4DI6A

Crystal structure of nucleoside-diphosphate kinase from borrelia burgdorferi
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
169
structure length
169
Chain Sequence
b'MSMLLQKTLCIVKPDGVRRGLIGDVVSRFERVGLKMVAAKMLIVDESLAKKHYLYDDIVFRHSEAVWNSLIKFISNSPVFTFVVEGVESIEVVRKLCGATEPKLAIPGTIRGDFSYHSFKYSNEKGFSIYNVIHASANEADAMREIPIWFKDNEILNYKRDDECEHYYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
molecule tags Transferase
source organism Borrelia burgdorferi
publication title Structure and analysis of nucleoside diphosphate kinase from Borrelia burgdorferi prepared in a transition-state complex with ADP and vanadate moieties.
pubmed doi rcsb
total genus 49
structure length 169
sequence length 169
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4di6A00
4KPCA 3FKBA 1HHQA 1EHWA 3FBCA 1B99A 1NDCA 1NSPA 1PAEX 2B8PA 3DDIA 1S5ZA 1HIYA 3ENAA 5CAAA 3R9LA 1WKJA 3Q8VA 2HVEA 2HVDA 3MPDA 3EVOA 3EE3A 3G2XA 3PJ9A 2DXDA 1VYAA 4S0MA 1LEOA 3VGUA 1XQIA 3FC9A 3B54A 2HURA 3NGTA 2VU5A 4EK2A 3VGTA 3EJMA 1WKKA 1B4SA 1LWXA 3VGSA 3GP9A 4UOHA 1MN9A 3Q89A 1NPKA 1NSKL 4DI6A 3BH6B 4F4AA 5IOLA 3EVWA 1BE4A 3GPAA 3NGSA 3EICA 1UCNA 2CWKA 4UOGA 4ANCA 4W98A 1BHNA 3ETMA 1F3FA 3BBFA 4CP5A 2AZ1A 2DXEA 1NLKL 5CABA 1U8WA 4O0NA 4DZ6A 4ANEA 2BEFA 4C6AA 4FKXA 5C7PA 3FCWA 3JS9A 1NDPA 1S59A 4FKYA 2B8QA 1HLWA 2DXFA 2ZUAA 3ZTRA 3BBCA 3FBEA 3EMTA 3VVTA 3ELHA 5BXIA 3Q8UA 1WKLA 2DY9A 3PRVA 1JXVA 3EM1A 4DUTA 1NB2A 3B6BA 3NGRA 3FBBA 3Q8YA 1XIQA 3Q86A 1ZS6A 1NDKA 3DKDA 1KDNA 4UOFA 1MN7A 2BX6A 4HR2A 3ZTOA 3VVUA 4ENOA 1BUXA 1NCLA 1NDLA 3FCVA 3ZTPA 2DYAA 3Q83A 3L7UA 3WX8A 3ZTSA 1W7WA 3BH7B 3FBFA 3ZTQA 2AZ3A 2NCKL 3NGUA 1NHKL 1PKUA 1NSQA 3VGVA 4F36A 1NUEA 1S57A 4WBFA 3EVMA 1F6TA 4ANDA 1K44A 3BBBA
chains in the Genus database with same CATH superfamily
3KUGA 4NLOA 3HSJA 3K89A 3B78A 1TKXB 2DNKA 3G71S 4LF6J 1UZDA 1N36J 2ZE2A 4G3IA 1NPRA 2RDJA 1MWQA 2JDJA 3UN3A 1KVJA 1X4DA 3M2RB 1S0VA 3SV4A 4B9UA 1XTZA 5CAAA 1SB6A 1FJEB 2BJ7A 2XS5A 2DGSA 4PPDA 1FWKA 5A6WA 3FGVA 2W4PA 3FMBA 2MPUA 5J2QB 3HK2A 4DX5A 2ZH1A 2HWHA 2GNKA 2ALZA 5ITHA 1VIOA 1IUJA 2CYYA 5F8IA 1TL4A 4RW7B 2KFNA 1RTHB 2HRUA 2WBMA 3MHYA 4MIWA 4OJ1A 1IBCB 2EFGA 1FRLA 4BWMA 3TEGA 4DPOA 1U7LA 4KT0C 4JI3F 3KXDA 3P5BP 3MEEB 1SUQB 2ZH9A 3MMBA 3AQPA 1PSDA 4MT1A 4O3QA 3ETOA 1UA0A 2XS7A 1U1RA 1Q5YA 3IRWP 2UU9F 2Z8QA 4MKBA 3IP0A 3DLKA 4OYZA 4UTGA 3DDNA 5MLCV 4DV2J 3QZ7A 1VHFA 1WDTA 2Q6BA 1HBUB 3PEJA 2J6UA 2ZNYA 3KNAA 3C46A 1QD1A 1RXOB 1N56A 3AXKA 5C2CA 1FFSB 4DG1B 4DV1F 5E3RA 4DFKA 1NMEB 1B0TA 1Y9OA 1RT6A 2UUWA 3BN4A 1HNZJ 3BDEA 1FK9A 2LQBA 4U8VA 4CNYA 4Z37A 4OL8A 2DHHA 3KLVA 3EVWA 1IKXA 1KEKA 5DGAA 2GMJA 1I94F 2KVIA 1XNRF 2KL8A 2XZTB 3MD1A 4DFMA 3OPKA 3QJPA 1N48A 1E6YB 4ITSA 3G87A 2R8JA 1IWGA 1P6TA 5EGYA 4N56A 3KLIB 4W92B 2HK2A 1ZBTA 5CABA 3F44A 4I2QA 4O23A 3CCJS 3D1OA 3OT9A 2ADCA 5IC6B 2AYBA 3JS9A 1ITPA 2DIUA 3J80U 2CIMA 2FJAB 3HLUA 4PXBA 4C8KA 3H2UB 4ECUA 1VLYA 3DOKA 1UJ4A 3PJWA 1Q1KA 1P9QC 4OYWA 4OHZA 3UNYA 2IRXA 4ECZA 1WI8A 3K8WA 3BYRA 1B0VA 3M30A 4GC6A 3EM1A 3IWLA 2XGQA 2R4FA 4TNOA 1Y5IB 3D0HE 5L1LA 4E2FB 3CSKA 3MPYA 1KQGB 4K59A 4KV8B 2Y1RI 2BA9A 3BF4A 3FSYA 3Q8YA 1H2VZ 4JB8B 3KK3A 1R8BA 3M4XA 4OYAA 2R9LA 2UXBJ 2FLPA 1TV6B 1NHVA 2WVEA 4L75A 3W2VB 4PG8A 2YKMB 5GAGI 4UZBA 3NNAA 4HR2A 2XWXA 2F1FA 1N32F 1C1CB 5GMDA 2Y0BB 3Q2SC 4GO5X 1S4FA 3CCWA 1F9HA 2RVJA 1IWAA 5DS7A 5DGBA 3FSIA 1YHQS 3H5XA 4K4ZA 2BKPA 2HHTA 2Y9HA 3L7UA 4KQZA 4JBCA 5G0RB 3MD3A 2AKWB 4FF2A 4CO3A 2G2ZA 3ZTSA 4USVA 3E2EA 3BN7A 5KT5A 1JLAB 2I0XA 1TELA 3BH7B 3QWPA 4DV0F 3T9ZA 2CNNB 5J2MA 1X9SA 1NSQA 1NHKL 1PKUA 2VFVA 1FD8A 3AHPA 4DQRA 1S6PB 2FB0A 3L7PA 5KG5A 1TFYA 4D3GA 4F50A 4HHUA 3PZPA 2MLZA 4NLQA 4CLFA 1M1KT 4KPCA 1TKTA 2LXFA 5AT1B 3PO5A 4H4OA 1HHQA 1TUGB 4RW6A 1T95A 1EHWA 2A0FB 1ZOTA 3T1AA 3GWCA 3TP2A 4C3LA 5KT4A 2KFZA 2ROEA 1NDCA 1S79A 4K4XA 2J5AA 3CCTA 5CXTA 3O1LA 5LL6d 1FJGJ 1Z2ZA 4K8RA 1HIYA 4KHRA 1MLAA 3GFZA 2XYGB 2KHCA 4PWWA 5CZVA 4WKYA 1TK0A 1JK9B 1VOMA 2EFOA 3A1YG 2IDEA 2WTFA 5I42A 3D6MB 2H3EB 3H20A 1TK8A 1KTVA 2O66A 3NCRA 1TTHB 2WOMB 1SXLA 1RTHA 3M8QA 2DGWA 2DXDA 3P8BB 3FQKA 1KC8T 2EC0A 2FJBB 2X1BA 5LMNJ 1FHTA 3BGRA 3OVSA 2KT3A 5IWAF 2FUG9 4HL9A 2CJQA 4PXCA 3LA0A 3FNNA 4PYAA 1TVRA 5C24A 3ZZTA 4CH0S 5DDPC 1CVJA 4ECTA 3VGTA 3RYLA 3MAHA 1VGYA 3OD2A 4DR5J 5HATA 4DV3J 4MTPA 5DG9A 5G0RA 1RTZA 5U47A 2A3JA 1N34F 4I6YA 3DOLA 2BQUA 3CIMA 4M5NA 2PO4A 4LF8F 4TVAB 3P4UB 3OR2B 3MR2A 4ZMMA 2J7KA 4CO1A 2MQNA 4MAKA 5BYSA 3NG8A 3P3DA 2VHGA 3C14A 1I3OB 3OTDA 4FVCA 2BRKA 4YEAA 2MY7A 2Y0SD 4P2SA 1YITS 2QRRA 2IC3A 1KOHA 4F4AA 4C3MA 3M9OB 2P9EA 1RT4B 3CD0A 4OI2A 1S4EA 1VC0A 1UCNA 4UOGA 4X4NA 5DZ7A 2AYMA 5DQIA 2COLA 2YKQA 3NRBA 4YY3F 2MZRA 4YHHF 2A2CA 1H0HB 4F26A 5KG6A 2XYHB 3IG1B 1CBKA 1N5SA 1R0AB 4NYPA 4ZVOB 2HYIB 1CQNA 1LW2B 1C0UA 4OI1A 4OHXA 4NRUA 2OPSB 1RAGB 2XMAA 2W8KA 2J9DE 5J2PB 3PRDA 5K14A 5HJXA 1XNQF 4KB7A 2FZCB 5F0WA 2D9PA 3QIPA 2W2NP 1HL6A 4FKYA 4P73A 1P1LA 4ZPTR 5AJ3F 1J5OB 4DSLA 2VZ9A 4I2QB 2BV3A 2GW8A 3JTPA 4LRAA 4M5LA 1FRJA 4RJVA 4WP8A 4ES1A 3KKFA 2FVPA 5CCMA 1UAWA 1S6QA 1NJYA 5EX3A 2YKNB 3T5KA 4DUTA 4RBVA 2W2MP 1RLCL 4P75A 1NB2A 3IA0A 3ISND 3S01A 3LOUA 4CLUA 1Y0HA 4I0WA 2BE2B 4N8OA 3V5RA 1T9VA 1YWXA 1VQ4S 4Z7CA 1RAHB 1VQ6S 2HFNA 4C11B 1FJ7A 1F0XA 3OVBA 3HSZA 5E3PA 1X5PA 1Y3JA 4JV0A 2Y8YA 9ATCB 2ZH8A 3KOAA 3TZWA 1U2FA 4G1QB 2BJ9A 2FY1A 1S49A 1BY9A 4MKYA 1WACA 4X64F 4R5PB 2AHOB 5T14A 1IJEB 3MM8A 5K8NA 3TAQA 4PWDA 5EDWA 2BVZA 2V8PA 8RUCA 1JWWA 3NS5A 2V34A 1S1XA 3D3CJ 3J7A1 1QUPA 3VAIA 1ROFA 1SKUB 3KUEA 1GX6A 5J2MB 3G86A 2E7WA 2QLWA 4A4JA 3QZ8A 1GT8A 2XG8A 4KHMA 3DOMA 3DRPB 2OPQA 4M5HA 1IKYB 3GJRB 5ETOA 3UWTA 1UVIA 1BWEA 2LEBA 2V0NA 2EG1A 5F41A 3HJVA 3OTOF 1UL3A 4PQAA 2DVIA 5HP1A 1JNZB 1TL3B 4WBFA 2I8EA 4ZS6A 1KLNA 3CIZA 3IAS9 3W9HA 2KI2A 5I42B 1JLQB 3BBBA 1VI7A 3KWMA 2I6WA 4AXIA 2P9GA 3W63A 5L39A 2CJ9A 3IR6B 2YBVA 4TXSA 4QJVA 4YB7A 1KWMA 1W26A 4WTOB 1FDBA 3EPIA 5DM7Q 1WG1A 3JXOA 3TA2A 1Q79A 4R8UB 3P49B 5ETRA 4HH1A 4AQYF 3ZXWA 3T5JA 3TZYA 4ED3A 2PC6A 2CJAA 1SJ4P 1CS4A 3OR2A 4KY3A 3UD5A 3FMWA 4QIFA 5DDQC 3MDFA 4LQ9A 3TUJC 4MK9A 4WE1A 1CQMA 3LAKA 5KT7A 2NQPA 4ELTA 1CPZA 3EGWB 2ACMA 1NZAA 2ZBRA 2BQRA 1N5VA 2E5GA 2RKIB 2FHMA 1HQEA 2K06A 4DL4A 3BO3A 4Q45A 2BOPA 3D5MA 2NSBA 3HT0A 2YNIA 3PO4A 2DISA 4N76A 1R6VA 1X4HA 1IKWA 2C3PA 1SH0A 1N52B 3FUYA 2DNQA 5IS2A 2Y1LB 1ZZFA 2OTJS 2IJRA 3H2LA 3OJSA 3DRSA 2RUGA 3FQLA 2W01A 3HFZB 2W9BB 2WK4A 3CDBA 3L7OA 4DPWA 1UEUA 2XI3A 3JYTB 3OBIA 3SDEB 1RWOB 1D09B 4U9RA 3D1QA 2AGPA 2CQIA 3IBWA 3HVAA 1DZ5A 3TRGA 2HFVA 1GMVA 4DV4J 1EKSA 4C48A 5KG2A 3V6DB 4I4BA 3RBEA 4OZLA 3R6LB 4FDFA 3JSBA 4FP9A 1KFDA 4ZDNA 3K59A 1T03B 5A8KB 1AYEA 1K1SA 1RWMB 2L9DA 5D6GA 2C42A 1EB0A 2B4OA 2H54B 2E1PA 4OZJA 4TYBA 4UW2A 5HK4A 1K9MT 2HQGA 3EUNA 1Q0NA 3ZZYA 2FJDB 5F0UA 3THVA 2RIJA 4R25A 4K2XA 1VRTB 1FFWB 2M52A 4FF1A 3J7YI 2FVSA 1AT1B 2QGFB 2MMYA 4LFAF 5KFDA 2BANA 4ZVUB 2MKYA 4DZ6A 2HVIA 2KM8C 2DIVA 1M90T 2V2ZA 3RTVA 4M5GA 1Q95G 1J5EJ 1UVJA 3QIPB 4LSZB 2QA2A 1P1TA 4OZ2A 3BREA 4X65J 4YR2A 1U1QA 2MY8A 3A8JA 5GAEI 3MFIA 2RMLA 3DLBA 3IN5A 1R8HA 2QJ3A 2W1BA 2H5EA 2GFFA 1HMVA 4WU3A 5IFMA 5L46A 3I4HX 5BXIA 2G0CA 3Q8RB 4NZ0A 1SV5A 4WFYA 1U26A 4V19X 4NA1A 5B0BA 2HHHF 1VQSA 1T11A 2R7OA 4ZPBA 3H7HB 5EUHA 1OY8A 1KD1T 1RCXB 1V9OA 3EGVA 2BJ1A 2VBZA 2NXNA 1HNWJ 3K8VA 2CPFA 2OUGA 5HLFA 2BM1A 3FBBA 1FE4A 1H98A 2V5HG 3FEXB 4O0IA 2OPQB 2ZEJA 2QC3A 4HDGA 1WF1A 4I7FB 5DDRC 1PJ7A 3I0RB 1SL2A 1DFDA 3LP2A 4R0JA 1WTFA 2JX2A 3DXSX 4XDDA 2HMIB 4GC7A 1REVA 2VG6A 4DPYA 3RB6A 4E0DA 2XI2A 1O51A 1U02A 1JLBB 3CGIA 4DF4A 3VQTA 3PYEA 1N33J 1WG5A 4G1QA 1NK5A 5CYMA 1FKOA 2V6AA 4RNOA 5LMUJ 2B51A 5LXYA 3Q8PB 1WSRA 2CQGA 3PM9A 5IQ6A 2JVOA 4ETXA 4IFYB 1CG2A 1RB0A 1SUQA 1I94J 3KLGB 1TQLA 5CYQA 4WFAQ 4A8QA 2IBKA 4P10A 2EW9A 1N6QB 4JI6J 2FHKA 1EP4B 3KJVB 1HNXJ 2Z56B 2LXUA 3M6XA 4JI5F 1JLQA 1OQ3A 1RAAB 2FLLA 2R2SA 1V3ZA 4X4VA 4ID5B 4FS2A 4MYUA 2W4CA 1NM2A 3JQJA 4CCHA 4NCAA 1HBNA 4BWJA 3VR1A 1S1WA 1WF2A 2VBXA 3HD1A 4MKVA 1HWKA 1O6XA 2C1EB 3ET6B 4IQMA 1S5ZA 4F4ZA 2MQQA 4HYKA 4O4RA 4W4MA 1I5OB 1DY3A 2KZZA 3KJNB 5DRKA 1QVGR 3C2PA 2CPDA 2KT2A 4OHVA 4OYXA 3HHDA 3H5UA 3OXLA 2J9CA 1HBMB 1RAOA 5CH7B 2ZHBA 1VISA 1HWUA 1ZM2A 3U7JA 5DDOC 5B0GA 3MCMA 5KFIA 4I69A 2D69A 4RNHA 3TAMB 2IDLA 4ZLNA 2M88A 2YWWA 2J9EA 2VF3A 4DF8A 2B4PA 2D3O1 4ED4A 4B9NA 1RT3A 4RBTA 4IOCQ 5D78A 3CW2C 1FNXH 3VGUA 4JV2A 2C3UA 2DR5A 3W64A 3M8YA 4GKJJ 1PC4A 2XLJA 3N5FA 2A2DA 2KKHA 2Q79A 3RW7A 4P7VA 1RWKB 2XMTA 3V6HA 4C2MA 2P2CB 2DB1A 2ZDOA 5HO4A 1JJHA 1FERA 2R7SA 2VC0A 2AGQA 3RRKA 2QLXA 1WC5A 1XBWA 5FLXU 4A8OA 2FQQB 3SCIE 5FDLA 1DTQA 2LEPA 4WIQA 2N7CA 1NRKA 5D0RA 4BC9A 2YH0A 2QX0A 4DV3F 1ICEB 5H9EK 2HS3A 1Q53A 2HBYB 5ETLA 1FXDA 1RZMA 4AUKA 3V81B 1WTBA 4QYZJ 6AT1B 1JLEA 2AJ1A 5KFNA 1NJIT 2HWTA 3R1LA 3BB5A 2CWKA 2C3OA 3IMQJ 3FJ2A 2VQEF 2MQ8A 3M2VA 2WZ1A 1NK8A 4YB1P 2LLZA 2N4DA 3N01A 2K8GA 3W65A 4CYUA 1F3VA 2U2FA 2EEYA 2W2PP 2VPWB 4OJHA 2L9WA 3UNGC 4U6PA 1NK4A 4CM0A 4CP5A 4JI1F 4ATNA 2J8AA 3CC7S 1JQGA 1JXEA 2AZ1A 4KC5A 4NZ6A 2J0QD 4O0NA 1JLBA 3ZO7A 3OV7A 2OPRB 2AEFA 4ZN1A 4DZDA 1HQUB 3FCWA 1Y10A 3MAQA 3GB0A 2RHQB 1TL7A 1YRXA 2B4VA 1FESA 3M6UA 3GONA 4HH0A 2ZUAA 4QR0A 1DQ9A 4BS2A 1XEZA 2GVDA 3H4BA 4B3TJ 3IAM9 3JAMY 2R7QA 1GNKA 1VCTA 3W2WB 4DL7A 2B9XA 2GJIA 5BYRA 5D0HA 2VFUA 2FTRA 1JLGB 3PIOQ 3O44A 2D3ZA 3B4DA 3B6BA 2W25A 4AQYJ 1RYRA 3G96A 1E6VB 5E7OB 2DR9A 1RADB 