4DGZA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dgzA00
4H7BA 4NDXA 3NUCA 1STNA 3QOLA 4QB4A 5IGBA 2F0KA 2F0HA 5HGTA 2F0OA 2OF1A 3P75A 5EGTA 5I9PA 4DGZA 2F0DA 2EYOA 3MEHA 3NK9A 2SNSA 4ZQ3A 3TP6A 3SK6A 2EY2A 3NXWA 1NUCA 3NQTA 4KTAA 2PW5A 1TR5A 1NSNS 4J1MA 4KY6A 5KYIA 4K2LA 4F8MA 2EYJA 1EYCA 5C5LA 3SHLA 3C1EA 2EY5A 4HMIA 4ZUIA 1SYEA 4K14A 1EY7A 4LAAA 4PMCA 5C4HA 3DHQA 1SYCA 4MIUA 4WRDA 2QDBA 5IGGA 3SXHA 2O4XA 4RKBA 2F0QA 3NP8A 2LKVA 5CV6A 4ME5A 4B9WA 1STGA 2RDFA 5CV8A 5C5MA 5J1ZA 2EY6A 2PW7A 3H6MA 3LX0A 4KD3A 4F7XA 1F2ZA 1SYDA 4NKLA 3SK8A 4G57A 2OXPA 3R3OA 2M00A 4J6HA 4KHVA 5KRUA 3OMGA 2PZWA 1ENCA 1JOQA 4RKLA 2F0FA 3D4DA 5J22A 1EY4A 2F0VA 5C3XA 4OL7A 3P1HA 4NMZA 2EY1A 1EZ6A 1F2MA 3MXPA 1STAA 5EKLA 2EXZA 4KD4A 1SNDA 3QOJA 4WORA 1A3VA 1JOOA 3D8GA 5E3FA 3TP5A 5CR3A 3T16A 2OEOA 4K5WA 1A3UA 2EYPA 3MHBA 4QF4A 1A2TA 4I65A 4K2KA 5IGFA 4QMGA 3ITPA 2F0NA 1EZ8A 2F0LA 5CV4A 4DFAA 2RBMA 3SK5A 3NHHA 3EVQA 1STHA 5C6AA 5J39A 1AEXA 1JORA 4EQPA 5K5PA 2RKSA 4N9PA 5IODA 4R8NA 2F3VA 1KDCA 3TP7A 3SR1A 5KEEA 2F0JA 3D4WA 2F0MA 3EJIA 1KABA 3OWFA 5EKKA 1TQOA 1A3TA 5E1FA 2F3WA 5C3WA 1SYFA 5M9OA 4HMJA 4S3SA 3OMCA 2KQ3A 1TT2A 2F0WA 5I9OA 5JAVA 5HURA 4KV6A 3T13A 5ISRA 2PZUA 2KHSA 2F0GA 1ENAA 5I6YA 2F0EA 1SYGA 1SYBA 2HQEA 3HEJA 1EY0A 4ODGA 4TRDA 5JOBA 1RKNA 3BDLA 2PQEA 3PMFA 3HZXA 3U9OA 4KJOA 5IGCA 4YIJA 4N9TA 1SNMA 5I6WA 2F0IA 5KIXA 2PYKA 4EQOA 3E5SA 5IOCA 1EY9A 1EY5A 1U9RA 4KY5A 1EYDA 4KY7A 1SNCA 4HTHA 5NUCA 1EY8A 4K5VA 1STYA 2SOBA 1EY6A 3OSOA 5DEHA 4NP5A 2EYFA 4K6DA 4IZ8A 1KDAA 2F0TA 2SNMA 5CV5A 1SNPA 2PZTA 5CV9A 3TP8A 5C4ZA 3ERQA 1F2YA 1KDBA 1A2UA 4EQNA 3TMEA 3C1FA 4DF7A 1KAAA 3MZ5A 3SK4A 4B9XA 4K5XA 4K8IA 5DAUA 4PMBA 3BDCA 4K8JA 1EYAA 4DU9A 2ENBA 1IHZA 5IGDA 5CGKA 5IGEA 2F0PA 1JOKA 2EYHA 2WACA 1EQVA 3MVVA 1SNQA 3S9WA 3D6CA 5F2DA 4IALA 4IUNA 2F0SA 5CC4A 2NUCA 1SNOA 2F0UA 3DMUA 4E6IA 3V2TA 5KGUA 3EROA 4KJNA 4EVOA 4ID6A 2EYLA 5CV7A 4PNYA 4ZUJA 3RUZA 3VA5A 2EYMA 5IIFA 1STBA 5KYLA 1II3A 3QB3A
chains in the Genus database with same CATH superfamily
2WKCA 4BBSB 3NUCA 4QB4A 5HGTA 2F0HA 1ML0D 1QVGA 1KTKA 3A56A 5IYBH 1O7LA 4P72A 5JVH3 3QWNA 4HSPA 4KTAA 1S4ZA 1E2VA 1YHBA 1TR5A 2B2TC 2XGTA 3H0GG 2EYJA 1EYCA 4IFDG 3J7ZC 4OONA 3LGJA 4K14A 3M7NA 3A5ZB 3KLSA 1KXLA 1FNUA 4XYOA 3I8ZA 2F0QA 2FINB 4OEMB 1SJED 1F2LA 3HOWH 1XPOA 1I4RA 2PW7A 2V4DA 3H6MA 3CCQA 1CQVA 3S1NH 3SK8A 4QY7A 4XT1B 3RN5A 3OWEB 3NBHA 3FVQA 1Q90A 3C46A 1HZCA 2P5ZX 4KLKA 1STAA 2E75C 2CQAA 3NWTA 4KD4A 3ULLA 4IN3A 1X32A 3I4LA 1NCVA 5C0XJ 1EWIA 2PQAB 4K2KA 4ZK9B 5IGFA 3MAQA 1AN8A 1MJCA 2H4OA 5ELCA 2K75A 4DFAA 2JA9A 1V8QA 3S1NB 3WDNA 3S17B 1KDCA 1KQSA 2L9HA 2ZTCA 2VUMB 2K5VA 1GM5A 1E2ZA 1Y8PB 3PUVA 5M5YH 3I7FA 4KN7C 1J5EQ 2F3WA 5C3WA 3J80E 3GTLB 1K0SA 4DAPA 5IE8A 4ZKCB 1TU2B 5EKIA 1PRTC 1S3OA 3I4OA 4BY7B 2BDNA 2KHSA 1MIUA 1I4HA 4KMUC 1EY0A 1XMQQ 2PQEA 2TSSA 3KK7A 2IX1A 5LMUQ 3GP7A 4EQOA 5IOCA 3VR4A 1D2BA 2K5HA 4JG2A 3QO2A 2SOBA 2NVYH 1MKHA 1RHPA 3TP8A 2CFMA 1WJJA 3CPFA 3PGZA 2MQHA 1W2BA 3H3VI 1B9NA 4LMQD 4A3FB 4DF7A 1QCBD 3E3XA 4K8IA 3F2DA 1I94Q 4LF5Q 4DU9A 3H0GB 2LXJA 3BDOA 4OO1G 4L6TB 1EFID 1HH2P 5M3FB 3PO3G 4PNYA 4FXGC 1D5MC 2K7VA 2NVTH 2PCFB 3MWYW 2BA0A 1H9KA 5FLXE 4WJWA 1PV4A 1WD0A 1NNXA 1HFNA 3NXWA 2AUKA 1NUCA 4KHPQ 5EPKA 4XDXA 1QZGA 1M8AA 1TS4A 4DUZL 2Z6BA 3F2UA 2VB3X 4HJ8A 3GTMH 2HUGA 1F9QA 3QJYA 4A3MB 4RKBA 1Q12A 2I5LX 1IKMA 3K5MA 2XNAC 3N6RA 4H13C 4BY1G 1SYDA 4HIDA 5JVG3 1EYGA 2RDHA 1S5FD 1NJIC 1LTRD 3U9SA 1EEID 3D8GA 4JI7L 5FO9B 4ALPA 4AH6A 2A19A 3MXNA 1G51A 2EYPA 4RGTA 1A2TA 1R9TB 3CCUA 4JI5Q 5J39A 4DK6C 4EQPA 2R92H 4CKCA 5IODA 2KVMA 3S1QB 4ME3A 3NBHB 3EJIA 3RMHA 4PV1C 4LNQA 1I6HH 4C2MB 2Q8TA 1TWAB 3MXUA 3T13A 3R8BA 1D5ZC 2F0GA 1RKNA 4BBSG 4L8JA 2F3IA 3KJOA 3W2DA 2HIVA 4KKSA 4N9TA 4AYBG 3GTKB 2JXMB 1EY9A 4FNFA 5I4DA 2CHBD 2Q8RE 5JPMC 2K33A 2N8NA 2KBNA 2EXDA 2A1AA 2ID0A 3GTQH 2Q8IB 5ELBA 3U4VA 1EL0A 5C3EH 1B4OA 4DNIA 4A3KH 3TS0A 3BDCA 2WACA 1U4RA 2N88A 2BA1A 4JW0A 1X65A 1RTNA 3BS1A 4EGVA 1TWHH 1PH7A 1Q7YC 4GLXA 1I4XA 1XNRQ 4YCVA 5CYUA 2EY2A 2B2VA 3TZDA 3CC4A 1VS0A 1FGUA 3PUZA 3P20A 4X3TA 3VA7A 4DV5Q 4PQXA 3VYSA 4ILWA 4BBRH 1B53A 1D7QA 1W6KA 1HNWL 1SN8A 1CKNA 2RF4A 4JI5L 2KCMA 3VR5A 3L7ZC 1QVFA 1GJXA 2D62A 1IL8A 1UUPA 4J6HA 1VQMA 1CSPA 1ENCA 4YWKA 3BVGA 4BY7G 1DD2A 1ICFB 1HCZA 3J7YW 2UUCQ 1WVLA 2IX3A 2E2IB 4IUTA 1C4QA 4KKUA 1IYUA 1J6QA 3MA2B 1QUQB 2N49A 3J81i 2RDGA 2EQSA 4A3EB 1VDZA 1JB3A 2YU9B 3RD4A 3RZOB 1OXTA 3CHBD 3HOYH 1UEBA 1NTGA 5DM63 2HDMA 3RR5A 4RG1A 1FL0A 1MI2A 1K3BC 1GUOA 4B3SL 4BXXH 1TS2A 2B8GA 1HR0W 1B3AA 4KKTA 4LFBL 1AZPA 1PH3A 2LMCB 4C3JG 5HURA 4KV6A 5M3FG 4M1UB 3QG1A 5CBEE 3J7A5 2QKIC 3URYA 3M4OB 1HXYD 2I5MX 2EVBA 3DM3A 4IOCA 5JJIA 2IT1A 1PDQA 1CTMA 3WWVA 3PIPA 1B44D 3D4RA 2VQFQ 3S1RH 5C4ZA 3S1QH 4GLAC 1JT8A 3IFTA 3NTHA 2WB1B 2QEXA 1PZJD 1IBML 3R2IA 4JYAL 5FJ8G 4JI3L 2VS1A 2ALYB 1Q46A 1YNNC 4IPDA 3S9WA 1K8AC 2UXDL 1RL2A 3OIQA 1D1IA 2ZTEA 1H9SA 1BCPD 1BCPC 2EYLA 4LFAL 2EYMA 4B08A 3TQYA 4JI4Q 3GDEA 4BBRB 5LMNL 3FRPB 2FJ2A 3S14H 2Z1CA 2F0OA 2ZXOA 1HPCA 4JI1L 1PFBA 1HTLD 3A54A 3M7GA 1P8LA 4DKAC 1BXTA 3CRLC 3NQTA 5EPJA 1CHQD 1BQQT 1K83B 2Z0SA 1VQ7A 4HMIA 2IL8A 1WTPA 3C3LA 2K28A 2JA6B 1SYCA 1RJTA 2DJGC 4BBSH 4MN3A 1VQBA 1HFGA 1V1OA 2LKVA 3L2PA 3MXNB 3KFUA 1I4QA 2EE1A 3BVZA 2RHSB 3IKJA 4LF8Q 3G48A 1H9JA 3W1GA 2NN6G 1QUQA 4AIMA 4LF4Q 1Q8KA 3PO3B 3IRBA 4JOIA 4HJ5A 2EXZA 2NN6H 1YEZA 1L1OC 4CBVA 2DN8A 1XPRA 1N34L 1N33L 1XNQL 5A2QE 5D14A 3BZKA 4Z9CB 1WTWA 2BDOA 5IYBG 2JEBI 4DN4M 2F3VA 5FKAC 2E2IH 1PYWD 3K81C 2SDFA 4A3MG 1AW7A 5HY6A 3H94A 4DNTB 4GOPB 2F0MA 1K9MC 4A3BG 4DNRB 1TWGH 4QUCA 4YHHL 5M9OA 1Z6HA 4QIWB 4A3BH 1FR3A 1B7YB 5CBAE 4OO1I 2ZJPA 4FF3A 1SYBA 1HR0Q 3W1BA 3PO2H 3T4AC 3M85A 3F8TA 3BDLA 3I3CA 4JBMA 2A68D 1B9MA 1EY8A 4POGA 1GHJA 5GADC 1EEFD 3OSOA 2EIFA 5FLXL 2EYFA 4WFN3 3QR8A 4BBRG 5IWAQ 4A3DH 4A3CH 4NXNL 1VMCA 3PO2G 3S2DB 5K36H 2BH2A 1QG7A 1O7YA 2VL6A 2EYHA 3KOJA 1EQVA 1GOZA 2Z4HA 4QGUA 5C44B 1W6JA 5ELEA 1TWCH 4DAYA 1EQTA 4JVZA 5KYLA 5L37A 3O13A 2Z9HA 4FO2A 1BVSA 4CGYB 3GQBA 3QOLA 5G3LD 1KLGD 1S5ED 4TSSA 2F0KA 2BCOA 2Q2TA 4DR6L 4DR3L 1X3GA 4RA8A 2EJGC 2F0DA 2R7ZG 1BR9A 1VQIA 5FJ8H 2R7ZH 4BA2I 1IBKL 5C44G 4LF9L 1I50H 4V190 5T1GA 2KENA 2K5DA 3S1MH 1W3SA 2WINB 3L9AX 2A6HD 2EZVA 1EU4A 3E9HA 4ME5A 1LUZA 3A55A 3S17H 1I3QH 1S72A 4KD3A 3OW2A 4DUZQ 1V1PA 1PYSB 3J81c 1R4PB 3FP9A 3G71A 1I6HB 1PTOB 2EJMA 1C8CA 2F0FA 3P1HA 3HRZC 3C2PA 1HHVA 4BS9A 3IL8A 2VUMG 5DM73 3UDIA 4JI3Q 1YITA 1SE2A 3RLFA 4KI0A 4OHJA 5CV4A 2F0LA 4IFDI 4A3LG 1QJOA 3KLRA 5AJ3Q 3I55A 5G3LF 1I5FA 2L11A 2UUBL 3SR1A 2OQ0A 4FF4A 1S5BD 1RF2D 3D4WA 1SE3A 5ELDA 4MZ9A 1SYFA 4UDUC 4JPBW 4QIWE 4Y7NB 4DV0Q 2Z6KC 4DAYB 2KA7A 4IQZA 4X65Q 3PO2B 3SDZA 1Y8NB 4F87A 3DXJC 3I4NH 1JQYD 2XVSA 2RQXA 4X62Q 3TS2A 4YWMA 4FF2A 4LW1A 5H1SE 2L4NA 4DV7Q 5GAEC 1TKWB 3Q24A 4IPCA 4JC0A 4RHRA 4OELB 3TMEA 4L5RC 1H9MA 1RIPA 1Y1VG 2HT1A 2I46A 1WTXA 2ZXPA 3M9BA 2NUCA 3J7AF 3LWEA 2ZM6L 3K7AB 1TWCB 3GTQB 3T53B 1YIJA 4C3HG 1VQNA 2JA8B 2Y0SG 5LMNQ 1XYIA 1STNA 2D5DA 1GUNA 3L3OC 1KHIA 2JA5H 3NK9A 2MNAA 2QF7A 3SK6A 2A5HA 2K4KA 4HCEA 1JJCB 5CORA 4DV0L 1ZKOA 2K03A 2X69A 3OOCA 4F8MA 2O2LD 3SHLA 1SYEA 3AU7A 1SJHD 1JB7A 3K5OA 3D3RA 2LY7A 2BE5C 4BA1I 1K83H 1K8MA 1HZBA 1BOSA 2AKWB 4B9WA 4LF6L 4G7ZC 2XTIA 1JJGA 3W5OA 2CWPA 4L5QA 5IT9L 5KRUA 2PZWA 2KCTA 4C3IG 5JJZA 2QW7A 4XTCS 1B70B 4JI2Q 4JCVE 4HIMA 1HA6A 2DNEA 4C1NK 3DLLA 1H9RA 3TP5A 2R93H 4DR5L 3DWAA 3EQLC 1X54A 2IHEA 4IUQA 2A6HC 3ITPA 1AH9A 2H1EA 4JI0Q 1L2FA 3UE0A 1HNXL 3SK5A 3LWUA 1SFOH 1X3FA 4CKBA 1PH9A 4DR4Q 3DUZA 4A3GH 4UPAA 1V1PB 5KEEA 2PO4A 3NE5B 1L1OA 1LT5D 3H3VH 1IYVA 4CKEA 1CZWA 3FKIH 1YNXA 1KLUD 5IY0A 2KQ3A 2NWGA 1IBLL 4DK1A 4GN5A 1LTBD 4XQJA 3STBD 1IZ6A 1YJWA 2LSSA 4Q5VA 3M4QA 1NMFA 3VYUA 2E2DC 3F1ZA 2K05A 3RNUA 2JA8G 2SNMA 3FKIG 2PZTA 5CV9A 3OTOQ 2VW9A 4ZLTF 2PI2E 4X65L 2B2WC 4U68A 3VR2A 4XQQA 3BZCA 4X3KA 1HZAA 2K01A 3G6EA 3OYYA 3DMUA 1CKNB 3EROA 4ID6A 4ZUJA 4RAUC 4FYDA 2CCZA 2UUBQ 4HR7B 4DUYL 4BY1B 4X64Q 3D6WA 5AJ3L 2OF1A 2JA7G 5FLMG 3P7JA 1OXSC 1B2TA 4ZYSA 3KF6A 1SMYD 1VQKA 4KY6A 1B8AA 5KYIA 2XRSD 1VQ4A 3CU7A 5D65A 1ZYRD 5C4HA 3X3MA 4DAVA 2PQAA 3A74A 1PYBA 2O4XA 1O7ZA 1V1QA 5FOBB 2R93B 3D0FA 2EY6A 1HUMA 1VMPA 3CPWA 1BF4A 2K1BA 3GTKH 3N52A 4ZAIA 1JE5A 4FP5D 4RGOS 2PPBC 1Y69U 3CCEA 4G7HC 2FMMA 3KJPA 3T1HL 5J22A 4OL7A 3MXPA 1SSOA 4KK7A 4RH6A 1EQQA 1PH5A 4JI2L 2R7ZB 3QOJA 2ZJRA 2JA5G 1A3UA 1VF5C 2JYOA 1IBKQ 2MFIA 1NBWA 4C3HH 2E76C 2KJXA 1QNKA 2RBMA 1DOLA 