4DGZA

Crystal structure of staphylococcal nuclease variant delta+phs i92a/l125a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYAYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLARKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4dgzA00
4K2KA 2EYOA 2EYPA 4EQPA 5DAUA 2EYJA 5KGUA 2ENBA 2F0WA 5JOBA 4ZUJA 5C5LA 3MZ5A 5KRUA 4KD4A 4QF4A 2PQEA 1SNPA 3NXWA 4B9WA 4QMGA 3P1HA 3SK8A 4ID6A 2PZTA 1STYA 2HQEA 5EKLA 2RKSA 2SNSA 4HTHA 4KTAA 3QOLA 1A3UA 5CV9A 3SR1A 1EY6A 3TMEA 4IUNA 1SYEA 2F0DA 5CV7A 1ENAA 5KEEA 2NUCA 2SNMA 2OXPA 2F0JA 4NKLA 1EYAA 1EY7A 2F0VA 1AEXA 2LKVA 3R3OA 1TR5A 2EYLA 4KJOA 1A3VA 5CV4A 1II3A 3BDCA 5DEHA 3SHLA 4DGZA 5I6WA 5IGFA 2KQ3A 2EYMA 2F3WA 2RBMA 3DMUA 3D4DA 3SK5A 4EQNA 2F0HA 2F0EA 3TP6A 2OF1A 5CGKA 5IOCA 2PYKA 3MXPA 2EYFA 2SOBA 4NMZA 3NQTA 1U9RA 2F0QA 4J6HA 4PMBA 3SK6A 1STBA 2M00A 4WRDA 5J1ZA 4ZUIA 4K5XA 3SXHA 2F0SA 4MIUA 3OWFA 5C3XA 2WACA 3ITPA 1STAA 4HMJA 1ENCA 1KAAA 3RUZA 4E6IA 5C4ZA 2F0IA 4PNYA 3ERQA 3LX0A 4QB4A 5ISRA 2F0OA 1EY4A 4YIJA 2QDBA 3TP5A 5HGTA 1SNOA 3TP7A 2EYHA 3H6MA 4KD3A 1EYDA 2F0KA 5NUCA 1A3TA 1A2TA 1EZ6A 2O4XA 3D6CA 2PZWA 4OL7A 5K5PA 3EROA 4TRDA 1KDAA 4I65A 5KYLA 1RKNA 2EY6A 3P75A 4EQOA 4F7XA 3TP8A 2F0GA 5CR3A 4DFAA 5IGDA 3C1FA 4B9XA 4DU9A 3QB3A 4ODGA 5C4HA 1EQVA 5C3WA 1KDCA 1SNMA 1SYCA 4WORA 2RDFA 4K2LA 2F0FA 5EKKA 1SYGA 4N9TA 1TQOA 1NUCA 2F3VA 1SYBA 2KHSA 3EJIA 4H7BA 4NP5A 1EY0A 1JOKA 1KABA 2EY2A 3BDLA 3E5SA 4J1MA 4K8JA 1JOQA 5CV8A 5C5MA 4IZ8A 1F2YA 3DHQA 4K5VA 4KY5A 3VA5A 1STGA 5M9OA 5IIFA 3OSOA 2EY5A 5IGGA 2F0MA 3NHHA 4K5WA 5J22A 5CV6A 1EYCA 1NSNS 2F0LA 3NK9A 4G57A 5IODA 4F8MA 4DF7A 3QOJA 1IHZA 5J39A 4NDXA 4KY7A 1JORA 4ZQ3A 3SK4A 3NP8A 1F2MA 1STHA 2EXZA 3EVQA 3OMCA 3MVVA 5KIXA 5KYIA 1JOOA 4N9PA 5CV5A 2PZUA 4S3SA 3D8GA 3OMGA 2F0NA 2PW7A 3NUCA 1EZ8A 1SYDA 4K6DA 1SNCA 3MHBA 5IGCA 2OEOA 5EGTA 5F2DA 3C1EA 5HURA 5IGBA 3D4WA 3MEHA 2F0TA 1SYFA 1EY5A 4HMIA 4LAAA 1TT2A 4KY6A 4R8NA 4RKBA 1EY8A 2F0UA 4KHVA 4EVOA 3S9WA 3T16A 4IALA 1F2ZA 2F0PA 1SNDA 1SNQA 5E1FA 4PMCA 1EY9A 1STNA 3T13A 3HEJA 4K8IA 4ME5A 5C6AA 5I6YA 4KJNA 3HZXA 5E3FA 3PMFA 1A2UA 2EY1A 4RKLA 5CC4A 5I9PA 5IGEA 4KV6A 4K14A 1KDBA 5JAVA 3V2TA 3U9OA 2PW5A 5I9OA
chains in the Genus database with same CATH superfamily
3FRPB 1LACA 3GTKH 5FK9C 1NTGA 4LF4L 3S1NB 4ZUJA 1LABA 3E6ZX 2WB1B 2VUMB 1VQCA 3GDEA 2D2CC 3K58A 2WKDA 2JEAI 3GTLH 4Y7NH 3E9HA 4DR1Q 2WFWA 5IYCG 4HJ7A 3PGZA 4DNRB 2H1EA 3PIO3 1I4QA 2ZXOA 1R9TH 5JJKA 3OYYA 2Y0SB 1H9SA 1FGBD 3PQIA 4FDBA 2EYLA 1UE6A 5I2XA 2UU9L 3HOVB 4IUVA 3J7AF 5AJ3L 1CZWA 2B2TC 2NTSA 3NWSA 3NPPA 4GKKL 1EQTA 5FO9B 1Y8PB 2K4KA 1KLGD 2JA9A 5LL6X 3AB9A 2HHHL 2UXDL 1D5ZC 4RCNA 1XXGA 2TSSA 5FO7B 1EEFD 2N3SA 1I94L 1EY4A 3VR3A 4B3TQ 1N8RC 1TVXA 3SDZA 5JJLA 2IL8A 2I5MX 1HFNA 3J7YW 2RF4A 1YJWA 2F0GA 3QJYA 1S5FD 2Z6KA 3QB3A 1JJGA 1ET6A 1HZBA 1LT6D 2PO4A 3A5ZB 1S4ZA 4OXPA 1XTCD 4N9TA 2KHSA 4P71A 2K03A 1F2YA 2MUYA 3MEFA 4L5TA 1PTOF 2MJ8A 1FGUA 1K8GA 4UDUC 1BUVT 4KY7A 2VW9A 1JORA 3GD7A 5KIXA 1JQYD 2A5HA 3VR5A 1Q8KA 3OMGA 4PQXA 1EQQA 1X3QA 2KECA 1SROA 1I50B 1C4QA 1SNCA 3RZOB 4A3FH 1D5XC 3X3NA 3C1EA 5IGBA 1DM0B 3J81i 1WTRA 1VQ7A 4BA2I 5EQ0A 1TKWB 4IALA 3WOEA 2XSCA 1DOLA 2LSSA 1CKNB 3CU7A 3M4OB 2UUCQ 1DXMA 3NE5B 1Z7TA 1GD7A 1FJGL 4DR4Q 4B9WA 3P1HA 1JE5A 3OTOL 2FMMA 1EOVA 2MFIA 1O78A 3CCEA 5CV9A 1EY6A 1U5KA 3DUZA 3KK7A 5IP7G 3MXNB 5IGCA 2MHVA 3RUZA 5M3MG 3M9BA 5CV4A 1A3VA 3FMCA 2A19A 2NN6G 4ZKCB 1AZQA 3NBHA 1PFBA 1WFQA 2ZXRA 1J8IA 1K9MC 3FKIH 4PZ6A 1A0IA 3LGJA 1DOMA 1TS4A 1PV4A 3T51B 1STBA 1GVPA 2L11A 1HA5A 1RF2D 3ERSX 1NR4A 4IFDH 5C4ZA 2RDHA 2CVRA 2F0OA 3PUZA 5FLXL 2YV5A 3LWUA 5NUCA 5C44B 4IJHA 4GNXB 4RWSC 2EY6A 4F7XA 2K01A 4P73A 1PLFA 1VQJA 3FKIB 3K81C 1TWHH 4I7AA 3SE0A 3UI2A 3G6EA 4B3SL 4MZ9A 1UUPA 4YWKA 1SYGA 5EJWA 5IYCH 1AH9A 3IKJA 3B6YA 2HCIA 3VA5A 1STGA 3C3LA 1TU2B 1NSNS 3CCLA 4DXGA 5IT9L 5C44H 4U68A 3J80i 4X65L 1STHA 2XIWA 2BCOA 4A3JH 1XMQL 2WB1E 2ZJRA 3PUVA 4QUFA 3HOZH 3AQQA 3J80E 4XQNA 4A93B 3ND9A 4HMIA 1JOQA 1I4HA 3S9WA 3I55A 1D6EC 2B63G 2DGYA 5IT9c 5EPKA 4A3MH 2VL6A 1A6XA 4RHSA 1ESFA 3Q6SA 5CBAE 2NVTB 4IFDG 3K5MA 3J7AV 1TS2A 1SSOA 3G48A 4OIJA 2OCEA 3PIP3 3PO2B 1J5EQ 3KLWA 1G6ZA 2FHTA 4A3JG 1STYA 1LTLA 1RDPD 2F3IA 5D14A 1SR3A 3CC2A 2BE5D 1I4GA 1BF4A 4E6IA 2F1MA 1SN8A 3Q8DA 3OWEB 5FKAC 1WTWA 3CF5A 1QNKA 1X56A 1AZPA 2I5LX 1HFGA 3I7FA 3I4MG 4DKAC 3R8BA 3F2UA 2VQFQ 1ONLA 3HOUB 2K6AA 1ZXTA 2CQAA 2Z8LA 3UE1A 1VQ5A 2B8FA 2CH4W 2M00A 1BCPF 3O13A 1VQ6A 2JA7H 4JI2Q 1QVCA 1VQ4A 5TSSA 1PH2A 1FYCA 4HMJA 2ZJQA 3CCSA 2F0IA 4I7ZC 1S5DD 4P74A 1SJED 3OIQA 3GO5A 1W6KA 1I94Q 3H6MA 4GN5A 1V43A 1XMOQ 5K5PA 4JOIA 3E3XA 2H5XA 4OO1H 2YYZA 1IL2A 4C3JG 2NVXH 1BOSA 4A3EG 2E2HH 3HP3A 2B63H 2NWGA 4YWMA 1EQVA 5C3WA 1XMQQ 2Z4HA 4K2LA 5C4JH 3K5LA 3H0GG 4DV7Q 3HOUH 2YTVA 2R7DA 4APVA 2FINB 4Q0FA 1UE5A 4BS9A 4R4OA 4L5QA 5L37A 4CDCC 3ICEA 1HUNA 4XYQA 5GROA 2N8NA 1X32A 2JA6G 2R93H 5BN4A 4DV5L 1K3BC 4ME3A 4JI7L 3QWNA 1ET9A 3Q22A 3CXCA 1PH7A 1QJOA 2D5DA 3CRKC 3MVVA 4XQJA 1LTTD 3L0OA 4C3JB 5KNBA 2JA5G 4GNXA 4YY3Q 1LLRD 1TY2A 2HUGA 4DV5Q 1MKHA 2F0TA 1TT2A 4R8NA 2F0UA 1K83B 3T16A 2ZM6L 3ULPA 5E1FA 2R7ZB 3G7LA 1WTPA 3KF6B 2VQEQ 4M8AA 2I07B 3EBEA 3NTKA 4TKOB 4YHHQ 2PW5A 2R93B 4K2KA 3KUPA 4UP9A 5ELNA 1B3QA 1QILA 1UNSA 4KI0A 1CHPD 5ELEA 3IRBA 1XNRQ 5T1IA 2RKSA 3SR1A 2K5VA 3M4OH 2D0OA 1XMOL 1F9RA 1FNVA 1OXVA 4GOPC 1QVGA 4FNFA 2IX0A 3CP0A 1II3A 2BA1A 4CBVA 1VQBA 4HCEA 4OX9Q 1PVOA 1GUGA 4NXNL 3I4MH 2M2LA 2F0HA 3PUXA 2VXWA 1JB7A 1QUQA 2X6LA 1ICFB 4IPHA 4AYBE 1G2TA 2VQFL 3NQIA 1EU4A 1DZ1A 3OHXC 1GOZA 1SMXA 1STAA 2R61A 1ENCA 3VR6A 5IP9H 1ASZA 4IPDA 4DAPA 4RGNA 5GAGC 3GTPH 1C0AA 3GTMB 2VB3X 1K0SA 2N88A 3RNUA 1IL8A 1YZ6A 4RMFA 3A7LA 4CDFC 3F2CA 3GQBA 2V1CC 2UXCQ 2JQOA 3GTQB 2ZXPA 2K7VA 3CCVA 3N52A 5IY0A 4C1NI 4B3RL 4IURA 2EY2A 2BA0A 2UUBL 1JJCB 1NAPA 4K0KQ 1VCIA 1U4PA 1Z6HA 3PV0A 4POFA 1XJVA 4XT1B 1EYCA 3J7ZC 3TDQA 3GTPB 1JC7A 2B29A 4DV2L 3D31A 4JYAQ 2IPKD 4JI0Q 4PZ8A 3TZDA 3T53B 2PMZE 5DM73 2PZUA 1E3PA 5EBCA 1GXDC 3HOXH 4JBKA 1IW7D 1VDZA 4OGQC 3MHBA 4AYBG 3K0YA 2EJMA 4DR3Q 2A74C 4O1NA 4OWWB 3A8KE 3MTSA 1PXUA 4GKJQ 1YBYA 1AE3A 4A93G 2ZTDA 3BS1A 4A3GH 5EAYA 4DV1L 1IBMQ 5CC4A 2LFNA 3T56B 1CTMA 2Q2HA 1VQFA 2EYPA 1YNJC 3D6WA 2V4DA 4ZCKA 3PUYA 4UY8C 4KD4A 1IYJB 4IOCA 3F8TA 3QG1A 1V1QA 3F1ZA 5D65A 1EUJA 3S24A 1H9SB 1IKLA 1MSHA 3S2DH 4ZK9B 4DR6L 1EWIA 4R1JA 4HJ9A 3S2HH 2GVAA 4R9WA 1VQOA 1MJEA 4ABNA 3RD4A 1LUZA 1HA6A 2UUAQ 2FJ2A 4DR1L 2ID0A 1CFMA 3HRZC 5FLXE 4HJ5A 3NEMA 3L3OC 3BYYB 2M9VA 3RR5A 3CCJA 3AFQA 5GAHC 4V0BA 3SEBA 4X3TA 4OO1I 5FLMH 1IZ6A 2K14A 4JV5Q 3TP7A 1HNXQ 2F0KA 1F2LA 2PZWA 3DLLA 4GOPA 1SE2A 4FXDA 5G3LD 5IYBH 2C9OA 5FOBB 5JVG3 3C1FA 4DV7L 1XPOA 2MP1A 2WINB 4NXML 4JI1Q 1RHPA 4DR7L 4OHJA 2KVMA 5FJ8H 5IP9G 2B39A 1JOKA 1LTID 3K7UC 2NYZD 1ZYRD 5C0XJ 1I4XA 1V1PA 3K80C 4BY7G 2YTYA 2E2HB 1JJ2A 2Y0SE 3NHHA 1SDFA 3NK9A 3I70A 4LFBL 4AH6A 4LUZA 1EQRA 2HIVA 1NE3A 2A6HC 1JMCA 1L0WA 1JOOA 4AIMA 3A7AB 5C4XH 2XVSA 1YHAA 4X66Q 1DCZA 1SMYC 2K5HA 3PSIA 4EVOA 1EY8A 3SGIA 3T1YL 1KRTA 4DR5Q 1PTOD 4FF2A 4A3IG 3P20A 3S17B 3HZXA 4BY7H 2UXCL 1PZJD 3HGBA 4GLXA 1TWCH 4FO2A 4DUYQ 5KGUA 2ENBA 2F0WA 5C5LA 4CHTB 5LL6S 1SMYD 1BCPC 1YEZA 3A55A 3S15H 1HRJA 1CKOA 1A3UA 2ATWA 3TZUA 4GN3B 5EPJA 4CKEA 3I90A 4JOIC 2CCZA 2SNMA 5KYLA 4LF6Q 1YITA 1KC8C 1PFSA 2C5CA 2RVLA 2Z6KC 3S17H 4H02A 5C3EG 1EYGA 1WTVA 2AUKA 1HR0W 3AYHB 2K5QA 4G7HC 1TWAH 3RLFA 5D3IB 2K05A 3H0GB 2D9UA 3RZDH 4IO9A 2RSNA 1RIPA 2UXBQ 5AJ3Q 1K8OA 1KAAA 3I4MB 2MNAA 1HQMC 3TRZA 4DN4M 2EYHA 3DXJC 1EYDA 1VQ9A 4IUPA 3ND8A 1EWHA 1EWCA 1QNUA 1F9SA 3CAMA 2L55A 3MAQA 4HEDA 4DR6Q 1R4QB 1IW7C 1G6PA 1EFWA 4A3CH 1YJ9A 1TQOA 1NUCA 4C3HB 3BVZA 3GTMH 1ICWA 2EXDA 2RCNA 5ELBA 2Q8IB 1M8AA 4WJ3M 1KNAA 2EY5A 5IGGA 3TS0A 1BQQT 1DYQA 2JP1A 3KLSA 2QW7A 4BBRB 4IPCA 2EIFA 3GTJH 2A68D 4ILWA 4C3IG 4LFCQ 1RJTA 1Q7YC 2K33A 4DK3C 1Y1WB 2X69A 1F77A 5EGTA 1QZHA 1N36Q 4LMQD 2MQHA 2B2UA 4MN3A 2B8GA 4XYOA 3PIPA 1JE4A 3K5NA 4LFAQ 4HJAA 1STNA 5E4WC 3D4RA 3K0XA 1N34Q 2NZOA 2WB1G 2VUMG 5JEAH 5KEEA 3TREA 3HOXB 3BZCA 1WCMH 4UP8A 5JOBA 3MXGA 3M4PA 4K0KL 1KLUD 5EKIA 1H9MA 1NY4A 1C48A 1KTKA 2NUCA 3MXNA 2MGSA 1EYAA 3S1RB 3S14H 1Q46A 3I4LA 4C3HG 2K50A 4LJZC 3TEHB 3AEVA 5K36G 1PH9A 3I4NG 4YCUA 2EYMA 1L1OB 4QIWE 4ULLA 3KOJA 3SK5A 2CQOA 1CQFA 1VQAA 2KA7A 1AFPA 5CGKA 3NENA 2PYKA 3OW2A 5JEAG 1WTOA 2SOBA 4J6HA 4PMBA 1MJCA 3CC4A 3CC7A 3SXHA 1E2VA 4QGUA 2Q2TA 1B4OA 3W1BA 4QB4A 3IFDA 3PCOB 4ZYSA 2PQAA 1V9PA 3S1MB 3M85A 2K04A 3FP9A 2A69D 1BBWA 1D1KA 1SLJA 2AWOA 