;  3O13 A;  1E2Z A;  1U4R A;  2E2J B;  1H9M A;  2BA1 A;  1EZ8 A;  2J7Z A;  2HCC A;  1G8Z D;  3OMG A;  1ZYR C;  2JA6 B;  3J7A V;  3MXN A;  3NQI A;  4N9P A;  1IYV A;  3TP6 A;  1WTP A;  2HDM A;  2ICE C;  4XTC S;  3K5M A;  1ICW A;  5AFW A;  4J8Q A;  2XWJ B;  2A68 D;  2DN8 A;  3A8I E;  5TSS A;  3TZD A;  2A74 C;  2LFN A;  3GTG B;  1STN A;  1NUC A;  1JOK A;  1G2T A;  3TBI B;  3QJY A;  4FXG C;  1W6J A;  4C3J G;  1DOM A;  2K33 A;  5KRU A;  3KF8 A;  2WAC A;  3ND9 A;  2B2U C;  4H7B A;  1S5E D;  3J80 E;  5C3X A;  1GXD C;  2X6L A;  4MHE A;  3H0G B;  2Z1C A;  1EYA A;  1EEI D;  1EEF D;  5C0X G;  4EGV A;  2NWG A;  4BY1 B;  1EY4 A;  4KN7 C;  5C4J B;  2I07 B;  4XYQ A;  1BO0 A;  3I91 A;  5CR3 A;  5IGG A;  4OO1 H;  2E2H B;  2JYO A;  2FFK B;  1EOT A;  1NSN S;  1HTL D;  4L6T B;  1KAA A;  3PO2 B;  1TS3 A;  2WIN B;  2K7V A;  5LL6 X;  1TWH B;  2EVB A;  1SMY D;  3M4O B;  3X3N A;  2E76 C;  1TY0 A;  2XRQ D;  4FO2 A;  1F2Y A;  1UAP A;  2EYM A;  2KJX A;  4CBV A;  3OHX C;  4A93 B;  1RDP D;  4PNY A;  1MD2 D;  4XQQ A;  4K6D A;  3DEO A;  3D4R A;  2PW5 A;  4K5W A;  2PMZ B;  1W6K A;  1L0X B;  1G2S A;  5COR A;  1XTC D;  3T56 B;  4AYB B;  1YNN D;  2R7Z B;  1DCZ A;  2B8G A;  1AP0 A;  1T5E A;  5E4X A;  1U9R A;  2HQE A;  5C5L A;  4A3M B;  3VR5 A;  2WV6 D;  4B9W A;  2HCI A;  1CZG A;  1HQR D;  2KOL A;  2EYJ A;  1DOL A;  3C2P A;  3I4N B;  3BDL A;  4DF7 A;  1CT1 D;  1A3T A;  1EY0 A;  1O7L A;  4A3K B;  3QOL A;  2EY1 A;  4KK7 A;  2A6E D;  4EQP A;  4C1N I;  3KLS A;  3OWE B;  3RD4 A;  1DYQ A;  2L0C A;  5CV9 A;  1KNA A;  4M1U B;  5JEA H;  1GUO A;  3N52 A;  1QB5 D;  3PO3 B;  4FVM A;  3SEB A;  1SE4 A;  1D5Z C;  4HMI A;  4H44 C;  4RAU C;  1GHJ A;  2X6G A;  3M7N A;  4KJN A;  1XYI A;  1STE A;  3K0Y A;  3PV0 A;  1C8C A;  1D6E C;  5CBA E;  3I4M B;  3GV3 A;  1OXU A;  1ILQ A;  2SNM A;  4IFD J;  1X32 A;  3A7A B;  4FF2 A;  2AWO A;  1SNC A;  1AZP A;  2KEE A;  2NUC A;  5M3F B;  1SNM A;  2ZXO A;  4K8J A;  1PLF A;  2R93 B;  3HG9 A;  4CJ2 C;  1CTM A;  3MXG A;  5JVG 3;  1PTO B;  4OIJ A;  4PMC A;  3T4A C;  2OT2 A;  4KKS A;  4BA1 I;  4C1N K;  1D2B A;  4DAY A;  1VF7 A;  2JA8 B;  5C44 B;  5EKK A;  5FK9 C;  3VA7 A;  1I4H A;  4C3I G;  4OL7 A;  1KDA A;  1JOO A;  2FHT A;  1G29 1;  4ID6 A;  3S15 B;  4OHJ A;  3RZO B;  2CVR A;  3H09 A;  4CKC A;  3A54 A;  1U4P A;  1TY2 A;  2RA4 A;  4KHZ A;  1X3P A;  2PPB C;  2RKS A;  4CHT B;  4F88 A;  4KY5 A;  2NTT A;  5CBE E;  4HTH A;  2PCF B;  1PTO C;  1EU4 A;  3AU7 A;  1RTN A;  4I7Z C;  4RCN A;  1K83 B;  3K6O A;  2M2L A;  2IX1 A;  3I8Z A;  3CRL C;  3Q22 A;  4KMU C;  1LTI D;  1ROD A;  2G9H D;  4UDU C;  2K5Q A;  5FO9 B;  