4DR2Q 4DR3Q 3NHHA 4A3JH 4OWXB 2IY5B 1JWUD 1KL9A 3FPPA 4KN4C 3J81j 1SDFA 1SLJA 1Y1VH 4GNXC 1VQOA 3CKIB 2JA5B 1KAWA 2Z4IA 4BY1H 1VQ5A 1R9TH 1BCPB 3Q6SA 5J3BA 1JWSD 2F0WA 2YYZA 2HDLA 1O80A 1N9WA 4DV1L 1SYGA 3J7AV 4C3HB 3OPOA 2EPBA 2Y0SB 3CF5A 2A73B 2KUMA 4KJOA 2M9VA 3KUPA 4FVMA 1KRTA 1EIYB 1J9OA 3I73A 4LWCA 4I7AA 4C56C 3MXGA 1PFMA 4DAMA 2MO0A 4LF9Q 2IW3A 4HJAA 2HIXA 2J4XA 3GTGH 3CMAA 1AFPA 1ZEQX 2WB1E 5C4JH 1GKHA 4APVA 3K59A 4O0AA 2E2HB 4X3UA 3T1YL 1SRUA 2A6ED 1XXGA 2VQFL 1XMOL 1ILPA 3HOYB 3RZDH 3DM1A 3G6JB 1JWMD 1N36L 1O7IA 1YVCA 3CC2A 5EBCA 2IWHA 3X3NA 1CKMA 4F88A 4LJZC 1EIHA 1FNWA 1K0RA 1O78A 4OIKA 4GN3B 4JBWA 3TEHB 4A3FG 1N32Q 3S16B 5C4XG 4PMCA 1QILA 4CJ0B 3ND8A 2B2UC 1XPUA 1QWYA 5C5MA 1G8ZD 1U0LA 1WOCA 1NE3A 5C4XH 1E3PA 1RTOA 4R9WA 1E22A 3GV6A 1DM0B 2F0VA 5C3XA 3I2ZA 4TKOB 1F2MA 5FK9C 3NPPA 4Y7NH 1BO0A 5BR8Q 4X64L 3A8IE 4IOAA 5C4XB 3TSSA 4HEDA 1PH4A 2X6GA 1VQDA 4WORA 5M3FH 3CCJA 3SGIA 4QUFA 1MSHA 1S40A 4I65A 1UAPA 1CI3M 2XN9C 1C7YA 3ICEA 5ELNA 2F0NA 3HOUB 4BXXG 4YCWA 3H15A 1AEXA 1HJPA 5JJKA 4R8NA 1EOTA 3CQZB 2MPMA 1BBUA 2J0TD 2K32A 1G291 4YWLA 1EWHA 1BNZA 1DCZA 3S2HH 4DV5L 2A69C 1Q1EA 5I9OA 2XWBB 4C3IB 3EN2A 3HOVG 3FDTA 2HHHQ 4GNXB 3UDXA 2J7ZA 3HEJA 3S24A 1WTRA 3AEVA 4GKJQ 1BUVT 1ONLA 4QL5A 1XNRL 3HKZE 1CFMA 2BOSA 4UHVA 2PMZE 2F52A 2F0IA 5KIXA 3A0JA 4DXGA 2B63B 4KY7A 1SNCA 2B2UA 1MD2D 1YNJD 3BJUA 3HOYG 3ND9A 3HP3A 3JAME 1A6XA 1XWEA 5CV5A 1X9NA 2B63H 4OXPA 1J8IA 2TMPA 4RCNA 3RN2A 2A69D 1U4LA 4JI1Q 3C1FA 1KAAA 1WTHA 2NVQH 3PF5A 4K5XA 5DAUA 1VQAA 5IYDH 3MVVA 1JE4A 1JOKA 4NXMQ 1SNQA 2MHVA 4IALA 4B3SQ 5M5XB 5EQ0A 4GN4B 3V2TA 1Q82C 1KC8C 2QDLA 4DV4L 4AYBB 2KEEA 1STBA 1II3A 3I90A 3IAYA 1GVPA 4P73A 2ASBA 1OTCA 3P75A 1T5EA 1B3QA 2SNSA 3F2BA 3BG3A 2PNHA 5AFWA 3K0YA 2UU9Q 5IP7H 4J1MA 3A8KE 1Q81C 3AQQA 3I72A 4R4OA 2I0QA 2QDBA 4H02A 4R1JA 2WIIB 5GAHC 1STGA 2F4VQ 5FO8B 1X3EA 1WCMH 4NPSA 1LTGD 3ZJYC 4IURA 2OXPA 3NQIA 1P16A 2JJQA 1VQ6A 1RCVD 1CK1A 2WKDA 1I50B 3GTJB 2Q2IA 1VQ9A 3UDGA 3CP0A 2NZHA 5EPLA 3T16A 5C3EG 2G9DA 2AUJD 1G2SA 1T5XD 2K04A 3IFDA 1EIGA 3HS0C 3PCOB 4ZCKA 2L12A 1F9RA 1L0XB 1JR0D 1QNUA 2R93G 3R2TA 2A6EC 2D0PA 1TWFH 2MP1A 1FGBD 1Y1WG 2R7DA 1XJVA 1G6PA 3KF8A 4TQUS 5D3DA 3S2HB 1PMRA 3GTOB 2UUAL 5ISRA 4A3DB 5I6YA 3PQIA 2R3ZA 1VQGA 2R61A 1SE8A 3DWQA 3S2DH 5BR8L 4YIJA 5I6WA 3FHWA 2UXDQ 4PMWA 2AQ3B 4K5VA 4JYAQ 1PLFA 3KLSX 2JQOA 5IGGA 3K80C 2E2JB 1E0BA 1K28A 3KF8B 1L0YB 4OGQC 4EQNA 2E74C 4LFCQ 2DNCA 1MHWC 2CW0D 1EYAA 3GV3A 5ELFA 5IGDA 1DYQA 1G91A 2DUDA 2F0SA 5CC4A 2AQ2B 4V0BA 1IXRA 4KJNA 2B3GA 3T1HQ 2FFKB 1NR4A 4NDXA 5IGBA 4B3RQ 2NVYB 3RLNA 3VYTA 4A93H 5EGTA 1Z47A 4DGZA 3Q22A 1XMOQ 1XMQL 1EU3A 2N3SA 1QB5D 2GA4B 4K2LA 1UEAB 2C5CA 2D9UA 3KYHC 2EY5A 5I2YA 4B3MQ 3AB9A 1SAPA 3DWPA 1LTTD 4NW2A 1XX8A 3NP8A 5CV8A 4XYQA 4YY3Q 3HOWB 4YY3L 2XIWA 5M5YB 4KHVA 3CMEA 3AFPA 3MC0B 5LL6X 1JOQA 2QEJC 3K7UC 3D4DA 2LFNA 2QCPX 4MNOA 4OO1H 5T1IA 2UXCL 4X3SA 1HZ9A 5FLMH 4X62L 1JOOA 3GTJH 3GTGB 4K5WA 2OEOA 4K0KQ 1RDPD 1E1TA 3ULJA 1ASYA 3M3YH 2F1MA 3GTPH 2B63G 1K8GA 3EVQA 4PZ6A 2JA6G 4DK3C 4GKKL 3B6YA 1BBXC 1TWGB 1DOKA 5M3MB 2F0JA 5M5WH 2CKZB 4JI7Q 3EBEA 3MFYA 3T51B 3U50C 1I94L 2G5DA 3J80i 2K5WA 5E4WC 1TT2A 2AWNA 4LFCL 3GD7A 1SROA 2RHQB 3CCLA 1Y1VB 1TWFB 4QCLA 4UAIA 3I4NG 1C9OA 3CW2C 4P74A 5IGCA 1ENFA 2OCEA 3HOUG 2PYKA 2PNRC 4HIOA 3UE1A 3BZDB 4FF1A 1LM0A 3U9OA 1ZYRC 1YHAA 2G9HD 1AE2A 4UP9A 4R4IA 1F2YA 3HGBA 1IW7D 5C4JB 4A3BB 3VR3A 5ELOA 3I4NB 2JA7B 3PUXA 1B1ZA 2L0CA 3S1MB 1LTAD 2F0PA 1H95A 2HD3A 3E6ZX 4E6IA 1JCKB 1HQRD 3KBGA 4EVOA 1HNZQ 5IIFA 1Q3LA 1WFQA 4LF5L 1S5DD 4B3TQ 1GO3E 1D8LA 3S15B 2RVLA 2HCIA 1D5XC 2EYOA 3MEHA 4ZQ3A 1JICA 3R93A 4H0LC 1Q1BA 1A0IA 4IFDH 3K5LA 2PW5A 2X6LA 2ZT9C 1CM9A 5C44H 1Q8IA 4Q0FA 1U4PA 1EY7A 4A3EH 4LAAA 2NVXB 2FXQA 1YJNA 2DGYA 5LMUL 2B2YC 5BN3A 4JBKA 1PRTB 3OTOL 4F7XA 2YTXA 1F2ZA 4HJ7A 3NENA 1BKBA 2JN4A 4K0KL 1YNND 2AQ1B 3PF4A 1SE4A 3HKZB 1EZ6A 1HA5A 2KCCA 1PH8A 1SNDA 1EUJA 5IT9E 5E3FA 1F9SA 4P71A 3MHBA 2ICIA 1XTDA 1CSQA 2HQLA 4L5TA 4POFA 4L5SA 2B2WA 1EZ8A 2VB2X 3JAMc 1Y1WH 1HR0L 1ILQA 4L63B 1QVCA 4DXFA 2A68C 3PV0A 1EQRA 5COYA 1KNEA 4DV7L 3E9IA 3E0JA 1FYCA 1TS5A 4YHHQ 3JC66 1YHQA 4PZ7A 3GTOH 1TQOA 4DR4L 1YZ6A 1M1KC 1JJ2A 5KNDA 1HTPA 3FKIB 3J80c 3TZUA 2V1CC 3I70A 3HOZH 2PI2A 1E1OA 1TY0A 3K0XA 3ER0A 3PUWA 4HCSA 2B2VC 4ODGA 2CW0C 2UXBL 1DONA 2UXBQ 1WD1A 3G7LA 5C3EB 4UY8C 2ZTDA 1UE1A 3K5NA 2DJFC 1EYDA 3M4OH 1N34Q 1K8OA 4LFBQ 3GTMB 1DJRD 4NP5A 4K6DA 1KDAA 2YV5A 3EA6A 3HOXG 1SNPA 2UU9L 4R4TA 4LUVA 5M3MH 3CAMA 4JI8L 1MGSA 1OO9B 1XTCD 1UE6A 4DPGA 2E8GA 2O5IC 5LL6S 4CJ1B 2ES2A 4DR7Q 2KOLA 5IT9c 4LK1C 1M4VA 3KF6B 5KGUA 4PG3A 1KIXA 3A5UA 4C3JH 1LTLA 4H7BA 3K6OA 1L0WA 2UUAQ 2VUMH 1QOHA 2K6AA 1SBBB 2ZM6Q 2JA8H 4DA2A 3HKZG 2R92B 1CQFA 2A8VA 3CXCA 5EBDA 1IKLA 1LABA 5C5LA 3C1EA 1PZID 1QZHA 1SMXA 4HSVA 2L15A 1M90C 3WOFA 1VCIA 1SFOB 2KCNA 3FMCA 3TRZA 4YCUA 4RKLA 3OHXC 4ABNA 3I4MB 2QGQA 3TREA 3K58A 2E5LL 2Z8LA 5CR3A 3J80L 2AWOA 4MHEA 1HNZL 1OXVA 5KNCA 2JA6H 1PTOF 2RCNA 3BYTB 2IHFA 2RKSA 3CCVA 2MGSA 4JK1C 1X3QA 4HAEA 1C48A 3OWFA 1NAPA 3G4SA 3M4YA 1A62A 4WJ3M 4P75A 2JEAI 4S3SA 1AP0A 4XQNA 1WTQA 2ATWA 5FLXc 2F0EA 2I5HA 4TRDA 1VQLA 4N8FA 4OX9Q 3EIVA 3CCRA 3HZXA 5DEHA 1LLRD 4J15A 3S15H 2ZXRA 1E7ZA 3ERSX 3S1RB 2EJFC 2CVRA 1YNJC 2NVQB 2NTSA 3ERQA 3J81E 2XWJB 3QIAA 4A3MH 3K8AA 2F4IA 4K8JA 2ENBA 3A7AB 5CGKA 1T9HA 4BY7H 3D6CA 1FNVA 3I56A 1YJ9A 1F9PA 4X66Q 4GKJL 2NZOA 2B2YA 2L1BA 3ULPA 2HHHL 3I4MH 1LO5D 2C9OA 4DR1L 5I9PA 4LF8L 3V05A 1E24A 2JK8A 4X66L 2MUYA 3TP6A 1VF7A 3SVMA 4ZUIA 2A74C 4AYBE 3DHQA 1A8VA 3PUYA 4B3ML 4A3GB 5C0XI 1VQEA 1R4QB 4RGNA 3HOZB 1PVOA 5J1ZA 3LX0A 1LV9A 4ULLA 3NELA 4NKLA 2F03A 4G57A 4HN7A 3H09A 3OIPA 2WV6D 4OWTB 3PO3H 3OMGA 2CH4A 4LFAQ 2XRQD 4DV6L 1MSGA 1A15A 1WTOA 4R8IA 1WYDA 2JSOA 2WAQG 4QQBX 1AE3A 3M4PA 4A3GG 3PIOA 1Y1WB 1KRSA 5JJLA 1DXMA 3I91A 3HOZG 1UWVA 3K57A 2VQEQ 2E2JH 4A3LH 3GO5A 3UDFA 4A3IH 1STHA 1BBWA 2KHIA 4JI8Q 4CHTB 3HOXB 4DR2L 1NY4A 1I3QB 3HKSA 1FD7D 4I7ZC 3PSIA 2RCFA 2WFWA 4LF6Q 3FPUB 2SEBD 2OWOA 3U58A 2IX0A 4JI6L 1FJGQ 5GAGC 5JEAH 2PZUA 2NTTA 4O1NA 1HUNA 2HQEA 1LT4D 3OW7A 4IUUA 3CCMA 4OWWB 1PA6A 3SEBA 1SNMA 1GD7A 4BWGB 1VQPA 2PMZB 3NWSA 5LHY1 3T1YQ 1G6ZA 4LUZA 4LF4L 2R92G 2H5XA 1STYA 2QA4A 4A93B 5CMDA 1H9SB 1PTOH 1J5EL 3UI2A 2R6GA 1Z7TA 1KDBA 1I4GA 3GTLH 1V43A 1U5KA 2B29A 4DUYQ 3HOUH 4KHZA 3WOEA 1EWCA 5F2DA 1CUKA 1U4MA 3KDFB 1WTVA 1VQ8A 5CV7A 3HOXH 1SXTA 3NBIA 4A4IA 4JI4L 1WI5A 4UP7A 4RHSA 4FDBA 3JAML 4IUPA 2NVTB 1HNWQ 1B50A 5IP9H 1VQFA 2NB0A 1K73C 2EOTA 1NSNS 4O2DA 4IJLA 1RODA 1PTOC 3NTKA 4DK0A 5IP9G 1G2TA 1LT6D 5A2QL 4R4CA 3F2CA 4EQ5A 2RDFA 4IPHA 4JBJA 1I4PA 4RCOA 1PFNA 5EAYA 1N8RC 3K7AH 5LMNW 2FHTA 2OTJA 4RGMA 1ESFA 2M00A 4CDCC 3NEMA 3CCSA 4HJ9A 3HFZB 1I6VC 2K5QA 1LTSD 4DV2Q 4CJ2C 4DV4Q 3H91A 1FVIA 1Z9FA 1UE5A 4C1NI 5BN5A 2E2HH 4A3DG 4A3CG 3A8JE 1ESRA 4NXML 2M2LA 3AFQA 1JORA 2RSOA 3MEFA 3BVMA 5K5PA 1SMYC 3TP7A 4CDFC 2DY8A 1DGSA 5GROA 1PH2A 1LYLA 3S16H 1GUWA 4XIGS 4HIKA 1KABA 1MJEA 1ICWA 1A3TA 5E1FA 4A93G 4TVAB 4ZRZA 3E0EA 4DV3Q 2GN5A 4FXKC 4Y52H 4P2CB 3OMCA 2VZAA 4GLVB 4A3EG 3DEPA 4IUVA 4OIJA 3J81L 4C3IH 3PMFA 1TVXA 2NYZD 3CQZH 4LUOA 2YU9H 3A7LA 2B39A 5NUCA 3RLOA 3AMUA 1S5CD 2N78A 5EJWA 2YTVA 1ASZA 2ICEC 3KLWA 4GKKQ 4C3JB 1A2UA 2JP1A 4N8X1 5C0XG 1ET9A 4JOIC 3VYRA 3NTIA 3STBC 1JC7A 1IHZA 3HOVB 5IGEA 1YBYA 3M3YB 1SR3A 5IWAL 2D2CC 1GHKA 1X56A 2F0UA 2UXCQ 1GUTA 5DLQE 2CH4W 1CA6A 2KECA 1BDOA 3QB3A 2WAQB 2FMCA 4RMFA 3HOWG 1PH6A 2Z6KA 1Y14B 1TWHB 3MFGA 4DV3L 2K5NA 1ET6A 4IO9A 1EIFA 2DY7A 2Q2UA 5IYCH 3TDQA 2HCCA 1LTID 2LS01 3PIP3 4MIUA 2R7FA 2JE6I 3SXHA 4KHPL 5CV6A 3KDFA 3TBIB 1HNXQ 2YTYA 4JI0L 1Y8OB 4A3JB 4G4KA 4B3RL 4GZYC 3R3OA 1PXUA 4RFBA 3BU2A 4GOPA 2O5JC 4JI6Q 1EY4A 2Q2HA 1FJGL 2B2TA 1STEA 2EY1A 3HG9A 3PIO3 4A3IG 4AQYQ 1A3VA 1IYJB 1CT1D 1LT3D 3VDYA 2E5LQ 1EOVA 4QF4A 1C0AA 2BE5D 4PZ8A 3LNNA 4A3JG 1PH1A 1F77A 5I2XA 4H44C 4DR1Q 1PZKD 3U4ZA 5C6AA 4DR6Q 2L55A 4IJHA 3KBXA 4ZKBB 2EDGA 5GQOA 1YI2A 2RSNA 1RD9D 2VQEL 4A3IB 2VY3A 1NR2A 2Y0SE 2QILA 1BCPF 5JEAG 5HGQA 4CDDC 4LF7Q 4MTNA 2MJ8A 5EKKA 1TY2A 5FO7B 5A35A 4DV6Q 1TWAH 4MTKA 1PFSA 2N55A 3S14B 3H0GH 2L5TA 2GVAA 3BYYB 1PTOD 2LXKA 2BH8A 4IPGA 3W3AA 4J8QA 5IYDG 3ONAB 2AHOB 2K50A 2XSCA 1V9PA 3E5SA 2VNUD 5TSSA 4R4QA 2RA4A 4IZ8A 2F0TA 1HRJA 1L1OB 1PRTD 1CZGA 4NB3A 1TIID 3FEWX 4GOPC 1IBMQ 1UNSA 3L0OA 3SK4A 1ZXTA 5E4XA 3GTPB 4PMBA 2GVBA 4JV5Q 3CC7A 1E2WA 4IUNA 1MBYA 4A75A 1CA5A 1N32L 3MTSA 4XT3B 2IJ0A 3VR6A 2WB1G 1CKOA 1KNAA 4G7OC 2MO1A 1VQCA 3Q23A 1JMCA 1UE7A 1N33Q 1XNQQ 2OT2A 2KEDA 4GS3A 1N36Q 2C35B 4X6AH 3TN2A 4UP8A 4A76A 1X6OA 3I4MG 5D3IB 1OXXK 2IPKD 2NBFA 5DNFA 4WRDA 2WAQE 2K14A 1X55A 4JV5L 4FXDA 4K6LA 3NSWA 5JEAJ 3SE0A 1PRTF 1HQMC 4NMZA 1X3PA 5EKLA 1DZ1A 2AMCB 1D1KA 4QMGA 3JAMi 4WJ4A 1QE6A 2UUCL 1NMGA 5IP7G 1PHJA 2ZJQA 4DV1Q 2K52A 4O42A 5JPNC 3EFXD 4N9PA 4U673 4IFDJ 5E7NA 4C2MH 1IL2A 2NZ1D 2WP8J 3HOVH 1GUGA 1CHPD 1K3RA 1GXDC 1WCMG 4DR7L 1VQJA 4LF7L 3CD6A 1SEBD 1VQHA 1EFWA 4HMJA 1DOMA 3Q8DA 5JAVA 4M8AA 5KNBA 1D6EC 2NVXH 1ENAA 3V96A 1GUSA 5K36G 5JOBA 3DEOA 1OXUA 3ZYYX 1Q86C 2CQOA 4B3TL 1WCMB 1A63A 4KY5A 1EY5A 1U9RA 5IYCG 1IW7C 1IBLQ 3H3VC 3RZOH 2OTLA 5C0XH 4HTHA 1LACA 4AQYL 1KD1C 1EY6A 2NN6I 5M3MG 3D31A 4A3KB 3CRKC 2F4VL 3RZDB 3T56B 4A3FH 2D0OA 4NXNQ 4QJFA 5BN4A 3MZ5A 4B9XA 1TXYA 2CWAA 2B8FA 5M5WB 3Q0AA 4GNXA 2JA7H 4CDEC 2I07B 1SNOA 4XXEA 2VXWA 4RWSC 1AZQA 3AYHB 1TS3A 2KHJA 3RUZA 2OQKA 3VA5A 4EX5A 4DR5Q 4DV2L 4A3KG 4OX9L 5M5XH