3RMHA 5IGDA 1LT5D 1PH5A 2NTTA 1BXTA 4ODGA 5C4HA 2J0TD 1B7YB 4WORA 2DNEA 4ZKBB 2F0FA 5EKKA 4NW2A 4AQYQ 4P2CB 2NVQB 1H95A 1UE7A 4YWLA 2YU9H 1WCMG 2Z4IA 4KKUA 1FNUA 3H3VH 3BDLA 4FXKC 2XWBB 4K5VA 3UDFA 1F9PA 3CPWA 4GLAC 5CV6A 4JI5Q 4G57A 4R8IA 2AKWB 4DF7A 1VQHA 4A3GG 5J39A 1EOTA 4A3KB 2CW0C 1K0RA 1HJPA 4OO1G 4WFN3 3HOYH 3A0JA 2K75A 1CSQA 3Q0AA 3D8GA 3HFZB 1JWUD 1VF7A 1PTOB 2WAQG 2KCMA 3M3YB 2KEEA 4KY6A 4RKBA 5H1SE 3M4QA 4A76A 2UU9Q 1D8LA 2D0PA 2F4VL 5EPLA 1EY9A 5KNCA 4K8IA 2JA7B 2R3ZA 4J8QA 3PMFA 3TQYA 3CD6A 3WWVA 2GN5A 4XQQA 3J80L 1LO5D 3V2TA 2CKZB 2E76C 1CHQD 5DAUA 1AP0A 4KMUC 1UEBA 5M3MH 5JEAJ 3GTKB 4QMGA 4DV0L 5ELDA 4QY7A 2KHIA 1EEID 1R4PB 4KTAA 4BY7B 3U9SA 2AUJD 1N34L 1JCKB 3VDYA 2DJGC 1PZID 1PH4A 3OTOQ 2Z6BA 3R3OA 1I5FA 3M3YH 5K36H 5DEHA 1S72A 1R9TB 3S16B 2KQ3A 2RBMA 1Y1VB 1WVLA 2L0CA 3W3AA 3HOVH 1KAWA 4RA8A 3HOWG 1PRTD 1VQIA 2EYFA 4LFCL 1U9RA 2F0QA 2L5TA 1BCPD 4RCOA 5J1ZA 1TY0A 3QIAA 5C44G 1X3GA 1X54A 1A15A 1Z47A 4CKBA 2OWOA 1PYWD 4XIGS 1VQMA 3HKZB 1B70B 3U4ZA 1HZAA 4L5SA 1XX8A 4GN4B 1EL0A 1B1ZA 1C8CA 2O4XA 1EIFA 2K52A 2WV6D 2NVYH 4TRDA 4JI3Q 3CQZH 3W2DA 1Q86C 4LWCA 2RSOA 1L0YB 4G7OC 1Q1EA 2PQAB 3D3RA 3J81E 2EJFC 5A2QE 4C3IB 3I2ZA 2K5WA 4QCLA 3NSWA 5DM63 4LF6L 3OSOA 2F0MA 2PNRC 3EFXD 4DR3L 3V05A 2DUDA 5A2QL 2EZVA 1Q82C 5ELFA 4HIKA 3CQZB 2K1BA 2Y0SG 3OMCA 1Y8NB 1LTBD 1J6QA 1BVSA 2E8GA 1QCBD 1RODA 1TWGB 1NMGA 4YCVA 1X3FA 3D4WA 5IWAL 4BXXG 1IKMA 1DJRD 1YNJD 4A3FB 2D62A 2WIIB 3GTJB 5C6AA 3HEJA 2CWPA 1W2BA 3CMAA 3E0EA 4CGYB 1KDBA 4LF7Q 5I9OA 3K59A 2GVBA 4CDDC 2JA5H 1HHVA 3VA7A 2VY3A 3IL8A 4IJLA 1SNPA 1YI2A 1QG7A 3SK8A 1B53A 2PZTA 3HOUG 4L6TB 4HTHA 1VQLA 3MWYW 3TMEA 1SYEA 5CV7A 1PH3A 3A54A 3TSSA 4NP5A 4KK7A 1HCZA 2LXJA 2HT1A 1WD1A 1ML0D 5BR8L 1JWSD 1QUQB 2EVBA 4NMZA 2XRSD 4DUZQ 5HGQA 4WRDA 4JI1L 1AE2A 3S14B 3K6OA 1Q3LA 3BU2A 1STEA 5C0XH 3OWFA 4WJWA 1HR0L 2DN8A 1MI2A 1HNWL 3H3VC 4DV4L 2AQ1B 3MFYA 3CW2C 2QDBA 1CKMA 4A3EB 4B3MQ 1A2TA 2HIXA 2HDLA 1N36L 2B2YC 4P75A 1KDAA 1VMPA 2L4NA 4KHPQ 3KJOA 2KBNA 1A62A 2JA8B 4B9XA 1VQGA 1ZEQX 4B3ML 2NZHA 1SNMA 4A3GB 1SYCA 4CJ0B 1PDQA 4CJ1B 1TS5A 1UE1A 3KF6A 2A8VA 1CUKA 3VYSA 3HOZG 3HKZG 4RGTA 2IX1A 5CV8A 5M3FB 4QJFA 2E2IH 2Q8TA 1W3SA 4FF1A 1ILQA 1BKBA 4A4IA 2WAQB 1W6JA 3AFPA 1FJGQ 1Y8OB 5IODA 1LTSD 5M5YH 1BBUA 1I3QB 1DONA 2EQSA 4H44C 3PO3G 2YU9B 4A3FG 3S2DB 1F2MA 2EXZA 2DY7A 4N9PA 1L2FA 3VR4A 1SYDA 2N78A 2BDOA 4LW1A 4A3JB 2UXBL 2LMCB 2I0QA 1EIYB 4CDEC 1EY5A 1VMCA 2WAQE 4NPSA 1Z9FA 4A93H 4Z9CB 3NTHA 1E1OA 3I8ZA 1KIXA 3S1NH 1B44D 4XT3B 2FXQA 4DNTB 2MPMA 1I4PA 3FPPA 3RLNA 4HJ8A 2XTIA 1GM5A 1BDOA 4H13C 4R4CA 3QOLA 5T1GA 4IUNA 3PO2H 1IBML 1K3RA 3RLOA 3CRLC 4CJ2C 3FKIG 3HKZE 2CHBD 5I6WA 3SHLA 4PMWA 4DGZA 1G51A 2R92B 4IUQA 2B2UC 5IGFA 4JBJA 1SXTA 2QEJC 5M5WB 4JI2L 5I4DA 4FF3A 1Q90A 1BNZA 4HR7B 2BDNA 3DWQA 3Q24A 1VQPA 4DR5L 2KCNA 3U50C 3KBGA 3C2PA 3DEOA 4K5XA 1S3OA 5C0XG 2EDGA 2KHJA 3PUWA 2F0SA 4QL5A 1Q12A 5GQOA 1V1PB 4DK0A 4A3LH 1DOKA 3NWTA 1SNOA 1O7YA 5C4XB 1N32L 4LF8L 4BY1H 1OXXK 1S5ED 2RHSB 1VS0A 5CYUA 3STBC 4IFDJ 2A6ED 2NVXB 1HH2P 4HIDA 3T1HQ 4MNOA 1GUTA 1SYBA 2G9DA 3L7ZC 3KJPA 2O2LD 1CSPA 4DAMA 2A6EC 4HSPA 3E5SA 1B50A 3ZJYC 4A3CG 3CMEA 1RD9D 2E2DC 3TN2A 1BBXC 4N8X1 3KFUA 3CCUA 2Z1CA 1I4RA 4DV6Q 1ZYRC 4R4QA 2PI2A 4ZQ3A 3NP8A 3RZOH 1HTLD 4M1UB 1WI5A 4RFBA 1JT8A 5I2YA 1V1OA 4JCVE 2AHOB 1SYFA 1IBKQ 4KHVA 4X62Q 2ICEC 1HNXL 4HAEA 3UE0A 4X3KA 1TWAB 3RN5A 3RZDB 5JAVA 1SRUA 1K83H 3URYA 1TS3A 3EN2A 3S1QB 4KHPL 5E7NA 1N33Q 2R7ZH 1XNRL 4JI8L 1CQVA 4PZ7A 5ELCA 1RTNA 4B3SQ 4IQZA 2KOLA 2PCFB 2R7ZG 1HNWQ 4DXFA 1X65A 2VQEL 1A63A 1NNXA 4GLVB 1PH1A 3TS2A 4G4KA 2OXPA 4NKLA 2LKVA 1TR5A 3U58A 3CPFA 5CORA 4UPAA 2NBFA 4POGA 2J4XA 3D4DA 5FLXc 3HS0C 4DV1Q 3C46A 3S1QH 1SE3A 2JXMB 2I5HA 2F03A 2B2WA 4DPGA 2AQ2B 1HUMA 3UDGA 1SAPA 1CM9A 1NMFA 5LMUQ 4O2DA 1CA5A 1I6HH 1Y1VG 1HXYD 3ERQA 3I73A 4IUUA 2E5LQ 1TWFB 1B3AA 4GKJL 3M7NA 1EZ6A 1CZGA 2CWAA 1P8LA 4KKSA 4DV2Q 3TP8A 4LF7L 1PZKD 4KLKA 3BJUA 4DUZL 1CI3M 1KDCA 2UUBQ 1PRTB 4A3EH 4HIMA 2ALYB 1D5MC 5IWAQ 1EY0A 2Z9HA 3F2BA 1KABA 2IW3A 1VF5C 4J1MA 3A5UA 1MHWC 3WOFA 1C7YA 4KY5A 3IAYA 3HOWH 3L9AX 4H0LC 5M9OA 2JA8H 1T5XD 1I6HB 1HZCA 2JEBI 4K5WA 1M1KC 2JA6B 5GAEC 1Q81C 1TWFH 4EGVA 1MSGA 3PF5A 3QOJA 5M3FG 1X9NA 4LF5L 1QB5D 2E2JB 3H09A 4DV3Q 1WOCA 3S1RH 2WP8J 4RHRA 1FD7D 1L1OA 1N9WA 3W1GA 4S3SA 1PA6A 1YJNA 3RN2A 2PPBC 1K28A 4X6AH 4DAYA 1AW7A 3PO3H 4LF8Q 2QCPX 1I3QH 1MD2D 2A6HD 3G71A 4RG1A 2F0PA 4BBRG 2IHFA 5I9PA 1SEBD 4KV6A 4K14A 1QVFA 5AFWA 4U673 4DK1A 5JPMC 4OX9L 3NTIA 1HTPA 5LHY1 1SE4A 3DM1A 5KRUA 3NXWA 3S1MH 4BBSG 2EPBA 1TIID 4A3IB 2J7ZA 1GO3E 4NXNQ 1O7LA 2N49A 2F0DA 4MTNA 2LY7A 4F8MA 1DD2A 4A3DG 2E5LL 2NB0A 3K7AB 2NVQH 4HIOA 2EJGC 1U4MA 4EQNA 3EQLC 5LMNW 2OF1A 1G91A 1XNQL 2UXDQ 2NZ1D 3SK6A 3LNNA 2DY8A 3KBXA 1KL9A 3DM3A 4C56C 3VR2A 4YHHL 4A3IH 3ITPA 2RCFA 1IYUA 1XTDA 4DAVA 2MO1A 2A1AA 2VNUD 1PTOH 2B63B 1FVIA 1JR0D 1NCVA 4I65A 2AWNA 5C4JB 1PHJA 3OOCA 1C9OA 4A3LG 1UWVA 1VQDA 4DU9A 2K5DA 2ZTCA 3H3VI 3H91A 1Y69U 1XYIA 2KEDA 1D2BA 2JN4A 4X3UA 4XDXA 3A74A 2MO0A 3E9IA 3EJIA 3STBD 2QGQA 3L2PA 4TSSA 4BY1B 5BN3A 4KKTA 2KENA 4R4TA 4FP5D 2N55A 4A3BG 1E22A 3I72A 4EQ5A 1B9MA 3J81L 3IFTA 4PV1C 4NDXA 1MIUA 1E0BA 2ZJPA 4DV0Q 3CCRA 3I4NH 1XWEA 1HZ9A 3CKIB 3S16H 3DWAA 2JJQA 2F0NA 1ILPA 2XRQD 4B08A 3W5OA 4K6DA 4OONA 3PIOA 1XPUA 4X64L 3BDOA 1VQNA 2CW0D 2DNCA 4ME5A 1LTAD 2XNAC 4JK1C 5E3FA 4BWGB 2BH8A 2DJFC 4DUYL 4BXXH 4JYAL 1HR0Q 1IXRA 2QDLA 2IX3A 4IN3A 2P5ZX 3UDXA 4DR4L 1TXYA 1EIGA 2OTLA 3U4VA 4JG2A 3CCQA 2L1BA 1TWCB 3I4NB 5BR8Q 3X3MA 2HQEA 4TQUS 4V190 4R4IA 5CMDA 4IOAA 1Q1BA 4JI5L 3QO2A 1WTXA 4GNXC 1GUWA 1RL2A 1YVCA 4XXEA 2NN6H 4C3IH 3KDFA 1I50H 2A73B 5KNDA 2BE5C 1QWYA 2FMCA 3TP6A 3SVMA 1D7QA 1KHIA 3V96A 3F2DA 2R6GA 2O5IC 2K28A 2RA4A 3R93A 4LF5Q 3A56A 1WTHA 1M4VA 2CH4A 3JAMc 3I56A 1CK1A 2QA4A 3KLRA 1SJHD 1CA6A 3LX0A 2PNHA 5HGTA 1V8QA 3FVQA 4IPGA 4KD3A 1A3TA 2L9HA 2JE6I 3A8IE 4DAYB 1LM0A 3EROA 1TWGH 4C1NK 3GP7A 1RKNA 4KHZA 4EQOA 3TBIB 4DFAA 5CR3A 2L12A 1JICA 3GTQH 1YIJA 4C2MH 1GHKA 1H9RA 2K32A 1NBWA 4JBWA 5IYDH 2B3GA 4LFAL 4GOPB 1PYBA 4JV5L 3GV3A 4BBSH 1X6OA 3HG9A 4OIKA 4H7BA 1S5BD 2VZAA 1FL0A 1PMRA 4X64Q 1OO9B 4NB3A 3MC0B 1KD1C 1D1IA 2WKCA 3DHQA 4C3HH 2B2VC 1H9KA 5IIFA 3J80c 2A69C 3BVGA 5IE8A 4J15A 5GADC 5LMUL 3OPOA 1SE8A 1I6VC 1IHZA 2JA7G 4A3MG 1GHJA 2JK8A 4RH6A 2HDMA 2JA8G 5D3DA 1IBLQ 3NBHB 4C2MB 4LF4Q 3ER0A 3NUCA 2R92G 1EZ8A 4ZLTF 2BH2A 3HOVG 1O7IA 4RGOS 1B2TA 2OEOA 4GZYC 2LXKA 1PYSB 4BBSB 1ZKOA 3UDIA 5FJ8G 1DGSA 1YNXA 2A68C 1Y1WH 2B2TA 4XTCS 1TWHB 1SNDA 1OXUA 4RGMA 3T13A 3DWPA 3R2TA 2AMCB 1XNQQ 2QF7A 5IGEA 4UP7A 2JYOA 2EYOA 3JC66 1K8AC 3PO3B 2EYJA 1T9HA 4LUOA 1CKNA 1LYLA 2PQEA 1WCMB 1IBKL 2O5JC 2QKIC 5C4XG 1ESRA 3S2HB 2Q8RE 2Z0SA 5HY6A 1O80A 4ZRZA 1OXSC 3BDCA 4JC0A 1Q8IA 4EX5A 2F3WA 1PTOC 4QIWB 1BCPB 5G3LF 2F0EA 1YHQA 2ZT9C 5LMNL 1XPRA 2E2IB 1UEAB 3MXUA 3NQTA 4A3DH 3VYTA 3JAML 5E4XA 2KCCA 4ZUIA 4MHEA 5M5YB 3NELA 2WACA 3I91A 3T1HL 1YHBA 5JVH3 2EOTA 3HOXG 2E75C 1FR3A 2F4VQ 3D6CA 2I46A 1MBYA 3H94A 1J9OA 1LT4D 3P75A 5DNFA 3BYTB 2HQLA 3DEPA 3CHBD 1RCVD 1N32Q 2PMZB 4A3BH 2ASBA 1K73C 2VS1A 1GUSA 1WJJA 1VQ8A 5FLMG 4GS3A 1ASYA 3J81j 2G5DA 4K8JA 5JPNC 4Q5VA 3G6JB 4KN4C 1VQKA 3OW7A 2KJXA 2AQ3B 5J22A 2L15A 3Q23A 5A35A 4AQYL 1KNEA 3EA6A 3OIPA 4B3TL 2R92H 1YNND 4BA1I 2E74C 1LT3D 3HOYB 1JB3A 4A3BB 5M5WH 2HD3A 4IUTA 4LAAA 3CCMA 2BOSA 2VUMH 1GKHA 3ULJA 1F2ZA 3GTLB 1SFOB 3H15A 1SNQA 1JWMD 2IJ0A 3J7A5 1X3EA 3E0JA 3J81c 3LWEA 4NXMQ 3G4SA 2F52A 4WJ4A 2F4IA 3U9OA 4GKKQ 4O0AA 2FFKB 5ELOA 2PI2E 2HHHQ 3S15B 2Q2UA 3A8JE 3FEWX 3GV6A 3MZ5A 4OWXB 3QR8A 4QF4A 3M4YA 2ZM6Q 4DR2L 3EIVA 5JJIA 5CBEE 3BG3A 4L5RC 1L1OC 1KXLA 4A75A 2SNSA 1YNNC 2OQKA 5IYDG 4YY3L 1NJIC 2NN6I 4LFBQ 4KN7C 4JI3L 5M3MB 1PFMA 2F0VA 4KJOA 4A3KG 2XWJB 1KQSA 4Y52H 2HCCA 4C3JH 1SFOH 4F87A 4JI8Q 3FPUB 5M5XH 3DMUA 1PRTF 3AU7A 5J3BA 1Y14B 3VYRA 4JI7Q 5IOCA 1T5EA 1M90C 3KLSX 3MXPA 5DLQE 4DR7Q 3H0GH 2GA4B 1HNZQ 1Y1VH 1EFID 2SDFA 5BN5A 5LMNQ 2OTJA 3M7GA 4X62L 3PO2G 3KF8A 4MIUA 4JI4Q 5IYBG 2JSOA 3ZYYX 2LS01 2IWHA 3TP5A 1S40A 3MFGA 4CKCA 4JVZA 1B8AA 4OL7A 5JJZA 3K57A 4X3SA 1GJXA 1O7ZA 2RHQB 4JI4L 1OXTA 4MTKA 1N33L 4JI6L 1K8MA 3MA2B 4ZAIA 3K5OA 5M5XB 4LF9L 2NVYB 1QOHA 4L63B 3VYUA 2RDFA 1GUOA 1S5CD 2ZTEA 3N6RA 5FO8B 1BO0A 2Q2IA 2UUAL 2F3VA 2QEXA 4JI6Q 1VQEA 1KRSA 2YTXA 3I4OA 4RAUC 5C5MA 4L8JA 2SEBD 2RQXA 4JW0A 4BBRH 4DV4Q 3NBIA 2H4OA 4JI0L 3HOYG 2UUCL 3GTGH 1B9NA 4DNIA 4N8FA 3ONAB 4DR2Q 3SK4A 2OT2A 3EVQA 4TVAB 1IBLL 5KYIA 1Y1WG 5CV5A 1EU3A 2PW7A 1LTRD 1U0LA 2X6GA 5IT9E 1P16A 1F9QA 5F2DA 4JBMA 3MEHA 2TMPA 1IYVA 1PH8A 1J5EL 5COYA 1A8VA 4PMCA 4IFDI 1UAPA 4O42A 3WDNA 4ALPA 4KJNA 1A2UA 2EY1A 4DV3L 1QZGA 1HQRD 5ISRA 3K8AA 3AMUA 4BY1G 2IY5B 4EQPA 1SBBB 3GTGB 2K5NA 3GTOH 1E1TA 1LV9A 4DK6C 2IT1A 1AN8A 4ID6A 5EBDA 5EKLA 2JA5B 4QQBX 1G8ZD 3FHWA 3I3CA 1ENAA 1WD0A 2XN9C 2F0JA 1AEXA 1EY7A 1HPCA 2C35B 4YCWA 4G7ZC 4DA2A 4HSVA 4X65Q 3T4AC 3KYHC 4B3RQ 4FYDA 5IP7H 2VB2X 3P7JA 4OWTB 3JAMi 3HOWB 3D0FA 2KUMA 1X3PA 1PH6A 2JA6H 2R93G 1H9JA 3GTOB 3KDFB 1ENFA 3JAME 5C3XA 2E2JH 2QILA 1E24A 2G9HD 4OEMB 3R2IA 5C3EB 4UHVA 4PNYA 4LK1C 4YIJA 3FDTA 1U4LA 2XGTA 4F88A 3T1YQ 4P72A 4FXGC 4PG3A 1CT1D 3HKSA 2R7FA 4A3DB 3ULLA 2ES2A 4X66L 3BZKA 3BVMA 1RTOA 1OTCA 3BZDB 4AYBB 1WTQA 1QE6A 4JPBW 1GUNA 4HN7A 1E2WA 2B2WC 4IZ8A 1NR2A 4LUVA 3KF8B 1EIHA 3HOZB 1PRTC 5C3EH 2OQ0A 4FF4A 4A3KH 1G2SA 1LTGD 2F0LA 2KCTA 5M3FH 3PF4A 1L0XB 1E2ZA 4UAIA 2B2YA 2EE1A 4Y7NB 4A3MB 2ICIA 3K7AH 4LF9Q 2CFMA 2IHEA 5C0XI 1E7ZA 2NVTH 4OELB 1WYDA 5HURA 1BR9A 1X55A 1PFNA 4K6LA 1FNWA 1HNZL 5I6YA 4LNQA 1MGSA 2RDGA 4HCSA 4RKLA 2B2VA 1U4RA 1G291 4DV6L 4QUCA 4FVMA