3CJ3A 1SL1A 1XIQA 4FPIA 1IVZA 4ED2A 4MH8A 4QIVA 1NJZA 2LXIA 2QN6B 5KG3A 4M95A 2HGLA 2N7YA 3UDVA 1JMTA 1RK8A 5SZTA 1M5PC 3D54A 4Q0BB 3C6TA 5ETMA 2LDIA 1HW9A 3DHWC 1RHRB 2AIRB 1SC3B 5B0CA 2HMIA 1CJVB 3M8WA 1FRIA 1JLFA 1NO8A 4WK1A 5D77A 1VRTA 3TYTA 1SJQA 2ZWOA 3GYGA 4EBDA 1JX4A 3WBZA 4O4GA 3ZNUA 2OD4A 4QBUA 2VOOA 1RSCA 2LMIA 3BR8A 2HHSA 4DCPB 5GAGU 1DJ0A 1G4CA 3CD5A 4IOBA 2ZUGA 5DG7A 3GIMA 3FBFA 3ZTQA 4X66J 5D3GA 1RKJA 4G65A 2XCAA 2JFKA 5C42A 3OSPA 1ZM4A 1BGXT 1FKPA 4C4WA 1EX8A 2B5JB 4QW9A 1KBRA 2DRBA 2F5GA 1MMNA 4UUWA 2BDPA 1QAIA 1KN6A 1N5YA 3M05A 1U6ZA 1WHXA 4HI1A 2H5IB 3T6BA 3MM8B 3W66A 2DGQA 1S9EB 3GV8B 4QYZK 2I5JB 4A47A 4ELVA 2RF2A 1S7HA 2F4FA 4IQXA 2HZAA 4C8YA 1YTYA 1U0SA 1S76D 2DHAA 4UUXA 3Q8VA 4F3QA 1ZM9A 4PKDB 2RQCA 3PW2A 1UA1A 3ISNC 1D9AA 4RW8B 1CJTA 2CJYB 2M8DB 3CMES 1ZAXA 2MKHA 4DR6J 1H2UX 3HXMA 4Z2XA 4OYMA 5IXUA 3ZZRA 3BZQA 3PJ9A 1XN9A 1RT3B 3MMJA 4KJIA 4JV5F 4DPXA 2ZH4A 1S9GA 2ZOGA 2CPJA 3TO8A 1XR7A 2WB1D 3BJYA 1HHTP 4WP9A 2DGVA 2OPPA 4PWUA 2E7XA 4GVBA 1F60B 3DNCA 3QMQA 2NPFA 2UUCJ 1Y5LB 3F41A 3N0VA 3OR1A 2UXDJ 3KMSA 2L48A 2DHXA 3JSMB 4Y2IA 2RRBA 4XTTA 4TY8B 4YMEA 1JLFB 3PJXA 4R8UA 3NCPA 3IM8A 2DPIA 3KMQA 3QT5A 2V4RA 3NNHA 2V2QA 3DRRB 5DM6Q 2HAIA 3G6YA 4DI6A 3BH6B 1T94A 4JI2F 2WONB 4DJBA 5A2QU 2DR7A 2EFVA 4X4UA 2MJUA 3CT9A 4USHA 2LFVA 4DV2F 1UZHA 2IA0A 4DFJA 2C3YA 2OSRA 2OJ3A 1E6VA 2NLWA 3TX0A 2JEJA 1IKYA 1HQEB 3CNQP 2F9DA 4O3NA 4DU7A 1RT1B 1HNIB 1X4FA 1X0PA 4ZVEA 5L8RC 2DEJA 3LP1A 1PJ6A 3BPDA 1UW9A 4C0OC 4B3RJ 2VG7A 2RF2B 4URGA 1XJWB 2HFZA 2ZBCA 2K2PA 5LMNF 1XC9A 1YZ6A 4C6AA 1MMDA 1PILA 1YJTA 2N4CA 3PW7A 1YBUA 1D0EA 5IV3A 3MEGA 2H5JB 4A8SA 4LF9F 2FGOA 4PG7A 2HHVA 3DRXA 2DXFA 4QWCA 2FHJA 2I9SA 3ZTRA 4I68A 2GAGC 1RA7A 7AT1B 2R42A 1DBDA 1E6YA 4B3OA 5D4LA 5K8MA 1U1PA 1GXUA 2HZCA 2X1GA 2CQBA 1N0VC 3MGJA 2E5HA 1R0CB 3DGPA 3LQVA 3QT8A 1TL5A 3NGRA 5C42B 1S48A 1Q7YT 2OEKA 2WOMA 2GMLA 3SXLA 1PYTA 3R7SB 4CLZA 5F3ZA 4ED5A 1RHKB 1RT6B 4DR3F 2LQJA 2H51B 3NAIA 2X1AA 2CJXB 2QT7A 4M5IA 1V5VA 3MCNA 1HBUA 1PC5A 3DOKB 8ATCB 3MM7B 2IY5B 2G2OA 4JYAJ 2RS8A 5AXKA 1RT5B 2DBBA 4ENOA 2CVIA 2OFGX 3R27A 2BXJA 7FDRA 3PW0A 2JSXA 3OFEA 1U6FA 4F25A 3QSIA 2IMWP 2KN4A 4U8YA 3VAMA 4ZHRA 3FEZA 3LO3A 3K57A 2CQ2A 4NI2A 3CF5Q 1ZTWA 2YKPA 2FHJD 1V5IB 3EZUA 4O3OA 3TJ9A 2O67A 4ZIWA 2ZD1B 1VQLS 5CCLA 2ZH5A 2C28A 1QSLA 2F8EX 1FKPB 1F6TA 4ZJOA 1IM4A 1RHMB 2OI2A 4ICLB 1IR1A 3A8EA 2ZOMA 2HAFA 4MYTA 2XHCA 2GVDB 2YPYA 3FKBA 5D3GB 4OZ3A 1A7GE 3I31A 3R5CA 3KLHA 4B9LA 3FBCA 3OSNA 4LF7F 3EXCX 4WWSA 2FLOA 1X5SA 1YK9A 4BBYA 2ZM6J 4OYPA 1S77D 2GGPB 3BKTA 2DH9A 2F3JA 4NCGB 4PRFA 3ENAA 4AT1B 4BCAA 3A3OB 3LH2S 2B9YA 4IO1A 5E0OA 1FX4A 2IPOB 3IM9A 3GR0A 3OTBA 3TVYA 4U95A 3CPWR 4JI8J 3G82A 4Z7YA 4DU8A 2YPZA 3ICLA 3UDEA 4TY8A 3LF0A 2HVDA 1VDHA 1QUVA 1UEKA 2IRUA 3ISZA 1Q8BA 3LP0B 4LR7A 5IM0B 4KV8A 1HWIA 3D68A 4DS4A 3GCWP 3MM6A 4TQRA 1EZZB 1H7XA 3IRXA 3JQMA 3QPIA 4J90A 4RPFA 2W8LA 3CC4S 2R8KA 4LF5J 1RP5A 2H9ZA 1HNVB 3GE9A 3DGPB 1RHJB 4PUOB 1XQIA 2JLEA 2FVCA 4LFCF 1WC0A 2GHVC 1ZTTA 2DR8A 2GHWA 3J7Z5 4LF4J 4USTA 3MOZA 4ERDA 4ZCKA 4DN0A 3MEGB 1XNRJ 1X0FA 2XS2A 3IFEA 2CWXA 3WC0A 2HQCA 5KFUA 3DLGA 4E8UA 3A12A 4NLVA 2DCLA 4HHHA 3VAKA 4ECSA 5HQLA 5DLGA 1U48A 2QSFA 1W2IA 2DCUB 3UPFA 3LPYA 1L3SA 4KH1B 1S6PA 2N3LA 3PHEA 4FPRA 4L3NA 3C66A 3W8GA 2QFJA 2DD8S 3RRGA 4OI0A 1FXLA 1Q86T 3TWZA 1HI8A 5AXNA 1NNDA 4DX6A 4RUBA 1XNQJ 2R8IA 2B9WA 3DU5A 1FI4A 1YBTA 3M2VB 5THWA 2QTWA 2RUSA 1TL3A 2Z58B 5BYQA 4B3SJ 2BJEA 4CRJA 1HBOA 2DO0A 3B82A 4QPTA 3ZZ0A 5FLXY 4MMOA 5MAOA 3HO1A 1GEHA 3DRPA 1U49A 1A0OB 4IH7A 3BSCA 4AE5A 1LOUA 2KRBA 2WSEC 2RQKA 4YUDA 3PR5B 3RW6A 2MZSA 4DL0C 4IFVA 1NK9A 2QV6A 4M5JA 1LW2A 1TL1A 3H8YA 2Y1IA 4NCGA 4Q44A 2RILA 4IG3A 4J37A 1RT7A 2CKWA 4ID5A 3RAXA 4RW4A 1CEZA 1RWXB 3FVYA 2UXCJ 2DY9A 2D3UA 2NZ4A 2V8GA 2ZD1A 1VLOA 1YG0A 3AODA 4DBQA 3BV8A 3AD8C 3LPEA 3M32B 3SMZA 3TNVA 2HHQA 1WF0A 3R5GA 2RKIA 3CUNA 1RKIA 2X3GA 2BQ3A 4J9VA 1M5OC 3MPWA 2ZKTA 3Q8QB 4O3SA 2ALYB 5JXSA 1MSWD 4X4PA 5E33A 1FX2A 3RB4A 2CDRB 2Z4PA 4DR2J 4P7TA 5HQ8A 1F9EB 4ED6A 2XY5A 4B3MJ 1HKAA 4MFBA 2HHPA 5F8MA 1R27B 4JOUA 4H4KC 4OYOA 2O01C 2AX1A 2FD2A 3POTA 5D0GA 4L74A 4X4TA 1KFSA 2MXYA 5CD4H 4DL5A 3M8PB 4FYWB 1XMQJ 1U4BA 3DU6A 1S1VB 2CQ0A 1C0UB 1UTAA 1SL0A 3OTEA 3W5XA 4PAAA 4DR3J 3CJ8A 5HMWA 3K5MA 1BLUA 1WEYA 5JMNA 3PFOA 4LSLB 1NSAA 1TP7A 2E5JA 3GV5B 4K4TA 4CLWA 3EVMA 2ATLA 2A10A 4OI4A 5KFGA 3TUPA 1FJGF 3TW0A 5KFHA 3R5JB 1VRUA 3GSDA 1RJJA 2H65B 2RE1A 3AB4B 3C15B 3GCXP 5LJ5Y 1JB0C 3R7NB 2FJXA 3RBDA 3V4MA 1B99A 1Y7PA 3IWXA 3VCDA 2DK2A 4DHVA 4XIUA 3OL7A 3CCSS 3PDNA 3RAQA 2M3DA 4USJC 2FLNA 5KFRA 2OMOA 3AB2B 4WIIA 4RNMA 1LQ9A 1F9FA 2OGUA 3QT7A 3HHEA 2HHXA 4A8XA 2QA4G 1UEVA 2J0XA 1LW0A 2BR0A 2HQDA 3HKWA 3DI6B 4CLYA 4B3RF 3KLIA 2JHEA 3MPDA 2BE2A 3TARA 5HJYA 2KFYA 2UP1A 4WYLA 3QSYB 2M4MA 2M0GB 4FYYB 1C1BA 4ZCIA 2IMOA 2RH3A 3K5LA 5J1EA 1KQSR 2RD5C 3PW4A 4DR4J 4UY8T 2RRAA 3C16A 1JLCA 1I51B 2E29A 1GXTA 2HQFA 2MYFA 3DOMB 3MECB 4ER8A 4JI2J 5D8HB 2JJ4D 3ILOA 3NXZA 1VQYA 3HX9A 2VFSA 5BJRA 3R2DJ 3MMAB 3M8PA 5B0AA 3ILIA 2KVQE 3Q89A 2WB4A 3HVRA 2X1FA 2KXHA 2ASJA 2IM0A 4QCLA 3UDLA 3NS6A 4G1IA 1YJVA 2AYEA 2LQ5A 2VICA 4DSIA 2UXDF 2OO4A 2GO9A 5HROA 1BE4A 1C4CA 2G2YA 1OSDA 3EICA 3BDPA 3ZC4A 3NOCA 4JV5J 2GMHA 4DQQA 1EP4A 4RZRA 3LALA 2LQ8A 4IDKB 1F3FA 1DURA 2V8HA 3PW5A 3IGNA 4IFYA 1AZSA 4RR5A 3N6NA 2DHSA 2DXEA 1MNEA 1VQ5S 4URQU 4ANEA 2BEFA 4C97A 3PACA 4LRCA 5EWFA 4DV5J 4WF9Q 3D1HA 1ZPWX 4PQUA 1B64A 4K4WA 4OZNA 4HHJA 4J9UE 1T9XA 2R7TA 4CO2A 3H42A 5DQGA 2RHSB 4JI0J 1UVLA 1FEHA 5DG8A 4JI4F 2V63A 3DRYA 4G1PA 5KAKA 4LR9A 2HIYA 1K1QA 1TKXA 4YDXA 4ZPDA 1BWVA 1FWPA 5C5JA 5KFYA 4U67Q 1QVFR 1RTJA 3UFCX 1YBAA 3I0RA 3EYZA 5M2PA 5KFJA 3Q0AA 2DNLA 3A3PB 4WKRA 4J91A 4RW4B 4F4WA 3MMCB 1X4AA 1RBLA 2RU9A 2ZC3A 3EDRB 3GZ7A 1HA1A 4FXDA 1JJCB 2EBGA 1TU0B 2ZDPA 5C25A 1FE0A 1WHVA 3ENVA 2ATCB 4ZN3A 1Q81T 2V9WA 4M63A 1M5KC 4RW8A 2H4YB 1K47A 2AJFE 3IS9A 1TMMA 1QTMA 1UJ5A 1DARA 1BUXA 5KFVA 2C2EA 3M8ZA 4TU7A 3T1HF 2YWFA 2CQPA 5I3UA 1S1WB 4MJKA 4F67A 2CNOB 2XSFA 4BDPA 2QMWA 1R6YA 2VG7B 4DOZA 3OL6A 5D0EA 1SC4B 1W7WA 2BANB 5L9NA 5IT4A 2CPEA 3I5CA 4NLTA 2H4WB 3RG6A 4TLQA 2DGXA 4YB6A 2NCKL 3VGVA 1C1BB 1U1NA 4DWIA 4ILRA 1DTTA 3SQOP 1L3UA 4KFBB 2XLIA 2KU7A 2PD1A 2YX4A 1QY7A 1ZPVA 5GAHI 2V9KA 2WONA 4USIA 1FFGB 3EX7B 2YNGA 3UVJA 2JWNA 2LEAA 3IWNC 1CC7A 3C6UA 1PJ5A 2H1YA 5LSLA 4H54A 1CULB 3D6FB 2WBRA 1OY6A 4RBUA 2YTCA 3OUYA 1WEXA 3KYLA 3DFEA 1DLOA 2YX7A 3O8WA 2HGMA 4ZP9A 3JSYA 2GVZB 3TA0A 2KTQA 5FIIA 2XTJP 2BE9B 2HK3A 5L1IA 3NNCA 3X1LB 1G2EA 4RKUC 3D0IE 1WOSA 2HFUA 3D9BA 4O44A 4WFZA 1FD2A 3G2XA 2ZOFA 4OJ3A 5F3TA 2JEIA 2XYPB 3DMJB 2MKIA 2IM3A 2H48B 1X4CA 4QZVB 3JQKA 4RW9A 2K3IA 4IRDA 5F8GA 4Q8FA 3BGFA 1LNQA 3SFUA 3IO1A 3OTOJ 1UVMA 3N5BA 2KJWA 2MHNA 3OTCA 1DTQB 1V6HA 4KE5A 4LF1A 2LP4A 1RWVB 4OLOA 2GIRA 3SSQA 4NEYA 5HVGA 4TU9A 5J2QA 5I3UB 4LRDA 3DOLB 4ZVPB 3WDOA 2B7BB 2X7IA 2UUBF 6FD1A 5KFMA 3R7BB 3QGGA 4UOHA 1LWEA 3A8IA 2ZJRQ 1TAUA 3J7YU 3KHGA 5KG7A 2GQ2A 3ULHA 1EIYB 3ZNJ1 5J1PA 1L3KA 3LTOA 3LUYA 1KQKA 3AD7C 3MCSA 4A8MP 3TQ1A 2C2RA 2J6SA 5J1NA 1JJ2R 4NXMJ 4USKA 3T1HJ 1KSPA 1RBAA 1VC6A 2EPIA 3NGSA 2UVWA 2J76E 1VHIA 5L38A 4DQIA 4JI7F 5HMXA 1LXJA 4M1KA 4IRKA 1AROP 4IKAA 4W98A 4C8MA 4AL5A 4ED8A 2WVCA 1BHNA 1SCJB 1OIAA 4P74A 2FPHX 2MKSA 1YSJA 3IBFB 1EETB 2NYHA 3NP5A 4R0EA 2HFSA 3RBXA 4CLLA 5LT5A 1X7VA 3TAMA 1SIZA 1WELA 3T5HA 4LF9J 3V81A 2KZMA 3UDCA 3DLKB 3I87A 1FO1A 1H72C 5C7PA 2BJDA 4Y28C 1S1XB 1S72S 3QFHA 2RS2A 2E1MC 3M1VB 4UQTA 3ZFVA 1TKDA 3SFGA 4DEZA 3DLEB 5IV4A 2Q66A 2FZGB 3EMTA 3FBEA 1NHUA 3DLLQ 1CJUB 3V4IA 2HG4A 1D8ZA 4DV7J 3HJFA 2YNIB 5SUHA 1WC1A 4PG6A 5LSRA 3MPVA 3R2CJ 1U1MA 1VRQC 4DV5F 5KFWA 2MKJA 5KOXA 1SH3A 3NGKA 4EBCA 2BW7A 1GMUA 5G4DA 2Q43A 1ZS6A 5M2RA 1YJRA 2QSWA 1WDDA 4ZOSA 4JV1A 4L72B 3FZ2A 4WFXA 1VIXA 4WTYA 2MZJA 2M2BA 1RTDA 4RUHA 4NA3A 3H5YA 4ZVRB 4ZPAA 1CS4B 2DH8A 1B7YB 3MEDB 3BSNA 1SJFA 3GSIA 4QIEA 1KONA 4N7TA 4URSA 2CPZA 4M94A 1SQFA 3NL0A 3AOBA 1LXNA 1TR0A 2JOQA 4P6QA 3US5A 4ZJLA 4QYRA 3R5AA 4HEA9 2VG5A 3KK3B 3MAAA 1ACMB 3SBMA 2ZVSA 1MROA 1NJWA 5L1KA 4CYUB 3E01B 1H3DA 2WRMA 4F36A 3M2UA 1FVSA 2HHHJ 1HNWF 2D1CA 2MQLA 3VHQA 3M6WA 1WEZA 1IQZA 1PAUB 1VBZA 3SEOA 2OSQA 1OY9A 3L09A 3D3BJ 2MEWA 4A8KA 1CJVA 1AFIA 3CCVS 1S1UB 2ZH7A 1RDRA 2R7UA 1KR4A 3KDOA 2CXEA 2O5DA 3IR7B 4KGKA 2UVVA 2B8PA 3P6YC 2C2DA 2OEJA 1P27B 4X65F 4JI7J 1VJQA 2B7CB 4Q43A 4X62F 1XWLA 4OV6A 1REVB 1S7IA 2BKNA 2IM2A 1H2TZ 2NXJA 2UZAA 5A8RA 4KGMA 4I7FA 4QPXA 4RW9B 1HWLA 4D3HA 1S1TA 3E8OA 2ILYA 3K17A 4L6V3 2QFIA 1LK5A 1AFJA 4KIAA 1CJTB 3QNWB 2YNHA 3U1MA 3W8PA 2I2YA 1RT2B 3D28A 1SH2A 1TMJA 1VJWA 3B54A 2HURA 4WJBA 2PE8A 2FIUA 3CJKB 1VQKS 2FHOB 2F4VF 1FRXA 1V3SA 2K3KA 1LWCA 4IG3B 1XR5A 1T3NA 4GKKJ 2ZNZA 3Q23A 2OHDA 4DV4F 3DYAB 1B4SA 2GHPA 3SCKE 4WFNQ 3NEKA 1C2PA 1GQEA 2RRNA 1A9NB 4ZPWR 3MMAA 3SYZA 2FJWA 4QQBA 4IOAQ 2M5YA 3D66A 3F73A 4F3OA 5EN1A 5A8WA 2Q3PA 3P5TL 4CT9A 3PNIA 3UCGA 1FXRA 3NCQA 1EQMA 1ZAVA 1NJXA 4J9PA 3G8TA 3CB4A 4X64J 1K0VA 1T3OA 4UZCA 3DLHA 1VFJA 1RUSA 4ZCLA 3CWJA 5BR8J 5H9EJ 5F8NA 3CDEA 2QL9B 5H1SV 2N3OA 4EZ9A 4KGXB 4X4OA 4A48A 4NEZA 3W9IA 2CNLB 2Z2LA 3BPSP 2IA6A 4NI2B 5CD4A 3H98A 4RLEA 5HANA 8AT1B 3H25A 1FNOA 4L76A 4NOHA 1NEEA 3HULA 1SJ3P 4NA2A 1HR0J 4X84A 1S59A 2EFPA 2P6SA 4ZLPA 2XCPA 4FXVA 3MWBA 2RQ4A 2UXCF 1HLWA 2B0GA 1IBLF 4B9TA 1IXKA 1FRHA 2GAHC 2NUHA 3I0SB 3CCMS 4JI1J 4WZMA 4RU2A 3S8SA 4OV1A 2P8IA 