chains in the Genus database with same CATH topology
2WKCA 4BBSB 3NUCA 4QB4A 5HGTA 2F0HA 1ML0D 1KTKA 3A56A 1O7LA 5JVH3 3QWNA 4HSPA 4KTAA 1S4ZA 1E2VA 1TR5A 2B2TC 2EYJA 1EYCA 4IFDG 4K14A 3M7NA 3KLSA 1FNUA 4XYOA 3I8ZA 2F0QA 2FINB 1SJED 1F2LA 1I4RA 2PW7A 2V4DA 3H6MA 1CQVA 3SK8A 4XT1B 3OWEB 3NBHA 3FVQA 1Q90A 3C46A 1STAA 2E75C 2CQAA 3NWTA 4KD4A 4IN3A 1X32A 3I4LA 1NCVA 5C0XJ 4ZK9B 4K2KA 5IGFA 3MAQA 1AN8A 2H4OA 5ELCA 4DFAA 1V8QA 3S1NB 3WDNA 3S17B 1KDCA 2L9HA 2VUMB 1E2ZA 1Y8PB 3PUVA 4KN7C 2F3WA 5C3WA 3J80E 3GTLB 4DAPA 4ZKCB 1TU2B 5EKIA 1PRTC 4BY7B 2BDNA 2KHSA 4KMUC 1I4HA 1EY0A 2PQEA 2TSSA 3KK7A 2IX1A 3GP7A 4EQOA 5IOCA 3VR4A 1D2BA 3QO2A 2SOBA 1RHPA 3TP8A 1B9NA 4LMQD 4A3FB 4DF7A 1QCBD 4K8IA 4DU9A 3H0GB 3BDOA 4OO1G 4L6TB 1EFID 5M3FB 4PNYA 4FXGC 1D5MC 2K7VA 2PCFB 3MWYW 2BA0A 1H9KA 5FLXE 4WJWA 1WD0A 1HFNA 3NXWA 2AUKA 1NUCA 5EPKA 4XDXA 1M8AA 1TS4A 3F2UA 2VB3X 2HUGA 1F9QA 3QJYA 4A3MB 4RKBA 1Q12A 1IKMA 3K5MA 2XNAC 3N6RA 4H13C 1SYDA 5JVG3 2RDHA 1S5FD 1LTRD 3U9SA 1EEID 3D8GA 5FO9B 3MXNA 2EYPA 4RGTA 1A2TA 1R9TB 5J39A 4EQPA 4CKCA 5IODA 2KVMA 3S1QB 3EJIA 3RMHA 4PV1C 4C2MB 2Q8TA 1TWAB 3MXUA 3T13A 3R8BA 1D5ZC 2F0GA 1RKNA 4L8JA 3W2DA 4KKSA 4N9TA 3GTKB 2JXMB 1EY9A 4FNFA 5I4DA 2CHBD 2Q8RE 5JPMC 2K33A 2ID0A 2Q8IB 5ELBA 1EL0A 1B4OA 3BDCA 2WACA 1U4RA 2N88A 2BA1A 1RTNA 3BS1A 4EGVA 1I4XA 5CYUA 2EY2A 2B2VA 3TZDA 3PUZA 3P20A 4X3TA 3VA7A 4PQXA 3VYSA 4ILWA 1B53A 1W6KA 3VR5A 3L7ZC 1GJXA 2D62A 1IL8A 1UUPA 4J6HA 1ENCA 3BVGA 1DD2A 3J7YW 1HCZA 1WVLA 2IX3A 2E2IB 4IUTA 1C4QA 4KKUA 1IYUA 3MA2B 2RDGA 4A3EB 1VDZA 1JB3A 2YU9B 3RD4A 3RZOB 1OXTA 3CHBD 5DM63 2HDMA 1MI2A 1GUOA 1TS2A 2B8GA 1B3AA 4KKTA 1AZPA 2LMCB 4C3JG 5HURA 4KV6A 4M1UB 3QG1A 5CBEE 2QKIC 3URYA 3M4OB 1HXYD 2EVBA 2IT1A 1PDQA 1CTMA 1B44D 3D4RA 5C4ZA 3IFTA 3NTHA 2WB1B 1PZJD 3R2IA 1YNNC 3S9WA 3OIQA 1D1IA 1H9SA 1BCPD 1BCPC 2EYLA 2EYMA 4B08A 4BBRB 3FRPB 2FJ2A 2Z1CA 2F0OA 2ZXOA 1HPCA 1PFBA 1HTLD 3A54A 3M7GA 1BXTA 3CRLC 3NQTA 5EPJA 1CHQD 1BQQT 1K83B 4HMIA 2IL8A 1WTPA 3C3LA 2K28A 2JA6B 1SYCA 1RJTA 4MN3A 1HFGA 1V1OA 2LKVA 1I4QA 2EE1A 3BVZA 3IKJA 1H9JA 2NN6G 3PO3B 2EXZA 2NN6H 4CBVA 2DN8A 5A2QE 5D14A 4Z9CB 1WTWA 2BDOA 2JEBI 4DN4M 2F3VA 5FKAC 1PYWD 2SDFA 1AW7A 3H94A 4DNTB 2F0MA 4DNRB 4QUCA 5M9OA 1Z6HA 4QIWB 1FR3A 5CBAE 4OO1I 4FF3A 1SYBA 3T4AC 3M85A 3BDLA 3I3CA 2A68D 1B9MA 1EY8A 1GHJA 1EEFD 3OSOA 5FLXL 2EYFA 4WFN3 1VMCA 3S2DB 5K36H 1QG7A 1O7YA 2EYHA 1EQVA 1GOZA 2Z4HA 5C44B 1W6JA 5ELEA 4DAYA 1EQTA 5KYLA 3O13A 4FO2A 4CGYB 3GQBA 3QOLA 5G3LD 1KLGD 1S5ED 4TSSA 2F0KA 2BCOA 4RA8A 2EJGC 2F0DA 1BR9A 4BA2I 4V190 5T1GA 2K5DA 2WINB 3L9AX 2A6HD 2EZVA 1EU4A 4ME5A 3A55A 4KD3A 1V1PA 1R4PB 1I6HB 1PTOB 2EJMA 1C8CA 2F0FA 3P1HA 3HRZC 3C2PA 1HHVA 4BS9A 3IL8A 5DM73 1SE2A 3RLFA 4KI0A 4OHJA 5CV4A 2F0LA 4IFDI 1QJOA 3KLRA 5G3LF 2L11A 3SR1A 4FF4A 1S5BD 1RF2D 3D4WA 1SE3A 5ELDA 1SYFA 4UDUC 4Y7NB 2KA7A 4IQZA 3PO2B 3SDZA 1Y8NB 4F87A 3DXJC 1JQYD 2XVSA 2RQXA 4FF2A 2L4NA 1TKWB 3Q24A 4RHRA 3TMEA 1H9MA 2I46A 1WTXA 2ZXPA 2NUCA 3J7AF 3LWEA 3K7AB 1TWCB 3GTQB 3T53B 4C3HG 2JA8B 1XYIA 1STNA 2D5DA 1GUNA 3L3OC 3NK9A 2QF7A 3SK6A 2A5HA 4HCEA 5CORA 1ZKOA 2K03A 2X69A 3OOCA 4F8MA 2O2LD 3SHLA 1SYEA 3AU7A 1SJHD 3K5OA 3D3RA 2LY7A 2BE5C 4BA1I 1K8MA 1BOSA 4B9WA 4G7ZC 5IT9L 5KRUA 2PZWA 4C3IG 5JJZA 4XTCS 1HA6A 2DNEA 4C1NK 1H9RA 3TP5A 3DWAA 3EQLC 4IUQA 2A6HC 3ITPA 2H1EA 3SK5A 3LWUA 4CKBA 3DUZA 1V1PB 5KEEA 2PO4A 3NE5B 1LT5D 1IYVA 4CKEA 1CZWA 1KLUD 2KQ3A 2NWGA 4DK1A 1LTBD 4XQJA 4Q5VA 3VYUA 2E2DC 2K05A 2SNMA 2PZTA 5CV9A 4ZLTF 2B2WC 4U68A 3VR2A 4XQQA 4X3KA 2K01A 3DMUA 3EROA 4ID6A 4ZUJA 4RAUC 4FYDA 4HR7B 4BY1B 3D6WA 2OF1A 3P7JA 1OXSC 1B2TA 4ZYSA 1SMYD 4KY6A 5KYIA 2XRSD 3CU7A 5D65A 1ZYRD 5C4HA 3X3MA 4DAVA 2O4XA 1O7ZA 5FOBB 2R93B 2EY6A 1HUMA 1VMPA 1BF4A 2K1BA 3N52A 4ZAIA 4FP5D 4RGOS 2PPBC 1Y69U 4G7HC 2FMMA 5J22A 4OL7A 3MXPA 1SSOA 4KK7A 4RH6A 2R7ZB 3QOJA 1A3UA 1VF5C 2JYOA 2E76C 2KJXA 1QNKA 2RBMA 1DOLA 3NHHA 1JWUD 3FPPA 4KN4C 1SDFA 3CKIB 2JA5B 2Z4IA 1BCPB 3Q6SA 1JWSD 2F0WA 2YYZA 2HDLA 1O80A 1SYGA 3J7AV 4C3HB 3OPOA 2EPBA 2Y0SB 2A73B 2KUMA 2M9VA 3KUPA 4KJOA 4FVMA 1J9OA 3I73A 4C56C 3MXGA 1PFMA 2IW3A 2J4XA 1AFPA 1ZEQX 3K59A 2E2HB 4X3UA 2A6ED 1XXGA 1ILPA 3HOYB 3DM1A 3G6JB 1JWMD 5EBCA 2IWHA 3X3NA 4F88A 4LJZC 1EIHA 1FNWA 1O78A 4OIKA 4JBWA 3S16B 4PMCA 1QILA 4CJ0B 3ND8A 2B2UC 1QWYA 5C5MA 1G8ZD 1RTOA 4R9WA 3GV6A 5C3XA 1DM0B 2F0VA 4TKOB 1F2MA 5FK9C 3NPPA 5C4XB 1BO0A 3A8IE 3TSSA 4HEDA 2X6GA 4WORA 4QUFA 1MSHA 4I65A 1UAPA 1CI3M 2XN9C 2F0NA 3HOUB 1AEXA 4R8NA 1EOTA 3CQZB 2MPMA 2J0TD 2K32A 1G291 1EWHA 1BNZA 1DCZA 2A69C 1Q1EA 5I9OA 2XWBB 4C3IB 3FDTA 2J7ZA 3HEJA 1WTRA 1BUVT 1ONLA 1CFMA 2BOSA 2F0IA 5KIXA 2B63B 4DXGA 4KY7A 1SNCA 2B2UA 1MD2D 1YNJD 3ND9A 3HP3A 3JAME 1A6XA 1XWEA 5CV5A 1J8IA 2TMPA 4RCNA 2A69D 1U4LA 3C1FA 1KAAA 4K5XA 5DAUA 3MVVA 1JE4A 1JOKA 1SNQA 2MHVA 4IALA 5M5XB 5EQ0A 3V2TA 4AYBB 2KEEA 1STBA 1II3A 3I90A 3IAYA 3P75A 1T5EA 2SNSA 3BG3A 5AFWA 3K0YA 4J1MA 3A8KE 3I72A 2QDBA 2WIIB 1STGA 5FO8B 1LTGD 4IURA 2OXPA 3NQIA 1RCVD 1CK1A 2WKDA 1I50B 3GTJB 5EPLA 3T16A 2G9DA 2AUJD 1G2SA 1T5XD 2K04A 3IFDA 1EIGA 3HS0C 2L12A 1F9RA 1L0XB 1JR0D 1QNUA 3R2TA 2A6EC 2MP1A 1FGBD 3KF8A 4TQUS 5D3DA 3S2HB 1PMRA 3GTOB 5ISRA 4A3DB 5I6YA 2R3ZA 2R61A 3DWQA 4YIJA 5I6WA 4PMWA 2AQ3B 4K5VA 1PLFA 3KLSX 5IGGA 2E2JB 1E0BA 1L0YB 4OGQC 4EQNA 2E74C 2DNCA 2CW0D 1EYAA 3GV3A 5ELFA 5IGDA 1DYQA 1G91A 2F0SA 5CC4A 2AQ2B 4V0BA 4KJNA 2FFKB 1NR4A 4NDXA 5IGBA 2NVYB 3VYTA 5EGTA 1Z47A 4DGZA 3Q22A 1EU3A 1QB5D 2GA4B 4K2LA 1UEAB 2C5CA 2D9UA 2EY5A 5I2YA 3AB9A 1SAPA 3DWPA 1LTTD 4NW2A 1XX8A 3NP8A 5CV8A 4XYQA 3HOWB 2XIWA 5M5YB 4KHVA 3MC0B 5LL6X 1JOQA 2QEJC 3D4DA 2LFNA 2QCPX 4OO1H 5T1IA 4X3SA 3GTGB 1JOOA 2OEOA 4K5WA 1RDPD 2F1MA 3EVQA 1BBXC 1TWGB 1DOKA 5M3MB 2F0JA 3MFYA 3T51B 2K5WA 5E4WC 1TT2A 2AWNA 3GD7A 1Y1VB 1TWFB 4QCLA 4UAIA 5IGCA 1ENFA 2PYKA 2PNRC 4FF1A 3BZDB 3U9OA 1ZYRC 2G9HD 1F2YA 3HGBA 1IW7D 5C4JB 4A3BB 3VR3A 3I4NB 2JA7B 3PUXA 1B1ZA 2L0CA 3S1MB 1LTAD 2F0PA 3E6ZX 4E6IA 1JCKB 1HQRD 3KBGA 4EVOA 5IIFA 1Q3LA 1S5DD 3S15B 2RVLA 2HCIA 1D5XC 2EYOA 3MEHA 4ZQ3A 1JICA 3R93A 4H0LC 1Q1BA 4IFDH 3K5LA 2PW5A 2X6LA 2ZT9C 1CM9A 1Q8IA 4Q0FA 1U4PA 1EY7A 4LAAA 2NVXB 2B2YC 5BN3A 1PRTB 4F7XA 1F2ZA 1YNND 2AQ1B 1SE4A 3HKZB 1EZ6A 1HA5A 2KCCA 1SNDA 5IT9E 5E3FA 1F9SA 2ICIA 3MHBA 2B2WA 1EZ8A 2VB2X 1ILQA 4L63B 4DXFA 2A68C 3PV0A 5COYA 1KNEA 1FYCA 3E0JA 1TS5A 1TQOA 5KNDA 1HTPA 3FKIB 3TZUA 3I70A 1TY0A 3PUWA 4HCSA 2B2VC 4ODGA 2CW0C 1DONA 1WD1A 3G7LA 5C3EB 3K5NA 1EYDA 1K8OA 3GTMB 1DJRD 4NP5A 4K6DA 1KDAA 3EA6A 1SNPA 1MGSA 1OO9B 1XTCD 2O5IC 5LL6S 4CJ1B 2KOLA 4LK1C 1M4VA 5KGUA 4H7BA 3K6OA 1QOHA 2K6AA 1SBBB 4DA2A 2R92B 1CQFA 5EBDA 1IKLA 1LABA 5C5LA 3C1EA 1PZID 4HSVA 3WOFA 1VCIA 1SFOB 2KCNA 3FMCA 4RKLA 3OHXC 4ABNA 3I4MB 3K58A 2Z8LA 5CR3A 3J80L 2AWOA 4MHEA 1OXVA 5KNCA 1PTOF 3BYTB 2RKSA 2MGSA 4JK1C 1X3QA 4HAEA 1C48A 3OWFA 1NAPA 3M4YA 2JEAI 4S3SA 1AP0A 4XQNA 1WTQA 2F0EA 4TRDA 3HZXA 5DEHA 1LLRD 2ZXRA 3S1RB 2EJFC 2CVRA 1YNJC 2NVQB 2NTSA 3ERQA 3J81E 2XWJB 3QIAA 2F4IA 4K8JA 2ENBA 3A7AB 5CGKA 3D6CA 1FNVA 1F9PA 2B2YA 2L1BA 1LO5D 2C9OA 5I9PA 3V05A 2MUYA 3TP6A 1VF7A 3SVMA 4ZUIA 2A74C 3DHQA 3PUYA 4A3GB 5C0XI 1R4QB 4RGNA 3HOZB 5J1ZA 3LX0A 1LV9A 4ULLA 4NKLA 2F03A 4G57A 4HN7A 3H09A 3OIPA 2WV6D 3OMGA 2XRQD 1MSGA 1A15A 1WTOA 4R8IA 2JSOA 1Y1WB 1DXMA 3I91A 3K57A 3GO5A 1STHA 4CHTB 3HOXB 1I3QB 1FD7D 4I7ZC 3FPUB 2SEBD 2IX0A 5JEAH 2PZUA 2NTTA 4O1NA 1HUNA 2HQEA 1LT4D 3OW7A 4IUUA 3SEBA 1SNMA 4BWGB 2PMZB 3NWSA 5LHY1 1G6ZA 1STYA 4A93B 5CMDA 1H9SB 1PTOH 3UI2A 2R6GA 