chains in the Genus database with same CATH topology
3FRPB 1LACA 5FK9C 3S1NB 4ZUJA 1LABA 3E6ZX 2WB1B 2VUMB 2D2CC 3K58A 2WKDA 2JEAI 4DNRB 2H1EA 3PIO3 1I4QA 2ZXOA 2Y0SB 1H9SA 1FGBD 2EYLA 5I2XA 3HOVB 4IUVA 3J7AF 1CZWA 2B2TC 2NTSA 3NWSA 3NPPA 1EQTA 5FO9B 1Y8PB 1KLGD 5LL6X 3AB9A 1D5ZC 4RCNA 1XXGA 2TSSA 5FO7B 1EEFD 1EY4A 3VR3A 1TVXA 3SDZA 2IL8A 1HFNA 3J7YW 2F0GA 3QJYA 1S5FD 3QB3A 1ET6A 1LT6D 2PO4A 1S4ZA 1XTCD 4N9TA 2KHSA 2K03A 1F2YA 2MUYA 1PTOF 2MJ8A 4UDUC 1BUVT 4KY7A 1JORA 3GD7A 5KIXA 1JQYD 2A5HA 3VR5A 3OMGA 4PQXA 1X3QA 2KECA 1I50B 1C4QA 1SNCA 3RZOB 1D5XC 3X3NA 3C1EA 5IGBA 1DM0B 4BA2I 1WTRA 5EQ0A 1TKWB 4IALA 3WOEA 2XSCA 1DOLA 3CU7A 3M4OB 1DXMA 3NE5B 1Z7TA 4B9WA 3P1HA 2FMMA 1O78A 5CV9A 1EY6A 3DUZA 3KK7A 5IGCA 2MHVA 3RUZA 5CV4A 1A3VA 3FMCA 2NN6G 4ZKCB 1AZQA 3NBHA 1PFBA 2ZXRA 1J8IA 1DOMA 1TS4A 3T51B 1STBA 2L11A 1HA5A 1RF2D 1NR4A 4IFDH 5C4ZA 2RDHA 2CVRA 2F0OA 3PUZA 5FLXL 3LWUA 5NUCA 5C44B 4RWSC 2EY6A 4F7XA 2K01A 1PLFA 3FKIB 3SE0A 3UI2A 1UUPA 1SYGA 5EJWA 3IKJA 2HCIA 3VA5A 1STGA 3C3LA 1TU2B 1NSNS 4DXGA 5IT9L 4U68A 1STHA 2XIWA 2BCOA 3PUVA 4QUFA 3J80E 4XQNA 4A93B 3ND9A 4HMIA 1JOQA 1I4HA 3S9WA 1D6EC 5EPKA 4RHSA 1ESFA 3Q6SA 5CBAE 2NVTB 4IFDG 3K5MA 3J7AV 1TS2A 1SSOA 4OIJA 3PIP3 3PO2B 1G6ZA 2FHTA 1STYA 1RDPD 5D14A 2BE5D 1I4GA 1BF4A 4E6IA 2F1MA 3OWEB 5FKAC 1WTWA 1QNKA 1AZPA 1HFGA 3R8BA 3F2UA 1ONLA 3HOUB 2K6AA 1ZXTA 2CQAA 2Z8LA 2B8FA 2M00A 3O13A 1BCPF 5TSSA 1FYCA 4HMJA 2F0IA 4I7ZC 1S5DD 1SJED 3OIQA 3GO5A 1W6KA 3H6MA 1V43A 5K5PA 4OO1H 2YYZA 4C3JG 1BOSA 3HP3A 2NWGA 1EQVA 5C3WA 2Z4HA 4K2LA 3K5LA 2FINB 4Q0FA 4BS9A 1HUNA 4XYQA 1X32A 5BN4A 3QWNA 1ET9A 3Q22A 1QJOA 2D5DA 3CRKC 3MVVA 4XQJA 1LTTD 4C3JB 5KNBA 1LLRD 1TY2A 2HUGA 2F0TA 1TT2A 4R8NA 2F0UA 1K83B 3T16A 5E1FA 2R7ZB 3G7LA 1WTPA 4M8AA 2I07B 3NTKA 4TKOB 2PW5A 2R93B 4K2KA 3KUPA 1QILA 1UNSA 4KI0A 1CHPD 5ELEA 5T1IA 2RKSA 3SR1A 1F9RA 1FNVA 1OXVA 4FNFA 2IX0A 1II3A 2BA1A 4CBVA 4HCEA 1GUGA 2M2LA 2F0HA 3PUXA 2VXWA 2X6LA 1G2TA 3NQIA 1EU4A 1DZ1A 3OHXC 1GOZA 1STAA 2R61A 1ENCA 3VR6A 4DAPA 4RGNA 3GTMB 2VB3X 2N88A 1IL8A 3A7LA 3GQBA 3GTQB 2ZXPA 2K7VA 3N52A 4C1NI 4IURA 2EY2A 2BA0A 1NAPA 1VCIA 1U4PA 1Z6HA 3PV0A 4XT1B 1EYCA 3TDQA 3GTPB 1JC7A 3D31A 2IPKD 3TZDA 3T53B 5DM73 2PZUA 5EBCA 1GXDC 1IW7D 1VDZA 4OGQC 3MHBA 3K0YA 2EJMA 2A74C 4O1NA 3A8KE 3MTSA 1PXUA 3BS1A 5CC4A 2LFNA 3T56B 1CTMA 2EYPA 1YNJC 3D6WA 2V4DA 3PUYA 4KD4A 3QG1A 5D65A 1H9SB 1IKLA 1MSHA 4ZK9B 4R9WA 4ABNA 3RD4A 1HA6A 2FJ2A 2ID0A 1CFMA 3HRZC 5FLXE 3L3OC 3BYYB 2M9VA 4V0BA 3SEBA 4X3TA 4OO1I 3TP7A 2F0KA 1F2LA 2PZWA 1SE2A 4FXDA 5G3LD 2C9OA 5FOBB 5JVG3 3C1FA 2MP1A 2WINB 1RHPA 4OHJA 2KVMA 2B39A 1JOKA 1LTID 2NYZD 1ZYRD 5C0XJ 1I4XA 1V1PA 2E2HB 3NHHA 1SDFA 3NK9A 3I70A 2A6HC 1JOOA 3A7AB 2XVSA 1DCZA 1SMYC 4EVOA 1EY8A 1PTOD 4FF2A 3P20A 3S17B 3HZXA 1PZJD 3HGBA 4FO2A 5KGUA 2ENBA 2F0WA 5C5LA 4CHTB 5LL6S 1SMYD 1BCPC 3A55A 1HRJA 1A3UA 3TZUA 5EPJA 4CKEA 3I90A 2SNMA 5KYLA 2C5CA 2RVLA 1WTVA 2AUKA 2K5QA 4G7HC 3RLFA 5D3IB 2K05A 3H0GB 2D9UA 2RSNA 1K8OA 1KAAA 3I4MB 1HQMC 4DN4M 2EYHA 3DXJC 1EYDA 4IUPA 3ND8A 1EWHA 1EWCA 1QNUA 1F9SA 2L55A 3MAQA 4HEDA 1R4QB 1IW7C 1TQOA 1NUCA 4C3HB 3BVZA 1ICWA 5ELBA 2Q8IB 1M8AA 1KNAA 2EY5A 5IGGA 1BQQT 1DYQA 2JP1A 3KLSA 4BBRB 2A68D 4ILWA 4C3IG 1RJTA 2K33A 1Y1WB 2X69A 1F77A 5EGTA 4LMQD 2B2UA 4MN3A 2B8GA 4XYOA 1JE4A 3K5NA 1STNA 5E4WC 3D4RA 5JEAH 5KEEA 3HOXB 5JOBA 3MXGA 1KLUD 5EKIA 1H9MA 1C48A 1KTKA 2NUCA 3MXNA 2MGSA 1EYAA 3S1RB 3I4LA 4C3HG 4LJZC 5K36G 2EYMA 4ULLA 3SK5A 1CQFA 1AFPA 2KA7A 5CGKA 2PYKA 5JEAG 1WTOA 2SOBA 4J6HA 4PMBA 3SXHA 1E2VA 1B4OA 4QB4A 3IFDA 4ZYSA 3S1MB 3M85A 2K04A 2A69D 1D1KA 2AWOA 3RMHA 5IGDA 1LT5D 2NTTA 1BXTA 5C4HA 4ODGA 2J0TD 4WORA 2DNEA 4ZKBB 2F0FA 5EKKA 4NW2A 4P2CB 2NVQB 2Z4IA 4KKUA 1FNUA 3BDLA 4FXKC 2XWBB 4K5VA 1F9PA 5CV6A 4G57A 4R8IA 4DF7A 5J39A 1EOTA 4A3KB 2CW0C 4OO1G 4WFN3 3Q0AA 3D8GA 1JWUD 1VF7A 1PTOB 3M3YB 2KEEA 4KY6A 4RKBA 5EPLA 1EY9A 5KNCA 4K8IA 2JA7B 2R3ZA 4J8QA 3PMFA 4XQQA 3J80L 1LO5D 3V2TA 2E76C 1CHQD 5DAUA 1AP0A 4KMUC 5JEAJ 3GTKB 4QMGA 5ELDA 4KTAA 1EEID 1R4PB 4BY7B 3U9SA 2AUJD 1JCKB 1PZID 3R3OA 5K36H 5DEHA 1R9TB 3S16B 2KQ3A 2RBMA 1Y1VB 1WVLA 2L0CA 3W3AA 4RA8A 1PRTD 2EYFA 1U9RA 2F0QA 2L5TA 1BCPD 4RCOA 5J1ZA 1TY0A 3QIAA 1A15A 1Z47A 4CKBA 1PYWD 4XIGS 3HKZB 1XX8A 1EL0A 1B1ZA 1C8CA 2O4XA 2WV6D 4TRDA 3W2DA 2RSOA 1L0YB 4G7OC 1Q1EA 3D3RA 3J81E 2EJFC 5A2QE 4C3IB 2K5WA 4QCLA 3NSWA 5DM63 3OSOA 2F0MA 2PNRC 3EFXD 3V05A 5A2QL 2EZVA 5ELFA 3CQZB 2K1BA 3OMCA 1Y8NB 1LTBD 1QCBD 1RODA 1TWGB 3D4WA 1IKMA 1DJRD 1YNJD 4A3FB 2D62A 2WIIB 3GTJB 5C6AA 3HEJA 4CGYB 1KDBA 5I9OA 3K59A 1HHVA 3VA7A 3IL8A 1SNPA 1QG7A 3SK8A 1B53A 2PZTA 4L6TB 4HTHA 3MWYW 3TMEA 1SYEA 5CV7A 3A54A 3TSSA 4NP5A 4KK7A 1HCZA 1WD1A 1ML0D 1JWSD 2EVBA 4NMZA 2XRSD 4WRDA 3S14B 3K6OA 1Q3LA 1STEA 5C0XH 3OWFA 4WJWA 2DN8A 1MI2A 3H3VC 2AQ1B 3MFYA 2QDBA 4A3EB 1A2TA 2HDLA 2B2YC 1KDAA 1VMPA 2L4NA 2JA8B 4B9XA 1ZEQX 1SNMA 4A3GB 1SYCA 4CJ0B 1PDQA 4CJ1B 1TS5A 3VYSA 4RGTA 2IX1A 5CV8A 5M3FB 2Q8TA 4FF1A 1ILQA 2WAQB 1W6JA 1Y8OB 5IODA 1LTSD 1I3QB 1DONA 4H44C 2YU9B 3S2DB 1F2MA 2EXZA 2DY7A 4N9PA 3VR4A 1SYDA 4A3JB 2BDOA 2LMCB 1EY5A 1VMCA 4Z9CB 3NTHA 3I8ZA 1B44D 4XT3B 4DNTB 2MPMA 1I4PA 3FPPA 1BDOA 4H13C 3QOLA 5T1GA 4IUNA 3CRLC 4CJ2C 2CHBD 5I6WA 3SHLA 4PMWA 4DGZA 2R92B 4IUQA 2B2UC 5IGFA 1SXTA 2QEJC 5M5WB 5I4DA 4FF3A 1Q90A 1BNZA 4HR7B 2BDNA 3DWQA 3Q24A 2KCNA 3KBGA 3C2PA 3DEOA 4K5XA 5C0XG 2EDGA 3PUWA 2F0SA 1Q12A 1V1PB 4DK0A 1DOKA 3NWTA 1SNOA 1O7YA 5C4XB 1OXXK 1S5ED 5CYUA 4IFDJ 2A6ED 2NVXB 1GUTA 1SYBA 2G9DA 3L7ZC 2O2LD 2A6EC 4HSPA 3E5SA 1B50A 1RD9D 2E2DC 3TN2A 1BBXC 2Z1CA 1I4RA 1ZYRC 4ZQ3A 3NP8A 1HTLD 4M1UB 4RFBA 5I2YA 1V1OA 1SYFA 4KHVA 2ICEC 4HAEA 4X3KA 1TWAB 3RZDB 5JAVA 3URYA 1TS3A 3S1QB 1CQVA 5ELCA 1RTNA 4IQZA 2KOLA 2PCFB 4DXFA 4G4KA 2OXPA 4NKLA 2LKVA 1TR5A 5CORA 2NBFA 2J4XA 3D4DA 3HS0C 3C46A 1SE3A 2JXMB 2F03A 2B2WA 2AQ2B 1HUMA 1SAPA 1CM9A 1CA5A 1HXYD 3ERQA 3I73A 4IUUA 1TWFB 1B3AA 3M7NA 1EZ6A 1CZGA 4KKSA 3TP8A 1PZKD 1CI3M 1KDCA 1PRTB 1D5MC 1EY0A 1KABA 2IW3A 1VF5C 4J1MA 3WOFA 4KY5A 3IAYA 3L9AX 4H0LC 5M9OA 1T5XD 1I6HB 2JEBI 4K5WA 2JA6B 4EGVA 1MSGA 3QOJA 1QB5D 2E2JB 3H09A 2WP8J 4RHRA 1FD7D 4S3SA 2PPBC 4DAYA 1AW7A 2QCPX 1MD2D 2A6HD 2F0PA 5I9PA 1SEBD 4KV6A 4K14A 5AFWA 4U673 4DK1A 5JPMC 3NTIA 1HTPA 5LHY1 1SE4A 3DM1A 5KRUA 3NXWA 2EPBA 1TIID 4A3IB 2J7ZA 1O7LA 2F0DA 2LY7A 4F8MA 1DD2A 2NB0A 3K7AB 2EJGC 1U4MA 4EQNA 3EQLC 2OF1A 1G91A 2NZ1D 3SK6A 3LNNA 2DY8A 3KBXA 4C56C 3VR2A 3ITPA 1IYUA 4DAVA 2VNUD 1PTOH 2B63B 1JR0D 1NCVA 4I65A 2AWNA 5C4JB 3OOCA 4DU9A 2K5DA 3H91A 1Y69U 1XYIA 2KEDA 1D2BA 4X3UA 4XDXA 3EJIA 4TSSA 4BY1B 5BN3A 4KKTA 4FP5D 2N55A 3I72A 1B9MA 3J81L 3IFTA 4PV1C 4NDXA 1E0BA 1XWEA 3CKIB 3DWAA 2F0NA 1ILPA 2XRQD 4B08A 4K6DA 3BDOA 2CW0D 2DNCA 4ME5A 1LTAD 2XNAC 4JK1C 5E3FA 4BWGB 2IX3A 4IN3A 1EIGA 2L1BA 1TWCB 3I4NB 3X3MA 2HQEA 4TQUS 4V190 5CMDA 1Q1BA 3QO2A 1WTXA 1GUWA 4XXEA 2NN6H 2A73B 5KNDA 2BE5C 1QWYA 2FMCA 3TP6A 3SVMA 3V96A 2R6GA 2O5IC 2K28A 2RA4A 3R93A 3A56A 1M4VA 1CK1A 3KLRA 1SJHD 1CA6A 3LX0A 5HGTA 1V8QA 3FVQA 4KD3A 1A3TA 2L9HA 2JE6I 3A8IE 3EROA 4C1NK 3GP7A 1RKNA 4KHZA 4EQOA 3TBIB 4DFAA 5CR3A 2L12A 1JICA 1GHKA 1H9RA 2K32A 4JBWA 3GV3A 3HG9A 4OIKA 4H7BA 1S5BD 1PMRA 1OO9B 3MC0B 1D1IA 2WKCA 3DHQA 2B2VC 1H9KA 5IIFA 2A69C 3BVGA 3OPOA 1I6VC 1IHZA 1GHJA 4RH6A 2HDMA 5D3DA 4C2MB 3NUCA 1EZ8A 4ZLTF 4RGOS 1B2TA 2OEOA 4GZYC 4BBSB 1ZKOA 2A68C 2B2TA 4XTCS 