1GHK A;  2F0N A;  5ELB A;  4CJ1 B;  1SYG A;  2IX3 A;  4J1M A;  1QOH A;  1I4Q A;  4H0L C;  4LK1 C;  3NQT A;  5J1Z A;  2BOS A;  4OGQ C;  5JPM C;  4TKO B;  3M85 A;  1DM0 B;  2EYF A;  3HOW B;  5M5Y B;  3P7J A;  1HA6 A;  2F0G A;  1EWC A;  2E2D C;  3QG1 A;  1JWS D;  1O7Y A;  3IL8 A;  2WP8 J;  3C3L A;  3GV6 A;  4RGN A;  1SYD A;  1GUW A;  5BN4 A;  2R6G A;  2AQ1 B;  4Y7N B;  5A2Q L;  3KBG A;  2D5D A;  2EOT A;  3I73 A;  4K8I A;  5FKA C;  4A3E B;  1KLG D;  3HS0 C;  3X3M A;  1H9S A;  5FOB B;  3TSS A;  3L3O C;  3QOJ A;  4RKL A;  3S2D B;  1STB A;  1NCV A;  2EYP A;  3KBX A;  1WTO A;  3HOZ B;  1TS4 A;  4CGY B;  1TKW B;  4V0B A;  2AWN A;  4EQN A;  3BDC A;  2PYK A;  2SOB A;  2JA5 B;  3VR4 A;  4KHV A;  2F0V A;  1F2Z A;  3T51 B;  1X3Q A;  1UNS A;  3GO5 A;  1B50 A;  2HUG A;  4P2C B;  1R4P B;  1Z6H A;  4ULL A;  2PO4 A;  1K8M A;  4A3I B;  2EYL A;  1B3A A;  5E3F A;  3SR1 A;  1IW7 D;  1FNV A;  3PMF A;  1QG7 A;  1SYF A;  3FEW X;  1Q8I A;  3J81 E;  3D31 A;  3HP3 A;  5EPJ A;  2RDF A;  5M5W B;  2CW0 D;  4LMQ D;  2B39 A;  4DN4 M;  3NK9 A;  1LO5 D;  4C3J B;  4X3S A;  4NKL A;  1DD2 A;  1STH A;  4L63 B;  4DXG A;  1ZEQ X;  5FO7 B;  1EU3 A;  4JK1 C;  4XYO A;  5KND A;  1WTQ A;  1H9S B;  4FF3 A;  3CKI B;  4KD3 A;  3T16 A;  1HUN A;  3S1M B;  1BF4 A;  4U67 3;  1OXT A;  1YNN C;  4IUP A;  1TS2 A;  3BVZ A;  2F0Q A;  1B53 A;  1TII D;  4DK1 A;  1I50 B;  4DFA A;  5EPL A;  2F0M A;  1HUM A;  2Q8R E;  2KQ3 A;  4IUT A;  1LTS D;  5C0X H;  2KCC A;  1KDC A;  2JP1 A;  3HOU B;  5EBC A;  2WKC A;  4R9W A;  1MGS A;  3PUY A;  1BUV T;  3GD7 A;  5M5X B;  2O5J C;  3OSO A;  1VMP A;  3E5S A;  1E2W A;  1VCI A;  1EZ6 A;  1LT5 D;  5HGT A;  1A3V A;  2SEB D;  4PV1 C;  3W3A A;  1J9O A;  2ZT9 C;  2H1E A;  3LWU A;  4HSP A;  3GTK B;  2XVS A;  3GTL B;  1ILP A;  1T5X D;  5D3D A;  4EQO A;  1H9R A;  2L5T A;  4G4K A;  4ODG A;  4E6I A;  1JR0 D;  1QCB D;  3M7G A;  1II3 A;  4IUV A;  1EY6 A;  2ICI A;  3CQZ B;  2F0P A;  2NVY B;  4FXD A;  4HAE A;  1RTO A;  1AN8 A;  2LY7 A;  2F4I A;  1Y1W B;  4XT3 B;  3SK5 A;  4WRD A;  2FMC A;  3DHQ A;  3I3C A;  4DU9 A;  2F0D A;  1QNK A;  3GP7 A;  2Y0S B;  1A6X A;  2VB3 X;  4TRD A;  4G7H C;  4XDX A;  4FF4 A;  4XQN A;  5I6Y A;  3Q6S A;  3S14 B;  3E0J A;  1BQQ T;  1F9P A;  1E2V A;  4KJO A;  3AMU A;  5CGK A;  5BN5 A;  1HHV A;  4ZK9 B;  3EJI A;  4Q5V A;  5DM7 3;  1PZI D;  4QIW B;  3OWF A;  2ENB A;  1S5D D;  4RA8 A;  3GQB A;  1BOS A;  1CK1 A;  3NWS A;  2A5H A;  3I70 A;  2L12 A;  1GUG A;  4PQX A;  4BY7 B;  5IIF A;  5JEA J;  1I6V C;  3N6R A;  4K5V A;  5K5P A;  1PFM A;  3KLS X;  3QB3 A;  1SNP A;  2FJ2 A;  5K36 G;  3J7A F;  5I2Y A;  3OW7 