The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
256
|
structure length |
256
|
Chain Sequence |
LAYDEAIMAQQDRIQQEIAVQNPLVATLAPFSILCAEYDNETSAAFLSKATELSEVYGEIRYIRGDGNCFYRAILVGLIEIMLKDRARLEKFIASSRDWTRTLVELGFPDWTCTDFCDFFIEFLEKIHSGVHTEEAVYTILNDDGSANYILMFFRLITSAFLKQNSEEYAPFIDEGMTVAQYCEQEIEPMWKDADHLAINSLIKAAGTRVRIEYMDRTAAPNGGWHYDIPSDDQQIAPEITLLYRPGHYDVIYKKD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The mechanism of OTUB1-mediated inhibition of ubiquitination.
pubmed doi rcsb |
molecule tags |
Hydrolase/signaling protein/ligase
|
source organism |
Homo sapiens
|
molecule keywords |
Ubiquitin thioesterase otubain-like
|
total genus |
91
|
structure length |
256
|
sequence length |
256
|
ec nomenclature |
ec
3.4.19.12: Ubiquitinyl hydrolase 1. |
pdb deposition date | 2012-01-30 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | 3 helical TM bundles of succinate and fumarate reductases | 3 helical TM bundles of succinate and fumarate reductases | ||
Alpha Beta | 2-Layer Sandwich | Phosphorylase Kinase; domain 1 | Phosphorylase Kinase; domain 1 |