1TWHB 1SNDA 1OXUA 4RGMA 3T13A 3DWPA 3R2TA 2QF7A 5IGEA 2JYOA 2EYOA 3PO3B 2EYJA 2PQEA 1WCMB 2O5JC 2QKIC 1ESRA 3S2HB 2Q8RE 1O80A 4ZRZA 1OXSC 3BDCA 1Q8IA 2F3WA 1PTOC 4QIWB 1BCPB 5G3LF 2F0EA 2ZT9C 2E2IB 1UEAB 3MXUA 3NQTA 3VYTA 3JAML 5E4XA 2KCCA 4ZUIA 4MHEA 5M5YB 2WACA 3I91A 5JVH3 2EOTA 2E75C 1FR3A 3D6CA 2I46A 1MBYA 3H94A 1J9OA 1LT4D 3P75A 5DNFA 3BYTB 3DEPA 3CHBD 1RCVD 2PMZB 1GUSA 4K8JA 5JPNC 4Q5VA 3G6JB 4KN4C 3OW7A 2KJXA 2AQ3B 5J22A 3Q23A 5A35A 1KNEA 3EA6A 3OIPA 1YNND 4BA1I 2E74C 1LT3D 3HOYB 1JB3A 4A3BB 4LAAA 4IUTA 2BOSA 1F2ZA 3GTLB 1SFOB 1SNQA 1JWMD 2IJ0A 3E0JA 3LWEA 2F4IA 3U9OA 2FFKB 3S15B 3A8JE 3FEWX 3GV6A 3MZ5A 4QF4A 3M4YA 5CBEE 3BG3A 2SNSA 1YNNC 2NN6I 4KN7C 5M3MB 1PFMA 2F0VA 4KJOA 2XWJB 2HCCA 4F87A 3FPUB 3DMUA 1PRTF 3AU7A 3VYRA 5IOCA 1T5EA 3KLSX 3MXPA 2GA4B 1EFID 2SDFA 5BN5A 3M7GA 3KF8A 4MIUA 2JSOA 3ZYYX 2LS01 2IWHA 3TP5A 3MFGA 4CKCA 4OL7A 5JJZA 3K57A 4X3SA 1GJXA 1O7ZA 1OXTA 1K8MA 3MA2B 4ZAIA 3K5OA 5M5XB 2NVYB 1QOHA 4L63B 3VYUA 2RDFA 1GUOA 1S5CD 3N6RA 5FO8B 1BO0A 2F3VA 4RAUC 5C5MA 4L8JA 2SEBD 2RQXA 3NBIA 2H4OA 1B9NA 3ONAB 3SK4A 2OT2A 3EVQA 5KYIA 5CV5A 1EU3A 2PW7A 1LTRD 2X6GA 5IT9E 1F9QA 5F2DA 3MEHA 2TMPA 1IYVA 5COYA 4PMCA 4IFDI 1UAPA 4O42A 3WDNA 4KJNA 1A2UA 2EY1A 1HQRD 5ISRA 3AMUA 4EQPA 1SBBB 3GTGB 1LV9A 2IT1A 1AN8A 4ID6A 5EBDA 5EKLA 2JA5B 1G8ZD 3I3CA 1ENAA 1WD0A 2XN9C 2F0JA 1AEXA 1EY7A 1HPCA 4G7ZC 4DA2A 4HSVA 3T4AC 4FYDA 2VB2X 3P7JA 3HOWB 2KUMA 1X3PA 1H9JA 3GTOB 1ENFA 3JAME 5C3XA 2QILA 2G9HD 5C3EB 3R2IA 4PNYA 4LK1C 4YIJA 3FDTA 1U4LA 4F88A 4FXGC 1CT1D 4A3DB 3BVMA 1RTOA 3BZDB 4AYBB 1WTQA 1QE6A 1GUNA 4HN7A 1E2WA 2B2WC 4IZ8A 1NR2A 1EIHA 3HOZB 1PRTC 4FF4A 1G2SA 1LTGD 2F0LA 1L0XB 1E2ZA 4UAIA 2B2YA 2EE1A 4Y7NB 4A3MB 2ICIA 5C0XI 5HURA 1BR9A 1PFNA 4K6LA 1FNWA 5I6YA 1MGSA 2RDGA 4HCSA 4RKLA 2B2VA 1U4RA 1G291 1A6XA 4QUCA 4FVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2K A;  2EYO A;  2EYP A;  4EQP A;  5DAU A;  2EYJ A;  5KGU A;  2ENB A;  2F0W A;  5JOB A;  4ZUJ A;  5C5L A;  3MZ5 A;  5KRU A;  4KD4 A;  4QF4 A;  2PQE A;  1SNP A;  3NXW A;  4B9W A;  4QMG A;  3P1H A;  3SK8 A;  4ID6 A;  2PZT A;  1STY A;  2HQE A;  5EKL A;  2RKS A;  2SNS A;  4HTH A;  4KTA A;  3QOL A;  1A3U A;  5CV9 A;  3SR1 A;  1EY6 A;  3TME A;  4IUN A;  1SYE A;  2F0D A;  5CV7 A;  1ENA A;  5KEE A;  2NUC A;  2SNM A;  2OXP A;  2F0J A;  4NKL A;  1EYA A;  1EY7 A;  2F0V A;  1AEX A;  2LKV A;  3R3O A;  1TR5 A;  2EYL A;  4KJO A;  1A3V A;  5CV4 A;  1II3 A;  3BDC A;  5DEH A;  3SHL A;  4DGZ A;  5I6W A;  5IGF A;  2KQ3 A;  2EYM A;  2F3W A;  2RBM A;  3DMU A;  3D4D A;  3SK5 A;  4EQN A;  2F0H A;  2F0E A;  3TP6 A;  2OF1 A;  5CGK A;  5IOC A;  2PYK A;  3MXP A;  2EYF A;  2SOB A;  4NMZ A;  3NQT A;  1U9R A;  2F0Q A;  4J6H A;  4PMB A;  3SK6 A;  1STB A;  2M00 A;  4WRD A;  5J1Z A;  4ZUI A;  4K5X A;  3SXH A;  2F0S A;  4MIU A;  3OWF A;  5C3X A;  2WAC A;  3ITP A;  1STA A;  4HMJ A;  1ENC A;  1KAA A;  3RUZ A;  4E6I A;  5C4Z A;  2F0I A;  4PNY A;  3ERQ A;  3LX0 A;  4QB4 A;  5ISR A;  2F0O A;  1EY4 A;  4YIJ A;  2QDB A;  3TP5 A;  5HGT A;  1SNO A;  3TP7 A;  2EYH A;  3H6M A;  4KD3 A;  1EYD A;  2F0K A;  5NUC A;  1A3T A;  1A2T A;  1EZ6 A;  2O4X A;  3D6C A;  2PZW A;  4OL7 A;  5K5P A;  3ERO A;  4TRD A;  1KDA A;  4I65 A;  5KYL A;  1RKN A;  2EY6 A;  3P75 A;  4EQO A;  4F7X A;  3TP8 A;  2F0G A;  5CR3 A;  4DFA A;  5IGD A;  3C1F A;  4B9X A;  4DU9 A;  3QB3 A;  4ODG A;  5C4H A;  1EQV A;  5C3W A;  1KDC A;  1SNM A;  1SYC A;  4WOR A;  2RDF A;  4K2L A;  2F0F A;  5EKK A;  1SYG A;  4N9T A;  1TQO A;  1NUC A;  2F3V A;  1SYB A;  2KHS A;  3EJI A;  4H7B A;  4NP5 A;  1EY0 A;  1JOK A;  1KAB A;  2EY2 A;  3BDL A;  3E5S A;  4J1M A;  4K8J A;  1JOQ A;  5CV8 A;  5C5M A;  4IZ8 A;  1F2Y A;  3DHQ A;  4K5V A;  4KY5 A;  3VA5 A;  1STG A;  5M9O A;  5IIF A;  3OSO A;  2EY5 A;  5IGG A;  2F0M A;  3NHH A;  4K5W A;  5J22 A;  5CV6 A;  1EYC A;  1NSN S;  2F0L A;  3NK9 A;  4G57 A;  5IOD A;  4F8M A;  4DF7 A;  3QOJ A;  1IHZ A;  5J39 A;  4NDX A;  4KY7 A;  1JOR A;  4ZQ3 A;  3SK4 A;  3NP8 A;  1F2M A;  1STH A;  2EXZ A;  3EVQ A;  3OMC A;  3MVV A;  5KIX A;  5KYI A;  1JOO A;  4N9P A;  5CV5 A;  2PZU A;  4S3S A;  3D8G A;  3OMG A;  2F0N A;  2PW7 A;  3NUC A;  1EZ8 A;  1SYD A;  4K6D A;  1SNC A;  3MHB A;  5IGC A;  2OEO A;  5EGT A;  5F2D A;  3C1E A;  5HUR A;  5IGB A;  3D4W A;  3MEH A;  2F0T A;  1SYF A;  1EY5 A;  4HMI A;  4LAA A;  1TT2 A;  4KY6 A;  4R8N A;  4RKB A;  1EY8 A;  2F0U A;  4KHV A;  4EVO A;  3S9W A;  3T16 A;  4IAL A;  1F2Z A;  2F0P A;  1SND A;  1SNQ A;  5E1F A;  4PMC A;  1EY9 A;  1STN A;  3T13 A;  3HEJ A;  4K8I A;  4ME5 A;  5C6A A;  5I6Y A;  4KJN A;  3HZX A;  5E3F A;  3PMF A;  1A2U A;  2EY1 A;  4RKL A;  5CC4 A;  5I9P A;  5IGE A;  4KV6 A;  4K14 A;  1KDB A;  5JAV A;  3V2T A;  3U9O A;  2PW5 A;  5I9O A; 
#chains in the Genus database with same CATH topology
 3FRP B;  1LAC A;  3GTK H;  5FK9 C;  1NTG A;  4LF4 L;  3S1N B;  4ZUJ A;  1LAB A;  3E6Z X;  2WB1 B;  2VUM B;  1VQC A;  3GDE A;  2D2C C;  3K58 A;  2WKD A;  2JEA I;  3GTL H;  4Y7N H;  3E9H A;  4DR1 Q;  2WFW A;  5IYC G;  4HJ7 A;  3PGZ A;  4DNR B;  2H1E A;  3PIO 3;  1I4Q A;  2ZXO A;  1R9T H;  5JJK A;  3OYY A;  2Y0S B;  1H9S A;  1FGB D;  3PQI A;  4FDB A;  2EYL A;  1UE6 A;  5I2X A;  2UU9 L;  3HOV B;  4IUV A;  3J7A F;  5AJ3 L;  1CZW A;  2B2T C;  2NTS A;  3NWS A;  3NPP A;  4GKK L;  1EQT A;  5FO9 B;  1Y8P B;  2K4K A;  1KLG D;  2JA9 A;  5LL6 X;  3AB9 A;  2HHH L;  2UXD L;  1D5Z C;  4RCN A;  1XXG A;  2TSS A;  5FO7 B;  1EEF D;  2N3S A;  1I94 L;  1EY4 A;  3VR3 A;  4B3T Q;  1N8R C;  1TVX A;  3SDZ A;  5JJL A;  2IL8 A;  2I5M X;  1HFN A;  3J7Y W;  2RF4 A;  1YJW A;  2F0G A;  3QJY A;  1S5F D;  2Z6K A;  3QB3 A;  1JJG A;  1ET6 A;  1HZB A;  1LT6 D;  2PO4 A;  3A5Z B;  1S4Z A;  4OXP A;  1XTC D;  4N9T A;  2KHS A;  4P71 A;  2K03 A;  1F2Y A;  2MUY A;  3MEF A;  4L5T A;  1PTO F;  2MJ8 A;  1FGU A;  1K8G A;  4UDU C;  1BUV T;  4KY7 A;  2VW9 A;  1JOR A;  3GD7 A;  5KIX A;  1JQY D;  2A5H A;  3VR5 A;  1Q8K A;  3OMG A;  4PQX A;  1EQQ A;  1X3Q A;  2KEC A;  1SRO A;  1I50 B;  1C4Q A;  1SNC A;  3RZO B;  4A3F H;  1D5X C;  3X3N A;  3C1E A;  5IGB A;  1DM0 B;  3J81 i;  1WTR A;  1VQ7 A;  4BA2 I;  5EQ0 A;  1TKW B;  4IAL A;  3WOE A;  2XSC A;  1DOL A;  2LSS A;  1CKN B;  3CU7 A;  3M4O B;  2UUC Q;  1DXM A;  3NE5 B;  1Z7T A;  1GD7 A;  1FJG L;  4DR4 Q;  4B9W A;  3P1H A;  1JE5 A;  3OTO L;  2FMM A;  1EOV A;  2MFI A;  1O78 A;  3CCE A;  5CV9 A;  1EY6 A;  1U5K A;  3DUZ A;  3KK7 A;  5IP7 G;  3MXN B;  5IGC A;  2MHV A;  3RUZ A;  5M3M G;  3M9B A;  5CV4 A;  1A3V A;  3FMC A;  2A19 A;  2NN6 G;  4ZKC B;  1AZQ A;  3NBH A;  1PFB A;  1WFQ A;  2ZXR A;  1J8I A;  1K9M C;  3FKI H;  4PZ6 A;  1A0I A;  3LGJ A;  1DOM A;  1TS4 A;  1PV4 A;  3T51 B;  1STB A;  1GVP A;  2L11 A;  1HA5 A;  1RF2 D;  3ERS X;  1NR4 A;  4IFD H;  5C4Z A;  2RDH A;  2CVR A;  2F0O A;  3PUZ A;  5FLX L;  2YV5 A;  3LWU A;  5NUC A;  5C44 B;  4IJH A;  4GNX B;  4RWS C;  2EY6 A;  4F7X A;  2K01 A;  4P73 A;  1PLF A;  1VQJ A;  3FKI B;  3K81 C;  1TWH H;  4I7A A;  3SE0 A;  3UI2 A;  3G6E A;  4B3S L;  4MZ9 A;  1UUP A;  4YWK A;  1SYG A;  5EJW A;  5IYC H;  1AH9 A;  3IKJ A;  3B6Y A;  2HCI A;  3VA5 A;  1STG A;  3C3L A;  1TU2 B;  1NSN S;  3CCL A;  4DXG A;  5IT9 L;  5C44 H;  4U68 A;  3J80 i;  4X65 L;  1STH A;  2XIW A;  2BCO A;  4A3J H;  1XMQ L;  2WB1 E;  2ZJR A;  3PUV A;  4QUF A;  3HOZ H;  3AQQ A;  3J80 E;  4XQN A;  4A93 B;  3ND9 A;  4HMI A;  1JOQ A;  1I4H A;  3S9W A;  3I55 A;  1D6E C;  2B63 G;  2DGY A;  5IT9 c;  5EPK A;  4A3M H;  2VL6 A;  1A6X A;  4RHS A;  1ESF A;  3Q6S A;  5CBA E;  2NVT B;  4IFD G;  3K5M A;  3J7A V;  1TS2 A;  1SSO A;  3G48 A;  4OIJ A;  2OCE A;  3PIP 3;  3PO2 B;  1J5E Q;  3KLW A;  1G6Z A;  2FHT A;  4A3J G;  1STY A;  1LTL A;  1RDP D;  2F3I A;  5D14 A;  1SR3 A;  3CC2 A;  2BE5 D;  1I4G A;  1BF4 A;  4E6I A;  2F1M A;  1SN8 A;  3Q8D A;  3OWE B;  5FKA C;  1WTW A;  3CF5 A;  1QNK A;  1X56 A;  1AZP A;  2I5L X;  1HFG A;  3I7F A;  3I4M G;  4DKA C;  3R8B A;  3F2U A;  2VQF Q;  1ONL A;  3HOU B;  2K6A A;  1ZXT A;  2CQA A;  2Z8L A;  3UE1 A;  1VQ5 A;  2B8F A;  2CH4 W;  2M00 A;  1BCP F;  3O13 A;  1VQ6 A;  2JA7 H;  4JI2 Q;  1QVC A;  1VQ4 A;  5TSS A;  1PH2 A;  1FYC A;  4HMJ A;  2ZJQ A;  3CCS A;  2F0I A;  4I7Z C;  1S5D D;  4P74 A;  1SJE D;  3OIQ A;  3GO5 A;  1W6K A;  1I94 Q;  3H6M A;  4GN5 A;  1V43 A;  1XMO Q;  5K5P A;  4JOI A;  3E3X A;  2H5X A;  4OO1 H;  2YYZ A;  1IL2 A;  4C3J G;  2NVX H;  1BOS A;  4A3E G;  2E2H