3K5NA 2PSZA 4LUBA 3NMAA 4QR1A 3HF5A 1TUWA 3HVWA 3E01A 2GIFA 3I9V9 3GILA 1RAFB 2MHEA 1UWBB 2WVBA 4ZKAA 3CJ5A 4ED1A 2XMVA 1VQNS 4Y65A 3GJQB 4W90B 3Q86A 1VBXA 4PR6A 2R3VA 4LVOP 3TEHB 5KFFA 1MROB 3CCRS 1HBMA 4BLGA 2F4VJ 3I5AA 3TZXA 1YJ7A 4P71A 3HP6A 4WE1B 1QDUB 3NWRA 4Y0FA 1W25A 4Y2KA 4HACA 1T9TA 1GXLA 1Q8IA 4QOTA 2RJZA 2W7AA 4DR7F 4K5SA 3B4MA 3AQOA 4YS2A 5DETA 4USWA 2LA4A 2BACA 2DYAA 2NXCA 3AJDA 4IUFA 5GAEU 1EETA 1RTDB 2P9CA 3D6HB 2L9NA 1JXLA 3HHKA 4ICLA 5F9NA 3BQ0A 5F8JA 4FBUA 2W9AA 3F56A 4L73A 1EARA 4Q5VA 3N28A 2DO4A 4RW7A 4JI3J 4F7VA 1PCAA 3KHRA 3HHLC 3SI8A 3CJTA 1QLNA 3PX6A 4LF4F 4QU6A 1K44A 2BBEA 2OLWA 3DLEA 2CJBA 3HI9A 4CLSA 2DNNA 4CH7A 2QLFB 2YXLA 4PXDA 1CJUA 4FS1A 5D15A 3BQ1A 3V4IB 1T05A 2XZDB 4RO0A 2VASA 1OWXA 3AOAA 3ZZZA 2AW0A 3W5ZA 1TL7B 1BMQB 3DDIA 2R7VA 2D41A 2AT1B 1ZZNA 3VAJA 1IBKF 3AJ2A 2E66A 4Y34A 1CULA 2XMMA 5F8LA 1C4AA 3DDKA 3I55S 5J2PA 5C25B 2HPUA 4F4YA 3THPA 3KG1A 3MXHP 4K4SA 1YKWA 2DHGA 2PA8D 1PBUA 5A0YA 3T41A 3EE3A 2E7VA 1O8BA 1ZA2B 4OMFG 4JI6F 4QW8A 3WZ0A 4KFBA 1D9FA 1Y5NB 3GYXB 4PG5A 2M8HA 2VB6A 5KFAA 5GADU 2XZWA 2W9CA 4EMDA 3FC9A 1N5YB 4ED7A 1SVDA 1HMVB 2HZVA 4DQPA 3IR5B 2VL1A 1YQHA 1FDNA 4FYDA 3HKZD 2DNHA 4LF8J 4L3KA 1WOOA 3QO9B 4FNHA 3RBZA 3DC2A 4EGLA 4DR7J 5CHCB 4FVMA 4MIAA 4JUZA 4MK7A 4U7CA 1MN9A 3VAGA 1LWEB 1NSKL 1BXNA 2WCXA 4DMZA 1M1GA 3HHLB 1XERA 5KFTA 2UUTA 1R8PA 3S7RA 3T1YJ 3W5YA 4A8WA 3HZEA 1F1BB 1HBOB 4N5SA 3ONQA 3G6ES 2Q1LA 2KH9A 4DS5A 2EK1A 4OLPA 4C3KA 2MKCA 3M9NB 1R8AA 5IT0A 1SKWA 2R2UA 3K2YA 1LK7A 5HQMA 3CD7A 1DQAA 4IFVB 4O3PA 4DX7A 4DUYJ 4ECRA 1GMWA 1IBLJ 1NLKL 3AXMA 2FVQA 2GQCA 5AE2A 1RBOB 3OHAA 4HLBA 3UQSA 1CC8A 1MMLA 1C0TA 1NBEB 1PGZA 2YKMA 3LWMA 3C6UB 3QAUA 1D1UA 2XO7A 3WC2A 3VALA 3A8KA 4RNNA 2R8HA 2XNRA 2JFDA 2LKZA 2Z0GA 4TN2A 4DUYF 5HLFB 2JC0A 4ZLJA 5GAHU 3PRVA 2MQMA 1AA1B 1JXVA 5IT9U 2VFRA 4KR0B 3VZHA 4AL7A 2I1RA 5C24B 1OPIA 1D8YA 2CPXA 4XPEA 4GMKA 1WC3A 2HEKA 1DHMA 4NLUA 3D7SB 3EWGA 3GFYA 2ZJQQ 3OHBA 3T5LA 2E5LJ 4B3MF 5FJ4A 3GG1A 2CQ3A 5GVQA 3H2VE 3U02A 4DR1J 2QZ8A 3F0NA 1RAIB 1HQ2A 1YDLA 2AU0A 4X2BA 4CTAB 2XMUA 1HYSA 1J27A 2YWKA 3E51A 3FRZA 2UV8G 5AE3A 4TY9A 2I5JA 1R89A 3PCOB 4AYBD 4P2FA 3QO9A 4Y2CA 1WWHA 4J9KA 1X8DA 4OYBA 1B70B 2ZHAA 3KTQA 2RB7A 1FTRA 4TLRA 1OPZA 5I3QA 4K0KF 4J9MA 2J0WA 2W7PA 5C2GA 2KRRA 4DUZF 2XSJB 2EG2A 4LSNB 3UCZP 1PIEA 1SI9A 1U2RA 3KG4A 4HT5A 3UR3C 3HM9A 1YJ9S 2VA2A 2UXBF 4LVNP 3RJMB 3WIUA 1X31C 3AAWB 2YKOA 1IBMJ 3I56S 2G4BA 1KS2A 1YLXA 2AWZA 4NLWA 2CZVC 4DR2F 1Q78A 1N5TA 3DN9A 4MIBA 2UUAF 3PKMA 1S12A 4B3OB 2VJVA 1N54B 4KHPJ 2YWHA 4RWWA 3DLJA 2JZ5A 1HW8A 3UI3A 3TJ8A 3KHLA 2UVRA 4CH1A 2XWYA 1LW0B 1NZ8A 2DNRA 2XLKA 5B0EA 2G9OA 3ET6A 2QA4S 3R9LA 2ZBQA 3LGMA 3MECA 4YR0A 4DL2A 2CJKA 4PQUB 3KK1A 3EZ5A 4J9OA 1DRZA 4IDKA 3D2WA 5KT2A 4LF6F 3AD9C 1JIHA 2YX1A 5J1EB 1C1CA 1NKEA 2L41A 4Y2AA 1ZETA 3KJVA 1NH7A 3EGZA 1S99A 3DI6A 4YFUA 3G6XA 3IGVA 2RT3A 2PDAA 3BGUA 3UN2A 2IHR1 5D4NA 3MAAB 1RCOB 1AB8A 2XBPA 3AFGA 4H4MB 3EJMA 2KXNB 2BW2A 1Z4UA 3R97A 2OEMA 2OELA 4FYXB 4OFZA 6FDRA 1YVFA 4YQWA 1HNZF 2UUAJ 1L5UA 2PN6A 1RA6A 3MR5A 1LKZA 1RE1B 2DTJA 4I64A 4F0MA 3DRRA 4G6VB 2WW4A 3H59A 3IS9B 4N77A 2VG6B 1T9UA 3IG1A 5FD1A 4QWDA 3CE8A 3AA8A 1JNRB 4K5RA 3HPOA 4PWDB 4XK8C 3QATA 4K0KJ 5KOWA 4XDCA 1PYSB 3QJLA 2E1CA 3WQPA 2KT5A 2HRTA 2LDYA 3TA1A 3GPAA 4B08A 4XPCA 1NK7A 3OL8A 1FKAF 1REGX 1BQNA 3OXFA 4P2XA 4LFBF 2JL9A 4PCQA 3RR7A 4FN5A 1RT1A 1UP1A 1S1TB 2SXLA 4NLSA 4NRTA 4C11A 4TU8A 4ECWA 3I82A 4DV7F 3JSRA 2BKOA 3NMRA 1QE1A 3DM2B 4QU7A 1FJCA 3ETMA 4V1Ak 3PFEA 4LFCJ 2Y8WA 1CJKB 3CDUA 4ZHRB 3O5TB 3MM9A 3UD4P 2KM8B 1VK3A 1M0SA 2HQIA 2ASDA 4ZPCA 2YWGA 3DCAA 4PPZA 1HD0A 1J5OA 2ZHOA 1FEEA 3U1NA 2IJNA 3HFVA 4DV6J 2ZJPQ 3GU0A 5KFZA 2D3OR 2BYCA 2B5JA 2E9TA 2HRYA 3VVTA 1U47A 3Q8UA 3TQEA 1HNVA 2AP6A 2J6TA 2E9RX 4P72A 2MLXA 3PVXA 3TI0A 2HSEB 4ZITA 2ZM6F 1S6QB 4FNIA 1UWBA 2WVDA 2XSJA 3B8HA 2GJ2A 2WW8A 3G82B 4I2PA 2WSFC 4NLRA 3GV7B 2QLJB 3MTKA 3QLHB 2KYXA 5A76A 2XMWA 3KLFB 2Y3YA 4ED0A 4DPUA 1X4GA 3KG0A 2DJWA 2A18A 4N8NA 4UY85 1MU2B 3EPGA 2ZH2A 4Y00A 1NCLA 3C6TB 1LWCB 1VQ8S 3GJTB 3ZTPA 5A2QY 3JYTA 3BQ2A 4NXNF 4CTAA 1WD6A 1HYSB 1U6BA 2GCFA 4GO7X 3C3LA 1X4EA 2FC8A 3ADAC 2VH7A 3J81j 1HHSA 1RTIA 3AJ1A 2KG1A 1GAOA 4HKQA 5IWAJ 3R1HA 4DR1F 1SQEA 3ILJA 2HLUA 4HTJA 4WK3A 3ITHA 5LJ3Y 1S97A 4Q7AA 2CG8A 2XO6A 3PKYA 1U0HA 2B9EA 4WCEQ 4FF4A 1S57A 3BGLA 4ZVQB 1SC6A 4TKTA 3GIJA 3VAFA 2XMJA 2VPZB 1T03A 3HFKA 2VODA 5K9FA 2QMUB 3GIIA 2F65A 5H9FJ 2MDAA 2MJNA 2W2OP 1X9WA 3D4JA 3JB9k 2POKA 1NU4A 4KGVB 2XB2D 3TUIC 1P9YA 4LR8A 3KK2B 2B6AA 1GTEA 1TL1B 2XMKA 1V3RA 1U09A 1AW0A 1Q5VA 4HI2A 4OX6A 1G7CB 1WKJA 2O3DA 5B0DA 3MF5A 1YRTA 2AD9A 2NREA 2W9BA 4LFBJ 1Q16B 1X4BA 5CQGA 2IVFB 1BC6A 2J9DA 4B3SF 2PFFB 3PIPQ 3HHLD 3CCQS 2XEXA 3U1LA 3CCLS 4OIXA 1IBKJ 4GVBB 3IRXB 3Q22A 2CRLA 3W3SA 1AXQA 4WYWA 3CJSA 3CDAA 1VYAA 1SV5B 3GIKA 2EC2A 3QFWA 2R7WA 1QAXA 3PX0A 1LEOA 1PBAA 2DRAA 2GIQA 4DLGA 1SJ1A 2VOPA 1S1VA 2QYCA 5KFPA 2C22A 3EZOA 4EYHB 2OIHA 3CJ0A 3BO2A 1RHQB 4EK2A 1JLAA 1Z2LA 4YR3A 1WHYA 1DQ8A 2DGOA 3V2UC 3POTB 3V6JA 2CVEA 3E3XA 1NB7A 5CA5A 3LANA 5L1JA 1OYDA 1D3WA 2VV5A 2DGTA 3CVKA 4DLEA 4X4RA 2GQQA 4HACB 4H4OB 4OQJA 1MU2A 3CDWA 5E41A 2AJQA 2ZVIA 5JVHQ 2PI4A 4NASA 1T0TV 2KO1A 2QMXA 1S10A 2HNYB 2ABYA 1HNIA 4AD6A 1TKZA 4DQSA 4JP8A 2DKOB 2M70A 4KKOB 4LBHA 3T9NA 3QIDA 5GADI 3OVAA 2E1RA 2V69A 4F2RA 2HS4A 4J9RA 2MSTA 3UN5A 2GZOA 1NPPA 2ZBIA 3NY0A 2XC9A 3TAPA 1UPMB 4YOEA 4PEOA 4QWBA 2BMBA 4ILLA 1HI1A 1RU2A 4JI4J 4KO0B 4MK8A 2R2RA 1DAXA 3RB0A 3SSSA 2B4UA 5HL7Q 1KRPA 2OAUA 1NK6A 2VG5B 4NZ7A 5GMKa 2EKNA 2B3TB 1S6UA 3G8QA 4HT7A 4FBTA 3JAMU 2VQFF 5KTQA 1PO6A 1KHVA 4ZPVR 4ALZA 4EYIB 1N4LA 1VK8A 1M1HA 1Y3KA 2D9OA 4NLXA 1MG7A 3QGHA 3IC1A 5ETVA 3PYDA 4X66F 3UCUP 3BBCA 3JTOA 1WUUA 3MM5A 1LV5A 3P45B 2FC9A 3M8SA 4DUZJ 3L3CA 3TANA 5HI7A 3WIVA 4DX8H 2PEBA 3QYYA 3DHXA 3D6TB 1QM9A 2NPIA 4KYZA 4Y2MA 5T41A 1HR0F 1FF2A 1LWFA 1J5EF 4V19J 4AFFA 1KLMB 4I6WA 4A8YA 4J9SA 1M5VC 5CYQB 4ECVA 4ILMA 4KH0B 3Q8SB 2VBWA 4PZVA 5E5NA 4KHPF 1N6QA 2QL7B 4K4YA 5HROB 2F7VA 2LU1A 3MURP 1SKSA 2V94A 1VQ7S 3GG0A 3W9JA 4NL5A 4DXLA 1YJNS 2BZ2A 2FDNA 2Z57B 3R8YA 2VIHA 3ZZPA 1RT5A 4I2PB 1OO0B 4K7QA 4ZVTB 4IR9A 1SIWB 4LQ3A 2G0IA 4PG4A 4WXWA 3X3UA 2ADBA 1R43A 2AJ2A 3N6MA 3CEDA 3GQCA 3HHNB 1HD1A 2NS1B 3SCLE 5K20B 3OL9A 3PYFA 1ULRA 1URNA 3G9CA 1U1LA 4PABA 2MLYA 2HHUA 3H0PA 4JI8F 2ASYA 1RU1A 2QE5A 3KFWX 4ES3A 2F40A 2AEJA 2E1AA 1IKXB 3MOJB 3QRQA 2U1AA 2YNFA 1RT4A 3LWLA 3VV2B 2B56A 3JTNA 4USUA 1X5OA 4F8RA 5A8RB 2GA7A 2IJFA 4DSFA 5KFXA 2D7SA 1YZ7A 1EKRA 2E5LF 4DPTA 1YX2A 4Q8EA 1X60A 1OYEA 1NSPA 2IC3B 1OS5A 2VDHA 3CO9A 1H74A 3VWSA 4R5PA 2C3MA 4C0HA 4QR2A 4NPOA 4F0HA 2V67A 2VQEJ 2X3DA 3UR0A 2E9ZA 2GV1A 2AF6A 1FA0A 1A6LA 3W60A 1N36F 5B08A 2JEFA 2JVRA 1FVQA 3PV8A 3FDSA 1VQMS 2HVEA 3J81Y 3N4WA 4KBIA 1HNXF 4ELUA 1X5TA 2OD6A 1IJFB 2KDOA 4U7UK 4EZ6A 4HDHA 1U1KA 4IH6A 5E3AA 1VBYA 4ZK7M 1RWNB 1UFLA 1FTCA 1YGYA 4WZQA 4GVLA 5DJBA 4JYAF 2EFNA 2AJ0A 3J80Y 4RU9A 5KT6A 3U27A 2Q6CA 3LGNA 1RGVA 2G0JA 1EAYC 3GR1A 3HVTA 4IYQA 4Q2LA 1Q7LB 3R5BA 4OHWA 3J81U 2R7XA 4M5MA 1HQUA 1VMBA 2GGPA 3OLBA 3SDEA 3K7RA 2HNDB 1RAEB 1ZYQA 4ZVFA 3SV3A 5E2QA 4ECYA 2CG4A 2HGNA 1FDAA 1TV6A 3MCOA 3W2VA 3UVJB 1XMOF 2IRYA 1RT2A 5IOLA 5GMEA 3J7ZT 3KK2A 1R31A 3OFFA 3GMGA 1IKVA 4K2JA 4WXOA 3VZIA 3PX4A 1W2BR 1Y11A 2WVFA 2X51A 1KLMA 1TFWA 3R6GB 4LSNA 2KG0A 4ANCA 1U45A 2VC1A 4LF2A 1KKHA 4LT6A 1JLEB 1ZAWA 4DR6F 5H9FK 3AY0A 4M8LA 1MWYA 3KDNA 4KKOA 2R7RA 1JLGA 2UV8A 4GKJF 4ZJQA 4ECQA 3VTIA 2QO3A 5ETNA 3CD6S 1KHWA 1TAQA 2CQDA 3S1TA 4F04B 4OX9F 3LW5C 4C9DA 4MKAA 4CNZA 4ZVGA 3S6EA 4JI5J 2B8QA 1UVKA 2C2KB 4N41A 5KFBA 4YN3B 3Q2TC 4E98A 4UF4A 1VRUB 3RB3A 3KJFB 3C15A 3R3TA 3EDQB 1SBRA 3CJQA 2ZZMA 2OP5A 4QIWD 2EI5A 5A6PA 3G8SA 1BQNB 1BD6A 1WOPA 2V50A 1UFKA 5A0YB 4LRBA 2EK6A 3M8QB 2BRLA 3TZZA 5KFCA 5E3QA 4DSEA 3M6VA 2RNEA 1P8GA 1NDKA 4HVZA 1BQXA 1FK9B 1U8SA 1PG5B 5A8WB 2HNYA 1RLDA 1MN7A 2AMCB 5KFEA 1QAYA 1GFWB 3IXQA 5CYJA 3AH6A 3I0SA 5LXRA 1MWZA 3CJ4A 1WJ9A 3FFIA 2XNQA 1UVNA 3HDSA 3HD2A 4CLTA 2GO8A 4MFBB 4K4VA 4KSEB 2C2NA 4C8OA 2DH7A 4I56A 2ZZTA 2GJFA 1WORA 4CDIA 3K5PA 1I1GA 4C8LA 3LGHA 1L3VA 2AEMA 4Q0BA 1IKWB 3RRHA 3C16B 1K8AT 3MM9B 5RUBA 2M9KA 1SJRA 3OXGA 3SCJE 1RWUA 4F3MA 4DR4F 1GTHA 2IAJA 1N33F 2FVRA 2RQMA 2EWHA 2UUBJ 1KVKA 3WHIA 1O0PA 3M32A 2MTLA 4ANDA 5A8KA 1S0MA 5LOQA 4OI6A 4F4KA 2QYGA 2VJUA 4PXEA 4I67A 3WX4A 2YY3A 4ZP7A 3QBCA 4LFAJ 4Q2MA 4NYZA 1T02A 5CZXA 3RAMA 3I32A 3W1YC 5HN0A 2W4DA 3PHTA 4F02A 1KTQA 2Z30B 5I4MA 4O3RA 4TYAA 4ZP6A 1PAEX 1S9EA 2CZ9A 3KLFA 4OHYA 1R0BG 2CFXA 2W2QP 3OUYB 2HNDA 2MZQA 1QAJA 1N0UA 2OPSA 4LF7J 3P96A 2AGOA 3JSMA 5K14B 4OJGA 3HMJG 1RWPB 2KXFA 1VR6A 3HVTB 3PYGA 1K0TA 4CIOA 2JRSA 2QG9B 3H4DA 1FRMA 1TKTB 3EVOA 1HWJA 5KFLA 5HBMB 5ETKA 5K8PA 1JLCB 2C2MB 3MPUB 1FT8A 3MR6A 2JEGA 4LIRA 1HPZB 2BM0A 2IIHA 1YIJS 1ZA1B 1OMSA 3HHLA 5ETQA 4DL6A 3D67A 4P9SA 4NXMF 3NBPA 4A46A 3AA9A 2FZKB 1Q4RA 3MZIA 4O4GB 3A13A 3MEKA 4AXJA 4ID8A 2PMZD 2ERRA 3MEDA 2BJ8A 3SQGA 1XK8A 1M5SA 3A3NB 3VGSA 1WC4A 3QGIA 1O5JA 1L3TA 4FZVA 1JJ4A 3R5DA 2DNGA 3K0JA 1QJHA 3LP1B 4CO4A 2UVUA 1RI7A 2HWIA 4EFAC 2ZH3A 2CQHA 2G1DA 3NWGA 1Q82T 1S1UA 3QRPA 4U96A 1OSCA 4CM2A 1RQ0A 2NSCA 3NGDA 3LP2B 4J9LA 2M7SA 2AV5A 2OH2A 2QEXS 2BE7D 3AT1B 3TJAA 1F5CA 2YQ0A 1SKRA 2B43A 4B02A 2MB0B 3MTJA 1YRUA 2LECA 5HP1B 1N32J 1EQ0A 1IR0A 3NKYA 5ETPA 4LSLA 3RUBL 3H5SA 4RL1A 5T7LB 2NXEA 5KG4A 3HT3A 2PA3A 