1Z7TA 1KDBA 1I4GA 1V43A 4KHZA 3WOEA 1EWCA 5F2DA 1U4MA 1WTVA 5CV7A 1SXTA 3NBIA 4RHSA 3JAML 4IUPA 2NVTB 1B50A 2NB0A 2EOTA 1NSNS 1RODA 1PTOC 3NTKA 4DK0A 1G2TA 1LT6D 5A2QL 2RDFA 1I4PA 4RCOA 1PFNA 2FHTA 4RGMA 1ESFA 2M00A 1I6VC 2K5QA 1LTSD 4CJ2C 3H91A 4C1NI 5BN5A 3A8JE 1ESRA 2M2LA 1JORA 2RSOA 5K5PA 3BVMA 1SMYC 3TP7A 2DY8A 1GUWA 4XIGS 1KABA 1ICWA 1A3TA 5E1FA 4ZRZA 4FXKC 4P2CB 3OMCA 3DEPA 4IUVA 4OIJA 3J81L 3PMFA 1TVXA 2NYZD 3A7LA 2B39A 5NUCA 3AMUA 1S5CD 5EJWA 2ICEC 4C3JB 1A2UA 2JP1A 5C0XG 1ET9A 3VYRA 3NTIA 1JC7A 1IHZA 3HOVB 5IGEA 3M3YB 2D2CC 1GHKA 2F0UA 1GUTA 1CA6A 2KECA 1BDOA 3QB3A 2WAQB 2FMCA 1TWHB 3MFGA 1ET6A 2DY7A 3TDQA 2HCCA 1LTID 2LS01 3PIP3 4MIUA 2JE6I 3SXHA 5CV6A 3TBIB 1Y8OB 4A3JB 4G4KA 4GZYC 3R3OA 1PXUA 4RFBA 2O5JC 1EY4A 2B2TA 1STEA 2EY1A 3PIO3 3HG9A 1A3VA 1CT1D 1LT3D 4QF4A 2BE5D 3LNNA 1F77A 5I2XA 4H44C 1PZKD 5C6AA 2L55A 3KBXA 4ZKBB 2EDGA 2RSNA 1RD9D 4A3IB 1NR2A 2QILA 1BCPF 5JEAG 2MJ8A 5EKKA 1TY2A 5FO7B 5A35A 2N55A 3S14B 2L5TA 3BYYB 1PTOD 3W3AA 4J8QA 3ONAB 2XSCA 3E5SA 2VNUD 5TSSA 2RA4A 4IZ8A 2F0TA 1HRJA 1PRTD 1CZGA 1TIID 3FEWX 1UNSA 3SK4A 1ZXTA 5E4XA 3GTPB 4PMBA 1E2WA 4IUNA 1MBYA 1CA5A 3MTSA 4XT3B 2IJ0A 3VR6A 1KNAA 4G7OC 3Q23A 2OT2A 2KEDA 3TN2A 5D3IB 1OXXK 2IPKD 2NBFA 5DNFA 4WRDA 4FXDA 4K6LA 3NSWA 5JEAJ 3SE0A 1PRTF 1HQMC 4NMZA 1X3PA 5EKLA 1DZ1A 1D1KA 4QMGA 1QE6A 4O42A 5JPNC 4U673 3EFXD 4N9PA 4IFDJ 2NZ1D 2WP8J 1GUGA 1CHPD 1GXDC 1SEBD 4HMJA 1DOMA 5JAVA 4M8AA 5KNBA 1D6EC 1ENAA 3V96A 1GUSA 5K36G 5JOBA 3DEOA 1OXUA 3ZYYX 1WCMB 4KY5A 1EY5A 1U9RA 3H3VC 1IW7C 5C0XH 4HTHA 1LACA 1EY6A 2NN6I 3D31A 4A3KB 3CRKC 3RZDB 3T56B 5BN4A 3MZ5A 4B9XA 2B8FA 5M5WB 3Q0AA 2I07B 1SNOA 4XXEA 2VXWA 4RWSC 1AZQA 1TS3A 3RUZA 3VA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H7B A;  4NDX A;  3NUC A;  1STN A;  3QOL A;  4QB4 A;  5IGB A;  2F0K A;  2F0H A;  5HGT A;  2F0O A;  2OF1 A;  3P75 A;  5EGT A;  5I9P A;  4DGZ A;  2F0D A;  2EYO A;  3MEH A;  3NK9 A;  2SNS A;  4ZQ3 A;  3TP6 A;  3SK6 A;  2EY2 A;  3NXW A;  1NUC A;  3NQT A;  4KTA A;  2PW5 A;  1TR5 A;  1NSN S;  4J1M A;  4KY6 A;  5KYI A;  4K2L A;  4F8M A;  2EYJ A;  1EYC A;  5C5L A;  3SHL A;  3C1E A;  2EY5 A;  4HMI A;  4ZUI A;  1SYE A;  4K14 A;  1EY7 A;  4LAA A;  4PMC A;  5C4H A;  3DHQ A;  1SYC A;  4MIU A;  4WRD A;  2QDB A;  5IGG A;  3SXH A;  2O4X A;  4RKB A;  2F0Q A;  3NP8 A;  2LKV A;  5CV6 A;  4ME5 A;  4B9W A;  1STG A;  2RDF A;  5CV8 A;  5C5M A;  5J1Z A;  2EY6 A;  2PW7 A;  3H6M A;  3LX0 A;  4KD3 A;  4F7X A;  1F2Z A;  1SYD A;  4NKL A;  3SK8 A;  4G57 A;  2OXP A;  3R3O A;  2M00 A;  4J6H A;  4KHV A;  5KRU A;  3OMG A;  2PZW A;  1ENC A;  1JOQ A;  4RKL A;  2F0F A;  3D4D A;  5J22 A;  1EY4 A;  2F0V A;  5C3X A;  4OL7 A;  3P1H A;  4NMZ A;  2EY1 A;  1EZ6 A;  1F2M A;  3MXP A;  1STA A;  5EKL A;  2EXZ A;  4KD4 A;  1SND A;  3QOJ A;  4WOR A;  1A3V A;  1JOO A;  3D8G A;  5E3F A;  3TP5 A;  5CR3 A;  3T16 A;  2OEO A;  4K5W A;  1A3U A;  2EYP A;  3MHB A;  4QF4 A;  1A2T A;  4I65 A;  4K2K A;  5IGF A;  4QMG A;  3ITP A;  2F0N A;  1EZ8 A;  2F0L A;  5CV4 A;  4DFA A;  2RBM A;  3SK5 A;  3NHH A;  3EVQ A;  1STH A;  5C6A A;  5J39 A;  1AEX A;  1JOR A;  4EQP A;  5K5P A;  2RKS A;  4N9P A;  5IOD A;  4R8N A;  2F3V A;  1KDC A;  3TP7 A;  3SR1 A;  5KEE A;  2F0J A;  3D4W A;  2F0M A;  3EJI A;  1KAB A;  3OWF A;  5EKK A;  1TQO A;  1A3T A;  5E1F A;  2F3W A;  5C3W A;  1SYF A;  5M9O A;  4HMJ A;  4S3S A;  3OMC A;  2KQ3 A;  1TT2 A;  2F0W A;  5I9O A;  5JAV A;  5HUR A;  4KV6 A;  3T13 A;  5ISR A;  2PZU A;  2KHS A;  2F0G A;  1ENA A;  5I6Y A;  2F0E A;  1SYG A;  1SYB A;  2HQE A;  3HEJ A;  1EY0 A;  4ODG A;  4TRD A;  5JOB A;  1RKN A;  3BDL A;  2PQE A;  3PMF A;  3HZX A;  3U9O A;  4KJO A;  5IGC A;  4YIJ A;  4N9T A;  1SNM A;  5I6W A;  2F0I A;  5KIX A;  2PYK A;  4EQO A;  3E5S A;  5IOC A;  1EY9 A;  1EY5 A;  1U9R A;  4KY5 A;  1EYD A;  4KY7 A;  1SNC A;  4HTH A;  5NUC A;  1EY8 A;  4K5V A;  1STY A;  2SOB A;  1EY6 A;  3OSO A;  5DEH A;  4NP5 A;  2EYF A;  4K6D A;  4IZ8 A;  1KDA A;  2F0T A;  2SNM A;  5CV5 A;  1SNP A;  2PZT A;  5CV9 A;  3TP8 A;  5C4Z A;  3ERQ A;  1F2Y A;  1KDB A;  1A2U A;  4EQN A;  3TME A;  3C1F A;  4DF7 A;  1KAA A;  3MZ5 A;  3SK4 A;  4B9X A;  4K5X A;  4K8I A;  5DAU A;  4PMB A;  3BDC A;  4K8J A;  1EYA A;  4DU9 A;  2ENB A;  1IHZ A;  5IGD A;  5CGK A;  5IGE A;  2F0P A;  1JOK A;  2EYH A;  2WAC A;  1EQV A;  3MVV A;  1SNQ A;  3S9W A;  3D6C A;  5F2D A;  4IAL A;  4IUN A;  2F0S A;  5CC4 A;  2NUC A;  1SNO A;  2F0U A;  3DMU A;  4E6I A;  3V2T A;  5KGU A;  3ERO A;  4KJN A;  4EVO A;  4ID6 A;  2EYL A;  5CV7 A;  4PNY A;  4ZUJ A;  3RUZ A;  3VA5 A;  2EYM A;  5IIF A;  1STB A;  5KYL A;  1II3 A;  3QB3 A; 
#chains in the Genus database with same CATH topology
 2WKC A;  4BBS B;  3NUC A;  4QB4 A;  5HGT A;  2F0H A;  1ML0 D;  1QVG A;  1KTK A;  3A56 A;  5IYB H;  1O7L A;  4P72 A;  5JVH 3;  3QWN A;  4HSP A;  4KTA A;  1S4Z A;  1E2V A;  1YHB A;  1TR5 A;  2B2T C;  2XGT A;  3H0G G;  2EYJ A;  1EYC A;  4IFD G;  3J7Z C;  4OON A;  3LGJ A;  4K14 A;  3M7N A;  3A5Z B;  3KLS A;  1KXL A;  1FNU A;  4XYO A;  3I8Z A;  2F0Q A;  2FIN B;  4OEM B;  1SJE D;  1F2L A;  3HOW H;  1XPO A;  1I4R A;  2PW7 A;  2V4D A;  3H6M A;  3CCQ A;  1CQV A;  3S1N H;  3SK8 A;  4QY7 A;  4XT1 B;  3RN5 A;  3OWE B;  3NBH A;  3FVQ A;  1Q90 A;  3C46 A;  1HZC A;  2P5Z X;  4KLK A;  1STA A;  2E75 C;  2CQA A;  3NWT A;  4KD4 A;  3ULL A;  4IN3 A;  1X32 A;  3I4L A;  1NCV A;  5C0X J;  1EWI A;  2PQA B;  4K2K A;  4ZK9 B;  5IGF A;  3MAQ A;  1AN8 A;  1MJC A;  2H4O A;  5ELC A;  2K75 A;  4DFA A;  2JA9 A;  1V8Q A;  3S1N B;  3WDN A;  3S17 B;  1KDC A;  1KQS A;  2L9H A;  2ZTC A;  2VUM B;  2K5V A;  1GM5 A;  1E2Z A;  1Y8P B;  3PUV A;  5M5Y H;  3I7F A;  4KN7 C;  1J5E Q;  2F3W A;  5C3W A;  3J80 E;  3GTL B;  1K0S A;  4DAP A;  5IE8 A;  4ZKC B;  1TU2 B;  5EKI A;  1PRT C;  1S3O A;  3I4O A;  4BY7 B;  2BDN A;  2KHS A;  1MIU A;  1I4H A;  4KMU C;  1EY0 A;  1XMQ Q;  2PQE A;  2TSS A;  3KK7 A;  2IX1 A;  5LMU Q;  3GP7 A;  4EQO A;  5IOC A;  3VR4 A;  1D2B A;  2K5H A;  4JG2 A;  3QO2 A;  2SOB A;  2NVY H;  1MKH A;  1RHP A;  3TP8 A;  2CFM A;  1WJJ A;  3CPF A;  3PGZ A;  2MQH A;  1W2B A;  3H3V I;  1B9N A;  4LMQ D;  4A3F B;  4DF7 A;  1QCB D;  3E3X A;  4K8I A;  3F2D A;  1I94 Q;  4LF5 Q;  4DU9 A;  3H0G B;  2LXJ A;  3BDO A;  4OO1 G;  4L6T B;  1EFI D;  1HH2 P;  5M3F B;  3PO3 G;  4PNY A;  4FXG C;  1D5M C;  2K7V A;  2NVT H;  2PCF B;  3MWY W;  2BA0 A;  1H9K A;  5FLX E;  4WJW A;  1PV4 A;  1WD0 A;  1NNX A;  1HFN A;  3NXW A;  2AUK A;  1NUC A;  4KHP Q;  5EPK A;  4XDX A;  1QZG A;  1M8A A;  1TS4 A;  4DUZ L;  2Z6B A;  3F2U A;  2VB3 X;  4HJ8 A;  3GTM H;  2HUG A;  1F9Q A;  3QJY A;  4A3M B;  4RKB A;  1Q12 A;  2I5L X;  1IKM A;  3K5M A;  2XNA C;  3N6R A;  4H13 C;  4BY1 G;  1SYD A;  4HID A;  5JVG 3;  1EYG A;  2RDH A;  1S5F D;  1NJI C;  1LTR D;  3U9S A;  1EEI D;  3D8G A;  4JI7 L;  5FO9 B;  4ALP A;  4AH6 A;  2A19 A;  3MXN A;  1G51 A;  2EYP A;  4RGT A;  1A2T A;  1R9T B;  3CCU A;  4JI5 Q;  5J39 A;  4DK6 C;  4EQP A;  2R92 H;  4CKC A;  5IOD A;  2KVM A;  3S1Q B;  4ME3 A;  3NBH B;  3EJI A;  3RMH A;  4PV1 C;  4LNQ A;  1I6H H;  4C2M B;  2Q8T A;  1TWA B;  3MXU A;  3T13 A;  3R8B A;  1D5Z C;  2F0G A;  1RKN A;  4BBS G;  4L8J A;  2F3I A;  3KJO A;  3W2D A;  2HIV A;  4KKS A;  4N9T A;  4AYB G;  3GTK B;  2JXM B;  1EY9 A;  4FNF A;  5I4D A;  2CHB D;  2Q8R E;  5JPM C;  2K33 A;  2N8N A;  2KBN A;  2EXD A;  2A1A A;  2ID0 A;  3GTQ H;  2Q8I B;  5ELB A;  3U4V A;  1EL0 A;  5C3E H;  1B4O A;  4DNI A;  4A3K H;  3TS0 A;  3BDC A;  2WAC A;  1U4R A;  2N88 A;  2BA1 A;  4JW0 A;  1X65 A;  1RTN A;  3BS1 A;  4EGV A;  1TWH H;  1PH7 A;  1Q7Y C;  4GLX A;  1I4X A;  1XNR Q;  4YCV A;  5CYU A;  2EY2 A;  2B2V A;  3TZD A;  3CC4 A;  1VS0 A;  1FGU A;  3PUZ A;  3P20 A;  4X3T A;  3VA7 A;  4DV5 Q;  4PQX A;  3VYS A;  4ILW A;  4BBR H;  1B53 A;  1D7Q A;  1W6K A;  1HNW L;  1SN8 A;  1CKN A;  2RF4 A;  4JI5 L;  2KCM A;  3VR5 A;  3L7Z C;  1QVF A;  1GJX A;  2D62 A;  1IL8 A;  1UUP A;  4J6H A;  1VQM A;  1CSP A;  1ENC A;  4YWK A;  3BVG A;  4BY7 G;  1DD2 A;  1ICF B;  1HCZ A;  3J7Y W;  2UUC Q;  1WVL A;  2IX3 A;  2E2I B;  4IUT A;  1C4Q A;  4KKU A;  1IYU A;  1J6Q A;  3MA2 B;  1QUQ B;  2N49 A;  3J81 i;  2RDG A;  2EQS A;  4A3E B;  1VDZ A;  1JB3 A;  2YU9 B;  3RD4 A;  3RZO B;  1OXT A;  3CHB D;  3HOY H;  1UEB A;  1NTG A;  5DM6 3;  2HDM A;  3RR5 A;  4RG1 A;  1FL0 A;  1MI2 A;  1K3B C;  1GUO A;  4B3S L;  4BXX H;  1TS2 A;  