H;  3HP3 A;  2B63 H;  2NWG A;  4YWM A;  1EQV A;  5C3W A;  1XMQ Q;  2Z4H A;  4K2L A;  5C4J H;  3K5L A;  3H0G G;  4DV7 Q;  3HOU H;  2YTV A;  2R7D A;  4APV A;  2FIN B;  4Q0F A;  1UE5 A;  4BS9 A;  4R4O A;  4L5Q A;  5L37 A;  4CDC C;  3ICE A;  1HUN A;  4XYQ A;  5GRO A;  2N8N A;  1X32 A;  2JA6 G;  2R93 H;  5BN4 A;  4DV5 L;  1K3B C;  4ME3 A;  4JI7 L;  3QWN A;  1ET9 A;  3Q22 A;  3CXC A;  1PH7 A;  1QJO A;  2D5D A;  3CRK C;  3MVV A;  4XQJ A;  1LTT D;  3L0O A;  4C3J B;  5KNB A;  2JA5 G;  4GNX A;  4YY3 Q;  1LLR D;  1TY2 A;  2HUG A;  4DV5 Q;  1MKH A;  2F0T A;  1TT2 A;  4R8N A;  2F0U A;  1K83 B;  3T16 A;  2ZM6 L;  3ULP A;  5E1F A;  2R7Z B;  3G7L A;  1WTP A;  3KF6 B;  2VQE Q;  4M8A A;  2I07 B;  3EBE A;  3NTK A;  4TKO B;  4YHH Q;  2PW5 A;  2R93 B;  4K2K A;  3KUP A;  4UP9 A;  5ELN A;  1B3Q A;  1QIL A;  1UNS A;  4KI0 A;  1CHP D;  5ELE A;  3IRB A;  1XNR Q;  5T1I A;  2RKS A;  3SR1 A;  2K5V A;  3M4O H;  2D0O A;  1XMO L;  1F9R A;  1FNV A;  1OXV A;  4GOP C;  1QVG A;  4FNF A;  2IX0 A;  3CP0 A;  1II3 A;  2BA1 A;  4CBV A;  1VQB A;  4HCE A;  4OX9 Q;  1PVO A;  1GUG A;  4NXN L;  3I4M H;  2M2L A;  2F0H A;  3PUX A;  2VXW A;  1JB7 A;  1QUQ A;  2X6L A;  1ICF B;  4IPH A;  4AYB E;  1G2T A;  2VQF L;  3NQI A;  1EU4 A;  1DZ1 A;  3OHX C;  1GOZ A;  1SMX A;  1STA A;  2R61 A;  1ENC A;  3VR6 A;  5IP9 H;  1ASZ A;  4IPD A;  4DAP A;  4RGN A;  5GAG C;  3GTP H;  1C0A A;  3GTM B;  2VB3 X;  1K0S A;  2N88 A;  3RNU A;  1IL8 A;  1YZ6 A;  4RMF A;  3A7L A;  4CDF C;  3F2C A;  3GQB A;  2V1C C;  2UXC Q;  2JQO A;  3GTQ B;  2ZXP A;  2K7V A;  3CCV A;  3N52 A;  5IY0 A;  4C1N I;  4B3R L;  4IUR A;  2EY2 A;  2BA0 A;  2UUB L;  1JJC B;  1NAP A;  4K0K Q;  1VCI A;  1U4P A;  1Z6H A;  3PV0 A;  4POF A;  1XJV A;  4XT1 B;  1EYC A;  3J7Z C;  3TDQ A;  3GTP B;  1JC7 A;  2B29 A;  4DV2 L;  3D31 A;  4JYA Q;  2IPK D;  4JI0 Q;  4PZ8 A;  3TZD A;  3T53 B;  2PMZ E;  5DM7 3;  2PZU A;  1E3P A;  5EBC A;  1GXD C;  3HOX H;  4JBK A;  1IW7 D;  1VDZ A;  4OGQ C;  3MHB A;  4AYB G;  3K0Y A;  2EJM A;  4DR3 Q;  2A74 C;  4O1N A;  4OWW B;  3A8K E;  3MTS A;  1PXU A;  4GKJ Q;  1YBY A;  1AE3 A;  4A93 G;  2ZTD A;  3BS1 A;  4A3G H;  5EAY A;  4DV1 L;  1IBM Q;  5CC4 A;  2LFN A;  3T56 B;  1CTM A;  2Q2H A;  1VQF A;  2EYP A;  1YNJ C;  3D6W A;  2V4D A;  4ZCK A;  3PUY A;  4UY8 C;  4KD4 A;  1IYJ B;  4IOC A;  3F8T A;  3QG1 A;  1V1Q A;  3F1Z A;  5D65 A;  1EUJ A;  3S24 A;  1H9S B;  1IKL A;  1MSH A;  3S2D H;  4ZK9 B;  4DR6 L;  1EWI A;  4R1J A;  4HJ9 A;  3S2H H;  2GVA A;  4R9W A;  1VQO A;  1MJE A;  4ABN A;  3RD4 A;  1LUZ A;  1HA6 A;  2UUA Q;  2FJ2 A;  4DR1 L;  2ID0 A;  1CFM A;  3HRZ C;  5FLX E;  4HJ5 A;  3NEM A;  3L3O C;  3BYY B;  2M9V A;  3RR5 A;  3CCJ A;  3AFQ A;  5GAH C;  4V0B A;  3SEB A;  4X3T A;  4OO1 I;  5FLM H;  1IZ6 A;  2K14 A;  4JV5 Q;  3TP7 A;  1HNX Q;  2F0K A;  1F2L A;  2PZW A;  3DLL A;  4GOP A;  1SE2 A;  4FXD A;  5G3L D;  5IYB H;  2C9O A;  5FOB B;  5JVG 3;  3C1F A;  4DV7 L;  1XPO A;  2MP1 A;  2WIN B;  4NXM L;  4JI1 Q;  1RHP A;  4DR7 L;  4OHJ A;  2KVM A;  5FJ8 H;  5IP9 G;  2B39 A;  1JOK A;  1LTI D;  3K7U C;  2NYZ D;  1ZYR D;  5C0X J;  1I4X A;  1V1P A;  3K80 C;  4BY7 G;  2YTY A;  2E2H B;  1JJ2 A;  2Y0S E;  3NHH A;  1SDF A;  3NK9 A;  3I70 A;  4LFB L;  4AH6 A;  4LUZ A;  1EQR A;  2HIV A;  1NE3 A;  2A6H C;  1JMC A;  1L0W A;  1JOO A;  4AIM A;  3A7A B;  5C4X H;  2XVS A;  1YHA A;  4X66 Q;  1DCZ A;  1SMY C;  2K5H A;  3PSI A;  4EVO A;  1EY8 A;  3SGI A;  3T1Y L;  1KRT A;  4DR5 Q;  1PTO D;  4FF2 A;  4A3I G;  3P20 A;  3S17 B;  3HZX A;  4BY7 H;  2UXC L;  1PZJ D;  3HGB A;  4GLX A;  1TWC H;  4FO2 A;  4DUY Q;  5KGU A;  2ENB A;  2F0W A;  5C5L A;  4CHT B;  5LL6 S;  1SMY D;  1BCP C;  1YEZ A;  3A55 A;  3S15 H;  1HRJ A;  1CKO A;  1A3U A;  2ATW A;  3TZU A;  4GN3 B;  5EPJ A;  4CKE A;  3I90 A;  4JOI C;  2CCZ A;  2SNM A;  5KYL A;  4LF6 Q;  1YIT A;  1KC8 C;  1PFS A;  2C5C A;  2RVL A;  2Z6K C;  3S17 H;  4H02 A;  5C3E G;  1EYG A;  1WTV A;  2AUK A;  1HR0 W;  3AYH B;  2K5Q A;  4G7H C;  1TWA H;  3RLF A;  5D3I B;  2K05 A;  3H0G B;  2D9U A;  3RZD H;  4IO9 A;  2RSN A;  1RIP A;  2UXB Q;  5AJ3 Q;  1K8O A;  1KAA A;  3I4M B;  2MNA A;  1HQM C;  3TRZ A;  4DN4 M;  2EYH A;  3DXJ C;  1EYD A;  1VQ9 A;  4IUP A;  3ND8 A;  1EWH A;  1EWC A;  1QNU A;  1F9S A;  3CAM A;  2L55 A;  3MAQ A;  4HED A;  4DR6 Q;  1R4Q B;  1IW7 C;  1G6P A;  1EFW A;  4A3C H;  1YJ9 A;  1TQO A;  1NUC A;  4C3H B;  3BVZ A;  3GTM H;  1ICW A;  2EXD A;  2RCN A;  5ELB A;  2Q8I B;  1M8A A;  4WJ3 M;  1KNA A;  2EY5 A;  5IGG A;  3TS0 A;  1BQQ T;  1DYQ A;  2JP1 A;  3KLS A;  2QW7 A;  4BBR B;  4IPC A;  2EIF A;  3GTJ H;  2A68 D;  4ILW A;  4C3I G;  4LFC Q;  1RJT A;  1Q7Y C;  2K33 A;  4DK3 C;  1Y1W B;  2X69 A;  1F77 A;  5EGT A;  1QZH A;  1N36 Q;  4LMQ D;  2MQH A;  2B2U A;  4MN3 A;  2B8G A;  4XYO A;  3PIP A;  1JE4 A;  3K5N A;  4LFA Q;  4HJA A;  1STN A;  5E4W C;  3D4R A;  3K0X A;  1N34 Q;  2NZO A;  2WB1 G;  2VUM G;  5JEA H;  5KEE A;  3TRE A;  3HOX B;  3BZC A;  1WCM H;  4UP8 A;  5JOB A;  3MXG A;  3M4P A;  4K0K L;  1KLU D;  5EKI A;  1H9M A;  1NY4 A;  1C48 A;  1KTK A;  2NUC A;  3MXN A;  2MGS A;  1EYA A;  3S1R B;  3S14 H;  1Q46 A;  3I4L A;  4C3H G;  2K50 A;  4LJZ C;  3TEH B;  3AEV A;  5K36 G;  1PH9 A;  3I4N G;  4YCU A;  2EYM A;  1L1O B;  4QIW E;  4ULL A;  3KOJ A;  3SK5 A;  2CQO A;  1CQF A;  1VQA A;  2KA7 A;  1AFP A;  5CGK A;  3NEN A;  2PYK A;  3OW2 A;  5JEA G;  1WTO A;  2SOB A;  4J6H A;  4PMB A;  1MJC A;  3CC4 A;  3CC7 A;  3SXH A;  1E2V A;  4QGU A;  2Q2T A;  1B4O A;  3W1B A;  4QB4 A;  3IFD A;  3PCO B;  4ZYS A;  2PQA A;  1V9P A;  3S1M B;  3M85 A;  2K04 A;  3FP9 A;  2A69 D;  1BBW A;  1D1K A;  1SLJ A;  2AWO A;  3RMH A;  5IGD A;  1LT5 D;  1PH5 A;  2NTT A;  1BXT A;  4ODG A;  5C4H A;  2J0T D;  1B7Y B;  4WOR A;  2DNE A;  4ZKB B;  2F0F A;  5EKK A;  4NW2 A;  4AQY Q;  4P2C B;  2NVQ B;  1H95 A;  1UE7 A;  4YWL A;  2YU9 H;  1WCM G;  2Z4I A;  4KKU A;  1FNU A;  3H3V H;  3BDL A;  4FXK C;  2XWB B;  4K5V A;  3UDF A;  1F9P A;  3CPW A;  4GLA C;  5CV6 A;  4JI5 Q;  4G57 A;  4R8I A;  2AKW B;  4DF7 A;  1VQH A;  4A3G G;  5J39 A;  1EOT A;  4A3K B;  2CW0 C;  1K0R A;  1HJP A;  4OO1 G;  4WFN 3;  3HOY H;  3A0J A;  2K75 A;  1CSQ A;  3Q0A A;  3D8G A;  3HFZ B;  1JWU D;  1VF7 A;  1PTO B;  2WAQ G;  2KCM A;  3M3Y B;  2KEE A;  4KY6 A;  4RKB A;  5H1S E;  3M4Q A;  4A76 A;  2UU9 Q;  1D8L A;  2D0P A;  2F4V L;  5EPL A;  1EY9 A;  5KNC A;  4K8I A;  2JA7 B;  2R3Z A;  4J8Q A;  3PMF A;  3TQY A;  3CD6 A;  3WWV A;  2GN5 A;  4XQQ A;  3J80 L;  1LO5 D;  3V2T A;  2CKZ B;  2E76 C;  1CHQ D;  5DAU A;  1AP0 A;  4KMU C;  1UEB A;  5M3M H;  5JEA J;  3GTK B;  4QMG A;  4DV0 L;  5ELD A;  4QY7 A;  2KHI A;  1EEI D;  1R4P B;  4KTA A;  4BY7 B;  3U9S A;  2AUJ D;  1N34 L;  1JCK B;  3VDY A;  2DJG C;  1PZI D;  1PH4 A;  3OTO Q;  2Z6B A;  3R3O A;  1I5F A;  3M3Y H;  5K36 H;  5DEH A;  1S72 A;  1R9T B;  3S16 B;  2KQ3 A;  2RBM A;  1Y1V B;  1WVL A;  2L0C A;  3W3A A;  3HOV H;  1KAW A;  4RA8 A;  3HOW G;  1PRT D;  1VQI A;  2EYF A;  4LFC L;  1U9R A;  2F0Q A;  2L5T A;  1BCP D;  4RCO A;  5J1Z A;  1TY0 A;  3QIA A;  5C44 G;  1X3G A;  1X54 A;  1A15 A;  1Z47 A;  4CKB A;  2OWO A;  1PYW D;  4XIG S;  1VQM A;  3HKZ B;  1B70 B;  3U4Z A;  1HZA A;  4L5S A;  1XX8 A;  4GN4 B;  1EL0 A;  1B1Z A;  1C8C A;  2O4X A;  1EIF A;  2K52 A;  2WV6 D;  2NVY H;  4TRD A;  4JI3 Q;  3CQZ H;  3W2D A;  1Q86 C;  4LWC A;  2RSO A;  1L0Y B;  4G7O C;  1Q1E A;  2PQA B;  3D3R A;  3J81 E;  2EJF C;  5A2Q E;  4C3I B;  3I2Z A;  2K5W A;  4QCL A;  3NSW A;  5DM6 3;  4LF6 L;  3OSO A;  2F0M A;  2PNR C;  3EFX D;  4DR3 L;  3V05 A;  2DUD A;  5A2Q L;  2EZV A;  1Q82 C;  5ELF A;  4HIK A;  3CQZ B;  2K1B A;  2Y0S G;  3OMC A;  1Y8N B;  1LTB D;  1J6Q A;  1BVS A;  2E8G A;  1QCB D;  1ROD A;  1TWG B;  1NMG A;  4YCV A;  1X3F A;  3D4W A;  5IWA L;  4BXX G;  1IKM A;  1DJR D;  1YNJ D;  4A3F B;  2D62 A;  2WII B;  3GTJ B;  5C6A A;  3HEJ A;  2CWP A;  1W2B A;  3CMA A;  3E0E A;  4CGY B;  1KDB A;  4LF7 Q;  5I9O A;  3K59 A;  2GVB A;  4CDD C;  2JA5 H;  1HHV A;  3VA7 A;  2VY3 A;  3IL8 A;  4IJL A;  1SNP A;  1YI2 A;  1QG7 A;  3SK8 A;  1B53 A;  2PZT A;  3HOU G;  4L6T B;  4HTH A;  1VQL A;  3MWY W;  3TME A;  1SYE A;  5CV7 A;  1PH3 A;  3A54 A;  3TSS A;  4NP5 A;  4KK7 A;  1HCZ A;  2LXJ A;  2HT1 A;  1WD1 A;  1ML0 D;  5BR8 L;  1JWS D;  1QUQ B;  2EVB A;  4NMZ A;  2XRS D;  4DUZ Q;  5HGQ A;  4WRD A;  4JI1 L;  1AE2 A;  3S14 B;  3K6O A;  1Q3L A;  3BU2 A;  1STE A;  5C0X