4F4XA 4I6AA 1VQ9S 1U8WA 3CCES 2DNOA 4EWTA 2CPIA 2YH1A 1ZH5A 1UJ6A 3PR4A 1D9DA 3I6PA 1F2HA 2ZBPA 2FGCA 2XM3A 2ASLA 3Q24A 2LYVA 4ZLLA 4IRCA 2BABA 1X9MA 2FYXA 1U2CA 4X62J 2HBRB 5M2UA 4ZVSB 3GYNA 3MR3A 2CAJA 4U7UD 4KRWA 3PG9A 1HBNB 2YQ3A 2RAQA 3V6KA 3D0GE 3L95X 3NBPB 4NWBA 4DFPA 1FCAA 2LU2A 1Q8LA 4NMLA 4KGZB 1HFEL 4X4QA 3T3FA 2EBEA 3PEHA 3BO4A 2VKRA 2K7JA 3DKDA 4LMZA 1HARA 1UETA 3GFHA 4DCOB 2HW3A 1KDNA 3K58A 1WNEA 2BX6A 5HAOA 2BJ3A 5IC4B 1Y00A 2E5IA 3FCHA 1QSSA 2HVHA 4OI3A 3M2RA 4DG1A 4WU2A 5HVFA 3KNGA 2WAQD 2OPRA 1UPPA 1NDLA 4EUVA 2KYZA 2PI5A 3O3LA 3QRRA 1KNZA 4N47A 3HZGA 3TOQA 4B9VA 2PGCA 3MM7A 5KFKA 1SQGA 3I9ZA 1B7FA 1F5AA 2WHOA 2VONA 1R0AA 3MMCA 4NLYA 1YJUA 4H4MA 3BKFA 3MMBB 4HTIA 5I3PA 1IM6A 1TUVA 2AZ3A 3MM6B 3ZZOA 3M2UB 4ECXA 4EEYA 2V8DA 2MGZB 4CT8A 3MI7X 1BQMB 2YNHB 3GTYX 2F8MA 4NMXA 4OYIA 9RUBA 4ES2A 1DTTB 4RNFA 2OTLS 1Z1ZA 2XY6A 2V2VA 5JUMA 5AXMA 5JVGQ 2IAJB 4CQ1A 3TVKA 2HIQA 3M30B 5K8OA 2AX0A 1IN0A 4FXWA 4QWEA 1SPBP 3BM7A 5IQQA 5L9XA 1NXIA 2MKKA 3KK1B 2VA3A 2DNMA 2VFTA 1NK0A 4OX9J 2QL5B 2VUGA 3L4BC 4TQSA 4DSJA 3KUHA 3DLGB 4IO9Q 4X4SA 3KLHB 3BR9A 2ZWPA 4C7QA 4WFBQ 3SQGB 1ZM3A 4J9QA 3K5OA 2XGPA 4WP3A 2AYGA 4DDFA 2PMWA 1T7PA 5AJ3J 4LRFA 3CTRA 4J5OA 2MZ1A 4KAIA 5HMYA 4RUCA 3O6QA 2HKEA 4ZA1A 2K7KA 5HSPA 3I5BA 2CA9A 1T9YA 3NGTA 2ROPA 2VU5A 4ZCMA 2IBOA 4XO0A 4PUOA 3MM5B 1K73T 2GVZA 3QAEA 3UE2A 3T19A 3FRYA 1Q8KA 2J7UA 1WKKA 3GLJA 1TK5A 3RR8A 2FJEB 3QJJA 1LWXA 2GX8A 2GC8A 4LREA 4IG0A 4B17A 3CJ2A 4EO8A 1VS3A 2K1RA 2HHWA 4OZ0A 5HMZA 1NPKA 1T05B 1AUDA 3J7AN 2YQ1A 2NYIA 3MUMP 2CZ4A 2J7WA 2ZH6A 3NS7B 4J9NA 4ETZA 1H6KX 1UW4A 4NYOA 3DRSB 5LM7E 2HFOA 5EX0A 3PXGa 4NLPA 3TR5A 1N34J 4FF3A 4CO5A 3BS9A 2R8GA 4CO0A 2PFDA 1S9GB 2IM1A 3W62A 2FY8A 3G4SS 1U0HB 3BEGB 3ILLA 2YVSA 5KFSA 3OLAA 3TVZA 1G1XA 4GRSA 3VQSA 1B3TA 2DY1A 2OKQA 3CCZA 1RTIB 5AXLA 5D4OA 2VBYA 3NOGA 3W7BA 2YWEA 1FRKA 1RACB 2EFQA 3FSXA 4EU0A 3CXCR 2LA6A 4DV6F 4C8ZA 1ELOA 3DXBA 4A8FA 4YDDB 4C0BA 5BR8F 1CJKA 1I6JA 2HLTA 5KFQA 2RSQA 1TZ0A 2DITA 1XMBA 1NKCA 2VPXB 3QLHA 3AOCA 3ENWA 3HSDA 1WC6A 2V2KA 2ZKUA 2BUNA 3O2IA 4F0KA 1N5QA 2LVWA 3ELHA 2Y1JA 4QIGA 2ZE2B 1WKLA 3ENQA 3BGRB 5DO2A 4K4UA 4OZ1A 2HNZB 3T6JA 3OFGA 2DGUA 3UO0A 1BQMA 4DCJB 4DN9A 3OW2R 2Z2ZA 2HS0A 4O44B 3RGIA 2RDDA 5F8HA 5EHHA 2ZITA 3FZBA 3CULA 4UT4A 3I4PA 5DZ6A 4GKKF 2RDIA 1YJWS 5LSOA 4QWAA 1FWLA 1WHWA 4OX8A 2K1RB 4AL6A 1XMQF 1J2VA 1RABB 3N79A 2A6MA 3KHHA 4NE9C 2FJVA 1CLFA 3C14B 2LCWA 3VVUA 3W61A 5F9LA 2MQPA 3CCUS 1GMWD 1M5HA 1XR6A 3OJUA 5D4PA 3M9MB 4DV0J 2C2OB 4M5KA 3GFXA 2CDQA 2NUUG 3A4TA 3BGOP 3CJRA 2B6AB 3MEEA 4C8NA 4NX9A 1WSVA 2OPPB 2VPYB 1F5BA 1N88A 2QLBB 3GIRA 3C19A 1U1OA 1IQTA 3PTWA 2ACYA 2PIIA 4CLKA 2ZZNA 3EGNA 2EVZA 4JI0F 2UUCF 5K5MA 1F2GA 3G6VA 2CPYA 1OJ4A 1NUEA 1QE1B 3DM2A 1TKZB 3L9ZA 4FYVB 5ADZA 4DSKA 1RISA 4PYDA 4F2SA 1IKVB 1JKHA 3MUTP 2A6OA 2C2ZB 2G1HA 3VF0B 5JJBA 3ITHB 4CZCA 1GH8A 3IBCB 1RT7B 4K50A 2YKNA 5AE1A 2YKAA 5CYMB 5E3CA 4CWBA 3SZ2A 1UMJA 2HVZA 1KP6A 2F8HA 3NLCA 3KJQB 2LQ9A 2NXUA 4YB5A 3HCXA 4UOCA 5J2NB 3NAHA 1QTNB 3M1VA 1NAQA 4IG0B 4LF5F 2W24A 1RWWB 5B7WA 2PMHA 2VQFJ 4EBEA 4B9SA 3LAMA 2VDIA 4M5DB 4YP3A 4H4KA 4CI0B 5B09A 2XHWA 2EXUA 1PYOB 4P52A 3H90A 1RYSA 2V4JA 3BSOA 3FK4A 2AQ4A 4RUAA 2OMLA 3I96A 2D74B 1UKUA 3CJKA 4DV1J 5IT9Y 1SC1B 1GX5A 1MW7A 5HBMA 3TX8A 4S0MA 1EJ7L 1RTJB 4OZ5A 5EWGA 2DNPA 2IFXA 2HNZA 2KB2A 2VD3A 2RU3A 1IBMF 1S9FA 1LWFB 4LBIA 4KTQA 3KLEA 1S0NA 2UU9J 2APOA 2J8SA 1FNMA 1Y4ZB 2HQ3A 2ZC4A 5EWEA 3KLGA 5DLFA 1APSA 2AJ4A 5B0FA 1KOOA 5LMUF 1H38A 2DPJA 2XY7A 3N9UC 3PRBA 5IZHA 1FKOB 2DNZA 2HBQB 4EI2A 3GP9A 2CQCA 2CUYA 5KG0A 3H40A 1NKBA 2BOAA 2ZFHA 4RWXA 4DR5F 3QWUA 1AZSB 2J0SD 2DEIA 3FFIB 3UW1A 2VKZG 2JH3A 3FEYB 2V4QA 3ZZUA 4Y3CA 4EO6A 2MQOA 2GS8A 3CMQA 3MUVP 1UFWA 3CC2S 4BHQA 2R2TA 3BYPA 4NLGA 2WSCC 2IYIA 2IVMA 3BSAA 4IH5A 1KQFB 3N6LA 1CSJA 1HPZA 1NH8A 3C8YA 2L08A 3BKUA 3CO0P 5ETSA 2Z2MA 1B0PA 3HSGA 3W2WA 2JC1A 3DGVA 5ETTA 1R7IA 2CQ1A 1S0OA 3CMAS 3BBFA 4LIWA 5KT3A 3LP0A 5IM0A 1T8EA 1R3NA 4B3TF 4LBPA 4OX7A 1UWAA 2DRDA 4USMA 1H73A 2P6TA 2JNJA 2KJVA 1C0TB 1S6OA 2CADA 1FDDA 1DLOB 4XAKA 4YY3J 4FKXA 3DYAA 4P2MA 4YHHJ 3EXYA 3QGPA 4J7CA 2YNGB 3MR7A 1VQPS 1NDPA 2DNYA 2L3MA 2QIFA 2Z2YB 2W7OA 1YI2S 2O1PA 4B9MA 3TUZC 3QQCD 1VQOS 2V68A 1U24A 5KG1A 4RW6B 3UD3P 4ZIVA 2PEHA 2EKYA 1N8RT 1HI0P 5DQHA 2I38A 3KLEB 4UQGA 3RZAA 2MSSA 3PY8A 1WI6A 2F63A 4WPAA 2N82B 1JKHB 2HBZB 2QA1A 2V8VA 3OQ2A 4ZVHA 2CNKB 2PT0A 2P5VA 4LJMA 5KFOA 1LFWA 2OFHX 2IVYA 1XMOJ 3T1YF 1GK8A 1VC5A 1H7WA 4Y6IA 4ZP8A 1G6BA 4UOFA 4IR1A 1LFPA 3QT6A 7FD1A 1QSYA 3ZTOA 4NXNJ 5FDLB 2MZTA 4NCBA 4BC7A 1URRA 3V6DA 2JLFA 3SIPB 3FCVA 4CLPA 1R8CA 1WG4A 4M5DA 3VAHA 4RX6A 1T9WA 3GJSB 1IR2A 3Q83A 3RU0A 2CQ4A 3WX8A 1G3OA 5T7LA 1OQ6A 4KO0A 4C98A 2XQCA 2G13A 2W9CB 1TVRB 2CPHA 4I1TA 3M8RA 5J2NA 2E44A 2YNFB 3OR1B 4KPYA 3THTA 4DL3A 1KVIA 3OFHA 3M7VA 2IYGA 5HVHA 1VBKA 2XULA 2ROGA 3NGUA 2JLGA 2A1BA 2NZCA 3DMJA 2DR6A 1U25A 2KHDA 3MFHA 1AUSL 4NLDA 1RHUB 2F9JA 2ILZA 3SSRA 2MGZA 2V4JB 2DT9A 2NR0A 1RAJA
chains in the Genus database with same CATH topology
4KPCA 3FKBA 1HHQA 1EHWA 3FBCA 1B99A 1NDCA 1NSPA 1PAEX 2B8PA 3DDIA 1S5ZA 1HIYA 3ENAA 5CAAA 3R9LA 1WKJA 3Q8VA 2HVEA 2HVDA 3MPDA 3EVOA 3EE3A 3G2XA 3PJ9A 2DXDA 1VYAA 4S0MA 1LEOA 3VGUA 1XQIA 3FC9A 3B54A 2HURA 3NGTA 2VU5A 4EK2A 3VGTA 3EJMA 1WKKA 1B4SA 1LWXA 3VGSA 3GP9A 4UOHA 1MN9A 3Q89A 1NPKA 1NSKL 4DI6A 3BH6B 4F4AA 5IOLA 3EVWA 1BE4A 3GPAA 3NGSA 3EICA 1UCNA 2CWKA 4UOGA 4ANCA 4W98A 1BHNA 3ETMA 1F3FA 3BBFA 4CP5A 2AZ1A 2DXEA 1NLKL 5CABA 1U8WA 4O0NA 4DZ6A 4ANEA 2BEFA 4C6AA 4FKXA 5C7PA 3FCWA 3JS9A 1NDPA 1S59A 4FKYA 2B8QA 1HLWA 2DXFA 2ZUAA 3ZTRA 3BBCA 3FBEA 3EMTA 3VVTA 3ELHA 5BXIA 3Q8UA 1WKLA 2DY9A 3PRVA 1JXVA 3EM1A 4DUTA 1NB2A 3B6BA 3NGRA 3FBBA 3Q8YA 1XIQA 3Q86A 1ZS6A 1NDKA 3DKDA 1KDNA 4UOFA 1MN7A 2BX6A 4HR2A 3ZTOA 3VVUA 4ENOA 1BUXA 1NCLA 1NDLA 3FCVA 3ZTPA 2DYAA 3Q83A 3L7UA 3WX8A 3ZTSA 1W7WA 3BH7B 3FBFA 3ZTQA 2AZ3A 2NCKL 3NGUA 1NHKL 1PKUA 1NSQA 3VGVA 4F36A 1NUEA 1S57A 4WBFA 3EVMA 1F6TA 4ANDA 1K44A 3BBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPC A;  3FKB A;  1HHQ A;  1EHW A;  3FBC A;  1B99 A;  1NDC A;  1NSP A;  1PAE X;  2B8P A;  3DDI A;  1S5Z A;  1HIY A;  3ENA A;  5CAA A;  3R9L A;  1WKJ A;  3Q8V A;  2HVE A;  2HVD A;  3MPD A;  3EVO A;  3EE3 A;  3G2X A;  3PJ9 A;  2DXD A;  1VYA A;  4S0M A;  1LEO A;  3VGU A;  1XQI A;  3FC9 A;  3B54 A;  2HUR A;  3NGT A;  2VU5 A;  4EK2 A;  3VGT A;  3EJM A;  1WKK A;  1B4S A;  1LWX A;  3VGS A;  3GP9 A;  4UOH A;  1MN9 A;  3Q89 A;  1NPK A;  1NSK L;  4DI6 A;  3BH6 B;  4F4A A;  5IOL A;  3EVW A;  1BE4 A;  3GPA A;  3NGS A;  3EIC A;  1UCN A;  2CWK A;  4UOG A;  4ANC A;  4W98 A;  1BHN A;  3ETM A;  1F3F A;  3BBF A;  4CP5 A;  2AZ1 A;  2DXE A;  1NLK L;  5CAB A;  1U8W A;  4O0N A;  4DZ6 A;  4ANE A;  2BEF A;  4C6A A;  4FKX A;  5C7P A;  3FCW A;  3JS9 A;  1NDP A;  1S59 A;  4FKY A;  2B8Q A;  1HLW A;  2DXF A;  2ZUA A;  3ZTR A;  3BBC A;  3FBE A;  3EMT A;  3VVT A;  3ELH A;  5BXI A;  3Q8U A;  1WKL A;  2DY9 A;  3PRV A;  1JXV A;  3EM1 A;  4DUT A;  1NB2 A;  3B6B A;  3NGR A;  3FBB A;  3Q8Y A;  1XIQ A;  3Q86 A;  1ZS6 A;  1NDK A;  3DKD A;  1KDN A;  4UOF A;  1MN7 A;  2BX6 A;  4HR2 A;  3ZTO A;  3VVU A;  4ENO A;  1BUX A;  1NCL A;  1NDL A;  3FCV A;  3ZTP A;  2DYA A;  3Q83 A;  3L7U A;  3WX8 A;  3ZTS A;  1W7W A;  3BH7 B;  3FBF A;  3ZTQ A;  2AZ3 A;  2NCK L;  3NGU A;  1NHK L;  1PKU A;  1NSQ A;  3VGV A;  4F36 A;  1NUE A;  1S57 A;  4WBF A;  3EVM A;  1F6T A;  4AND A;  1K44 A;  3BBB A; 
#chains in the Genus database with same CATH topology
 3KUG A;  4NLO A;  3HSJ A;  3K89 A;  3B78 A;  1TKX B;  2DNK A;  3G71 S;  4LF6 J;  1UZD A;  1N36 J;  2ZE2 A;  4G3I A;  1NPR A;  2RDJ A;  1MWQ A;  2JDJ A;  3UN3 A;  1KVJ A;  1X4D A;  3M2R B;  1S0V A;  3SV4 A;  4B9U A;  1XTZ A;  5CAA A;  1SB6 A;  1FJE B;  2BJ7 A;  2XS5 A;  2DGS A;  4PPD A;  1FWK A;  5A6W A;  3FGV A;  2W4P A;  3FMB A;  2MPU A;  5J2Q B;  3HK2 A;  4DX5 A;  2ZH1 A;  2HWH A;  2GNK A;  2ALZ A;  5ITH A;  1VIO A;  1IUJ A;  2CYY A;  5F8I A;  1TL4 A;  4RW7 B;  2KFN A;  1RTH B;  2HRU A;  2WBM A;  3MHY A;  4MIW A;  4OJ1 A;  1IBC B;  2EFG A;  1FRL A;  4BWM A;  3TEG A;  4DPO A;  1U7L A;  4KT0 C;  4JI3 F;  3KXD A;  3P5B P;  3MEE B;  1SUQ B;  2ZH9 A;  3MMB A;  3AQP A;  1PSD A;  4MT1 A;  4O3Q A;  3ETO A;  1UA0 A;  2XS7 A;  1U1R A;  1Q5Y A;  3IRW P;  2UU9 F;  2Z8Q A;  4MKB A;  3IP0 A;  3DLK A;  4OYZ A;  4UTG A;  3DDN A;  5MLC V;  4DV2 J;  3QZ7 A;  1VHF A;  1WDT A;  2Q6B A;  1HBU B;  3PEJ A;  2J6U A;  2ZNY A;  3KNA A;  3C46 A;  1QD1 A;  1RXO B;  1N56 A;  3AXK A;  5C2C A;  1FFS B;  4DG1 B;  4DV1 F;  5E3R A;  4DFK A;  1NME B;  1B0T A;  1Y9O A;  1RT6 A;  2UUW A;  3BN4 A;  1HNZ J;  3BDE A;  1FK9 A;  2LQB A;  4U8V A;  4CNY A;  4Z37 A;  4OL8 A;  2DHH A;  3KLV A;  3EVW A;  1IKX A;  1KEK A;  5DGA A;  2GMJ A;  1I94 F;  2KVI A;  1XNR F;  2KL8 A;  2XZT B;  3MD1 A;  4DFM A;  3OPK A;  3QJP A;  1N48 A;  1E6Y B;  4ITS A;  3G87 A;  2R8J A;  1IWG A;  1P6T A;  5EGY A;  4N56 A;  3KLI B;  4W92 B;  2HK2 A;  1ZBT A;  5CAB A;  3F44 A;  4I2Q A;  4O23 A;  3CCJ S;  3D1O A;  3OT9 A;  2ADC A;  5IC6 B;  2AYB A;  3JS9 A;  1ITP A;  2DIU A;  3J80 U;  2CIM A;  2FJA B;  3HLU A;  4PXB A;  4C8K A;  3H2U B;  4ECU A;  1VLY A;  3DOK A;  1UJ4 A;  3PJW A;  1Q1K A;  1P9Q C;  4OYW A;  4OHZ A;  3UNY A;  2IRX A;  4ECZ A;  1WI8 A;  3K8W A;  3BYR A;  1B0V