2B8G A;  1HR0 W;  1B3A A;  4KKT A;  4LFB L;  1AZP A;  1PH3 A;  2LMC B;  4C3J G;  5HUR A;  4KV6 A;  5M3F G;  4M1U B;  3QG1 A;  5CBE E;  3J7A 5;  2QKI C;  3URY A;  3M4O B;  1HXY D;  2I5M X;  2EVB A;  3DM3 A;  4IOC A;  5JJI A;  2IT1 A;  1PDQ A;  1CTM A;  3WWV A;  3PIP A;  1B44 D;  3D4R A;  2VQF Q;  3S1R H;  5C4Z A;  3S1Q H;  4GLA C;  1JT8 A;  3IFT A;  3NTH A;  2WB1 B;  2QEX A;  1PZJ D;  1IBM L;  3R2I A;  4JYA L;  5FJ8 G;  4JI3 L;  2VS1 A;  2ALY B;  1Q46 A;  1YNN C;  4IPD A;  3S9W A;  1K8A C;  2UXD L;  1RL2 A;  3OIQ A;  1D1I A;  2ZTE A;  1H9S A;  1BCP D;  1BCP C;  2EYL A;  4LFA L;  2EYM A;  4B08 A;  3TQY A;  4JI4 Q;  3GDE A;  4BBR B;  5LMN L;  3FRP B;  2FJ2 A;  3S14 H;  2Z1C A;  2F0O A;  2ZXO A;  1HPC A;  4JI1 L;  1PFB A;  1HTL D;  3A54 A;  3M7G A;  1P8L A;  4DKA C;  1BXT A;  3CRL C;  3NQT A;  5EPJ A;  1CHQ D;  1BQQ T;  1K83 B;  2Z0S A;  1VQ7 A;  4HMI A;  2IL8 A;  1WTP A;  3C3L A;  2K28 A;  2JA6 B;  1SYC A;  1RJT A;  2DJG C;  4BBS H;  4MN3 A;  1VQB A;  1HFG A;  1V1O A;  2LKV A;  3L2P A;  3MXN B;  3KFU A;  1I4Q A;  2EE1 A;  3BVZ A;  2RHS B;  3IKJ A;  4LF8 Q;  3G48 A;  1H9J A;  3W1G A;  2NN6 G;  1QUQ A;  4AIM A;  4LF4 Q;  1Q8K A;  3PO3 B;  3IRB A;  4JOI A;  4HJ5 A;  2EXZ A;  2NN6 H;  1YEZ A;  1L1O C;  4CBV A;  2DN8 A;  1XPR A;  1N34 L;  1N33 L;  1XNQ L;  5A2Q E;  5D14 A;  3BZK A;  4Z9C B;  1WTW A;  2BDO A;  5IYB G;  2JEB I;  4DN4 M;  2F3V A;  5FKA C;  2E2I H;  1PYW D;  3K81 C;  2SDF A;  4A3M G;  1AW7 A;  5HY6 A;  3H94 A;  4DNT B;  4GOP B;  2F0M A;  1K9M C;  4A3B G;  4DNR B;  1TWG H;  4QUC A;  4YHH L;  5M9O A;  1Z6H A;  4QIW B;  4A3B H;  1FR3 A;  1B7Y B;  5CBA E;  4OO1 I;  2ZJP A;  4FF3 A;  1SYB A;  1HR0 Q;  3W1B A;  3PO2 H;  3T4A C;  3M85 A;  3F8T A;  3BDL A;  3I3C A;  4JBM A;  2A68 D;  1B9M A;  1EY8 A;  4POG A;  1GHJ A;  5GAD C;  1EEF D;  3OSO A;  2EIF A;  5FLX L;  2EYF A;  4WFN 3;  3QR8 A;  4BBR G;  5IWA Q;  4A3D H;  4A3C H;  4NXN L;  1VMC A;  3PO2 G;  3S2D B;  5K36 H;  2BH2 A;  1QG7 A;  1O7Y A;  2VL6 A;  2EYH A;  3KOJ A;  1EQV A;  1GOZ A;  2Z4H A;  4QGU A;  5C44 B;  1W6J A;  5ELE A;  1TWC H;  4DAY A;  1EQT A;  4JVZ A;  5KYL A;  5L37 A;  3O13 A;  2Z9H A;  4FO2 A;  1BVS A;  4CGY B;  3GQB A;  3QOL A;  5G3L D;  1KLG D;  1S5E D;  4TSS A;  2F0K A;  2BCO A;  2Q2T A;  4DR6 L;  4DR3 L;  1X3G A;  4RA8 A;  2EJG C;  2F0D A;  2R7Z G;  1BR9 A;  1VQI A;  5FJ8 H;  2R7Z H;  4BA2 I;  1IBK L;  5C44 G;  4LF9 L;  1I50 H;  4V19 0;  5T1G A;  2KEN A;  2K5D A;  3S1M H;  1W3S A;  2WIN B;  3L9A X;  2A6H D;  2EZV A;  1EU4 A;  3E9H A;  4ME5 A;  1LUZ A;  3A55 A;  3S17 H;  1I3Q H;  1S72 A;  4KD3 A;  3OW2 A;  4DUZ Q;  1V1P A;  1PYS B;  3J81 c;  1R4P B;  3FP9 A;  3G71 A;  1I6H B;  1PTO B;  2EJM A;  1C8C A;  2F0F A;  3P1H A;  3HRZ C;  3C2P A;  1HHV A;  4BS9 A;  3IL8 A;  2VUM G;  5DM7 3;  3UDI A;  4JI3 Q;  1YIT A;  1SE2 A;  3RLF A;  4KI0 A;  4OHJ A;  5CV4 A;  2F0L A;  4IFD I;  4A3L G;  1QJO A;  3KLR A;  5AJ3 Q;  3I55 A;  5G3L F;  1I5F A;  2L11 A;  2UUB L;  3SR1 A;  2OQ0 A;  4FF4 A;  1S5B D;  1RF2 D;  3D4W A;  1SE3 A;  5ELD A;  4MZ9 A;  1SYF A;  4UDU C;  4JPB W;  4QIW E;  4Y7N B;  4DV0 Q;  2Z6K C;  4DAY B;  2KA7 A;  4IQZ A;  4X65 Q;  3PO2 B;  3SDZ A;  1Y8N B;  4F87 A;  3DXJ C;  3I4N H;  1JQY D;  2XVS A;  2RQX A;  4X62 Q;  3TS2 A;  4YWM A;  4FF2 A;  4LW1 A;  5H1S E;  2L4N A;  4DV7 Q;  5GAE C;  1TKW B;  3Q24 A;  4IPC A;  4JC0 A;  4RHR A;  4OEL B;  3TME A;  4L5R C;  1H9M A;  1RIP A;  1Y1V G;  2HT1 A;  2I46 A;  1WTX A;  2ZXP A;  3M9B A;  2NUC A;  3J7A F;  3LWE A;  2ZM6 L;  3K7A B;  1TWC B;  3GTQ B;  3T53 B;  1YIJ A;  4C3H G;  1VQN A;  2JA8 B;  2Y0S G;  5LMN Q;  1XYI A;  1STN A;  2D5D A;  1GUN A;  3L3O C;  1KHI A;  2JA5 H;  3NK9 A;  2MNA A;  2QF7 A;  3SK6 A;  2A5H A;  2K4K A;  4HCE A;  1JJC B;  5COR A;  4DV0 L;  1ZKO A;  2K03 A;  2X69 A;  3OOC A;  4F8M A;  2O2L D;  3SHL A;  1SYE A;  3AU7 A;  1SJH D;  1JB7 A;  3K5O A;  3D3R A;  2LY7 A;  2BE5 C;  4BA1 I;  1K83 H;  1K8M A;  1HZB A;  1BOS A;  2AKW B;  4B9W A;  4LF6 L;  4G7Z C;  2XTI A;  1JJG A;  3W5O A;  2CWP A;  4L5Q A;  5IT9 L;  5KRU A;  2PZW A;  2KCT A;  4C3I G;  5JJZ A;  2QW7 A;  4XTC S;  1B70 B;  4JI2 Q;  4JCV E;  4HIM A;  1HA6 A;  2DNE A;  4C1N K;  3DLL A;  1H9R A;  3TP5 A;  2R93 H;  4DR5 L;  3DWA A;  3EQL C;  1X54 A;  2IHE A;  4IUQ A;  2A6H C;  3ITP A;  1AH9 A;  2H1E A;  4JI0 Q;  1L2F A;  3UE0 A;  1HNX L;  3SK5 A;  3LWU A;  1SFO H;  1X3F A;  4CKB A;  1PH9 A;  4DR4 Q;  3DUZ A;  4A3G H;  4UPA A;  1V1P B;  5KEE A;  2PO4 A;  3NE5 B;  1L1O A;  1LT5 D;  3H3V H;  1IYV A;  4CKE A;  1CZW A;  3FKI H;  1YNX A;  1KLU D;  5IY0 A;  2KQ3 A;  2NWG A;  1IBL L;  4DK1 A;  4GN5 A;  1LTB D;  4XQJ A;  3STB D;  1IZ6 A;  1YJW A;  2LSS A;  4Q5V A;  3M4Q A;  1NMF A;  3VYU A;  2E2D C;  3F1Z A;  2K05 A;  3RNU A;  2JA8 G;  2SNM A;  3FKI G;  2PZT A;  5CV9 A;  3OTO Q;  2VW9 A;  4ZLT F;  2PI2 E;  4X65 L;  2B2W C;  4U68 A;  3VR2 A;  4XQQ A;  3BZC A;  4X3K A;  1HZA A;  2K01 A;  3G6E A;  3OYY A;  3DMU A;  1CKN B;  3ERO A;  4ID6 A;  4ZUJ A;  4RAU C;  4FYD A;  2CCZ A;  2UUB Q;  4HR7 B;  4DUY L;  4BY1 B;  4X64 Q;  3D6W A;  5AJ3 L;  2OF1 A;  2JA7 G;  5FLM G;  3P7J A;  1OXS C;  1B2T A;  4ZYS A;  3KF6 A;  1SMY D;  1VQK A;  4KY6 A;  1B8A A;  5KYI A;  2XRS D;  1VQ4 A;  3CU7 A;  5D65 A;  1ZYR D;  5C4H A;  3X3M A;  4DAV A;  2PQA A;  3A74 A;  1PYB A;  2O4X A;  1O7Z A;  1V1Q A;  5FOB B;  2R93 B;  3D0F A;  2EY6 A;  1HUM A;  1VMP A;  3CPW A;  1BF4 A;  2K1B A;  3GTK H;  3N52 A;  4ZAI A;  1JE5 A;  4FP5 D;  4RGO S;  2PPB C;  1Y69 U;  3CCE A;  4G7H C;  2FMM A;  3KJP A;  3T1H L;  5J22 A;  4OL7 A;  3MXP A;  1SSO A;  4KK7 A;  4RH6 A;  1EQQ A;  1PH5 A;  4JI2 L;  2R7Z B;  3QOJ A;  2ZJR A;  2JA5 G;  1A3U A;  1VF5 C;  2JYO A;  1IBK Q;  2MFI A;  1NBW A;  4C3H H;  2E76 C;  2KJX A;  1QNK A;  2RBM A;  1DOL A;  4DR2 Q;  4DR3 Q;  3NHH A;  4A3J H;  4OWX B;  2IY5 B;  1JWU D;  1KL9 A;  3FPP A;  4KN4 C;  3J81 j;  1SDF A;  1SLJ A;  1Y1V H;  4GNX C;  1VQO A;  3CKI B;  2JA5 B;  1KAW A;  2Z4I A;  4BY1 H;  1VQ5 A;  1R9T H;  1BCP B;  3Q6S A;  5J3B A;  1JWS D;  2F0W A;  2YYZ A;  2HDL A;  1O80 A;  1N9W A;  4DV1 L;  1SYG A;  3J7A V;  4C3H B;  3OPO A;  2EPB A;  2Y0S B;  3CF5 A;  2A73 B;  2KUM A;  4KJO A;  2M9V A;  3KUP A;  4FVM A;  1KRT A;  1EIY B;  1J9O A;  3I73 A;  4LWC A;  4I7A A;  4C56 C;  3MXG A;  1PFM A;  4DAM A;  2MO0 A;  4LF9 Q;  2IW3 A;  4HJA A;  2HIX A;  2J4X A;  3GTG H;  3CMA A;  1AFP A;  1ZEQ X;  2WB1 E;  5C4J H;  1GKH A;  4APV A;  3K59 A;  4O0A A;  2E2H B;  4X3U A;  3T1Y L;  1SRU A;  2A6E D;  1XXG A;  2VQF L;  1XMO L;  1ILP A;  3HOY B;  3RZD H;  3DM1 A;  3G6J B;  1JWM D;  1N36 L;  1O7I A;  1YVC A;  3CC2 A;  5EBC A;  2IWH A;  3X3N A;  1CKM A;  4F88 A;  4LJZ C;  1EIH A;  1FNW A;  1K0R A;  1O78 A;  4OIK A;  4GN3 B;  4JBW A;  3TEH B;  4A3F G;  1N32 Q;  3S16 B;  5C4X G;  4PMC A;  1QIL A;  4CJ0 B;  3ND8 A;  2B2U C;  1XPU A;  1QWY A;  5C5M A;  1G8Z D;  1U0L A;  1WOC A;  1NE3 A;  5C4X H;  1E3P A;  1RTO A;  4R9W A;  1E22 A;  3GV6 A;  1DM0 B;  2F0V A;  5C3X A;  3I2Z A;  4TKO B;  1F2M A;  5FK9 C;  3NPP A;  4Y7N H;  1BO0 A;  5BR8 Q;  4X64 L;  3A8I E;  4IOA A;  5C4X B;  3TSS A;  4HED A;  1PH4 A;  2X6G A;  1VQD A;  4WOR A;  5M3F H;  3CCJ A;  3SGI A;  4QUF A;  1MSH A;  1S40 A;  4I65 A;  1UAP A;  1CI3 M;  2XN9 C;  1C7Y A;  3ICE A;  5ELN A;  2F0N A;  3HOU B;  4BXX G;  4YCW A;  3H15 A;  1AEX A;  1HJP A;  5JJK A;  4R8N A;  1EOT A;  3CQZ B;  2MPM A;  1BBU A;  2J0T D;  2K32 A;  1G29 1;  4YWL A;  1EWH A;  1BNZ A;  1DCZ A;  3S2H H;  4DV5 L;  2A69 C;  1Q1E A;  5I9O A;  2XWB B;  4C3I B;  3EN2 A;  3HOV G;  3FDT A;  2HHH Q;  4GNX B;  3UDX A;  2J7Z A;  3HEJ A;  3S24 A;  1WTR A;  3AEV A;  4GKJ Q;  1BUV T;  1ONL A;  4QL5 A;  1XNR L;  3HKZ E;  1CFM A;  2BOS A;  4UHV A;  2PMZ E;  2F52 A;  2F0I A;  5KIX A;  3A0J A;  4DXG A;  2B63 B;  4KY7 A;  1SNC A;  2B2U A;  1MD2 D;  1YNJ D;  3BJU A;  3HOY G;  3ND9 A;  3HP3 A;  3JAM E;  1A6X A;  1XWE A;  5CV5 A;  1X9N A;  2B63 H;  4OXP A;  1J8I A;  2TMP A;  4RCN A;  3RN2 A;  2A69 D;  1U4L A;  4JI1 Q;  3C1F A;  1KAA A;  1WTH A;  2NVQ H;  3PF5 A;  4K5X A;  5DAU A;  1VQA A;  5IYD H;  3MVV A;  1JE4 A;  1JOK A;  4NXM Q;  1SNQ A;  2MHV A;  4IAL A;  4B3S Q;  5M5X B;  5EQ0 A;  4GN4 B;  3V2T A;  1Q82 C;  1KC8 C;  2QDL A;  4DV4 L;  4AYB B;  2KEE A;  1STB A;  1II3 A;  3I90 A;  3IAY A;  1GVP A;  4P73 A;  2ASB A;  1OTC A;  3P75 A;  1T5E