H;  3OWF A;  4WJW A;  1HR0 L;  2DN8 A;  1MI2 A;  1HNW L;  3H3V C;  4DV4 L;  2AQ1 B;  3MFY A;  3CW2 C;  2QDB A;  1CKM A;  4A3E B;  4B3M Q;  1A2T A;  2HIX A;  2HDL A;  1N36 L;  2B2Y C;  4P75 A;  1KDA A;  1VMP A;  2L4N A;  4KHP Q;  3KJO A;  2KBN A;  1A62 A;  2JA8 B;  4B9X A;  1VQG A;  1ZEQ X;  4B3M L;  2NZH A;  1SNM A;  4A3G B;  1SYC A;  4CJ0 B;  1PDQ A;  4CJ1 B;  1TS5 A;  1UE1 A;  3KF6 A;  2A8V A;  1CUK A;  3VYS A;  3HOZ G;  3HKZ G;  4RGT A;  2IX1 A;  5CV8 A;  5M3F B;  4QJF A;  2E2I H;  2Q8T A;  1W3S A;  4FF1 A;  1ILQ A;  1BKB A;  4A4I A;  2WAQ B;  1W6J A;  3AFP A;  1FJG Q;  1Y8O B;  5IOD A;  1LTS D;  5M5Y H;  1BBU A;  1I3Q B;  1DON A;  2EQS A;  4H44 C;  3PO3 G;  2YU9 B;  4A3F G;  3S2D B;  1F2M A;  2EXZ A;  2DY7 A;  4N9P A;  1L2F A;  3VR4 A;  1SYD A;  2N78 A;  2BDO A;  4LW1 A;  4A3J B;  2UXB L;  2LMC B;  2I0Q A;  1EIY B;  4CDE C;  1EY5 A;  1VMC A;  2WAQ E;  4NPS A;  1Z9F A;  4A93 H;  4Z9C B;  3NTH A;  1E1O A;  3I8Z A;  1KIX A;  3S1N H;  1B44 D;  4XT3 B;  2FXQ A;  4DNT B;  2MPM A;  1I4P A;  3FPP A;  3RLN A;  4HJ8 A;  2XTI A;  1GM5 A;  1BDO A;  4H13 C;  4R4C A;  3QOL A;  5T1G A;  4IUN A;  3PO2 H;  1IBM L;  1K3R A;  3RLO A;  3CRL C;  4CJ2 C;  3FKI G;  3HKZ E;  2CHB D;  5I6W A;  3SHL A;  4PMW A;  4DGZ A;  1G51 A;  2R92 B;  4IUQ A;  2B2U C;  5IGF A;  4JBJ A;  1SXT A;  2QEJ C;  5M5W B;  4JI2 L;  5I4D A;  4FF3 A;  1Q90 A;  1BNZ A;  4HR7 B;  2BDN A;  3DWQ A;  3Q24 A;  1VQP A;  4DR5 L;  2KCN A;  3U50 C;  3KBG A;  3C2P A;  3DEO A;  4K5X A;  1S3O A;  5C0X G;  2EDG A;  2KHJ A;  3PUW A;  2F0S A;  4QL5 A;  1Q12 A;  5GQO A;  1V1P B;  4DK0 A;  4A3L H;  1DOK A;  3NWT A;  1SNO A;  1O7Y A;  5C4X B;  1N32 L;  4LF8 L;  4BY1 H;  1OXX K;  1S5E D;  2RHS B;  1VS0 A;  5CYU A;  3STB C;  4IFD J;  2A6E D;  2NVX B;  1HH2 P;  4HID A;  3T1H Q;  4MNO A;  1GUT A;  1SYB A;  2G9D A;  3L7Z C;  3KJP A;  2O2L D;  1CSP A;  4DAM A;  2A6E C;  4HSP A;  3E5S A;  1B50 A;  3ZJY C;  4A3C G;  3CME A;  1RD9 D;  2E2D C;  3TN2 A;  1BBX C;  4N8X 1;  3KFU A;  3CCU A;  2Z1C A;  1I4R A;  4DV6 Q;  1ZYR C;  4R4Q A;  2PI2 A;  4ZQ3 A;  3NP8 A;  3RZO H;  1HTL D;  4M1U B;  1WI5 A;  4RFB A;  1JT8 A;  5I2Y A;  1V1O A;  4JCV E;  2AHO B;  1SYF A;  1IBK Q;  4KHV A;  4X62 Q;  2ICE C;  1HNX L;  4HAE A;  3UE0 A;  4X3K A;  1TWA B;  3RN5 A;  3RZD B;  5JAV A;  1SRU A;  1K83 H;  3URY A;  1TS3 A;  3EN2 A;  3S1Q B;  4KHP L;  5E7N A;  1N33 Q;  2R7Z H;  1XNR L;  4JI8 L;  1CQV A;  4PZ7 A;  5ELC A;  1RTN A;  4B3S Q;  4IQZ A;  2KOL A;  2PCF B;  2R7Z G;  1HNW Q;  4DXF A;  1X65 A;  2VQE L;  1A63 A;  1NNX A;  4GLV B;  1PH1 A;  3TS2 A;  4G4K A;  2OXP A;  4NKL A;  2LKV A;  1TR5 A;  3U58 A;  3CPF A;  5COR A;  4UPA A;  2NBF A;  4POG A;  2J4X A;  3D4D A;  5FLX c;  3HS0 C;  4DV1 Q;  3C46 A;  3S1Q H;  1SE3 A;  2JXM B;  2I5H A;  2F03 A;  2B2W A;  4DPG A;  2AQ2 B;  1HUM A;  3UDG A;  1SAP A;  1CM9 A;  1NMF A;  5LMU Q;  4O2D A;  1CA5 A;  1I6H H;  1Y1V G;  1HXY D;  3ERQ A;  3I73 A;  4IUU A;  2E5L Q;  1TWF B;  1B3A A;  4GKJ L;  3M7N A;  1EZ6 A;  1CZG A;  2CWA A;  1P8L A;  4KKS A;  4DV2 Q;  3TP8 A;  4LF7 L;  1PZK D;  4KLK A;  3BJU A;  4DUZ L;  1CI3 M;  1KDC A;  2UUB Q;  1PRT B;  4A3E H;  4HIM A;  2ALY B;  1D5M C;  5IWA Q;  1EY0 A;  2Z9H A;  3F2B A;  1KAB A;  2IW3 A;  1VF5 C;  4J1M A;  3A5U A;  1MHW C;  3WOF A;  1C7Y A;  4KY5 A;  3IAY A;  3HOW H;  3L9A X;  4H0L C;  5M9O A;  2JA8 H;  1T5X D;  1I6H B;  1HZC A;  2JEB I;  4K5W A;  1M1K C;  2JA6 B;  5GAE C;  1Q81 C;  1TWF H;  4EGV A;  1MSG A;  3PF5 A;  3QOJ A;  5M3F G;  1X9N A;  4LF5 L;  1QB5 D;  2E2J B;  3H09 A;  4DV3 Q;  1WOC A;  3S1R H;  2WP8 J;  4RHR A;  1FD7 D;  1L1O A;  1N9W A;  3W1G A;  4S3S A;  1PA6 A;  1YJN A;  3RN2 A;  2PPB C;  1K28 A;  4X6A H;  4DAY A;  1AW7 A;  3PO3 H;  4LF8 Q;  2QCP X;  1I3Q H;  1MD2 D;  2A6H D;  3G71 A;  4RG1 A;  2F0P A;  4BBR G;  2IHF A;  5I9P A;  1SEB D;  4KV6 A;  4K14 A;  1QVF A;  5AFW A;  4U67 3;  4DK1 A;  5JPM C;  4OX9 L;  3NTI A;  1HTP A;  5LHY 1;  1SE4 A;  3DM1 A;  5KRU A;  3NXW A;  3S1M H;  4BBS G;  2EPB A;  1TII D;  4A3I B;  2J7Z A;  1GO3 E;  4NXN Q;  1O7L A;  2N49 A;  2F0D A;  4MTN A;  2LY7 A;  4F8M A;  1DD2 A;  4A3D G;  2E5L L;  2NB0 A;  3K7A B;  2NVQ H;  4HIO A;  2EJG C;  1U4M A;  4EQN A;  3EQL C;  5LMN W;  2OF1 A;  1G91 A;  1XNQ L;  2UXD Q;  2NZ1 D;  3SK6 A;  3LNN A;  2DY8 A;  3KBX A;  1KL9 A;  3DM3 A;  4C56 C;  3VR2 A;  4YHH L;  4A3I H;  3ITP A;  2RCF A;  1IYU A;  1XTD A;  4DAV A;  2MO1 A;  2A1A A;  2VNU D;  1PTO H;  2B63 B;  1FVI A;  1JR0 D;  1NCV A;  4I65 A;  2AWN A;  5C4J B;  1PHJ A;  3OOC A;  1C9O A;  4A3L G;  1UWV A;  1VQD A;  4DU9 A;  2K5D A;  2ZTC A;  3H3V I;  3H91 A;  1Y69 U;  1XYI A;  2KED A;  1D2B A;  2JN4 A;  4X3U A;  4XDX A;  3A74 A;  2MO0 A;  3E9I A;  3EJI A;  3STB D;  2QGQ A;  3L2P A;  4TSS A;  4BY1 B;  5BN3 A;  4KKT A;  2KEN A;  4R4T A;  4FP5 D;  2N55 A;  4A3B G;  1E22 A;  3I72 A;  4EQ5 A;  1B9M A;  3J81 L;  3IFT A;  4PV1 C;  4NDX A;  1MIU A;  1E0B A;  2ZJP A;  4DV0 Q;  3CCR A;  3I4N H;  1XWE A;  1HZ9 A;  3CKI B;  3S16 H;  3DWA A;  2JJQ A;  2F0N A;  1ILP A;  2XRQ D;  4B08 A;  3W5O A;  4K6D A;  4OON A;  3PIO A;  1XPU A;  4X64 L;  3BDO A;  1VQN A;  2CW0 D;  2DNC A;  4ME5 A;  1LTA D;  2XNA C;  4JK1 C;  5E3F A;  4BWG B;  2BH8 A;  2DJF C;  4DUY L;  4BXX H;  4JYA L;  1HR0 Q;  1IXR A;  2QDL A;  2IX3 A;  4IN3 A;  2P5Z X;  3UDX A;  4DR4 L;  1TXY A;  1EIG A;  2OTL A;  3U4V A;  4JG2 A;  3CCQ A;  2L1B A;  1TWC B;  3I4N B;  5BR8 Q;  3X3M A;  2HQE A;  4TQU S;  4V19 0;  4R4I A;  5CMD A;  4IOA A;  1Q1B A;  4JI5 L;  3QO2 A;  1WTX A;  4GNX C;  1GUW A;  1RL2 A;  1YVC A;  4XXE A;  2NN6 H;  4C3I H;  3KDF A;  1I50 H;  2A73 B;  5KND A;  2BE5 C;  1QWY A;  2FMC A;  3TP6 A;  3SVM A;  1D7Q A;  1KHI A;  3V96 A;  3F2D A;  2R6G A;  2O5I C;  2K28 A;  2RA4 A;  3R93 A;  4LF5 Q;  3A56 A;  1WTH A;  1M4V A;  2CH4 A;  3JAM c;  3I56 A;  1CK1 A;  2QA4 A;  3KLR A;  1SJH D;  1CA6 A;  3LX0 A;  2PNH A;  5HGT A;  1V8Q A;  3FVQ A;  4IPG A;  4KD3 A;  1A3T A;  2L9H A;  2JE6 I;  3A8I E;  4DAY B;  1LM0 A;  3ERO A;  1TWG H;  4C1N K;  3GP7 A;  1RKN A;  4KHZ A;  4EQO A;  3TBI B;  4DFA A;  5CR3 A;  2L12 A;  1JIC A;  3GTQ H;  1YIJ A;  4C2M H;  1GHK A;  1H9R A;  2K32 A;  1NBW A;  4JBW A;  5IYD H;  2B3G A;  4LFA L;  4GOP B;  1PYB A;  4JV5 L;  3GV3 A;  4BBS H;  1X6O A;  3HG9 A;  4OIK A;  4H7B A;  1S5B D;  2VZA A;  1FL0 A;  1PMR A;  4X64 Q;  1OO9 B;  4NB3 A;  3MC0 B;  1KD1 C;  1D1I A;  2WKC A;  3DHQ A;  4C3H H;  2B2V C;  1H9K A;  5IIF A;  3J80 c;  2A69 C;  3BVG A;  5IE8 A;  4J15 A;  5GAD C;  5LMU L;  3OPO A;  1SE8 A;  1I6V C;  1IHZ A;  2JA7 G;  4A3M G;  1GHJ A;  2JK8 A;  4RH6 A;  2HDM A;  2JA8 G;  5D3D A;  1IBL Q;  3NBH B;  4C2M B;  4LF4 Q;  3ER0 A;  3NUC A;  2R92 G;  1EZ8 A;  4ZLT F;  2BH2 A;  3HOV G;  1O7I A;  4RGO S;  1B2T A;  2OEO A;  4GZY C;  2LXK A;  1PYS B;  4BBS B;  1ZKO A;  3UDI A;  5FJ8 G;  1DGS A;  1YNX A;  2A68 C;  1Y1W H;  2B2T A;  4XTC S;  1TWH B;  1SND A;  1OXU A;  4RGM A;  3T13 A;  3DWP A;  3R2T A;  2AMC B;  1XNQ Q;  2QF7 A;  5IGE A;  4UP7 A;  2JYO A;  2EYO A;  3JC6 6;  1K8A C;  3PO3 B;  2EYJ A;  1T9H A;  4LUO A;  1CKN A;  1LYL A;  2PQE A;  1WCM B;  1IBK L;  2O5J C;  2QKI C;  5C4X G;  1ESR A;  3S2H B;  2Q8R E;  2Z0S A;  5HY6 A;  1O80 A;  4ZRZ A;  1OXS C;  3BDC A;  4JC0 A;  1Q8I A;  4EX5 A;  2F3W A;  1PTO C;  4QIW B;  1BCP B;  5G3L F;  2F0E A;  1YHQ A;  2ZT9 C;  5LMN L;  1XPR A;  2E2I B;  1UEA B;  3MXU A;  3NQT A;  4A3D H;  3VYT A;  3JAM L;  5E4X A;  2KCC A;  4ZUI A;  4MHE A;  5M5Y B;  3NEL A;  2WAC A;  3I91 A;  3T1H L;  1YHB A;  5JVH 3;  2EOT A;  3HOX G;  2E75 C;  1FR3 A;  2F4V Q;  3D6C A;  2I46 A;  1MBY A;  3H94 A;  1J9O A;  1LT4 D;  3P75 A;  5DNF A;  3BYT B;  2HQL A;  3DEP A;  3CHB D;  1RCV D;  1N32 Q;  2PMZ B;  4A3B H;  2ASB A;  1K73 C;  2VS1 A;  1GUS A;  1WJJ A;  1VQ8 A;  5FLM G;  4GS3 A;  1ASY A;  3J81 j;  2G5D A;  4K8J A;  5JPN C;  4Q5V A;  3G6J B;  4KN4 C;  1VQK A;  3OW7 A;  2KJX A;  2AQ3 B;  5J22 A;  2L15 A;  3Q23 A;  5A35 A;  4AQY L;  1KNE A;  3EA6 A;  3OIP A;  4B3T L;  2R92 H;  1YNN D;  4BA1 I;  2E74 C;  1LT3 D;  3HOY B;  1JB3 A;  4A3B B;  5M5W H;  2HD3 A;  4IUT A;  4LAA A;  3CCM A;  2BOS A;  2VUM H;  1GKH A;  3ULJ A;  1F2Z A;  3GTL B;  1SFO B;  3H15 A;  1SNQ A;  1JWM D;  2IJ0 A;  3J7A 5;  1X3E A;  3E0J A;  3J81 c;  3LWE A;  4NXM Q;  3G4S A;  2F52 A;  4WJ4 A;  2F4I A;  3U9O A;  4GKK Q;  4O0A A;  2FFK B;  5ELO A;  2PI2 