A;  3M30 A;  4GC6 A;  3EM1 A;  3IWL A;  2XGQ A;  2R4F A;  4TNO A;  1Y5I B;  3D0H E;  5L1L A;  4E2F B;  3CSK A;  3MPY A;  1KQG B;  4K59 A;  4KV8 B;  2Y1R I;  2BA9 A;  3BF4 A;  3FSY A;  3Q8Y A;  1H2V Z;  4JB8 B;  3KK3 A;  1R8B A;  3M4X A;  4OYA A;  2R9L A;  2UXB J;  2FLP A;  1TV6 B;  1NHV A;  2WVE A;  4L75 A;  3W2V B;  4PG8 A;  2YKM B;  5GAG I;  4UZB A;  3NNA A;  4HR2 A;  2XWX A;  2F1F A;  1N32 F;  1C1C B;  5GMD A;  2Y0B B;  3Q2S C;  4GO5 X;  1S4F A;  3CCW A;  1F9H A;  2RVJ A;  1IWA A;  5DS7 A;  5DGB A;  3FSI A;  1YHQ S;  3H5X A;  4K4Z A;  2BKP A;  2HHT A;  2Y9H A;  3L7U A;  4KQZ A;  4JBC A;  5G0R B;  3MD3 A;  2AKW B;  4FF2 A;  4CO3 A;  2G2Z A;  3ZTS A;  4USV A;  3E2E A;  3BN7 A;  5KT5 A;  1JLA B;  2I0X A;  1TEL A;  3BH7 B;  3QWP A;  4DV0 F;  3T9Z A;  2CNN B;  5J2M A;  1X9S A;  1NSQ A;  1NHK L;  1PKU A;  2VFV A;  1FD8 A;  3AHP A;  4DQR A;  1S6P B;  2FB0 A;  3L7P A;  5KG5 A;  1TFY A;  4D3G A;  4F50 A;  4HHU A;  3PZP A;  2MLZ A;  4NLQ A;  4CLF A;  1M1K T;  4KPC A;  1TKT A;  2LXF A;  5AT1 B;  3PO5 A;  4H4O A;  1HHQ A;  1TUG B;  4RW6 A;  1T95 A;  1EHW A;  2A0F B;  1ZOT A;  3T1A A;  3GWC A;  3TP2 A;  4C3L A;  5KT4 A;  2KFZ A;  2ROE A;  1NDC A;  1S79 A;  4K4X A;  2J5A A;  3CCT A;  5CXT A;  3O1L A;  5LL6 d;  1FJG J;  1Z2Z A;  4K8R A;  1HIY A;  4KHR A;  1MLA A;  3GFZ A;  2XYG B;  2KHC A;  4PWW A;  5CZV A;  4WKY A;  1TK0 A;  1JK9 B;  1VOM A;  2EFO A;  3A1Y G;  2IDE A;  2WTF A;  5I42 A;  3D6M B;  2H3E B;  3H20 A;  1TK8 A;  1KTV A;  2O66 A;  3NCR A;  1TTH B;  2WOM B;  1SXL A;  1RTH A;  3M8Q A;  2DGW A;  2DXD A;  3P8B B;  3FQK A;  1KC8 T;  2EC0 A;  2FJB B;  2X1B A;  5LMN J;  1FHT A;  3BGR A;  3OVS A;  2KT3 A;  5IWA F;  2FUG 9;  4HL9 A;  2CJQ A;  4PXC A;  3LA0 A;  3FNN A;  4PYA A;  1TVR A;  5C24 A;  3ZZT A;  4CH0 S;  5DDP C;  1CVJ A;  4ECT A;  3VGT A;  3RYL A;  3MAH A;  1VGY A;  3OD2 A;  4DR5 J;  5HAT A;  4DV3 J;  4MTP A;  5DG9 A;  5G0R A;  1RTZ A;  5U47 A;  2A3J A;  1N34 F;  4I6Y A;  3DOL A;  2BQU A;  3CIM A;  4M5N A;  2PO4 A;  4LF8 F;  4TVA B;  3P4U B;  3OR2 B;  3MR2 A;  4ZMM A;  2J7K A;  4CO1 A;  2MQN A;  4MAK A;  5BYS A;  3NG8 A;  3P3D A;  2VHG A;  3C14 A;  1I3O B;  3OTD A;  4FVC A;  2BRK A;  4YEA A;  2MY7 A;  2Y0S D;  4P2S A;  1YIT S;  2QRR A;  2IC3 A;  1KOH A;  4F4A A;  4C3M A;  3M9O B;  2P9E A;  1RT4 B;  3CD0 A;  4OI2 A;  1S4E A;  1VC0 A;  1UCN A;  4UOG A;  4X4N A;  5DZ7 A;  2AYM A;  5DQI A;  2COL A;  2YKQ A;  3NRB A;  4YY3 F;  2MZR A;  4YHH F;  2A2C A;  1H0H B;  4F26 A;  5KG6 A;  2XYH B;  3IG1 B;  1CBK A;  1N5S A;  1R0A B;  4NYP A;  4ZVO B;  2HYI B;  1CQN A;  1LW2 B;  1C0U A;  4OI1 A;  4OHX A;  4NRU A;  2OPS B;  1RAG B;  2XMA A;  2W8K A;  2J9D E;  5J2P B;  3PRD A;  5K14 A;  5HJX A;  1XNQ F;  4KB7 A;  2FZC B;  5F0W A;  2D9P A;  3QIP A;  2W2N P;  1HL6 A;  4FKY A;  4P73 A;  1P1L A;  4ZPT R;  5AJ3 F;  1J5O B;  4DSL A;  2VZ9 A;  4I2Q B;  2BV3 A;  2GW8 A;  3JTP A;  4LRA A;  4M5L A;  1FRJ A;  4RJV A;  4WP8 A;  4ES1 A;  3KKF A;  2FVP A;  5CCM A;  1UAW A;  1S6Q A;  1NJY A;  5EX3 A;  2YKN B;  3T5K A;  4DUT A;  4RBV A;  2W2M P;  1RLC L;  4P75 A;  1NB2 A;  3IA0 A;  3ISN D;  3S01 A;  3LOU A;  4CLU A;  1Y0H A;  4I0W A;  2BE2 B;  4N8O A;  3V5R A;  1T9V A;  1YWX A;  1VQ4 S;  4Z7C A;  1RAH B;  1VQ6 S;  2HFN A;  4C11 B;  1FJ7 A;  1F0X A;  3OVB A;  3HSZ A;  5E3P A;  1X5P A;  1Y3J A;  4JV0 A;  2Y8Y A;  9ATC B;  2ZH8 A;  3KOA A;  3TZW A;  1U2F A;  4G1Q B;  2BJ9 A;  2FY1 A;  1S49 A;  1BY9 A;  4MKY A;  1WAC A;  4X64 F;  4R5P B;  2AHO B;  5T14 A;  1IJE B;  3MM8 A;  5K8N A;  3TAQ A;  4PWD A;  5EDW A;  2BVZ A;  2V8P A;  8RUC A;  1JWW A;  3NS5 A;  2V34 A;  1S1X A;  3D3C J;  3J7A 1;  1QUP A;  3VAI A;  1ROF A;  1SKU B;  3KUE A;  1GX6 A;  5J2M B;  3G86 A;  2E7W A;  2QLW A;  4A4J A;  3QZ8 A;  1GT8 A;  2XG8 A;  4KHM A;  3DOM A;  3DRP B;  2OPQ A;  4M5H A;  1IKY B;  3GJR B;  5ETO A;  3UWT A;  1UVI A;  1BWE A;  2LEB A;  2V0N A;  2EG1 A;  5F41 A;  3HJV A;  3OTO F;  1UL3 A;  4PQA A;  2DVI A;  5HP1 A;  1JNZ B;  1TL3 B;  4WBF A;  2I8E A;  4ZS6 A;  1KLN A;  3CIZ A;  3IAS 9;  3W9H A;  2KI2 A;  5I42 B;  1JLQ B;  3BBB A;  1VI7 A;  3KWM A;  2I6W A;  4AXI A;  2P9G A;  3W63 A;  5L39 A;  2CJ9 A;  3IR6 B;  2YBV A;  4TXS A;  4QJV A;  4YB7 A;  1KWM A;  1W26 A;  4WTO B;  1FDB A;  3EPI A;  5DM7 Q;  1WG1 A;  3JXO A;  3TA2 A;  1Q79 A;  4R8U B;  3P49 B;  5ETR A;  4HH1 A;  4AQY F;  3ZXW A;  3T5J A;  3TZY A;  4ED3 A;  2PC6 A;  2CJA A;  1SJ4 P;  1CS4 A;  3OR2 A;  4KY3 A;  3UD5 A;  3FMW A;  4QIF A;  5DDQ C;  3MDF A;  4LQ9 A;  3TUJ C;  4MK9 A;  4WE1 A;  1CQM A;  3LAK A;  5KT7 A;  2NQP A;  4ELT A;  1CPZ A;  3EGW B;  2ACM A;  1NZA A;  2ZBR A;  2BQR A;  1N5V A;  2E5G A;  2RKI B;  2FHM A;  1HQE A;  2K06 A;  4DL4 A;  3BO3 A;  4Q45 A;  2BOP A;  3D5M A;  2NSB A;  3HT0 A;  2YNI A;  3PO4 A;  2DIS A;  4N76 A;  1R6V A;  1X4H A;  1IKW A;  2C3P A;  1SH0 A;  1N52 B;  3FUY A;  2DNQ A;  5IS2 A;  2Y1L B;  1ZZF A;  2OTJ S;  2IJR A;  3H2L A;  3OJS A;  3DRS A;  2RUG A;  3FQL A;  2W01 A;  3HFZ B;  2W9B B;  2WK4 A;  3CDB A;  3L7O A;  4DPW A;  1UEU A;  2XI3 A;  3JYT B;  3OBI A;  3SDE B;  1RWO B;  1D09 B;  4U9R A;  3D1Q A;  2AGP A;  2CQI A;  3IBW A;  3HVA A;  1DZ5 A;  3TRG A;  2HFV A;  1GMV A;  4DV4 J;  1EKS A;  4C48 A;  5KG2 A;  3V6D B;  4I4B A;  3RBE A;  4OZL A;  3R6L B;  4FDF A;  3JSB A;  4FP9 A;  1KFD A;  4ZDN A;  3K59 A;  1T03 B;  5A8K B;  1AYE A;  1K1S A;  1RWM B;  2L9D A;  5D6G A;  2C42 A;  1EB0 A;  2B4O A;  2H54 B;  2E1P A;  4OZJ A;  4TYB A;  4UW2 A;  5HK4 A;  1K9M T;  2HQG A;  3EUN A;  1Q0N A;  3ZZY A;  2FJD B;  5F0U A;  3THV A;  2RIJ A;  4R25 A;  4K2X A;  1VRT B;  1FFW B;  2M52 A;  4FF1 A;  3J7Y I;  2FVS A;  1AT1 B;  2QGF B;  2MMY A;  4LFA F;  5KFD A;  2BAN A;  4ZVU B;  2MKY A;  4DZ6 A;  2HVI A;  2KM8 C;  2DIV A;  1M90 T;  2V2Z A;  3RTV A;  4M5G A;  1Q95 G;  1J5E J;  1UVJ A;  3QIP B;  4LSZ B;  2QA2 A;  1P1T A;  4OZ2 A;  3BRE A;  4X65 J;  4YR2 A;  1U1Q A;  2MY8 A;  3A8J A;  5GAE I;  3MFI A;  2RML A;  3DLB A;  3IN5 A;  1R8H A;  2QJ3 A;  2W1B A;  2H5E A;  2GFF A;  1HMV A;  4WU3 A;  5IFM A;  5L46 A;  3I4H X;  5BXI A;  2G0C A;  3Q8R B;  4NZ0 A;  1SV5 A;  4WFY A;  1U26 A;  4V19 X;  4NA1 A;  5B0B A;  2HHH F;  1VQS A;  1T11 A;  2R7O A;  4ZPB A;  3H7H B;  5EUH A;  1OY8 A;  1KD1 T;  1RCX B;  1V9O A;  3EGV A;  2BJ1 A;  2VBZ A;  2NXN A;  1HNW J;  3K8V A;  2CPF A;  2OUG A;  5HLF A;  2BM1 A;  3FBB A;  1FE4 A;  1H98 A;  2V5H G;  3FEX B;  4O0I A;  2OPQ B;  2ZEJ A;  2QC3 A;  4HDG A;  1WF1 A;  4I7F B;  5DDR C;  1PJ7 A;  3I0R B;  1SL2 A;  1DFD A;  3LP2 A;  4R0J A;  1WTF A;  2JX2 A;  3DXS X;  4XDD A;  2HMI B;  4GC7 A;  1REV A;  2VG6 A;  4DPY A;  3RB6 A;  4E0D A;  2XI2 A;  1O51 A;  1U02 A;  1JLB B;  3CGI A;  4DF4 A;  3VQT A;  3PYE A;  1N33 J;  1WG5 A;  4G1Q A;  1NK5 A;  5CYM A;  1FKO A;  2V6A A;  4RNO A;  5LMU J;  2B51 A;  5LXY A;  3Q8P B;  1WSR A;  2CQG A;  3PM9 A;  5IQ6 A;  2JVO A;  4ETX A;  4IFY B;  1CG2 A;  1RB0 A;  1SUQ A;  1I94 J;  3KLG B;  1TQL A;  5CYQ A;  4WFA Q;  4A8Q A;  2IBK A;  4P10 A;  2EW9 A;  1N6Q B;  4JI6 J;  2FHK A;  1EP4 B;  3KJV B;  1HNX J;  2Z56 B;  2LXU A;  3M6X A;  4JI5 F;  1JLQ A;  1OQ3 A;  1RAA B;  2FLL A;  2R2S A;  1V3Z A;  4X4V A;  4ID5 B;  4FS2 A;  4MYU A;  2W4C A;  1NM2 A;  3JQJ A;  4CCH A;  4NCA A;  1HBN A;  4BWJ A;  3VR1 A;  1S1W A;  1WF2 A;  2VBX A;  3HD1 A;  4MKV A;  1HWK A;  1O6X A;  2C1E B;  3ET6 B;  4IQM A;  1S5Z A;  4F4Z A;  2MQQ A;  4HYK A;  4O4R A;  4W4M A;  1I5O B;  1DY3 A;  2KZZ A;  3KJN B;  5DRK A;  1QVG R;  3C2P A;  2CPD A;  2KT2 A;  4OHV A;  4OYX A;  3HHD A;  3H5U A;  3OXL A;  2J9C A;  1HBM B;  1RAO A;  5CH7 B;  2ZHB A;  1VIS A;  1HWU A;  1ZM2 A;  3U7J A;  5DDO C;  5B0G A;  3MCM A;  5KFI A;  4I69 A;  2D69 A;  4RNH A;  3TAM B;  2IDL A;  4ZLN A;  2M88 A;  2YWW A;  2J9E A;  2VF3 A;  4DF8 A;  2B4P A;  2D3O 1;  4ED4 A;  4B9N A;  1RT3 A;  4RBT A;  4IOC Q;  5D78 A;  3CW2 C;  1FNX H;  3VGU A;  4JV2 A;  2C3U A;  2DR5 A;  3W64 A;  3M8Y A;  4GKJ J;  1PC4 A;  2XLJ A;  3N5F A;  2A2D A;  2KKH A;  2Q79 A;  3RW7 A;  4P7V A;  1RWK B;  2XMT A;  3V6H A;  4C2M A;  2P2C B;  2DB1 A;  2ZDO A;  5HO4 A;  1JJH A;  1FER A;  2R7S A;  2VC0 A;  2AGQ A;  3RRK A;  2QLX A;  1WC5 A;  1XBW A;  5FLX U;  4A8O A;  2FQQ B;  3SCI E;  5FDL A;  1DTQ A;  2LEP A;  4WIQ A;  2N7C A;  1NRK A;  5D0R A;  4BC9 A;  2YH0 A;  2QX0 A;  4DV3 F;  1ICE B;  5H9E K;  2HS3 A;  1Q53 A;  2HBY B;  5ETL A;  1FXD A;  1RZM A;  4AUK A;  3V81 B;  1WTB A;  4QYZ J;  6AT1 B;  1JLE A;  2AJ1 A;  5KFN A;  1NJI T;  2HWT A;  3R1L A;  3BB5 A;  2CWK A;  2C3O A;  3IMQ J;  3FJ2 A;  2VQE F;  2MQ8 A;  3M2V A;  2WZ1 A;  1NK8 A;  4YB1 P;  2LLZ A;  2N4D A;  3N01 A;  2K8G A;  3W65 A;  4CYU A;  1F3V A;  2U2F A;  2EEY A;  2W2P P;  2VPW B;  4OJH A;  2L9W A;  3UNG C;  4U6P A;  1NK4 A;  4CM0 A;  4CP5 A;  4JI1 F;  4ATN A;  2J8A A;  3CC7 S;  1JQG A;  1JXE A;  2AZ1 A;  4KC5 A;  4NZ6 A;  2J0Q D;  4O0N A;  1JLB A;  3ZO7 A;  3OV7 A;  2OPR B;  2AEF A;  4ZN1 A;  4DZD A;  1HQU B;  3FCW A;  1Y10 A;  3MAQ A;  3GB0 A;  2RHQ B;  1TL7 A;  1YRX A;  2B4V A;  1FES A;  3M6U A;  3GON A;  4HH0 A;  2ZUA A;  4QR0 A;  1DQ9 A;  4BS2 A;  1XEZ A;  2GVD A;  3H4B A;  4B3T J;  3IAM 9;  3JAM Y;  2R7Q A;  1GNK A;  1VCT A;  3W2W B;  4DL7 A;  2B9X A;  2GJI A;  5BYR A;  5D0H A;  2VFU A;  2FTR A;  1JLG