A;  1B3Q A;  2SNS A;  3F2B A;  3BG3 A;  2PNH A;  5AFW A;  3K0Y A;  2UU9 Q;  5IP7 H;  4J1M A;  3A8K E;  1Q81 C;  3AQQ A;  3I72 A;  4R4O A;  2I0Q A;  2QDB A;  4H02 A;  4R1J A;  2WII B;  5GAH C;  1STG A;  2F4V Q;  5FO8 B;  1X3E A;  1WCM H;  4NPS A;  1LTG D;  3ZJY C;  4IUR A;  2OXP A;  3NQI A;  1P16 A;  2JJQ A;  1VQ6 A;  1RCV D;  1CK1 A;  2WKD A;  1I50 B;  3GTJ B;  2Q2I A;  1VQ9 A;  3UDG A;  3CP0 A;  2NZH A;  5EPL A;  3T16 A;  5C3E G;  2G9D A;  2AUJ D;  1G2S A;  1T5X D;  2K04 A;  3IFD A;  1EIG A;  3HS0 C;  3PCO B;  4ZCK A;  2L12 A;  1F9R A;  1L0X B;  1JR0 D;  1QNU A;  2R93 G;  3R2T A;  2A6E C;  2D0P A;  1TWF H;  2MP1 A;  1FGB D;  1Y1W G;  2R7D A;  1XJV A;  1G6P A;  3KF8 A;  4TQU S;  5D3D A;  3S2H B;  1PMR A;  3GTO B;  2UUA L;  5ISR A;  4A3D B;  5I6Y A;  3PQI A;  2R3Z A;  1VQG A;  2R61 A;  1SE8 A;  3DWQ A;  3S2D H;  5BR8 L;  4YIJ A;  5I6W A;  3FHW A;  2UXD Q;  4PMW A;  2AQ3 B;  4K5V A;  4JYA Q;  1PLF A;  3KLS X;  2JQO A;  5IGG A;  3K80 C;  2E2J B;  1E0B A;  1K28 A;  3KF8 B;  1L0Y B;  4OGQ C;  4EQN A;  2E74 C;  4LFC Q;  2DNC A;  1MHW C;  2CW0 D;  1EYA A;  3GV3 A;  5ELF A;  5IGD A;  1DYQ A;  1G91 A;  2DUD A;  2F0S A;  5CC4 A;  2AQ2 B;  4V0B A;  1IXR A;  4KJN A;  2B3G A;  3T1H Q;  2FFK B;  1NR4 A;  4NDX A;  5IGB A;  4B3R Q;  2NVY B;  3RLN A;  3VYT A;  4A93 H;  5EGT A;  1Z47 A;  4DGZ A;  3Q22 A;  1XMO Q;  1XMQ L;  1EU3 A;  2N3S A;  1QB5 D;  2GA4 B;  4K2L A;  1UEA B;  2C5C A;  2D9U A;  3KYH C;  2EY5 A;  5I2Y A;  4B3M Q;  3AB9 A;  1SAP A;  3DWP A;  1LTT D;  4NW2 A;  1XX8 A;  3NP8 A;  5CV8 A;  4XYQ A;  4YY3 Q;  3HOW B;  4YY3 L;  2XIW A;  5M5Y B;  4KHV A;  3CME A;  3AFP A;  3MC0 B;  5LL6 X;  1JOQ A;  2QEJ C;  3K7U C;  3D4D A;  2LFN A;  2QCP X;  4MNO A;  4OO1 H;  5T1I A;  2UXC L;  4X3S A;  1HZ9 A;  5FLM H;  4X62 L;  1JOO A;  3GTJ H;  3GTG B;  4K5W A;  2OEO A;  4K0K Q;  1RDP D;  1E1T A;  3ULJ A;  1ASY A;  3M3Y H;  2F1M A;  3GTP H;  2B63 G;  1K8G A;  3EVQ A;  4PZ6 A;  2JA6 G;  4DK3 C;  4GKK L;  3B6Y A;  1BBX C;  1TWG B;  1DOK A;  5M3M B;  2F0J A;  5M5W H;  2CKZ B;  4JI7 Q;  3EBE A;  3MFY A;  3T51 B;  3U50 C;  1I94 L;  2G5D A;  3J80 i;  2K5W A;  5E4W C;  1TT2 A;  2AWN A;  4LFC L;  3GD7 A;  1SRO A;  2RHQ B;  3CCL A;  1Y1V B;  1TWF B;  4QCL A;  4UAI A;  3I4N G;  1C9O A;  3CW2 C;  4P74 A;  5IGC A;  1ENF A;  2OCE A;  3HOU G;  2PYK A;  2PNR C;  4HIO A;  3UE1 A;  3BZD B;  4FF1 A;  1LM0 A;  3U9O A;  1ZYR C;  1YHA A;  2G9H D;  1AE2 A;  4UP9 A;  4R4I A;  1F2Y A;  3HGB A;  1IW7 D;  5C4J B;  4A3B B;  3VR3 A;  5ELO A;  3I4N B;  2JA7 B;  3PUX A;  1B1Z A;  2L0C A;  3S1M B;  1LTA D;  2F0P A;  1H95 A;  2HD3 A;  3E6Z X;  4E6I A;  1JCK B;  1HQR D;  3KBG A;  4EVO A;  1HNZ Q;  5IIF A;  1Q3L A;  1WFQ A;  4LF5 L;  1S5D D;  4B3T Q;  1GO3 E;  1D8L A;  3S15 B;  2RVL A;  2HCI A;  1D5X C;  2EYO A;  3MEH A;  4ZQ3 A;  1JIC A;  3R93 A;  4H0L C;  1Q1B A;  1A0I A;  4IFD H;  3K5L A;  2PW5 A;  2X6L A;  2ZT9 C;  1CM9 A;  5C44 H;  1Q8I A;  4Q0F A;  1U4P A;  1EY7 A;  4A3E H;  4LAA A;  2NVX B;  2FXQ A;  1YJN A;  2DGY A;  5LMU L;  2B2Y C;  5BN3 A;  4JBK A;  1PRT B;  3OTO L;  4F7X A;  2YTX A;  1F2Z A;  4HJ7 A;  3NEN A;  1BKB A;  2JN4 A;  4K0K L;  1YNN D;  2AQ1 B;  3PF4 A;  1SE4 A;  3HKZ B;  1EZ6 A;  1HA5 A;  2KCC A;  1PH8 A;  1SND A;  1EUJ A;  5IT9 E;  5E3F A;  1F9S A;  4P71 A;  3MHB A;  2ICI A;  1XTD A;  1CSQ A;  2HQL A;  4L5T A;  4POF A;  4L5S A;  2B2W A;  1EZ8 A;  2VB2 X;  3JAM c;  1Y1W H;  1HR0 L;  1ILQ A;  4L63 B;  1QVC A;  4DXF A;  2A68 C;  3PV0 A;  1EQR A;  5COY A;  1KNE A;  4DV7 L;  3E9I A;  3E0J A;  1FYC A;  1TS5 A;  4YHH Q;  3JC6 6;  1YHQ A;  4PZ7 A;  3GTO H;  1TQO A;  4DR4 L;  1YZ6 A;  1M1K C;  1JJ2 A;  5KND A;  1HTP A;  3FKI B;  3J80 c;  3TZU A;  2V1C C;  3I70 A;  3HOZ H;  2PI2 A;  1E1O A;  1TY0 A;  3K0X A;  3ER0 A;  3PUW A;  4HCS A;  2B2V C;  4ODG A;  2CW0 C;  2UXB L;  1DON A;  2UXB Q;  1WD1 A;  3G7L A;  5C3E B;  4UY8 C;  2ZTD A;  1UE1 A;  3K5N A;  2DJF C;  1EYD A;  3M4O H;  1N34 Q;  1K8O A;  4LFB Q;  3GTM B;  1DJR D;  4NP5 A;  4K6D A;  1KDA A;  2YV5 A;  3EA6 A;  3HOX G;  1SNP A;  2UU9 L;  4R4T A;  4LUV A;  5M3M H;  3CAM A;  4JI8 L;  1MGS A;  1OO9 B;  1XTC D;  1UE6 A;  4DPG A;  2E8G A;  2O5I C;  5LL6 S;  4CJ1 B;  2ES2 A;  4DR7 Q;  2KOL A;  5IT9 c;  4LK1 C;  1M4V A;  3KF6 B;  5KGU A;  4PG3 A;  1KIX A;  3A5U A;  4C3J H;  1LTL A;  4H7B A;  3K6O A;  1L0W A;  2UUA Q;  2VUM H;  1QOH A;  2K6A A;  1SBB B;  2ZM6 Q;  2JA8 H;  4DA2 A;  3HKZ G;  2R92 B;  1CQF A;  2A8V A;  3CXC A;  5EBD A;  1IKL A;  1LAB A;  5C5L A;  3C1E A;  1PZI D;  1QZH A;  1SMX A;  4HSV A;  2L15 A;  1M90 C;  3WOF A;  1VCI A;  1SFO B;  2KCN A;  3FMC A;  3TRZ A;  4YCU A;  4RKL A;  3OHX C;  4ABN A;  3I4M B;  2QGQ A;  3TRE A;  3K58 A;  2E5L L;  2Z8L A;  5CR3 A;  3J80 L;  2AWO A;  4MHE A;  1HNZ L;  1OXV A;  5KNC A;  2JA6 H;  1PTO F;  2RCN A;  3BYT B;  2IHF A;  2RKS A;  3CCV A;  2MGS A;  4JK1 C;  1X3Q A;  4HAE A;  1C48 A;  3OWF A;  1NAP A;  3G4S A;  3M4Y A;  1A62 A;  4WJ3 M;  4P75 A;  2JEA I;  4S3S A;  1AP0 A;  4XQN A;  1WTQ A;  2ATW A;  5FLX c;  2F0E A;  2I5H A;  4TRD A;  1VQL A;  4N8F A;  4OX9 Q;  3EIV A;  3CCR A;  3HZX A;  5DEH A;  1LLR D;  4J15 A;  3S15 H;  2ZXR A;  1E7Z A;  3ERS X;  3S1R B;  2EJF C;  2CVR A;  1YNJ C;  2NVQ B;  2NTS A;  3ERQ A;  3J81 E;  2XWJ B;  3QIA A;  4A3M H;  3K8A A;  2F4I A;  4K8J A;  2ENB A;  3A7A B;  5CGK A;  1T9H A;  4BY7 H;  3D6C A;  1FNV A;  3I56 A;  1YJ9 A;  1F9P A;  4X66 Q;  4GKJ L;  2NZO A;  2B2Y A;  2L1B A;  3ULP A;  2HHH L;  3I4M H;  1LO5 D;  2C9O A;  4DR1 L;  5I9P A;  4LF8 L;  3V05 A;  1E24 A;  2JK8 A;  4X66 L;  2MUY A;  3TP6 A;  1VF7 A;  3SVM A;  4ZUI A;  2A74 C;  4AYB E;  3DHQ A;  1A8V A;  3PUY A;  4B3M L;  4A3G B;  5C0X I;  1VQE A;  1R4Q B;  4RGN A;  3HOZ B;  1PVO A;  5J1Z A;  3LX0 A;  1LV9 A;  4ULL A;  3NEL A;  4NKL A;  2F03 A;  4G57 A;  4HN7 A;  3H09 A;  3OIP A;  2WV6 D;  4OWT B;  3PO3 H;  3OMG A;  2CH4 A;  4LFA Q;  2XRQ D;  4DV6 L;  1MSG A;  1A15 A;  1WTO A;  4R8I A;  1WYD A;  2JSO A;  2WAQ G;  4QQB X;  1AE3 A;  3M4P A;  4A3G G;  3PIO A;  1Y1W B;  1KRS A;  5JJL A;  1DXM A;  3I91 A;  3HOZ G;  1UWV A;  3K57 A;  2VQE Q;  2E2J H;  4A3L H;  3GO5 A;  3UDF A;  4A3I H;  1STH A;  1BBW A;  2KHI A;  4JI8 Q;  4CHT B;  3HOX B;  4DR2 L;  1NY4 A;  1I3Q B;  3HKS A;  1FD7 D;  4I7Z C;  3PSI A;  2RCF A;  2WFW A;  4LF6 Q;  3FPU B;  2SEB D;  2OWO A;  3U58 A;  2IX0 A;  4JI6 L;  1FJG Q;  5GAG C;  5JEA H;  2PZU A;  2NTT A;  4O1N A;  1HUN A;  2HQE A;  1LT4 D;  3OW7 A;  4IUU A;  3CCM A;  4OWW B;  1PA6 A;  3SEB A;  1SNM A;  1GD7 A;  4BWG B;  1VQP A;  2PMZ B;  3NWS A;  5LHY 1;  3T1Y Q;  1G6Z A;  4LUZ A;  4LF4 L;  2R92 G;  2H5X A;  1STY A;  2QA4 A;  4A93 B;  5CMD A;  1H9S B;  1PTO H;  1J5E L;  3UI2 A;  2R6G A;  1Z7T A;  1KDB A;  1I4G A;  3GTL H;  1V43 A;  1U5K A;  2B29 A;  4DUY Q;  3HOU H;  4KHZ A;  3WOE A;  1EWC A;  5F2D A;  1CUK A;  1U4M A;  3KDF B;  1WTV A;  1VQ8 A;  5CV7 A;  3HOX H;  1SXT A;  3NBI A;  4A4I A;  4JI4 L;  1WI5 A;  4UP7 A;  4RHS A;  4FDB A;  3JAM L;  4IUP A;  2NVT B;  1HNW Q;  1B50 A;  5IP9 H;  1VQF A;  2NB0 A;  1K73 C;  2EOT A;  1NSN S;  4O2D A;  4IJL A;  1ROD A;  1PTO C;  3NTK A;  4DK0 A;  5IP9 G;  1G2T A;  1LT6 D;  5A2Q L;  4R4C A;  3F2C A;  4EQ5 A;  2RDF A;  4IPH A;  4JBJ A;  1I4P A;  4RCO A;  1PFN A;  5EAY A;  1N8R C;  3K7A H;  5LMN W;  2FHT A;  2OTJ A;  4RGM A;  1ESF A;  2M00 A;  4CDC C;  3NEM A;  3CCS A;  4HJ9 A;  3HFZ B;  1I6V C;  2K5Q A;  1LTS D;  4DV2 Q;  4CJ2 C;  4DV4 Q;  3H91 A;  1FVI A;  1Z9F A;  1UE5 A;  4C1N I;  5BN5 A;  2E2H H;  4A3D G;  4A3C G;  3A8J E;  1ESR A;  4NXM L;  2M2L A;  3AFQ A;  1JOR A;  2RSO A;  3MEF A;  3BVM A;  5K5P A;  1SMY C;  3TP7 A;  4CDF C;  2DY8 A;  1DGS A;  5GRO A;  1PH2 A;  1LYL A;  3S16 H;  1GUW A;  4XIG S;  4HIK A;  1KAB A;  1MJE A;  1ICW A;  1A3T A;  5E1F A;  4A93 G;  4TVA B;  4ZRZ A;  3E0E A;  4DV3 Q;  2GN5 A;  4FXK C;  4Y52 H;  4P2C B;  3OMC A;  2VZA A;  4GLV B;  4A3E G;  3DEP A;  4IUV A;  4OIJ A;  3J81 L;  4C3I H;  3PMF A;  1TVX A;  2NYZ D;  3CQZ H;  4LUO A;  2YU9 H;  3A7L A;  2B39 A;  5NUC A;  3RLO A;  3AMU A;  1S5C D;  2N78 A;  5EJW A;  2YTV A;  1ASZ A;  2ICE C;  3KLW A;  4GKK Q;  4C3J B;  1A2U A;  2JP1 A;  4N8X 1;  5C0X G;  1ET9 A;  4JOI C;  3VYR A;  3NTI A;  3STB C;  1JC7 A;  1IHZ A;  3HOV B;  5IGE A;  1YBY A;  3M3Y B;  1SR3 A;  5IWA L;  2D2C C;  1GHK A;  1X56 A;  2F0U A;  2UXC Q;  