E;  2HHH Q;  3S15 B;  2Q2U A;  3A8J E;  3FEW X;  3GV6 A;  3MZ5 A;  4OWX B;  3QR8 A;  4QF4 A;  3M4Y A;  2ZM6 Q;  4DR2 L;  3EIV A;  5JJI A;  5CBE E;  3BG3 A;  4L5R C;  1L1O C;  1KXL A;  4A75 A;  2SNS A;  1YNN C;  2OQK A;  5IYD G;  4YY3 L;  1NJI C;  2NN6 I;  4LFB Q;  4KN7 C;  4JI3 L;  5M3M B;  1PFM A;  2F0V A;  4KJO A;  4A3K G;  2XWJ B;  1KQS A;  4Y52 H;  2HCC A;  4C3J H;  1SFO H;  4F87 A;  4JI8 Q;  3FPU B;  5M5X H;  3DMU A;  1PRT F;  3AU7 A;  5J3B A;  1Y14 B;  3VYR A;  4JI7 Q;  5IOC A;  1T5E A;  1M90 C;  3KLS X;  3MXP A;  5DLQ E;  4DR7 Q;  3H0G H;  2GA4 B;  1HNZ Q;  1Y1V H;  1EFI D;  2SDF A;  5BN5 A;  5LMN Q;  2OTJ A;  3M7G A;  4X62 L;  3PO2 G;  3KF8 A;  4MIU A;  4JI4 Q;  5IYB G;  2JSO A;  3ZYY X;  2LS0 1;  2IWH A;  3TP5 A;  1S40 A;  3MFG A;  4CKC A;  4JVZ A;  1B8A A;  4OL7 A;  5JJZ A;  3K57 A;  4X3S A;  1GJX A;  1O7Z A;  2RHQ B;  4JI4 L;  1OXT A;  4MTK A;  1N33 L;  4JI6 L;  1K8M A;  3MA2 B;  4ZAI A;  3K5O A;  5M5X B;  4LF9 L;  2NVY B;  1QOH A;  4L63 B;  3VYU A;  2RDF A;  1GUO A;  1S5C D;  2ZTE A;  3N6R A;  5FO8 B;  1BO0 A;  2Q2I A;  2UUA L;  2F3V A;  2QEX A;  4JI6 Q;  1VQE A;  1KRS A;  2YTX A;  3I4O A;  4RAU C;  5C5M A;  4L8J A;  2SEB D;  2RQX A;  4JW0 A;  4BBR H;  4DV4 Q;  3NBI A;  2H4O A;  4JI0 L;  3HOY G;  2UUC L;  3GTG H;  1B9N A;  4DNI A;  4N8F A;  3ONA B;  4DR2 Q;  3SK4 A;  2OT2 A;  3EVQ A;  4TVA B;  1IBL L;  5KYI A;  1Y1W G;  5CV5 A;  1EU3 A;  2PW7 A;  1LTR D;  1U0L A;  2X6G A;  5IT9 E;  1P16 A;  1F9Q A;  5F2D A;  4JBM A;  3MEH A;  2TMP A;  1IYV A;  1PH8 A;  1J5E L;  5COY A;  1A8V A;  4PMC A;  4IFD I;  1UAP A;  4O42 A;  3WDN A;  4ALP A;  4KJN A;  1A2U A;  2EY1 A;  4DV3 L;  1QZG A;  1HQR D;  5ISR A;  3K8A A;  3AMU A;  4BY1 G;  2IY5 B;  4EQP A;  1SBB B;  3GTG B;  2K5N A;  3GTO H;  1E1T A;  1LV9 A;  4DK6 C;  2IT1 A;  1AN8 A;  4ID6 A;  5EBD A;  5EKL A;  2JA5 B;  4QQB X;  1G8Z D;  3FHW A;  3I3C A;  1ENA A;  1WD0 A;  2XN9 C;  2F0J A;  1AEX A;  1EY7 A;  1HPC A;  2C35 B;  4YCW A;  4G7Z C;  4DA2 A;  4HSV A;  4X65 Q;  3T4A C;  3KYH C;  4B3R Q;  4FYD A;  5IP7 H;  2VB2 X;  3P7J A;  4OWT B;  3JAM i;  3HOW B;  3D0F A;  2KUM A;  1X3P A;  1PH6 A;  2JA6 H;  2R93 G;  1H9J A;  3GTO B;  3KDF B;  1ENF A;  3JAM E;  5C3X A;  2E2J H;  2QIL A;  1E24 A;  2G9H D;  4OEM B;  3R2I A;  5C3E B;  4UHV A;  4PNY A;  4LK1 C;  4YIJ A;  3FDT A;  1U4L A;  2XGT A;  4F88 A;  3T1Y Q;  4P72 A;  4FXG C;  4PG3 A;  1CT1 D;  3HKS A;  2R7F A;  4A3D B;  3ULL A;  2ES2 A;  4X66 L;  3BZK A;  3BVM A;  1RTO A;  1OTC A;  3BZD B;  4AYB B;  1WTQ A;  1QE6 A;  4JPB W;  1GUN A;  4HN7 A;  1E2W A;  2B2W C;  4IZ8 A;  1NR2 A;  4LUV A;  3KF8 B;  1EIH A;  3HOZ B;  1PRT C;  5C3E H;  2OQ0 A;  4FF4 A;  4A3K H;  1G2S A;  1LTG D;  2F0L A;  2KCT A;  5M3F H;  3PF4 A;  1L0X B;  1E2Z A;  4UAI A;  2B2Y A;  2EE1 A;  4Y7N B;  4A3M B;  2ICI A;  3K7A H;  4LF9 Q;  2CFM A;  2IHE A;  5C0X I;  1E7Z A;  2NVT H;  4OEL B;  1WYD A;  5HUR A;  1BR9 A;  1X55 A;  1PFN A;  4K6L A;  1FNW A;  1HNZ L;  5I6Y A;  4LNQ A;  1MGS A;  2RDG A;  4HCS A;  4RKL A;  2B2V A;  1U4R A;  1G29 1;  4DV6 L;  4QUC A;  4FVM A; 
#chains in the Genus database with same CATH homology
 3FRP B;  1LAC A;  5FK9 C;  3S1N B;  4ZUJ A;  1LAB A;  3E6Z X;  2WB1 B;  2VUM B;  2D2C C;  3K58 A;  2WKD A;  2JEA I;  4DNR B;  2H1E A;  3PIO 3;  1I4Q A;  2ZXO A;  2Y0S B;  1H9S A;  1FGB D;  2EYL A;  5I2X A;  3HOV B;  4IUV A;  3J7A F;  1CZW A;  2B2T C;  2NTS A;  3NWS A;  3NPP A;  1EQT A;  5FO9 B;  1Y8P B;  1KLG D;  5LL6 X;  3AB9 A;  1D5Z C;  4RCN A;  1XXG A;  2TSS A;  5FO7 B;  1EEF D;  1EY4 A;  3VR3 A;  1TVX A;  3SDZ A;  2IL8 A;  1HFN A;  3J7Y W;  2F0G A;  3QJY A;  1S5F D;  3QB3 A;  1ET6 A;  1LT6 D;  2PO4 A;  1S4Z A;  1XTC D;  4N9T A;  2KHS A;  2K03 A;  1F2Y A;  2MUY A;  1PTO F;  2MJ8 A;  4UDU C;  1BUV T;  4KY7 A;  1JOR A;  3GD7 A;  5KIX A;  1JQY D;  2A5H A;  3VR5 A;  3OMG A;  4PQX A;  1X3Q A;  2KEC A;  1I50 B;  1C4Q A;  1SNC A;  3RZO B;  1D5X C;  3X3N A;  3C1E A;  5IGB A;  1DM0 B;  4BA2 I;  1WTR A;  5EQ0 A;  1TKW B;  4IAL A;  3WOE A;  2XSC A;  1DOL A;  3CU7 A;  3M4O B;  1DXM A;  3NE5 B;  1Z7T A;  4B9W A;  3P1H A;  2FMM A;  1O78 A;  5CV9 A;  1EY6 A;  3DUZ A;  3KK7 A;  5IGC A;  2MHV A;  3RUZ A;  5CV4 A;  1A3V A;  3FMC A;  2NN6 G;  4ZKC B;  1AZQ A;  3NBH A;  1PFB A;  2ZXR A;  1J8I A;  1DOM A;  1TS4 A;  3T51 B;  1STB A;  2L11 A;  1HA5 A;  1RF2 D;  1NR4 A;  4IFD H;  5C4Z A;  2RDH A;  2CVR A;  2F0O A;  3PUZ A;  5FLX L;  3LWU A;  5NUC A;  5C44 B;  4RWS C;  2EY6 A;  4F7X A;  2K01 A;  1PLF A;  3FKI B;  3SE0 A;  3UI2 A;  1UUP A;  1SYG A;  5EJW A;  3IKJ A;  2HCI A;  3VA5 A;  1STG A;  3C3L A;  1TU2 B;  1NSN S;  4DXG A;  5IT9 L;  4U68 A;  1STH A;  2XIW A;  2BCO A;  3PUV A;  4QUF A;  3J80 E;  4XQN A;  4A93 B;  3ND9 A;  4HMI A;  1JOQ A;  1I4H A;  3S9W A;  1D6E C;  5EPK A;  4RHS A;  1ESF A;  3Q6S A;  5CBA E;  2NVT B;  4IFD G;  3K5M A;  3J7A V;  1TS2 A;  1SSO A;  4OIJ A;  3PIP 3;  3PO2 B;  1G6Z A;  2FHT A;  1STY A;  1RDP D;  5D14 A;  2BE5 D;  1I4G A;  1BF4 A;  4E6I A;  2F1M A;  3OWE B;  5FKA C;  1WTW A;  1QNK A;  1AZP A;  1HFG A;  3R8B A;  3F2U A;  1ONL A;  3HOU B;  2K6A A;  1ZXT A;  2CQA A;  2Z8L A;  2B8F A;  2M00 A;  3O13 A;  1BCP F;  5TSS A;  1FYC A;  4HMJ A;  2F0I A;  4I7Z C;  1S5D D;  1SJE D;  3OIQ A;  3GO5 A;  1W6K A;  3H6M A;  1V43 A;  5K5P A;  4OO1 H;  2YYZ A;  4C3J G;  1BOS A;  3HP3 A;  2NWG A;  1EQV A;  5C3W A;  2Z4H A;  4K2L A;  3K5L A;  2FIN B;  4Q0F A;  4BS9 A;  1HUN A;  4XYQ A;  1X32 A;  5BN4 A;  3QWN A;  1ET9 A;  3Q22 A;  1QJO A;  2D5D A;  3CRK C;  3MVV A;  4XQJ A;  1LTT D;  4C3J B;  5KNB A;  1LLR D;  1TY2 A;  2HUG A;  2F0T A;  1TT2 A;  4R8N A;  2F0U A;  1K83 B;  3T16 A;  5E1F A;  2R7Z B;  3G7L A;  1WTP A;  4M8A A;  2I07 B;  3NTK A;  4TKO B;  2PW5 A;  2R93 B;  4K2K A;  3KUP A;  1QIL A;  1UNS A;  4KI0 A;  1CHP D;  5ELE A;  5T1I A;  2RKS A;  3SR1 A;  1F9R A;  1FNV A;  1OXV A;  4FNF A;  2IX0 A;  1II3 A;  2BA1 A;  4CBV A;  4HCE A;  1GUG A;  2M2L A;  2F0H A;  3PUX A;  2VXW A;  2X6L A;  1G2T A;  3NQI A;  1EU4 A;  1DZ1 A;  3OHX C;  1GOZ A;  1STA A;  2R61 A;  1ENC A;  3VR6 A;  4DAP A;  4RGN A;  3GTM B;  2VB3 X;  2N88 A;  1IL8 A;  3A7L A;  3GQB A;  3GTQ B;  2ZXP A;  2K7V A;  3N52 A;  4C1N I;  4IUR A;  2EY2 A;  2BA0 A;  1NAP A;  1VCI A;  1U4P A;  1Z6H A;  3PV0 A;  4XT1 B;  1EYC A;  3TDQ A;  3GTP B;  1JC7 A;  3D31 A;  2IPK D;  3TZD A;  3T53 B;  5DM7 3;  2PZU A;  5EBC A;  1GXD C;  1IW7 D;  1VDZ A;  4OGQ C;  3MHB A;  3K0Y A;  2EJM A;  2A74 C;  4O1N A;  3A8K E;  3MTS A;  1PXU A;  3BS1 A;  5CC4 A;  2LFN A;  3T56 B;  1CTM A;  2EYP A;  1YNJ C;  3D6W A;  2V4D A;  3PUY A;  4KD4 A;  3QG1 A;  5D65 A;  1H9S B;  1IKL A;  1MSH A;  4ZK9 B;  4R9W A;  4ABN A;  3RD4 A;  1HA6 A;  2FJ2 A;  2ID0 A;  1CFM A;  3HRZ C;  5FLX E;  3L3O C;  3BYY B;  2M9V A;  4V0B A;  3SEB A;  4X3T A;  4OO1 I;  3TP7 A;  2F0K A;  1F2L A;  2PZW A;  1SE2 A;  4FXD A;  5G3L D;  2C9O A;  5FOB B;  5JVG 3;  3C1F A;  2MP1 A;  2WIN B;  1RHP A;  4OHJ A;  2KVM A;  2B39 A;  1JOK A;  1LTI D;  2NYZ D;  1ZYR D;  5C0X J;  1I4X A;  1V1P A;  2E2H B;  3NHH A;  1SDF A;  3NK9 A;  3I70 A;  2A6H C;  1JOO A;  3A7A B;  2XVS A;  1DCZ A;  1SMY C;  4EVO A;  1EY8 A;  1PTO D;  4FF2 A;  3P20 A;  3S17 B;  3HZX A;  1PZJ D;  3HGB A;  4FO2 A;  5KGU A;  2ENB A;  2F0W A;  5C5L A;  4CHT B;  5LL6 S;  1SMY D;  1BCP C;  3A55 A;  1HRJ A;  1A3U A;  3TZU A;  5EPJ A;  4CKE A;  3I90 A;  2SNM A;  5KYL A;  2C5C A;  2RVL A;  1WTV A;  2AUK A;  2K5Q A;  4G7H C;  3RLF A;  5D3I B;  2K05 A;  3H0G B;  2D9U A;  2RSN A;  1K8O A;  1KAA A;  3I4M B;  1HQM C;  4DN4 M;  2EYH A;  3DXJ C;  1EYD A;  4IUP A;  3ND8 A;  1EWH A;  1EWC A;  1QNU A;  1F9S A;  2L55 A;  3MAQ A;  4HED A;  1R4Q B;  1IW7 C;  1TQO A;  1NUC A;  4C3H B;  3BVZ A;  1ICW A;  5ELB A;  2Q8I B;  1M8A A;  1KNA A;  2EY5 A;  5IGG A;  1BQQ T;  1DYQ A;  2JP1 A;  3KLS A;  4BBR B;  2A68 D;  4ILW A;  4C3I G;  1RJT A;  2K33 A;  1Y1W B;  2X69 A;  1F77 A;  5EGT A;  4LMQ D;  2B2U A;  4MN3 A;  2B8G A;  4XYO A;  1JE4 A;  3K5N A;  1STN A;  5E4W C;  3D4R A;  5JEA H;  5KEE A;  3HOX B;  5JOB A;  3MXG A;  1KLU D;  5EKI A;  1H9M A;  1C48 A;  1KTK A;  2NUC A;  3MXN A;  2MGS A;  1EYA A;  3S1R B;  3I4L A;  4C3H G;  4LJZ C;  5K36 G;  2EYM A;  4ULL A;  3SK5 A;  1CQF A;  1AFP A;  2KA7 A;  5CGK A;  2PYK A;  5JEA G;  1WTO A;  2SOB A;  4J6H A;  4PMB A;  3SXH A;  1E2V A;  1B4O A;  4QB4 A;  3IFD A;  4ZYS A;  3S1M