B;  3PIO Q;  3O44 A;  2D3Z A;  3B4D A;  3B6B A;  2W25 A;  4AQY J;  1RYR A;  3G96 A;  1E6V B;  5E7O B;  2DR9 A;  1RAD B;  3CJ3 A;  1SL1 A;  1XIQ A;  4FPI A;  1IVZ A;  4ED2 A;  4MH8 A;  4QIV A;  1NJZ A;  2LXI A;  2QN6 B;  5KG3 A;  4M95 A;  2HGL A;  2N7Y A;  3UDV A;  1JMT A;  1RK8 A;  5SZT A;  1M5P C;  3D54 A;  4Q0B B;  3C6T A;  5ETM A;  2LDI A;  1HW9 A;  3DHW C;  1RHR B;  2AIR B;  1SC3 B;  5B0C A;  2HMI A;  1CJV B;  3M8W A;  1FRI A;  1JLF A;  1NO8 A;  4WK1 A;  5D77 A;  1VRT A;  3TYT A;  1SJQ A;  2ZWO A;  3GYG A;  4EBD A;  1JX4 A;  3WBZ A;  4O4G A;  3ZNU A;  2OD4 A;  4QBU A;  2VOO A;  1RSC A;  2LMI A;  3BR8 A;  2HHS A;  4DCP B;  5GAG U;  1DJ0 A;  1G4C A;  3CD5 A;  4IOB A;  2ZUG A;  5DG7 A;  3GIM A;  3FBF A;  3ZTQ A;  4X66 J;  5D3G A;  1RKJ A;  4G65 A;  2XCA A;  2JFK A;  5C42 A;  3OSP A;  1ZM4 A;  1BGX T;  1FKP A;  4C4W A;  1EX8 A;  2B5J B;  4QW9 A;  1KBR A;  2DRB A;  2F5G A;  1MMN A;  4UUW A;  2BDP A;  1QAI A;  1KN6 A;  1N5Y A;  3M05 A;  1U6Z A;  1WHX A;  4HI1 A;  2H5I B;  3T6B A;  3MM8 B;  3W66 A;  2DGQ A;  1S9E B;  3GV8 B;  4QYZ K;  2I5J B;  4A47 A;  4ELV A;  2RF2 A;  1S7H A;  2F4F A;  4IQX A;  2HZA A;  4C8Y A;  1YTY A;  1U0S A;  1S76 D;  2DHA A;  4UUX A;  3Q8V A;  4F3Q A;  1ZM9 A;  4PKD B;  2RQC A;  3PW2 A;  1UA1 A;  3ISN C;  1D9A A;  4RW8 B;  1CJT A;  2CJY B;  2M8D B;  3CME S;  1ZAX A;  2MKH A;  4DR6 J;  1H2U X;  3HXM A;  4Z2X A;  4OYM A;  5IXU A;  3ZZR A;  3BZQ A;  3PJ9 A;  1XN9 A;  1RT3 B;  3MMJ A;  4KJI A;  4JV5 F;  4DPX A;  2ZH4 A;  1S9G A;  2ZOG A;  2CPJ A;  3TO8 A;  1XR7 A;  2WB1 D;  3BJY A;  1HHT P;  4WP9 A;  2DGV A;  2OPP A;  4PWU A;  2E7X A;  4GVB A;  1F60 B;  3DNC A;  3QMQ A;  2NPF A;  2UUC J;  1Y5L B;  3F41 A;  3N0V A;  3OR1 A;  2UXD J;  3KMS A;  2L48 A;  2DHX A;  3JSM B;  4Y2I A;  2RRB A;  4XTT A;  4TY8 B;  4YME A;  1JLF B;  3PJX A;  4R8U A;  3NCP A;  3IM8 A;  2DPI A;  3KMQ A;  3QT5 A;  2V4R A;  3NNH A;  2V2Q A;  3DRR B;  5DM6 Q;  2HAI A;  3G6Y A;  4DI6 A;  3BH6 B;  1T94 A;  4JI2 F;  2WON B;  4DJB A;  5A2Q U;  2DR7 A;  2EFV A;  4X4U A;  2MJU A;  3CT9 A;  4USH A;  2LFV A;  4DV2 F;  1UZH A;  2IA0 A;  4DFJ A;  2C3Y A;  2OSR A;  2OJ3 A;  1E6V A;  2NLW A;  3TX0 A;  2JEJ A;  1IKY A;  1HQE B;  3CNQ P;  2F9D A;  4O3N A;  4DU7 A;  1RT1 B;  1HNI B;  1X4F A;  1X0P A;  4ZVE A;  5L8R C;  2DEJ A;  3LP1 A;  1PJ6 A;  3BPD A;  1UW9 A;  4C0O C;  4B3R J;  2VG7 A;  2RF2 B;  4URG A;  1XJW B;  2HFZ A;  2ZBC A;  2K2P A;  5LMN F;  1XC9 A;  1YZ6 A;  4C6A A;  1MMD A;  1PIL A;  1YJT A;  2N4C A;  3PW7 A;  1YBU A;  1D0E A;  5IV3 A;  3MEG A;  2H5J B;  4A8S A;  4LF9 F;  2FGO A;  4PG7 A;  2HHV A;  3DRX A;  2DXF A;  4QWC A;  2FHJ A;  2I9S A;  3ZTR A;  4I68 A;  2GAG C;  1RA7 A;  7AT1 B;  2R42 A;  1DBD A;  1E6Y A;  4B3O A;  5D4L A;  5K8M A;  1U1P A;  1GXU A;  2HZC A;  2X1G A;  2CQB A;  1N0V C;  3MGJ A;  2E5H A;  1R0C B;  3DGP A;  3LQV A;  3QT8 A;  1TL5 A;  3NGR A;  5C42 B;  1S48 A;  1Q7Y T;  2OEK A;  2WOM A;  2GML A;  3SXL A;  1PYT A;  3R7S B;  4CLZ A;  5F3Z A;  4ED5 A;  1RHK B;  1RT6 B;  4DR3 F;  2LQJ A;  2H51 B;  3NAI A;  2X1A A;  2CJX B;  2QT7 A;  4M5I A;  1V5V A;  3MCN A;  1HBU A;  1PC5 A;  3DOK B;  8ATC B;  3MM7 B;  2IY5 B;  2G2O A;  4JYA J;  2RS8 A;  5AXK A;  1RT5 B;  2DBB A;  4ENO A;  2CVI A;  2OFG X;  3R27 A;  2BXJ A;  7FDR A;  3PW0 A;  2JSX A;  3OFE A;  1U6F A;  4F25 A;  3QSI A;  2IMW P;  2KN4 A;  4U8Y A;  3VAM A;  4ZHR A;  3FEZ A;  3LO3 A;  3K57 A;  2CQ2 A;  4NI2 A;  3CF5 Q;  1ZTW A;  2YKP A;  2FHJ D;  1V5I B;  3EZU A;  4O3O A;  3TJ9 A;  2O67 A;  4ZIW A;  2ZD1 B;  1VQL S;  5CCL A;  2ZH5 A;  2C28 A;  1QSL A;  2F8E X;  1FKP B;  1F6T A;  4ZJO A;  1IM4 A;  1RHM B;  2OI2 A;  4ICL B;  1IR1 A;  3A8E A;  2ZOM A;  2HAF A;  4MYT A;  2XHC A;  2GVD B;  2YPY A;  3FKB A;  5D3G B;  4OZ3 A;  1A7G E;  3I31 A;  3R5C A;  3KLH A;  4B9L A;  3FBC A;  3OSN A;  4LF7 F;  3EXC X;  4WWS A;  2FLO A;  1X5S A;  1YK9 A;  4BBY A;  2ZM6 J;  4OYP A;  1S77 D;  2GGP B;  3BKT A;  2DH9 A;  2F3J A;  4NCG B;  4PRF A;  3ENA A;  4AT1 B;  4BCA A;  3A3O B;  3LH2 S;  2B9Y A;  4IO1 A;  5E0O A;  1FX4 A;  2IPO B;  3IM9 A;  3GR0 A;  3OTB A;  3TVY A;  4U95 A;  3CPW R;  4JI8 J;  3G82 A;  4Z7Y A;  4DU8 A;  2YPZ A;  3ICL A;  3UDE A;  4TY8 A;  3LF0 A;  2HVD A;  1VDH A;  1QUV A;  1UEK A;  2IRU A;  3ISZ A;  1Q8B A;  3LP0 B;  4LR7 A;  5IM0 B;  4KV8 A;  1HWI A;  3D68 A;  4DS4 A;  3GCW P;  3MM6 A;  4TQR A;  1EZZ B;  1H7X A;  3IRX A;  3JQM A;  3QPI A;  4J90 A;  4RPF A;  2W8L A;  3CC4 S;  2R8K A;  4LF5 J;  1RP5 A;  2H9Z A;  1HNV B;  3GE9 A;  3DGP B;  1RHJ B;  4PUO B;  1XQI A;  2JLE A;  2FVC A;  4LFC F;  1WC0 A;  2GHV C;  1ZTT A;  2DR8 A;  2GHW A;  3J7Z 5;  4LF4 J;  4UST A;  3MOZ A;  4ERD A;  4ZCK A;  4DN0 A;  3MEG B;  1XNR J;  1X0F A;  2XS2 A;  3IFE A;  2CWX A;  3WC0 A;  2HQC A;  5KFU A;  3DLG A;  4E8U A;  3A12 A;  4NLV A;  2DCL A;  4HHH A;  3VAK A;  4ECS A;  5HQL A;  5DLG A;  1U48 A;  2QSF A;  1W2I A;  2DCU B;  3UPF A;  3LPY A;  1L3S A;  4KH1 B;  1S6P A;  2N3L A;  3PHE A;  4FPR A;  4L3N A;  3C66 A;  3W8G A;  2QFJ A;  2DD8 S;  3RRG A;  4OI0 A;  1FXL A;  1Q86 T;  3TWZ A;  1HI8 A;  5AXN A;  1NND A;  4DX6 A;  4RUB A;  1XNQ J;  2R8I A;  2B9W A;  3DU5 A;  1FI4 A;  1YBT A;  3M2V B;  5THW A;  2QTW A;  2RUS A;  1TL3 A;  2Z58 B;  5BYQ A;  4B3S J;  2BJE A;  4CRJ A;  1HBO A;  2DO0 A;  3B82 A;  4QPT A;  3ZZ0 A;  5FLX Y;  4MMO A;  5MAO A;  3HO1 A;  1GEH A;  3DRP A;  1U49 A;  1A0O B;  4IH7 A;  3BSC A;  4AE5 A;  1LOU A;  2KRB A;  2WSE C;  2RQK A;  4YUD A;  3PR5 B;  3RW6 A;  2MZS A;  4DL0 C;  4IFV A;  1NK9 A;  2QV6 A;  4M5J A;  1LW2 A;  1TL1 A;  3H8Y A;  2Y1I A;  4NCG A;  4Q44 A;  2RIL A;  4IG3 A;  4J37 A;  1RT7 A;  2CKW A;  4ID5 A;  3RAX A;  4RW4 A;  1CEZ A;  1RWX B;  3FVY A;  2UXC J;  2DY9 A;  2D3U A;  2NZ4 A;  2V8G A;  2ZD1 A;  1VLO A;  1YG0 A;  3AOD A;  4DBQ A;  3BV8 A;  3AD8 C;  3LPE A;  3M32 B;  3SMZ A;  3TNV A;  2HHQ A;  1WF0 A;  3R5G A;  2RKI A;  3CUN A;  1RKI A;  2X3G A;  2BQ3 A;  4J9V A;  1M5O C;  3MPW A;  2ZKT A;  3Q8Q B;  4O3S A;  2ALY B;  5JXS A;  1MSW D;  4X4P A;  5E33 A;  1FX2 A;  3RB4 A;  2CDR B;  2Z4P A;  4DR2 J;  4P7T A;  5HQ8 A;  1F9E B;  4ED6 A;  2XY5 A;  4B3M J;  1HKA A;  4MFB A;  2HHP A;  5F8M A;  1R27 B;  4JOU A;  4H4K C;  4OYO A;  2O01 C;  2AX1 A;  2FD2 A;  3POT A;  5D0G A;  4L74 A;  4X4T A;  1KFS A;  2MXY A;  5CD4 H;  4DL5 A;  3M8P B;  4FYW B;  1XMQ J;  1U4B A;  3DU6 A;  1S1V B;  2CQ0 A;  1C0U B;  1UTA A;  1SL0 A;  3OTE A;  3W5X A;  4PAA A;  4DR3 J;  3CJ8 A;  5HMW A;  3K5M A;  1BLU A;  1WEY A;  5JMN A;  3PFO A;  4LSL B;  1NSA A;  1TP7 A;  2E5J A;  3GV5 B;  4K4T A;  4CLW A;  3EVM A;  2ATL A;  2A10 A;  4OI4 A;  5KFG A;  3TUP A;  1FJG F;  3TW0 A;  5KFH A;  3R5J B;  1VRU A;  3GSD A;  1RJJ A;  2H65 B;  2RE1 A;  3AB4 B;  3C15 B;  3GCX P;  5LJ5 Y;  1JB0 C;  3R7N B;  2FJX A;  3RBD A;  3V4M A;  1B99 A;  1Y7P A;  3IWX A;  3VCD A;  2DK2 A;  4DHV A;  4XIU A;  3OL7 A;  3CCS S;  3PDN A;  3RAQ A;  2M3D A;  4USJ C;  2FLN A;  5KFR A;  2OMO A;  3AB2 B;  4WII A;  4RNM A;  1LQ9 A;  1F9F A;  2OGU A;  3QT7 A;  3HHE A;  2HHX A;  4A8X A;  2QA4 G;  1UEV A;  2J0X A;  1LW0 A;  2BR0 A;  2HQD A;  3HKW A;  3DI6 B;  4CLY A;  4B3R F;  3KLI A;  2JHE A;  3MPD A;  2BE2 A;  3TAR A;  5HJY A;  2KFY A;  2UP1 A;  4WYL A;  3QSY B;  2M4M A;  2M0G B;  4FYY B;  1C1B A;  4ZCI A;  2IMO A;  2RH3 A;  3K5L A;  5J1E A;  1KQS R;  2RD5 C;  3PW4 A;  4DR4 J;  4UY8 T;  2RRA A;  3C16 A;  1JLC A;  1I51 B;  2E29 A;  1GXT A;  2HQF A;  2MYF A;  3DOM B;  3MEC B;  4ER8 A;  4JI2 J;  5D8H B;  2JJ4 D;  3ILO A;  3NXZ A;  1VQY A;  3HX9 A;  2VFS A;  5BJR A;  3R2D J;  3MMA B;  3M8P A;  5B0A A;  3ILI A;  2KVQ E;  3Q89 A;  2WB4 A;  3HVR A;  2X1F A;  2KXH A;  2ASJ A;  2IM0 A;  4QCL A;  3UDL A;  3NS6 A;  4G1I A;  1YJV A;  2AYE A;  2LQ5 A;  2VIC A;  4DSI A;  2UXD F;  2OO4 A;  2GO9 A;  5HRO A;  1BE4 A;  1C4C A;  2G2Y A;  1OSD A;  3EIC A;  3BDP A;  3ZC4 A;  3NOC A;  4JV5 J;  2GMH A;  4DQQ A;  1EP4 A;  4RZR A;  3LAL A;  2LQ8 A;  4IDK B;  1F3F A;  1DUR A;  2V8H A;  3PW5 A;  3IGN A;  4IFY A;  1AZS A;  4RR5 A;  3N6N A;  2DHS A;  2DXE A;  1MNE A;  1VQ5 S;  4URQ U;  4ANE A;  2BEF A;  4C97 A;  3PAC A;  4LRC A;  5EWF A;  4DV5 J;  4WF9 Q;  3D1H A;  1ZPW X;  4PQU A;  1B64 A;  4K4W A;  4OZN A;  4HHJ A;  4J9U E;  1T9X A;  2R7T A;  4CO2 A;  3H42 A;  5DQG A;  2RHS B;  4JI0 J;  1UVL A;  1FEH A;  5DG8 A;  4JI4 F;  2V63 A;  3DRY A;  4G1P A;  5KAK A;  4LR9 A;  2HIY A;  1K1Q A;  1TKX A;  4YDX A;  4ZPD A;  1BWV A;  1FWP A;  5C5J A;  5KFY A;  4U67 Q;  1QVF R;  1RTJ A;  3UFC X;  1YBA A;  3I0R A;  3EYZ A;  5M2P A;  5KFJ A;  3Q0A A;  2DNL A;  3A3P B;  4WKR A;  4J91 A;  4RW4 B;  4F4W A;  3MMC B;  1X4A A;  1RBL A;  2RU9 A;  2ZC3 A;  3EDR B;  3GZ7 A;  1HA1 A;  4FXD A;  1JJC B;  2EBG A;  1TU0 B;  2ZDP A;  5C25 A;  1FE0 A;  1WHV A;  3ENV A;  2ATC B;  4ZN3 A;  1Q81 T;  2V9W A;  4M63 A;  1M5K C;  4RW8 A;  2H4Y B;  1K47 A;  2AJF E;  3IS9 A;  1TMM A;  1QTM A;  1UJ5 A;  1DAR A;  1BUX A;  5KFV A;  2C2E A;  3M8Z A;  4TU7 A;  3T1H F;  2YWF A;  2CQP A;  5I3U A;  1S1W B;  4MJK A;  4F67 A;  2CNO B;  2XSF A;  4BDP A;  2QMW A;  1R6Y A;  2VG7 B;  4DOZ A;  3OL6 A;  5D0E A;  1SC4 B;  1W7W A;  2BAN B;  5L9N A;  5IT4 A;  2CPE A;  3I5C A;  4NLT A;  2H4W B;  3RG6 A;  4TLQ A;  2DGX A;  4YB6 A;  2NCK L;  3VGV A;  