1GUT A;  5DLQ E;  2CH4 W;  1CA6 A;  2KEC A;  1BDO A;  3QB3 A;  2WAQ B;  2FMC A;  4RMF A;  3HOW G;  1PH6 A;  2Z6K A;  1Y14 B;  1TWH B;  3MFG A;  4DV3 L;  2K5N A;  1ET6 A;  4IO9 A;  1EIF A;  2DY7 A;  2Q2U A;  5IYC H;  3TDQ A;  2HCC A;  1LTI D;  2LS0 1;  3PIP 3;  4MIU A;  2R7F A;  2JE6 I;  3SXH A;  4KHP L;  5CV6 A;  3KDF A;  3TBI B;  1HNX Q;  2YTY A;  4JI0 L;  1Y8O B;  4A3J B;  4G4K A;  4B3R L;  4GZY C;  3R3O A;  1PXU A;  4RFB A;  3BU2 A;  4GOP A;  2O5J C;  4JI6 Q;  1EY4 A;  2Q2H A;  1FJG L;  2B2T A;  1STE A;  2EY1 A;  3HG9 A;  3PIO 3;  4A3I G;  4AQY Q;  1A3V A;  1IYJ B;  1CT1 D;  1LT3 D;  3VDY A;  2E5L Q;  1EOV A;  4QF4 A;  1C0A A;  2BE5 D;  4PZ8 A;  3LNN A;  4A3J G;  1PH1 A;  1F77 A;  5I2X A;  4H44 C;  4DR1 Q;  1PZK D;  3U4Z A;  5C6A A;  4DR6 Q;  2L55 A;  4IJH A;  3KBX A;  4ZKB B;  2EDG A;  5GQO A;  1YI2 A;  2RSN A;  1RD9 D;  2VQE L;  4A3I B;  2VY3 A;  1NR2 A;  2Y0S E;  2QIL A;  1BCP F;  5JEA G;  5HGQ A;  4CDD C;  4LF7 Q;  4MTN A;  2MJ8 A;  5EKK A;  1TY2 A;  5FO7 B;  5A35 A;  4DV6 Q;  1TWA H;  4MTK A;  1PFS A;  2N55 A;  3S14 B;  3H0G H;  2L5T A;  2GVA A;  3BYY B;  1PTO D;  2LXK A;  2BH8 A;  4IPG A;  3W3A A;  4J8Q A;  5IYD G;  3ONA B;  2AHO B;  2K50 A;  2XSC A;  1V9P A;  3E5S A;  2VNU D;  5TSS A;  4R4Q A;  2RA4 A;  4IZ8 A;  2F0T A;  1HRJ A;  1L1O B;  1PRT D;  1CZG A;  4NB3 A;  1TII D;  3FEW X;  4GOP C;  1IBM Q;  1UNS A;  3L0O A;  3SK4 A;  1ZXT A;  5E4X A;  3GTP B;  4PMB A;  2GVB A;  4JV5 Q;  3CC7 A;  1E2W A;  4IUN A;  1MBY A;  4A75 A;  1CA5 A;  1N32 L;  3MTS A;  4XT3 B;  2IJ0 A;  3VR6 A;  2WB1 G;  1CKO A;  1KNA A;  4G7O C;  2MO1 A;  1VQC A;  3Q23 A;  1JMC A;  1UE7 A;  1N33 Q;  1XNQ Q;  2OT2 A;  2KED A;  4GS3 A;  1N36 Q;  2C35 B;  4X6A H;  3TN2 A;  4UP8 A;  4A76 A;  1X6O A;  3I4M G;  5D3I B;  1OXX K;  2IPK D;  2NBF A;  5DNF A;  4WRD A;  2WAQ E;  2K14 A;  1X55 A;  4JV5 L;  4FXD A;  4K6L A;  3NSW A;  5JEA J;  3SE0 A;  1PRT F;  1HQM C;  4NMZ A;  1X3P A;  5EKL A;  1DZ1 A;  2AMC B;  1D1K A;  4QMG A;  3JAM i;  4WJ4 A;  1QE6 A;  2UUC L;  1NMG A;  5IP7 G;  1PHJ A;  2ZJQ A;  4DV1 Q;  2K52 A;  4O42 A;  5JPN C;  3EFX D;  4N9P A;  4U67 3;  4IFD J;  5E7N A;  4C2M H;  1IL2 A;  2NZ1 D;  2WP8 J;  3HOV H;  1GUG A;  1CHP D;  1K3R A;  1GXD C;  1WCM G;  4DR7 L;  1VQJ A;  4LF7 L;  3CD6 A;  1SEB D;  1VQH A;  1EFW A;  4HMJ A;  1DOM A;  3Q8D A;  5JAV A;  4M8A A;  5KNB A;  1D6E C;  2NVX H;  1ENA A;  3V96 A;  1GUS A;  5K36 G;  5JOB A;  3DEO A;  1OXU A;  3ZYY X;  1Q86 C;  2CQO A;  4B3T L;  1WCM B;  1A63 A;  4KY5 A;  1EY5 A;  1U9R A;  5IYC G;  1IW7 C;  1IBL Q;  3H3V C;  3RZO H;  2OTL A;  5C0X H;  4HTH A;  1LAC A;  4AQY L;  1KD1 C;  1EY6 A;  2NN6 I;  5M3M G;  3D31 A;  4A3K B;  3CRK C;  2F4V L;  3RZD B;  3T56 B;  4A3F H;  2D0O A;  4NXN Q;  4QJF A;  5BN4 A;  3MZ5 A;  4B9X A;  1TXY A;  2CWA A;  2B8F A;  5M5W B;  3Q0A A;  4GNX A;  2JA7 H;  4CDE C;  2I07 B;  1SNO A;  4XXE A;  2VXW A;  4RWS C;  1AZQ A;  3AYH B;  1TS3 A;  2KHJ A;  3RUZ A;  2OQK A;  3VA5 A;  4EX5 A;  4DR5 Q;  4DV2 L;  4A3K G;  4OX9 L;  5M5X H; 
#chains in the Genus database with same CATH homology
 2WKC A;  4BBS B;  3NUC A;  4QB4 A;  5HGT A;  2F0H A;  1ML0 D;  1KTK A;  3A56 A;  1O7L A;  5JVH 3;  3QWN A;  4HSP A;  4KTA A;  1S4Z A;  1E2V A;  1TR5 A;  2B2T C;  2EYJ A;  1EYC A;  4IFD G;  4K14 A;  3M7N A;  3KLS A;  1FNU A;  4XYO A;  3I8Z A;  2F0Q A;  2FIN B;  1SJE D;  1F2L A;  1I4R A;  2PW7 A;  2V4D A;  3H6M A;  1CQV A;  3SK8 A;  4XT1 B;  3OWE B;  3NBH A;  3FVQ A;  1Q90 A;  3C46 A;  1STA A;  2E75 C;  2CQA A;  3NWT A;  4KD4 A;  4IN3 A;  1X32 A;  3I4L A;  1NCV A;  5C0X J;  4ZK9 B;  4K2K A;  5IGF A;  3MAQ A;  1AN8 A;  2H4O A;  5ELC A;  4DFA A;  1V8Q A;  3S1N B;  3WDN A;  3S17 B;  1KDC A;  2L9H A;  2VUM B;  1E2Z A;  1Y8P B;  3PUV A;  4KN7 C;  2F3W A;  5C3W A;  3J80 E;  3GTL B;  4DAP A;  4ZKC B;  1TU2 B;  5EKI A;  1PRT C;  4BY7 B;  2BDN A;  2KHS A;  4KMU C;  1I4H A;  1EY0 A;  2PQE A;  2TSS A;  3KK7 A;  2IX1 A;  3GP7 A;  4EQO A;  5IOC A;  3VR4 A;  1D2B A;  3QO2 A;  2SOB A;  1RHP A;  3TP8 A;  1B9N A;  4LMQ D;  4A3F B;  4DF7 A;  1QCB D;  4K8I A;  4DU9 A;  3H0G B;  3BDO A;  4OO1 G;  4L6T B;  1EFI D;  5M3F B;  4PNY A;  4FXG C;  1D5M C;  2K7V A;  2PCF B;  3MWY W;  2BA0 A;  1H9K A;  5FLX E;  4WJW A;  1WD0 A;  1HFN A;  3NXW A;  2AUK A;  1NUC A;  5EPK A;  4XDX A;  1M8A A;  1TS4 A;  3F2U A;  2VB3 X;  2HUG A;  1F9Q A;  3QJY A;  4A3M B;  4RKB A;  1Q12 A;  1IKM A;  3K5M A;  2XNA C;  3N6R A;  4H13 C;  1SYD A;  5JVG 3;  2RDH A;  1S5F D;  1LTR D;  3U9S A;  1EEI D;  3D8G A;  5FO9 B;  3MXN A;  2EYP A;  4RGT A;  1A2T A;  1R9T B;  5J39 A;  4EQP A;  4CKC A;  5IOD A;  2KVM A;  3S1Q B;  3EJI A;  3RMH A;  4PV1 C;  4C2M B;  2Q8T A;  1TWA B;  3MXU A;  3T13 A;  3R8B A;  1D5Z C;  2F0G A;  1RKN A;  4L8J A;  3W2D A;  4KKS A;  4N9T A;  3GTK B;  2JXM B;  1EY9 A;  4FNF A;  5I4D A;  2CHB D;  2Q8R E;  5JPM C;  2K33 A;  2ID0 A;  2Q8I B;  5ELB A;  1EL0 A;  1B4O A;  3BDC A;  2WAC A;  1U4R A;  2N88 A;  2BA1 A;  1RTN A;  3BS1 A;  4EGV A;  1I4X A;  5CYU A;  2EY2 A;  2B2V A;  3TZD A;  3PUZ A;  3P20 A;  4X3T A;  3VA7 A;  4PQX A;  3VYS A;  4ILW A;  1B53 A;  1W6K A;  3VR5 A;  3L7Z C;  1GJX A;  2D62 A;  1IL8 A;  1UUP A;  4J6H A;  1ENC A;  3BVG A;  1DD2 A;  3J7Y W;  1HCZ A;  1WVL A;  2IX3 A;  2E2I B;  4IUT A;  1C4Q A;  4KKU A;  1IYU A;  3MA2 B;  2RDG A;  4A3E B;  1VDZ A;  1JB3 A;  2YU9 B;  3RD4 A;  3RZO B;  1OXT A;  3CHB D;  5DM6 3;  2HDM A;  1MI2 A;  1GUO A;  1TS2 A;  2B8G A;  1B3A A;  4KKT A;  1AZP A;  2LMC B;  4C3J G;  5HUR A;  4KV6 A;  4M1U B;  3QG1 A;  5CBE E;  2QKI C;  3URY A;  3M4O B;  1HXY D;  2EVB A;  2IT1 A;  1PDQ A;  1CTM A;  1B44 D;  3D4R A;  5C4Z A;  3IFT A;  3NTH A;  2WB1 B;  1PZJ D;  3R2I A;  1YNN C;  3S9W A;  3OIQ A;  1D1I A;  1H9S A;  1BCP D;  1BCP C;  2EYL A;  2EYM A;  4B08 A;  4BBR B;  3FRP B;  2FJ2 A;  2Z1C A;  2F0O A;  2ZXO A;  1HPC A;  1PFB A;  1HTL D;  3A54 A;  3M7G A;  1BXT A;  3CRL C;  3NQT A;  5EPJ A;  1CHQ D;  1BQQ T;  1K83 B;  4HMI A;  2IL8 A;  1WTP A;  3C3L A;  2K28 A;  2JA6 B;  1SYC A;  1RJT A;  4MN3 A;  1HFG A;  1V1O A;  2LKV A;  1I4Q A;  2EE1 A;  3BVZ A;  3IKJ A;  1H9J A;  2NN6 G;  3PO3 B;  2EXZ A;  2NN6 H;  4CBV A;  2DN8 A;  5A2Q E;  5D14 A;  4Z9C B;  1WTW A;  2BDO A;  2JEB I;  4DN4 M;  2F3V A;  5FKA C;  1PYW D;  2SDF A;  1AW7 A;  3H94 A;  4DNT B;  2F0M A;  4DNR B;  4QUC A;  5M9O A;  1Z6H A;  4QIW B;  1FR3 A;  5CBA E;  4OO1 I;  4FF3 A;  1SYB A;  3T4A C;  3M85 A;  3BDL A;  3I3C A;  2A68 D;  1B9M A;  1EY8 A;  1GHJ A;  1EEF D;  3OSO A;  5FLX L;  2EYF A;  4WFN 3;  1VMC A;  3S2D B;  5K36 H;  1QG7 A;  1O7Y A;  2EYH A;  1EQV A;  1GOZ A;  2Z4H A;  5C44 B;  1W6J A;  5ELE A;  4DAY A;  1EQT A;  5KYL A;  3O13 A;  4FO2 A;  4CGY B;  3GQB A;  3QOL A;  5G3L D;  1KLG D;  1S5E D;  4TSS A;  2F0K A;  2BCO A;  4RA8 A;  2EJG C;  2F0D A;  1BR9 A;  4BA2 I;  4V19 0;  5T1G A;  2K5D A;  2WIN B;  3L9A X;  2A6H D;  2EZV A;  1EU4 A;  4ME5 A;  3A55 A;  4KD3 A;  1V1P A;  1R4P B;  1I6H B;  1PTO B;  2EJM A;  1C8C A;  2F0F A;  3P1H A;  3HRZ C;  3C2P A;  1HHV A;  4BS9 A;  3IL8 A;  5DM7 3;  1SE2 A;  3RLF A;  4KI0 A;  4OHJ A;  5CV4 A;  2F0L A;  4IFD I;  1QJO A;  3KLR A;  5G3L F;  2L11 A;  3SR1 A;  4FF4 A;  1S5B D;  1RF2 D;  3D4W A;  1SE3 A;  5ELD A;  1SYF A;  4UDU C;  4Y7N B;  2KA7 A;  4IQZ A;  3PO2 B;  3SDZ A;  1Y8N B;  4F87 A;  3DXJ C;  1JQY D;  2XVS A;  2RQX A;  4FF2 A;  2L4N A;  1TKW B;  3Q24 A;  4RHR A;  3TME A;  1H9M A;  2I46 A;  1WTX A;  2ZXP A;  2NUC A;  3J7A F;  3LWE A;  3K7A B;  1TWC B;  3GTQ B;  3T53 B;  4C3H G;  2JA8 B;  1XYI A;  1STN A;  2D5D A;  1GUN A;  3L3O C;  3NK9 A;  2QF7 A;  3SK6 A;  2A5H A;  4HCE A;  5COR A;  1ZKO A;  2K03 A;  2X69 A;  3OOC A;  4F8M A;  2O2L D;  3SHL A;  1SYE A;  3AU7 A;  1SJH D;  3K5O A;  3D3R A;  2LY7 A;  2BE5 C;  4BA1 I;  1K8M A;  1BOS A;  4B9W A;  4G7Z C;  5IT9 L;  5KRU A;  2PZW A;  4C3I G;  5JJZ A;  4XTC S;  1HA6 A;  2DNE A;  4C1N K;  1H9R A;  3TP5 A;  3DWA A;  3EQL C;  4IUQ A;  2A6H C;  3ITP A;  2H1E A;  3SK5 A;  3LWU A;  4CKB A;  3DUZ A;  1V1P B;  5KEE A;  2PO4 A;  3NE5 B;  1LT5 D;  1IYV A;  4CKE A;  1CZW A;  1KLU D;  2KQ3 A;  2NWG A;  4DK1 A;  1LTB D;  4XQJ A;  4Q5V A;  3VYU A;  2E2D C;  2K05 A;  2SNM A;  2PZT A;  5CV9 A;  4ZLT F;  2B2W C;  4U68 A;  3VR2 A;  4XQQ A;  4X3K A;  2K01 A;  3DMU A;  3ERO A;  4ID6 A;  4ZUJ A;  4RAU C;  4FYD A;  4HR7 B;  4BY1 B;  