B;  3M85 A;  2K04 A;  2A69 D;  1D1K A;  2AWO A;  3RMH A;  5IGD A;  1LT5 D;  2NTT A;  1BXT A;  5C4H A;  4ODG A;  2J0T D;  4WOR A;  2DNE A;  4ZKB B;  2F0F A;  5EKK A;  4NW2 A;  4P2C B;  2NVQ B;  2Z4I A;  4KKU A;  1FNU A;  3BDL A;  4FXK C;  2XWB B;  4K5V A;  1F9P A;  5CV6 A;  4G57 A;  4R8I A;  4DF7 A;  5J39 A;  1EOT A;  4A3K B;  2CW0 C;  4OO1 G;  4WFN 3;  3Q0A A;  3D8G A;  1JWU D;  1VF7 A;  1PTO B;  3M3Y B;  2KEE A;  4KY6 A;  4RKB A;  5EPL A;  1EY9 A;  5KNC A;  4K8I A;  2JA7 B;  2R3Z A;  4J8Q A;  3PMF A;  4XQQ A;  3J80 L;  1LO5 D;  3V2T A;  2E76 C;  1CHQ D;  5DAU A;  1AP0 A;  4KMU C;  5JEA J;  3GTK B;  4QMG A;  5ELD A;  4KTA A;  1EEI D;  1R4P B;  4BY7 B;  3U9S A;  2AUJ D;  1JCK B;  1PZI D;  3R3O A;  5K36 H;  5DEH A;  1R9T B;  3S16 B;  2KQ3 A;  2RBM A;  1Y1V B;  1WVL A;  2L0C A;  3W3A A;  4RA8 A;  1PRT D;  2EYF A;  1U9R A;  2F0Q A;  2L5T A;  1BCP D;  4RCO A;  5J1Z A;  1TY0 A;  3QIA A;  1A15 A;  1Z47 A;  4CKB A;  1PYW D;  4XIG S;  3HKZ B;  1XX8 A;  1EL0 A;  1B1Z A;  1C8C A;  2O4X A;  2WV6 D;  4TRD A;  3W2D A;  2RSO A;  1L0Y B;  4G7O C;  1Q1E A;  3D3R A;  3J81 E;  2EJF C;  5A2Q E;  4C3I B;  2K5W A;  4QCL A;  3NSW A;  5DM6 3;  3OSO A;  2F0M A;  2PNR C;  3EFX D;  3V05 A;  5A2Q L;  2EZV A;  5ELF A;  3CQZ B;  2K1B A;  3OMC A;  1Y8N B;  1LTB D;  1QCB D;  1ROD A;  1TWG B;  3D4W A;  1IKM A;  1DJR D;  1YNJ D;  4A3F B;  2D62 A;  2WII B;  3GTJ B;  5C6A A;  3HEJ A;  4CGY B;  1KDB A;  5I9O A;  3K59 A;  1HHV A;  3VA7 A;  3IL8 A;  1SNP A;  1QG7 A;  3SK8 A;  1B53 A;  2PZT A;  4L6T B;  4HTH A;  3MWY W;  3TME A;  1SYE A;  5CV7 A;  3A54 A;  3TSS A;  4NP5 A;  4KK7 A;  1HCZ A;  1WD1 A;  1ML0 D;  1JWS D;  2EVB A;  4NMZ A;  2XRS D;  4WRD A;  3S14 B;  3K6O A;  1Q3L A;  1STE A;  5C0X H;  3OWF A;  4WJW A;  2DN8 A;  1MI2 A;  3H3V C;  2AQ1 B;  3MFY A;  2QDB A;  4A3E B;  1A2T A;  2HDL A;  2B2Y C;  1KDA A;  1VMP A;  2L4N A;  2JA8 B;  4B9X A;  1ZEQ X;  1SNM A;  4A3G B;  1SYC A;  4CJ0 B;  1PDQ A;  4CJ1 B;  1TS5 A;  3VYS A;  4RGT A;  2IX1 A;  5CV8 A;  5M3F B;  2Q8T A;  4FF1 A;  1ILQ A;  2WAQ B;  1W6J A;  1Y8O B;  5IOD A;  1LTS D;  1I3Q B;  1DON A;  4H44 C;  2YU9 B;  3S2D B;  1F2M A;  2EXZ A;  2DY7 A;  4N9P A;  3VR4 A;  1SYD A;  4A3J B;  2BDO A;  2LMC B;  1EY5 A;  1VMC A;  4Z9C B;  3NTH A;  3I8Z A;  1B44 D;  4XT3 B;  4DNT B;  2MPM A;  1I4P A;  3FPP A;  1BDO A;  4H13 C;  3QOL A;  5T1G A;  4IUN A;  3CRL C;  4CJ2 C;  2CHB D;  5I6W A;  3SHL A;  4PMW A;  4DGZ A;  2R92 B;  4IUQ A;  2B2U C;  5IGF A;  1SXT A;  2QEJ C;  5M5W B;  5I4D A;  4FF3 A;  1Q90 A;  1BNZ A;  4HR7 B;  2BDN A;  3DWQ A;  3Q24 A;  2KCN A;  3KBG A;  3C2P A;  3DEO A;  4K5X A;  5C0X G;  2EDG A;  3PUW A;  2F0S A;  1Q12 A;  1V1P B;  4DK0 A;  1DOK A;  3NWT A;  1SNO A;  1O7Y A;  5C4X B;  1OXX K;  1S5E D;  5CYU A;  4IFD J;  2A6E D;  2NVX B;  1GUT A;  1SYB A;  2G9D A;  3L7Z C;  2O2L D;  2A6E C;  4HSP A;  3E5S A;  1B50 A;  1RD9 D;  2E2D C;  3TN2 A;  1BBX C;  2Z1C A;  1I4R A;  1ZYR C;  4ZQ3 A;  3NP8 A;  1HTL D;  4M1U B;  4RFB A;  5I2Y A;  1V1O A;  1SYF A;  4KHV A;  2ICE C;  4HAE A;  4X3K A;  1TWA B;  3RZD B;  5JAV A;  3URY A;  1TS3 A;  3S1Q B;  1CQV A;  5ELC A;  1RTN A;  4IQZ A;  2KOL A;  2PCF B;  4DXF A;  4G4K A;  2OXP A;  4NKL A;  2LKV A;  1TR5 A;  5COR A;  2NBF A;  2J4X A;  3D4D A;  3HS0 C;  3C46 A;  1SE3 A;  2JXM B;  2F03 A;  2B2W A;  2AQ2 B;  1HUM A;  1SAP A;  1CM9 A;  1CA5 A;  1HXY D;  3ERQ A;  3I73 A;  4IUU A;  1TWF B;  1B3A A;  3M7N A;  1EZ6 A;  1CZG A;  4KKS A;  3TP8 A;  1PZK D;  1CI3 M;  1KDC A;  1PRT B;  1D5M C;  1EY0 A;  1KAB A;  2IW3 A;  1VF5 C;  4J1M A;  3WOF A;  4KY5 A;  3IAY A;  3L9A X;  4H0L C;  5M9O A;  1T5X D;  1I6H B;  2JEB I;  4K5W A;  2JA6 B;  4EGV A;  1MSG A;  3QOJ A;  1QB5 D;  2E2J B;  3H09 A;  2WP8 J;  4RHR A;  1FD7 D;  4S3S A;  2PPB C;  4DAY A;  1AW7 A;  2QCP X;  1MD2 D;  2A6H D;  2F0P A;  5I9P A;  1SEB D;  4KV6 A;  4K14 A;  5AFW A;  4U67 3;  4DK1 A;  5JPM C;  3NTI A;  1HTP A;  5LHY 1;  1SE4 A;  3DM1 A;  5KRU A;  3NXW A;  2EPB A;  1TII D;  4A3I B;  2J7Z A;  1O7L A;  2F0D A;  2LY7 A;  4F8M A;  1DD2 A;  2NB0 A;  3K7A B;  2EJG C;  1U4M A;  4EQN A;  3EQL C;  2OF1 A;  1G91 A;  2NZ1 D;  3SK6 A;  3LNN A;  2DY8 A;  3KBX A;  4C56 C;  3VR2 A;  3ITP A;  1IYU A;  4DAV A;  2VNU D;  1PTO H;  2B63 B;  1JR0 D;  1NCV A;  4I65 A;  2AWN A;  5C4J B;  3OOC A;  4DU9 A;  2K5D A;  3H91 A;  1Y69 U;  1XYI A;  2KED A;  1D2B A;  4X3U A;  4XDX A;  3EJI A;  4TSS A;  4BY1 B;  5BN3 A;  4KKT A;  4FP5 D;  2N55 A;  3I72 A;  1B9M A;  3J81 L;  3IFT A;  4PV1 C;  4NDX A;  1E0B A;  1XWE A;  3CKI B;  3DWA A;  2F0N A;  1ILP A;  2XRQ D;  4B08 A;  4K6D A;  3BDO A;  2CW0 D;  2DNC A;  4ME5 A;  1LTA D;  2XNA C;  4JK1 C;  5E3F A;  4BWG B;  2IX3 A;  4IN3 A;  1EIG A;  2L1B A;  1TWC B;  3I4N B;  3X3M A;  2HQE A;  4TQU S;  4V19 0;  5CMD A;  1Q1B A;  3QO2 A;  1WTX A;  1GUW A;  4XXE A;  2NN6 H;  2A73 B;  5KND A;  2BE5 C;  1QWY A;  2FMC A;  3TP6 A;  3SVM A;  3V96 A;  2R6G A;  2O5I C;  2K28 A;  2RA4 A;  3R93 A;  3A56 A;  1M4V A;  1CK1 A;  3KLR A;  1SJH D;  1CA6 A;  3LX0 A;  5HGT A;  1V8Q A;  3FVQ A;  4KD3 A;  1A3T A;  2L9H A;  2JE6 I;  3A8I E;  3ERO A;  4C1N K;  3GP7 A;  1RKN A;  4KHZ A;  4EQO A;  3TBI B;  4DFA A;  5CR3 A;  2L12 A;  1JIC A;  1GHK A;  1H9R A;  2K32 A;  4JBW A;  3GV3 A;  3HG9 A;  4OIK A;  4H7B A;  1S5B D;  1PMR A;  1OO9 B;  3MC0 B;  1D1I A;  2WKC A;  3DHQ A;  2B2V C;  1H9K A;  5IIF A;  2A69 C;  3BVG A;  3OPO A;  1I6V C;  1IHZ A;  1GHJ A;  4RH6 A;  2HDM A;  5D3D A;  4C2M B;  3NUC A;  1EZ8 A;  4ZLT F;  4RGO S;  1B2T A;  2OEO A;  4GZY C;  4BBS B;  1ZKO A;  2A68 C;  2B2T A;  4XTC S;  1TWH B;  1SND A;  1OXU A;  4RGM A;  3T13 A;  3DWP A;  3R2T A;  2QF7 A;  5IGE A;  2JYO A;  2EYO A;  3PO3 B;  2EYJ A;  2PQE A;  1WCM B;  2O5J C;  2QKI C;  1ESR A;  3S2H B;  2Q8R E;  1O80 A;  4ZRZ A;  1OXS C;  3BDC A;  1Q8I A;  2F3W A;  1PTO C;  4QIW B;  1BCP B;  5G3L F;  2F0E A;  2ZT9 C;  2E2I B;  1UEA B;  3MXU A;  3NQT A;  3VYT A;  3JAM L;  5E4X A;  2KCC A;  4ZUI A;  4MHE A;  5M5Y B;  2WAC A;  3I91 A;  5JVH 3;  2EOT A;  2E75 C;  1FR3 A;  3D6C A;  2I46 A;  1MBY A;  3H94 A;  1J9O A;  1LT4 D;  3P75 A;  5DNF A;  3BYT B;  3DEP A;  3CHB D;  1RCV D;  2PMZ B;  1GUS A;  4K8J A;  5JPN C;  4Q5V A;  3G6J B;  4KN4 C;  3OW7 A;  2KJX A;  2AQ3 B;  5J22 A;  3Q23 A;  5A35 A;  1KNE A;  3EA6 A;  3OIP A;  1YNN D;  4BA1 I;  2E74 C;  1LT3 D;  3HOY B;  1JB3 A;  4A3B B;  4LAA A;  4IUT A;  2BOS A;  1F2Z A;  3GTL B;  1SFO B;  1SNQ A;  1JWM D;  2IJ0 A;  3E0J A;  3LWE A;  2F4I A;  3U9O A;  2FFK B;  3S15 B;  3A8J E;  3FEW X;  3GV6 A;  3MZ5 A;  4QF4 A;  3M4Y A;  5CBE E;  3BG3 A;  2SNS A;  1YNN C;  2NN6 I;  4KN7 C;  5M3M B;  1PFM A;  2F0V A;  4KJO A;  2XWJ B;  2HCC A;  4F87 A;  3FPU B;  3DMU A;  1PRT F;  3AU7 A;  3VYR A;  5IOC A;  1T5E A;  3KLS X;  3MXP A;  2GA4 B;  1EFI D;  2SDF A;  5BN5 A;  3M7G A;  3KF8 A;  4MIU A;  2JSO A;  3ZYY X;  2LS0 1;  2IWH A;  3TP5 A;  3MFG A;  4CKC A;  4OL7 A;  5JJZ A;  3K57 A;  4X3S A;  1GJX A;  1O7Z A;  1OXT A;  1K8M A;  3MA2 B;  4ZAI A;  3K5O A;  5M5X B;  2NVY B;  1QOH A;  4L63 B;  3VYU A;  2RDF A;  1GUO A;  1S5C D;  3N6R A;  5FO8 B;  1BO0 A;  2F3V A;  4RAU C;  5C5M A;  4L8J A;  2SEB D;  2RQX A;  3NBI A;  2H4O A;  1B9N A;  3ONA B;  3SK4 A;  2OT2 A;  3EVQ A;  5KYI A;  5CV5 A;  1EU3 A;  2PW7 A;  1LTR D;  2X6G A;  5IT9 E;  1F9Q A;  5F2D A;  3MEH A;  2TMP A;  1IYV A;  5COY A;  4PMC A;  4IFD I;  1UAP A;  4O42 A;  3WDN A;  4KJN A;  1A2U A;  2EY1 A;  1HQR D;  5ISR A;  3AMU A;  4EQP A;  1SBB B;  3GTG B;  1LV9 A;  2IT1 A;  1AN8 A;  4ID6 A;  5EBD A;  5EKL A;  2JA5 B;  1G8Z D;  3I3C A;  1ENA A;  1WD0 A;  2XN9 C;  2F0J A;  1AEX A;  1EY7 A;  1HPC A;  4G7Z C;  4DA2 A;  4HSV A;  3T4A C;  4FYD A;  2VB2 X;  3P7J A;  3HOW B;  2KUM A;  1X3P A;  1H9J A;  3GTO B;  1ENF A;  3JAM E;  5C3X A;  2QIL A;  2G9H D;  5C3E B;  3R2I A;  4PNY A;  4LK1 C;  4YIJ A;  3FDT A;  1U4L A;  4F88 A;  4FXG C;  1CT1 D;  4A3D B;  3BVM A;  1RTO A;  3BZD B;  4AYB B;  1WTQ A;  1QE6 A;  1GUN A;  4HN7 A;  1E2W A;  2B2W C;  4IZ8 A;  1NR2 A;  1EIH A;  3HOZ B;  1PRT C;  4FF4 A;  1G2S A;  1LTG D;  2F0L A;  1L0X B;  1E2Z A;  4UAI A;  2B2Y A;  2EE1 A;  4Y7N B;  4A3M B;  2ICI A;  5C0X I;  5HUR A;  1BR9 A;  1PFN A;  4K6L A;  1FNW A;  5I6Y A;  1MGS A;  2RDG A;  4HCS A;  4RKL A;  2B2V A;  1U4R A;  1G29 1;  1A6X A;  4QUC A;  4FVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...