1C1B B;  1U1N A;  4DWI A;  4ILR A;  1DTT A;  3SQO P;  1L3U A;  4KFB B;  2XLI A;  2KU7 A;  2PD1 A;  2YX4 A;  1QY7 A;  1ZPV A;  5GAH I;  2V9K A;  2WON A;  4USI A;  1FFG B;  3EX7 B;  2YNG A;  3UVJ A;  2JWN A;  2LEA A;  3IWN C;  1CC7 A;  3C6U A;  1PJ5 A;  2H1Y A;  5LSL A;  4H54 A;  1CUL B;  3D6F B;  2WBR A;  1OY6 A;  4RBU A;  2YTC A;  3OUY A;  1WEX A;  3KYL A;  3DFE A;  1DLO A;  2YX7 A;  3O8W A;  2HGM A;  4ZP9 A;  3JSY A;  2GVZ B;  3TA0 A;  2KTQ A;  5FII A;  2XTJ P;  2BE9 B;  2HK3 A;  5L1I A;  3NNC A;  3X1L B;  1G2E A;  4RKU C;  3D0I E;  1WOS A;  2HFU A;  3D9B A;  4O44 A;  4WFZ A;  1FD2 A;  3G2X A;  2ZOF A;  4OJ3 A;  5F3T A;  2JEI A;  2XYP B;  3DMJ B;  2MKI A;  2IM3 A;  2H48 B;  1X4C A;  4QZV B;  3JQK A;  4RW9 A;  2K3I A;  4IRD A;  5F8G A;  4Q8F A;  3BGF A;  1LNQ A;  3SFU A;  3IO1 A;  3OTO J;  1UVM A;  3N5B A;  2KJW A;  2MHN A;  3OTC A;  1DTQ B;  1V6H A;  4KE5 A;  4LF1 A;  2LP4 A;  1RWV B;  4OLO A;  2GIR A;  3SSQ A;  4NEY A;  5HVG A;  4TU9 A;  5J2Q A;  5I3U B;  4LRD A;  3DOL B;  4ZVP B;  3WDO A;  2B7B B;  2X7I A;  2UUB F;  6FD1 A;  5KFM A;  3R7B B;  3QGG A;  4UOH A;  1LWE A;  3A8I A;  2ZJR Q;  1TAU A;  3J7Y U;  3KHG A;  5KG7 A;  2GQ2 A;  3ULH A;  1EIY B;  3ZNJ 1;  5J1P A;  1L3K A;  3LTO A;  3LUY A;  1KQK A;  3AD7 C;  3MCS A;  4A8M P;  3TQ1 A;  2C2R A;  2J6S A;  5J1N A;  1JJ2 R;  4NXM J;  4USK A;  3T1H J;  1KSP A;  1RBA A;  1VC6 A;  2EPI A;  3NGS A;  2UVW A;  2J76 E;  1VHI A;  5L38 A;  4DQI A;  4JI7 F;  5HMX A;  1LXJ A;  4M1K A;  4IRK A;  1ARO P;  4IKA A;  4W98 A;  4C8M A;  4AL5 A;  4ED8 A;  2WVC A;  1BHN A;  1SCJ B;  1OIA A;  4P74 A;  2FPH X;  2MKS A;  1YSJ A;  3IBF B;  1EET B;  2NYH A;  3NP5 A;  4R0E A;  2HFS A;  3RBX A;  4CLL A;  5LT5 A;  1X7V A;  3TAM A;  1SIZ A;  1WEL A;  3T5H A;  4LF9 J;  3V81 A;  2KZM A;  3UDC A;  3DLK B;  3I87 A;  1FO1 A;  1H72 C;  5C7P A;  2BJD A;  4Y28 C;  1S1X B;  1S72 S;  3QFH A;  2RS2 A;  2E1M C;  3M1V B;  4UQT A;  3ZFV A;  1TKD A;  3SFG A;  4DEZ A;  3DLE B;  5IV4 A;  2Q66 A;  2FZG B;  3EMT A;  3FBE A;  1NHU A;  3DLL Q;  1CJU B;  3V4I A;  2HG4 A;  1D8Z A;  4DV7 J;  3HJF A;  2YNI B;  5SUH A;  1WC1 A;  4PG6 A;  5LSR A;  3MPV A;  3R2C J;  1U1M A;  1VRQ C;  4DV5 F;  5KFW A;  2MKJ A;  5KOX A;  1SH3 A;  3NGK A;  4EBC A;  2BW7 A;  1GMU A;  5G4D A;  2Q43 A;  1ZS6 A;  5M2R A;  1YJR A;  2QSW A;  1WDD A;  4ZOS A;  4JV1 A;  4L72 B;  3FZ2 A;  4WFX A;  1VIX A;  4WTY A;  2MZJ A;  2M2B A;  1RTD A;  4RUH A;  4NA3 A;  3H5Y A;  4ZVR B;  4ZPA A;  1CS4 B;  2DH8 A;  1B7Y B;  3MED B;  3BSN A;  1SJF A;  3GSI A;  4QIE A;  1KON A;  4N7T A;  4URS A;  2CPZ A;  4M94 A;  1SQF A;  3NL0 A;  3AOB A;  1LXN A;  1TR0 A;  2JOQ A;  4P6Q A;  3US5 A;  4ZJL A;  4QYR A;  3R5A A;  4HEA 9;  2VG5 A;  3KK3 B;  3MAA A;  1ACM B;  3SBM A;  2ZVS A;  1MRO A;  1NJW A;  5L1K A;  4CYU B;  3E01 B;  1H3D A;  2WRM A;  4F36 A;  3M2U A;  1FVS A;  2HHH J;  1HNW F;  2D1C A;  2MQL A;  3VHQ A;  3M6W A;  1WEZ A;  1IQZ A;  1PAU B;  1VBZ A;  3SEO A;  2OSQ A;  1OY9 A;  3L09 A;  3D3B J;  2MEW A;  4A8K A;  1CJV A;  1AFI A;  3CCV S;  1S1U B;  2ZH7 A;  1RDR A;  2R7U A;  1KR4 A;  3KDO A;  2CXE A;  2O5D A;  3IR7 B;  4KGK A;  2UVV A;  2B8P A;  3P6Y C;  2C2D A;  2OEJ A;  1P27 B;  4X65 F;  4JI7 J;  1VJQ A;  2B7C B;  4Q43 A;  4X62 F;  1XWL A;  4OV6 A;  1REV B;  1S7I A;  2BKN A;  2IM2 A;  1H2T Z;  2NXJ A;  2UZA A;  5A8R A;  4KGM A;  4I7F A;  4QPX A;  4RW9 B;  1HWL A;  4D3H A;  1S1T A;  3E8O A;  2ILY A;  3K17 A;  4L6V 3;  2QFI A;  1LK5 A;  1AFJ A;  4KIA A;  1CJT B;  3QNW B;  2YNH A;  3U1M A;  3W8P A;  2I2Y A;  1RT2 B;  3D28 A;  1SH2 A;  1TMJ A;  1VJW A;  3B54 A;  2HUR A;  4WJB A;  2PE8 A;  2FIU A;  3CJK B;  1VQK S;  2FHO B;  2F4V F;  1FRX A;  1V3S A;  2K3K A;  1LWC A;  4IG3 B;  1XR5 A;  1T3N A;  4GKK J;  2ZNZ A;  3Q23 A;  2OHD A;  4DV4 F;  3DYA B;  1B4S A;  2GHP A;  3SCK E;  4WFN Q;  3NEK A;  1C2P A;  1GQE A;  2RRN A;  1A9N B;  4ZPW R;  3MMA A;  3SYZ A;  2FJW A;  4QQB A;  4IOA Q;  2M5Y A;  3D66 A;  3F73 A;  4F3O A;  5EN1 A;  5A8W A;  2Q3P A;  3P5T L;  4CT9 A;  3PNI A;  3UCG A;  1FXR A;  3NCQ A;  1EQM A;  1ZAV A;  1NJX A;  4J9P A;  3G8T A;  3CB4 A;  4X64 J;  1K0V A;  1T3O A;  4UZC A;  3DLH A;  1VFJ A;  1RUS A;  4ZCL A;  3CWJ A;  5BR8 J;  5H9E J;  5F8N A;  3CDE A;  2QL9 B;  5H1S V;  2N3O A;  4EZ9 A;  4KGX B;  4X4O A;  4A48 A;  4NEZ A;  3W9I A;  2CNL B;  2Z2L A;  3BPS P;  2IA6 A;  4NI2 B;  5CD4 A;  3H98 A;  4RLE A;  5HAN A;  8AT1 B;  3H25 A;  1FNO A;  4L76 A;  4NOH A;  1NEE A;  3HUL A;  1SJ3 P;  4NA2 A;  1HR0 J;  4X84 A;  1S59 A;  2EFP A;  2P6S A;  4ZLP A;  2XCP A;  4FXV A;  3MWB A;  2RQ4 A;  2UXC F;  1HLW A;  2B0G A;  1IBL F;  4B9T A;  1IXK A;  1FRH A;  2GAH C;  2NUH A;  3I0S B;  3CCM S;  4JI1 J;  4WZM A;  4RU2 A;  3S8S A;  4OV1 A;  2P8I A;  3K5N A;  2PSZ A;  4LUB A;  3NMA A;  4QR1 A;  3HF5 A;  1TUW A;  3HVW A;  3E01 A;  2GIF A;  3I9V 9;  3GIL A;  1RAF B;  2MHE A;  1UWB B;  2WVB A;  4ZKA A;  3CJ5 A;  4ED1 A;  2XMV A;  1VQN S;  4Y65 A;  3GJQ B;  4W90 B;  3Q86 A;  1VBX A;  4PR6 A;  2R3V A;  4LVO P;  3TEH B;  5KFF A;  1MRO B;  3CCR S;  1HBM A;  4BLG A;  2F4V J;  3I5A A;  3TZX A;  1YJ7 A;  4P71 A;  3HP6 A;  4WE1 B;  1QDU B;  3NWR A;  4Y0F A;  1W25 A;  4Y2K A;  4HAC A;  1T9T A;  1GXL A;  1Q8I A;  4QOT A;  2RJZ A;  2W7A A;  4DR7 F;  4K5S A;  3B4M A;  3AQO A;  4YS2 A;  5DET A;  4USW A;  2LA4 A;  2BAC A;  2DYA A;  2NXC A;  3AJD A;  4IUF A;  5GAE U;  1EET A;  1RTD B;  2P9C A;  3D6H B;  2L9N A;  1JXL A;  3HHK A;  4ICL A;  5F9N A;  3BQ0 A;  5F8J A;  4FBU A;  2W9A A;  3F56 A;  4L73 A;  1EAR A;  4Q5V A;  3N28 A;  2DO4 A;  4RW7 A;  4JI3 J;  4F7V A;  1PCA A;  3KHR A;  3HHL C;  3SI8 A;  3CJT A;  1QLN A;  3PX6 A;  4LF4 F;  4QU6 A;  1K44 A;  2BBE A;  2OLW A;  3DLE A;  2CJB A;  3HI9 A;  4CLS A;  2DNN A;  4CH7 A;  2QLF B;  2YXL A;  4PXD A;  1CJU A;  4FS1 A;  5D15 A;  3BQ1 A;  3V4I B;  1T05 A;  2XZD B;  4RO0 A;  2VAS A;  1OWX A;  3AOA A;  3ZZZ A;  2AW0 A;  3W5Z A;  1TL7 B;  1BMQ B;  3DDI A;  2R7V A;  2D41 A;  2AT1 B;  1ZZN A;  3VAJ A;  1IBK F;  3AJ2 A;  2E66 A;  4Y34 A;  1CUL A;  2XMM A;  5F8L A;  1C4A A;  3DDK A;  3I55 S;  5J2P A;  5C25 B;  2HPU A;  4F4Y A;  3THP A;  3KG1 A;  3MXH P;  4K4S A;  1YKW A;  2DHG A;  2PA8 D;  1PBU A;  5A0Y A;  3T41 A;  3EE3 A;  2E7V A;  1O8B A;  1ZA2 B;  4OMF G;  4JI6 F;  4QW8 A;  3WZ0 A;  4KFB A;  1D9F A;  1Y5N B;  3GYX B;  4PG5 A;  2M8H A;  2VB6 A;  5KFA A;  5GAD U;  2XZW A;  2W9C A;  4EMD A;  3FC9 A;  1N5Y B;  4ED7 A;  1SVD A;  1HMV B;  2HZV A;  4DQP A;  3IR5 B;  2VL1 A;  1YQH A;  1FDN A;  4FYD A;  3HKZ D;  2DNH A;  4LF8 J;  4L3K A;  1WOO A;  3QO9 B;  4FNH A;  3RBZ A;  3DC2 A;  4EGL A;  4DR7 J;  5CHC B;  4FVM A;  4MIA A;  4JUZ A;  4MK7 A;  4U7C A;  1MN9 A;  3VAG A;  1LWE B;  1NSK L;  1BXN A;  2WCX A;  4DMZ A;  1M1G A;  3HHL B;  1XER A;  5KFT A;  2UUT A;  1R8P A;  3S7R A;  3T1Y J;  3W5Y A;  4A8W A;  3HZE A;  1F1B B;  1HBO B;  4N5S A;  3ONQ A;  3G6E S;  2Q1L A;  2KH9 A;  4DS5 A;  2EK1 A;  4OLP A;  4C3K A;  2MKC A;  3M9N B;  1R8A A;  5IT0 A;  1SKW A;  2R2U A;  3K2Y A;  1LK7 A;  5HQM A;  3CD7 A;  1DQA A;  4IFV B;  4O3P A;  4DX7 A;  4DUY J;  4ECR A;  1GMW A;  1IBL J;  1NLK L;  3AXM A;  2FVQ A;  2GQC A;  5AE2 A;  1RBO B;  3OHA A;  4HLB A;  3UQS A;  1CC8 A;  1MML A;  1C0T A;  1NBE B;  1PGZ A;  2YKM A;  3LWM A;  3C6U B;  3QAU A;  1D1U A;  2XO7 A;  3WC2 A;  3VAL A;  3A8K A;  4RNN A;  2R8H A;  2XNR A;  2JFD A;  2LKZ A;  2Z0G A;  4TN2 A;  4DUY F;  5HLF B;  2JC0 A;  4ZLJ A;  5GAH U;  3PRV A;  2MQM A;  1AA1 B;  1JXV A;  5IT9 U;  2VFR A;  4KR0 B;  3VZH A;  4AL7 A;  2I1R A;  5C24 B;  1OPI A;  1D8Y A;  2CPX A;  4XPE A;  4GMK A;  1WC3 A;  2HEK A;  1DHM A;  4NLU A;  3D7S B;  3EWG A;  3GFY A;  2ZJQ Q;  3OHB A;  3T5L A;  2E5L J;  4B3M F;  5FJ4 A;  3GG1 A;  2CQ3 A;  5GVQ A;  3H2V E;  3U02 A;  4DR1 J;  2QZ8 A;  3F0N A;  1RAI B;  1HQ2 A;  1YDL A;  2AU0 A;  4X2B A;  4CTA B;  2XMU A;  1HYS A;  1J27 A;  2YWK A;  3E51 A;  3FRZ A;  2UV8 G;  5AE3 A;  4TY9 A;  2I5J A;  1R89 A;  3PCO B;  4AYB D;  4P2F A;  3QO9 A;  4Y2C A;  1WWH A;  4J9K A;  1X8D A;  4OYB A;  1B70 B;  2ZHA A;  3KTQ A;  2RB7 A;  1FTR A;  4TLR A;  1OPZ A;  5I3Q A;  4K0K F;  4J9M A;  2J0W A;  2W7P A;  5C2G A;  2KRR A;  4DUZ F;  2XSJ B;  2EG2 A;  4LSN B;  3UCZ P;  1PIE A;  1SI9 A;  1U2R A;  3KG4 A;  4HT5 A;  3UR3 C;  3HM9 A;  1YJ9 S;  2VA2 A;  2UXB F;  4LVN P;  3RJM B;  3WIU A;  1X31 C;  3AAW B;  2YKO A;  1IBM J;  3I56 S;  2G4B A;  1KS2 A;  1YLX A;  2AWZ A;  4NLW A;  2CZV C;  4DR2 F;  1Q78 A;  1N5T A;  3DN9 A;  4MIB A;  2UUA F;  3PKM A;  1S12 A;  4B3O B;  2VJV A;  1N54 B;  4KHP J;  2YWH A;  4RWW A;  3DLJ A;  2JZ5 A;  1HW8 A;  3UI3 A;  3TJ8 A;  3KHL A;  2UVR A;  4CH1 A;  2XWY A;  1LW0 B;  1NZ8 A;  2DNR A;  2XLK A;  5B0E A;  2G9O A;  3ET6 A;  2QA4 S;  3R9L A;  2ZBQ A;  3LGM A;  3MEC A;  4YR0 A;  4DL2 A;  2CJK A;  4PQU B;  3KK1 A;  3EZ5 A;  4J9O A;  1DRZ A;  4IDK A;  3D2W A;  5KT2 A;  4LF6 F;  3AD9 C;  1JIH A;  2YX1 A;  5J1E B;  1C1C A;  1NKE A;  2L41 A;  4Y2A A;  1ZET A;  3KJV A;  1NH7 A;  3EGZ A;  1S99 A;  3DI6 A;  4YFU A;  3G6X A;  3IGV A;  2RT3 A;  2PDA A;  3BGU A;  3UN2 A;  2IHR 1;  5D4N A;  3MAA B;  1RCO B;  1AB8 A;  2XBP A;  3AFG A;  4H4M B;  3EJM A;  2KXN B;  2BW2 A;  1Z4U A;  3R97 A;  2OEM A;  2OEL A;  4FYX B;  4OFZ A;  6FDR A;  1YVF