3D6W A;  2OF1 A;  3P7J A;  1OXS C;  1B2T A;  4ZYS A;  1SMY D;  4KY6 A;  5KYI A;  2XRS D;  3CU7 A;  5D65 A;  1ZYR D;  5C4H A;  3X3M A;  4DAV A;  2O4X A;  1O7Z A;  5FOB B;  2R93 B;  2EY6 A;  1HUM A;  1VMP A;  1BF4 A;  2K1B A;  3N52 A;  4ZAI A;  4FP5 D;  4RGO S;  2PPB C;  1Y69 U;  4G7H C;  2FMM A;  5J22 A;  4OL7 A;  3MXP A;  1SSO A;  4KK7 A;  4RH6 A;  2R7Z B;  3QOJ A;  1A3U A;  1VF5 C;  2JYO A;  2E76 C;  2KJX A;  1QNK A;  2RBM A;  1DOL A;  3NHH A;  1JWU D;  3FPP A;  4KN4 C;  1SDF A;  3CKI B;  2JA5 B;  2Z4I A;  1BCP B;  3Q6S A;  1JWS D;  2F0W A;  2YYZ A;  2HDL A;  1O80 A;  1SYG A;  3J7A V;  4C3H B;  3OPO A;  2EPB A;  2Y0S B;  2A73 B;  2KUM A;  2M9V A;  3KUP A;  4KJO A;  4FVM A;  1J9O A;  3I73 A;  4C56 C;  3MXG A;  1PFM A;  2IW3 A;  2J4X A;  1AFP A;  1ZEQ X;  3K59 A;  2E2H B;  4X3U A;  2A6E D;  1XXG A;  1ILP A;  3HOY B;  3DM1 A;  3G6J B;  1JWM D;  5EBC A;  2IWH A;  3X3N A;  4F88 A;  4LJZ C;  1EIH A;  1FNW A;  1O78 A;  4OIK A;  4JBW A;  3S16 B;  4PMC A;  1QIL A;  4CJ0 B;  3ND8 A;  2B2U C;  1QWY A;  5C5M A;  1G8Z D;  1RTO A;  4R9W A;  3GV6 A;  5C3X A;  1DM0 B;  2F0V A;  4TKO B;  1F2M A;  5FK9 C;  3NPP A;  5C4X B;  1BO0 A;  3A8I E;  3TSS A;  4HED A;  2X6G A;  4WOR A;  4QUF A;  1MSH A;  4I65 A;  1UAP A;  1CI3 M;  2XN9 C;  2F0N A;  3HOU B;  1AEX A;  4R8N A;  1EOT A;  3CQZ B;  2MPM A;  2J0T D;  2K32 A;  1G29 1;  1EWH A;  1BNZ A;  1DCZ A;  2A69 C;  1Q1E A;  5I9O A;  2XWB B;  4C3I B;  3FDT A;  2J7Z A;  3HEJ A;  1WTR A;  1BUV T;  1ONL A;  1CFM A;  2BOS A;  2F0I A;  5KIX A;  2B63 B;  4DXG A;  4KY7 A;  1SNC A;  2B2U A;  1MD2 D;  1YNJ D;  3ND9 A;  3HP3 A;  3JAM E;  1A6X A;  1XWE A;  5CV5 A;  1J8I A;  2TMP A;  4RCN A;  2A69 D;  1U4L A;  3C1F A;  1KAA A;  4K5X A;  5DAU A;  3MVV A;  1JE4 A;  1JOK A;  1SNQ A;  2MHV A;  4IAL A;  5M5X B;  5EQ0 A;  3V2T A;  4AYB B;  2KEE A;  1STB A;  1II3 A;  3I90 A;  3IAY A;  3P75 A;  1T5E A;  2SNS A;  3BG3 A;  5AFW A;  3K0Y A;  4J1M A;  3A8K E;  3I72 A;  2QDB A;  2WII B;  1STG A;  5FO8 B;  1LTG D;  4IUR A;  2OXP A;  3NQI A;  1RCV D;  1CK1 A;  2WKD A;  1I50 B;  3GTJ B;  5EPL A;  3T16 A;  2G9D A;  2AUJ D;  1G2S A;  1T5X D;  2K04 A;  3IFD A;  1EIG A;  3HS0 C;  2L12 A;  1F9R A;  1L0X B;  1JR0 D;  1QNU A;  3R2T A;  2A6E C;  2MP1 A;  1FGB D;  3KF8 A;  4TQU S;  5D3D A;  3S2H B;  1PMR A;  3GTO B;  5ISR A;  4A3D B;  5I6Y A;  2R3Z A;  2R61 A;  3DWQ A;  4YIJ A;  5I6W A;  4PMW A;  2AQ3 B;  4K5V A;  1PLF A;  3KLS X;  5IGG A;  2E2J B;  1E0B A;  1L0Y B;  4OGQ C;  4EQN A;  2E74 C;  2DNC A;  2CW0 D;  1EYA A;  3GV3 A;  5ELF A;  5IGD A;  1DYQ A;  1G91 A;  2F0S A;  5CC4 A;  2AQ2 B;  4V0B A;  4KJN A;  2FFK B;  1NR4 A;  4NDX A;  5IGB A;  2NVY B;  3VYT A;  5EGT A;  1Z47 A;  4DGZ A;  3Q22 A;  1EU3 A;  1QB5 D;  2GA4 B;  4K2L A;  1UEA B;  2C5C A;  2D9U A;  2EY5 A;  5I2Y A;  3AB9 A;  1SAP A;  3DWP A;  1LTT D;  4NW2 A;  1XX8 A;  3NP8 A;  5CV8 A;  4XYQ A;  3HOW B;  2XIW A;  5M5Y B;  4KHV A;  3MC0 B;  5LL6 X;  1JOQ A;  2QEJ C;  3D4D A;  2LFN A;  2QCP X;  4OO1 H;  5T1I A;  4X3S A;  3GTG B;  1JOO A;  2OEO A;  4K5W A;  1RDP D;  2F1M A;  3EVQ A;  1BBX C;  1TWG B;  1DOK A;  5M3M B;  2F0J A;  3MFY A;  3T51 B;  2K5W A;  5E4W C;  1TT2 A;  2AWN A;  3GD7 A;  1Y1V B;  1TWF B;  4QCL A;  4UAI A;  5IGC A;  1ENF A;  2PYK A;  2PNR C;  4FF1 A;  3BZD B;  3U9O A;  1ZYR C;  2G9H D;  1F2Y A;  3HGB A;  1IW7 D;  5C4J B;  4A3B B;  3VR3 A;  3I4N B;  2JA7 B;  3PUX A;  1B1Z A;  2L0C A;  3S1M B;  1LTA D;  2F0P A;  3E6Z X;  4E6I A;  1JCK B;  1HQR D;  3KBG A;  4EVO A;  5IIF A;  1Q3L A;  1S5D D;  3S15 B;  2RVL A;  2HCI A;  1D5X C;  2EYO A;  3MEH A;  4ZQ3 A;  1JIC A;  3R93 A;  4H0L C;  1Q1B A;  4IFD H;  3K5L A;  2PW5 A;  2X6L A;  2ZT9 C;  1CM9 A;  1Q8I A;  4Q0F A;  1U4P A;  1EY7 A;  4LAA A;  2NVX B;  2B2Y C;  5BN3 A;  1PRT B;  4F7X A;  1F2Z A;  1YNN D;  2AQ1 B;  1SE4 A;  3HKZ B;  1EZ6 A;  1HA5 A;  2KCC A;  1SND A;  5IT9 E;  5E3F A;  1F9S A;  2ICI A;  3MHB A;  2B2W A;  1EZ8 A;  2VB2 X;  1ILQ A;  4L63 B;  4DXF A;  2A68 C;  3PV0 A;  5COY A;  1KNE A;  1FYC A;  3E0J A;  1TS5 A;  1TQO A;  5KND A;  1HTP A;  3FKI B;  3TZU A;  3I70 A;  1TY0 A;  3PUW A;  4HCS A;  2B2V C;  4ODG A;  2CW0 C;  1DON A;  1WD1 A;  3G7L A;  5C3E B;  3K5N A;  1EYD A;  1K8O A;  3GTM B;  1DJR D;  4NP5 A;  4K6D A;  1KDA A;  3EA6 A;  1SNP A;  1MGS A;  1OO9 B;  1XTC D;  2O5I C;  5LL6 S;  4CJ1 B;  2KOL A;  4LK1 C;  1M4V A;  5KGU A;  4H7B A;  3K6O A;  1QOH A;  2K6A A;  1SBB B;  4DA2 A;  2R92 B;  1CQF A;  5EBD A;  1IKL A;  1LAB A;  5C5L A;  3C1E A;  1PZI D;  4HSV A;  3WOF A;  1VCI A;  1SFO B;  2KCN A;  3FMC A;  4RKL A;  3OHX C;  4ABN A;  3I4M B;  3K58 A;  2Z8L A;  5CR3 A;  3J80 L;  2AWO A;  4MHE A;  1OXV A;  5KNC A;  1PTO F;  3BYT B;  2RKS A;  2MGS A;  4JK1 C;  1X3Q A;  4HAE A;  1C48 A;  3OWF A;  1NAP A;  3M4Y A;  2JEA I;  4S3S A;  1AP0 A;  4XQN A;  1WTQ A;  2F0E A;  4TRD A;  3HZX A;  5DEH A;  1LLR D;  2ZXR A;  3S1R B;  2EJF C;  2CVR A;  1YNJ C;  2NVQ B;  2NTS A;  3ERQ A;  3J81 E;  2XWJ B;  3QIA A;  2F4I A;  4K8J A;  2ENB A;  3A7A B;  5CGK A;  3D6C A;  1FNV A;  1F9P A;  2B2Y A;  2L1B A;  1LO5 D;  2C9O A;  5I9P A;  3V05 A;  2MUY A;  3TP6 A;  1VF7 A;  3SVM A;  4ZUI A;  2A74 C;  3DHQ A;  3PUY A;  4A3G B;  5C0X I;  1R4Q B;  4RGN A;  3HOZ B;  5J1Z A;  3LX0 A;  1LV9 A;  4ULL A;  4NKL A;  2F03 A;  4G57 A;  4HN7 A;  3H09 A;  3OIP A;  2WV6 D;  3OMG A;  2XRQ D;  1MSG A;  1A15 A;  1WTO A;  4R8I A;  2JSO A;  1Y1W B;  1DXM A;  3I91 A;  3K57 A;  3GO5 A;  1STH A;  4CHT B;  3HOX B;  1I3Q B;  1FD7 D;  4I7Z C;  3FPU B;  2SEB D;  2IX0 A;  5JEA H;  2PZU A;  2NTT A;  4O1N A;  1HUN A;  2HQE A;  1LT4 D;  3OW7 A;  4IUU A;  3SEB A;  1SNM A;  4BWG B;  2PMZ B;  3NWS A;  5LHY 1;  1G6Z A;  1STY A;  4A93 B;  5CMD A;  1H9S B;  1PTO H;  3UI2 A;  2R6G A;  1Z7T A;  1KDB A;  1I4G A;  1V43 A;  4KHZ A;  3WOE A;  1EWC A;  5F2D A;  1U4M A;  1WTV A;  5CV7 A;  1SXT A;  3NBI A;  4RHS A;  3JAM L;  4IUP A;  2NVT B;  1B50 A;  2NB0 A;  2EOT A;  1NSN S;  1ROD A;  1PTO C;  3NTK A;  4DK0 A;  1G2T A;  1LT6 D;  5A2Q L;  2RDF A;  1I4P A;  4RCO A;  1PFN A;  2FHT A;  4RGM A;  1ESF A;  2M00 A;  1I6V C;  2K5Q A;  1LTS D;  4CJ2 C;  3H91 A;  4C1N I;  5BN5 A;  3A8J E;  1ESR A;  2M2L A;  1JOR A;  2RSO A;  5K5P A;  3BVM A;  1SMY C;  3TP7 A;  2DY8 A;  1GUW A;  4XIG S;  1KAB A;  1ICW A;  1A3T A;  5E1F A;  4ZRZ A;  4FXK C;  4P2C B;  3OMC A;  3DEP A;  4IUV A;  4OIJ A;  3J81 L;  3PMF A;  1TVX A;  2NYZ D;  3A7L A;  2B39 A;  5NUC A;  3AMU A;  1S5C D;  5EJW A;  2ICE C;  4C3J B;  1A2U A;  2JP1 A;  5C0X G;  1ET9 A;  3VYR A;  3NTI A;  1JC7 A;  1IHZ A;  3HOV B;  5IGE A;  3M3Y B;  2D2C C;  1GHK A;  2F0U A;  1GUT A;  1CA6 A;  2KEC A;  1BDO A;  3QB3 A;  2WAQ B;  2FMC A;  1TWH B;  3MFG A;  1ET6 A;  2DY7 A;  3TDQ A;  2HCC A;  1LTI D;  2LS0 1;  3PIP 3;  4MIU A;  2JE6 I;  3SXH A;  5CV6 A;  3TBI B;  1Y8O B;  4A3J B;  4G4K A;  4GZY C;  3R3O A;  1PXU A;  4RFB A;  2O5J C;  1EY4 A;  2B2T A;  1STE A;  2EY1 A;  3PIO 3;  3HG9 A;  1A3V A;  1CT1 D;  1LT3 D;  4QF4 A;  2BE5 D;  3LNN A;  1F77 A;  5I2X A;  4H44 C;  1PZK D;  5C6A A;  2L55 A;  3KBX A;  4ZKB B;  2EDG A;  2RSN A;  1RD9 D;  4A3I B;  1NR2 A;  2QIL A;  1BCP F;  5JEA G;  2MJ8 A;  5EKK A;  1TY2 A;  5FO7 B;  5A35 A;  2N55 A;  3S14 B;  2L5T A;  3BYY B;  1PTO D;  3W3A A;  4J8Q A;  3ONA B;  2XSC A;  3E5S A;  2VNU D;  5TSS A;  2RA4 A;  4IZ8 A;  2F0T A;  1HRJ A;  1PRT D;  1CZG A;  1TII D;  3FEW X;  1UNS A;  3SK4 A;  1ZXT A;  5E4X A;  3GTP B;  4PMB A;  1E2W A;  4IUN A;  1MBY A;  1CA5 A;  3MTS A;  4XT3 B;  2IJ0 A;  3VR6 A;  1KNA A;  4G7O C;  3Q23 A;  2OT2 A;  2KED A;  3TN2 A;  5D3I B;  1OXX K;  2IPK D;  2NBF A;  5DNF A;  4WRD A;  4FXD A;  4K6L A;  3NSW A;  5JEA J;  3SE0 A;  1PRT F;  1HQM C;  4NMZ A;  1X3P A;  5EKL A;  1DZ1 A;  1D1K A;  4QMG A;  1QE6 A;  4O42 A;  5JPN C;  4U67 3;  3EFX D;  4N9P A;  4IFD J;  2NZ1 D;  2WP8 J;  1GUG A;  1CHP D;  1GXD C;  1SEB D;  4HMJ A;  1DOM A;  5JAV A;  4M8A A;  5KNB A;  1D6E C;  1ENA A;  3V96 A;  1GUS A;  5K36 G;  5JOB A;  3DEO A;  1OXU A;  3ZYY X;  1WCM B;  4KY5 A;  1EY5 A;  1U9R A;  3H3V C;  1IW7 C;  5C0X H;  4HTH A;  1LAC A;  1EY6 A;  2NN6 I;  3D31 A;  4A3K B;  3CRK C;  3RZD B;  3T56 B;  5BN4 A;  3MZ5 A;  4B9X A;  2B8F A;  5M5W B;  3Q0A A;  2I07 B;  1SNO A;  4XXE A;  2VXW A;  4RWS C;  1AZQ A;  1TS3 A;  3RUZ A;  3VA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...