A;  3EVQ A;  5IGF A;  1D1I A;  3BZD B;  1LLR D;  1V43 A;  4K5X A;  3TP8 A;  4L8J A;  4WJW A;  5COY A;  3TN2 A;  3E6Z X;  1RKN A;  3F2U A;  3VYS A;  2HDL A;  4HSV A;  4ZYS A;  1A2T A;  3M3Y B;  4QUF A;  1TT2 A;  4HCS A;  3I72 A;  5F2D A;  2LKV A;  2K04 A;  4C2M B;  2I46 A;  3NHH A;  4G57 A;  2RBM A;  4RKB A;  1Y8N B;  3IFT A;  2AUK A;  3S9W A;  1PTO F;  5T1I A;  3SVM A;  1S5C D;  4ZRZ A;  1M4V A;  1F77 A;  2N88 A;  3HGB A;  1SXT A;  3J7Y W;  1JWM D;  1A15 A;  3S1R B;  3MC0 B;  2K5D A;  2N55 A;  3K7A B;  1C48 A;  3MHB A;  1Y8O B;  1K8O A;  2MJ8 A;  1EQV A;  2F3V A;  2Q8I B;  2EJF C;  2XSC A;  5A35 A;  1JOR A;  3MA2 B;  5D14 A;  3R8B A;  4BWG B;  5LL6 S;  3V96 A;  4IFD I;  2EJG C;  3DWQ A;  5ISR A;  4IUQ A;  1NR4 A;  2OEO A;  4HMJ A;  1F9R A;  1MSH A;  2F0E A;  4IUR A;  3KLR A;  1CZW A;  1B2T A;  2Z4I A;  3V05 A;  4PMB A;  1ET9 A;  1HPC A;  3W2D A;  2GA4 B;  1HXY D;  4C56 C;  1EY8 A;  5DAU A;  3J80 L;  3GTM B;  1PZJ D;  2XWB B;  2F0T A;  3MXP A;  1UUP A;  4DNR B;  5CYU A;  5C4H A;  1JWU D;  1BDO A;  5KIX A;  2NVQ B;  1WCM B;  2YU9 B;  5FO8 B;  3LNN A;  3NSW A;  1SE2 A;  3Q24 A;  2DNE A;  1TVX A;  5EBD A;  1PFN A;  1HCZ A;  4O1N A;  2E74 C;  5CV8 A;  1F2M A;  5I4D A;  5FLX E;  3M4Y A;  1CFM A;  1ZYR D;  2B63 B;  1D5X C;  4CKB A;  2XNA C;  2QIL A;  1D1K A;  1SE3 A;  1AW7 A;  1JCK B;  2JSO A;  2ZXP A;  1A3U A;  5IGC A;  2JEB I;  1SYB A;  3HOY B;  1SSO A;  3LX0 A;  4QB4 A;  3U9S A;  3D4D A;  3L9A X;  2WB1 B;  4A3D B;  1XWE A;  4O42 A;  1AFP A;  1QWY A;  3TDQ A;  3PIO 3;  2B2T A;  2BA0 A;  2O2L D;  3MEH A;  1IHZ A;  2EE1 A;  4N9T A;  3I90 A;  1Q12 A;  1STA A;  5CMD A;  1JE4 A;  1BR9 A;  3NBH A;  4QF4 A;  1EQT A;  1LT6 D;  1I4G A;  3NBI A;  3C1E A;  1SYE A;  1EL0 A;  1O80 A;  2MPM A;  2QCP X;  4V19 0;  3GTO B;  4ZUJ A;  4F8M A;  1PRT F;  5C4X B;  4DAV A;  5KGU A;  3TZU A;  2IJ0 A;  2R92 B;  1KNE A;  1IKL A;  1V1P A;  5JOB A;  3MXU A;  3VR6 A;  3SK8 A;  4ZLT F;  4EVO A;  1WD0 A;  2A68 C;  4ABN A;  5EPK A;  2F0W A;  4NMZ A;  1TS5 A;  4QUC A;  1IYU A;  2G9D A;  2F0F A;  5I9O A;  1BCP F;  2K32 A;  5C0X J;  1Y8P B;  4IUN A;  1KLU D;  3DWA A;  1CA5 A;  1G6Z A;  3U9O A;  4ZKC B;  5I2X A;  5ELF A;  5C4Z A;  1M8A A;  2PZU A;  1G91 A;  2RVL A;  1JIC A;  3DMU A;  1FYC A;  3JAM E;  1B9M A;  4Z9C B;  2K1B A;  2RDG A;  2A69 D;  3BYY B;  3PUV A;  3NTI A;  1GUT A;  2SDF A;  2VNU D;  3UI2 A;  4DGZ A;  3NTH A;  2F3W A;  2C9O A;  2D62 A;  3SK6 A;  5FLX L;  5IT9 E;  3BVG A;  3HOX B;  4A3B B;  4KY6 A;  1LTA D;  2MGS A;  3OPO A;  3IAY A;  3NWT A;  4G7O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...