A;  4YQW A;  1HNZ F;  2UUA J;  1L5U A;  2PN6 A;  1RA6 A;  3MR5 A;  1LKZ A;  1RE1 B;  2DTJ A;  4I64 A;  4F0M A;  3DRR A;  4G6V B;  2WW4 A;  3H59 A;  3IS9 B;  4N77 A;  2VG6 B;  1T9U A;  3IG1 A;  5FD1 A;  4QWD A;  3CE8 A;  3AA8 A;  1JNR B;  4K5R A;  3HPO A;  4PWD B;  4XK8 C;  3QAT A;  4K0K J;  5KOW A;  4XDC A;  1PYS B;  3QJL A;  2E1C A;  3WQP A;  2KT5 A;  2HRT A;  2LDY A;  3TA1 A;  3GPA A;  4B08 A;  4XPC A;  1NK7 A;  3OL8 A;  1FKA F;  1REG X;  1BQN A;  3OXF A;  4P2X A;  4LFB F;  2JL9 A;  4PCQ A;  3RR7 A;  4FN5 A;  1RT1 A;  1UP1 A;  1S1T B;  2SXL A;  4NLS A;  4NRT A;  4C11 A;  4TU8 A;  4ECW A;  3I82 A;  4DV7 F;  3JSR A;  2BKO A;  3NMR A;  1QE1 A;  3DM2 B;  4QU7 A;  1FJC A;  3ETM A;  4V1A k;  3PFE A;  4LFC J;  2Y8W A;  1CJK B;  3CDU A;  4ZHR B;  3O5T B;  3MM9 A;  3UD4 P;  2KM8 B;  1VK3 A;  1M0S A;  2HQI A;  2ASD A;  4ZPC A;  2YWG A;  3DCA A;  4PPZ A;  1HD0 A;  1J5O A;  2ZHO A;  1FEE A;  3U1N A;  2IJN A;  3HFV A;  4DV6 J;  2ZJP Q;  3GU0 A;  5KFZ A;  2D3O R;  2BYC A;  2B5J A;  2E9T A;  2HRY A;  3VVT A;  1U47 A;  3Q8U A;  3TQE A;  1HNV A;  2AP6 A;  2J6T A;  2E9R X;  4P72 A;  2MLX A;  3PVX A;  3TI0 A;  2HSE B;  4ZIT A;  2ZM6 F;  1S6Q B;  4FNI A;  1UWB A;  2WVD A;  2XSJ A;  3B8H A;  2GJ2 A;  2WW8 A;  3G82 B;  4I2P A;  2WSF C;  4NLR A;  3GV7 B;  2QLJ B;  3MTK A;  3QLH B;  2KYX A;  5A76 A;  2XMW A;  3KLF B;  2Y3Y A;  4ED0 A;  4DPU A;  1X4G A;  3KG0 A;  2DJW A;  2A18 A;  4N8N A;  4UY8 5;  1MU2 B;  3EPG A;  2ZH2 A;  4Y00 A;  1NCL A;  3C6T B;  1LWC B;  1VQ8 S;  3GJT B;  3ZTP A;  5A2Q Y;  3JYT A;  3BQ2 A;  4NXN F;  4CTA A;  1WD6 A;  1HYS B;  1U6B A;  2GCF A;  4GO7 X;  3C3L A;  1X4E A;  2FC8 A;  3ADA C;  2VH7 A;  3J81 j;  1HHS A;  1RTI A;  3AJ1 A;  2KG1 A;  1GAO A;  4HKQ A;  5IWA J;  3R1H A;  4DR1 F;  1SQE A;  3ILJ A;  2HLU A;  4HTJ A;  4WK3 A;  3ITH A;  5LJ3 Y;  1S97 A;  4Q7A A;  2CG8 A;  2XO6 A;  3PKY A;  1U0H A;  2B9E A;  4WCE Q;  4FF4 A;  1S57 A;  3BGL A;  4ZVQ B;  1SC6 A;  4TKT A;  3GIJ A;  3VAF A;  2XMJ A;  2VPZ B;  1T03 A;  3HFK A;  2VOD A;  5K9F A;  2QMU B;  3GII A;  2F65 A;  5H9F J;  2MDA A;  2MJN A;  2W2O P;  1X9W A;  3D4J A;  3JB9 k;  2POK A;  1NU4 A;  4KGV B;  2XB2 D;  3TUI C;  1P9Y A;  4LR8 A;  3KK2 B;  2B6A A;  1GTE A;  1TL1 B;  2XMK A;  1V3R A;  1U09 A;  1AW0 A;  1Q5V A;  4HI2 A;  4OX6 A;  1G7C B;  1WKJ A;  2O3D A;  5B0D A;  3MF5 A;  1YRT A;  2AD9 A;  2NRE A;  2W9B A;  4LFB J;  1Q16 B;  1X4B A;  5CQG A;  2IVF B;  1BC6 A;  2J9D A;  4B3S F;  2PFF B;  3PIP Q;  3HHL D;  3CCQ S;  2XEX A;  3U1L A;  3CCL S;  4OIX A;  1IBK J;  4GVB B;  3IRX B;  3Q22 A;  2CRL A;  3W3S A;  1AXQ A;  4WYW A;  3CJS A;  3CDA A;  1VYA A;  1SV5 B;  3GIK A;  2EC2 A;  3QFW A;  2R7W A;  1QAX A;  3PX0 A;  1LEO A;  1PBA A;  2DRA A;  2GIQ A;  4DLG A;  1SJ1 A;  2VOP A;  1S1V A;  2QYC A;  5KFP A;  2C22 A;  3EZO A;  4EYH B;  2OIH A;  3CJ0 A;  3BO2 A;  1RHQ B;  4EK2 A;  1JLA A;  1Z2L A;  4YR3 A;  1WHY A;  1DQ8 A;  2DGO A;  3V2U C;  3POT B;  3V6J A;  2CVE A;  3E3X A;  1NB7 A;  5CA5 A;  3LAN A;  5L1J A;  1OYD A;  1D3W A;  2VV5 A;  2DGT A;  3CVK A;  4DLE A;  4X4R A;  2GQQ A;  4HAC B;  4H4O B;  4OQJ A;  1MU2 A;  3CDW A;  5E41 A;  2AJQ A;  2ZVI A;  5JVH Q;  2PI4 A;  4NAS A;  1T0T V;  2KO1 A;  2QMX A;  1S10 A;  2HNY B;  2ABY A;  1HNI A;  4AD6 A;  1TKZ A;  4DQS A;  4JP8 A;  2DKO B;  2M70 A;  4KKO B;  4LBH A;  3T9N A;  3QID A;  5GAD I;  3OVA A;  2E1R A;  2V69 A;  4F2R A;  2HS4 A;  4J9R A;  2MST A;  3UN5 A;  2GZO A;  1NPP A;  2ZBI A;  3NY0 A;  2XC9 A;  3TAP A;  1UPM B;  4YOE A;  4PEO A;  4QWB A;  2BMB A;  4ILL A;  1HI1 A;  1RU2 A;  4JI4 J;  4KO0 B;  4MK8 A;  2R2R A;  1DAX A;  3RB0 A;  3SSS A;  2B4U A;  5HL7 Q;  1KRP A;  2OAU A;  1NK6 A;  2VG5 B;  4NZ7 A;  5GMK a;  2EKN A;  2B3T B;  1S6U A;  3G8Q A;  4HT7 A;  4FBT A;  3JAM U;  2VQF F;  5KTQ A;  1PO6 A;  1KHV A;  4ZPV R;  4ALZ A;  4EYI B;  1N4L A;  1VK8 A;  1M1H A;  1Y3K A;  2D9O A;  4NLX A;  1MG7 A;  3QGH A;  3IC1 A;  5ETV A;  3PYD A;  4X66 F;  3UCU P;  3BBC A;  3JTO A;  1WUU A;  3MM5 A;  1LV5 A;  3P45 B;  2FC9 A;  3M8S A;  4DUZ J;  3L3C A;  3TAN A;  5HI7 A;  3WIV A;  4DX8 H;  2PEB A;  3QYY A;  3DHX A;  3D6T B;  1QM9 A;  2NPI A;  4KYZ A;  4Y2M A;  5T41 A;  1HR0 F;  1FF2 A;  1LWF A;  1J5E F;  4V19 J;  4AFF A;  1KLM B;  4I6W A;  4A8Y A;  4J9S A;  1M5V C;  5CYQ B;  4ECV A;  4ILM A;  4KH0 B;  3Q8S B;  2VBW A;  4PZV A;  5E5N A;  4KHP F;  1N6Q A;  2QL7 B;  4K4Y A;  5HRO B;  2F7V A;  2LU1 A;  3MUR P;  1SKS A;  2V94 A;  1VQ7 S;  3GG0 A;  3W9J A;  4NL5 A;  4DXL A;  1YJN S;  2BZ2 A;  2FDN A;  2Z57 B;  3R8Y A;  2VIH A;  3ZZP A;  1RT5 A;  4I2P B;  1OO0 B;  4K7Q A;  4ZVT B;  4IR9 A;  1SIW B;  4LQ3 A;  2G0I A;  4PG4 A;  4WXW A;  3X3U A;  2ADB A;  1R43 A;  2AJ2 A;  3N6M A;  3CED A;  3GQC A;  3HHN B;  1HD1 A;  2NS1 B;  3SCL E;  5K20 B;  3OL9 A;  3PYF A;  1ULR A;  1URN A;  3G9C A;  1U1L A;  4PAB A;  2MLY A;  2HHU A;  3H0P A;  4JI8 F;  2ASY A;  1RU1 A;  2QE5 A;  3KFW X;  4ES3 A;  2F40 A;  2AEJ A;  2E1A A;  1IKX B;  3MOJ B;  3QRQ A;  2U1A A;  2YNF A;  1RT4 A;  3LWL A;  3VV2 B;  2B56 A;  3JTN A;  4USU A;  1X5O A;  4F8R A;  5A8R B;  2GA7 A;  2IJF A;  4DSF A;  5KFX A;  2D7S A;  1YZ7 A;  1EKR A;  2E5L F;  4DPT A;  1YX2 A;  4Q8E A;  1X60 A;  1OYE A;  1NSP A;  2IC3 B;  1OS5 A;  2VDH A;  3CO9 A;  1H74 A;  3VWS A;  4R5P A;  2C3M A;  4C0H A;  4QR2 A;  4NPO A;  4F0H A;  2V67 A;  2VQE J;  2X3D A;  3UR0 A;  2E9Z A;  2GV1 A;  2AF6 A;  1FA0 A;  1A6L A;  3W60 A;  1N36 F;  5B08 A;  2JEF A;  2JVR A;  1FVQ A;  3PV8 A;  3FDS A;  1VQM S;  2HVE A;  3J81 Y;  3N4W A;  4KBI A;  1HNX F;  4ELU A;  1X5T A;  2OD6 A;  1IJF B;  2KDO A;  4U7U K;  4EZ6 A;  4HDH A;  1U1K A;  4IH6 A;  5E3A A;  1VBY A;  4ZK7 M;  1RWN B;  1UFL A;  1FTC A;  1YGY A;  4WZQ A;  4GVL A;  5DJB A;  4JYA F;  2EFN A;  2AJ0 A;  3J80 Y;  4RU9 A;  5KT6 A;  3U27 A;  2Q6C A;  3LGN A;  1RGV A;  2G0J A;  1EAY C;  3GR1 A;  3HVT A;  4IYQ A;  4Q2L A;  1Q7L B;  3R5B A;  4OHW A;  3J81 U;  2R7X A;  4M5M A;  1HQU A;  1VMB A;  2GGP A;  3OLB A;  3SDE A;  3K7R A;  2HND B;  1RAE B;  1ZYQ A;  4ZVF A;  3SV3 A;  5E2Q A;  4ECY A;  2CG4 A;  2HGN A;  1FDA A;  1TV6 A;  3MCO A;  3W2V A;  3UVJ B;  1XMO F;  2IRY A;  1RT2 A;  5IOL A;  5GME A;  3J7Z T;  3KK2 A;  1R31 A;  3OFF A;  3GMG A;  1IKV A;  4K2J A;  4WXO A;  3VZI A;  3PX4 A;  1W2B R;  1Y11 A;  2WVF A;  2X51 A;  1KLM A;  1TFW A;  3R6G B;  4LSN A;  2KG0 A;  4ANC A;  1U45 A;  2VC1 A;  4LF2 A;  1KKH A;  4LT6 A;  1JLE B;  1ZAW A;  4DR6 F;  5H9F K;  3AY0 A;  4M8L A;  1MWY A;  3KDN A;  4KKO A;  2R7R A;  1JLG A;  2UV8 A;  4GKJ F;  4ZJQ A;  4ECQ A;  3VTI A;  2QO3 A;  5ETN A;  3CD6 S;  1KHW A;  1TAQ A;  2CQD A;  3S1T A;  4F04 B;  4OX9 F;  3LW5 C;  4C9D A;  4MKA A;  4CNZ A;  4ZVG A;  3S6E A;  4JI5 J;  2B8Q A;  1UVK A;  2C2K B;  4N41 A;  5KFB A;  4YN3 B;  3Q2T C;  4E98 A;  4UF4 A;  1VRU B;  3RB3 A;  3KJF B;  3C15 A;  3R3T A;  3EDQ B;  1SBR A;  3CJQ A;  2ZZM A;  2OP5 A;  4QIW D;  2EI5 A;  5A6P A;  3G8S A;  1BQN B;  1BD6 A;  1WOP A;  2V50 A;  1UFK A;  5A0Y B;  4LRB A;  2EK6 A;  3M8Q B;  2BRL A;  3TZZ A;  5KFC A;  5E3Q A;  4DSE A;  3M6V A;  2RNE A;  1P8G A;  1NDK A;  4HVZ A;  1BQX A;  1FK9 B;  1U8S A;  1PG5 B;  5A8W B;  2HNY A;  1RLD A;  1MN7 A;  2AMC B;  5KFE A;  1QAY A;  1GFW B;  3IXQ A;  5CYJ A;  3AH6 A;  3I0S A;  5LXR A;  1MWZ A;  3CJ4 A;  1WJ9 A;  3FFI A;  2XNQ A;  1UVN A;  3HDS A;  3HD2 A;  4CLT A;  2GO8 A;  4MFB B;  4K4V A;  4KSE B;  2C2N A;  4C8O A;  2DH7 A;  4I56 A;  2ZZT A;  2GJF A;  1WOR A;  4CDI A;  3K5P A;  1I1G A;  4C8L A;  3LGH A;  1L3V A;  2AEM A;  4Q0B A;  1IKW B;  3RRH A;  3C16 B;  1K8A T;  3MM9 B;  5RUB A;  2M9K A;  1SJR A;  3OXG A;  3SCJ E;  1RWU A;  4F3M A;  4DR4 F;  1GTH A;  2IAJ A;  1N33 F;  2FVR A;  2RQM A;  2EWH A;  2UUB J;  1KVK A;  3WHI A;  1O0P A;  3M32 A;  2MTL A;  4AND A;  5A8K A;  1S0M A;  5LOQ A;  4OI6 A;  4F4K A;  2QYG A;  2VJU A;  4PXE A;  4I67 A;  3WX4 A;  2YY3 A;  4ZP7 A;  3QBC A;  4LFA J;  4Q2M A;  4NYZ A;  1T02 A;  5CZX A;  3RAM A;  3I32 A;  3W1Y C;  5HN0 A;  2W4D A;  3PHT A;  4F02 A;  1KTQ A;  2Z30 B;  5I4M A;  4O3R A;  4TYA A;  4ZP6 A;  1PAE X;  1S9E A;  2CZ9 A;  3KLF A;  4OHY A;  1R0B G;  2CFX A;  2W2Q P;  3OUY B;  2HND A;  2MZQ A;  1QAJ A;  1N0U A;  2OPS A;  4LF7 J;  3P96 A;  2AGO A;  3JSM A;  5K14 B;  4OJG A;  3HMJ G;  1RWP B;  2KXF A;  1VR6 A;  3HVT B;  3PYG A;  1K0T A;  4CIO A;  2JRS A;  2QG9 B;  3H4D A;  1FRM A;  1TKT B;  3EVO A;  1HWJ A;  5KFL A;  5HBM B;  5ETK A;  5K8P A;  1JLC B;  2C2M B;  3MPU B;  1FT8 A;  3MR6 A;  2JEG A;  4LIR A;  1HPZ B;  2BM0 A;  2IIH A;  1YIJ S;  1ZA1 B;  1OMS A;  3HHL A;  5ETQ A;  4DL6 A;  3D67 A;  4P9S A;  4NXM F;  3NBP A;  4A46 A;  3AA9 A;  2FZK B;  1Q4R A;  3MZI A;  4O4G B;  3A13 A;  3MEK A;  4AXJ A;  4ID8 A;  2PMZ D;  2ERR A;  3MED A;  2BJ8 A;  3SQG A;  1XK8 A;  1M5S A;  3A3N B;  3VGS A;  1WC4 A;  3QGI A;  1O5J A;  1L3T A;  4FZV A;  1JJ4 A;  3R5D A;  2DNG A;  3K0J A;  1QJH A;  3LP1 B;  4CO4 A;  2UVU A;  1RI7 A;  2HWI A;  4EFA C;  2ZH3 A;  2CQH A;  2G1D A;  3NWG A;  1Q82 T;  1S1U A;  3QRP A;  4U96 A;  1OSC A;  4CM2 A;  1RQ0 A;  2NSC A;  3NGD A;  3LP2 B;  4J9L A;  2M7S A;  2AV5 A;  2OH2 A;  2QEX S;  2BE7 D;  3AT1 B;  3TJA A;  1F5C A;  2YQ0 A;  1SKR A;  2B43 A;  4B02 A;  2MB0 B;  3MTJ A;  1YRU A;  2LEC A;  5HP1 B;  1N32 J;  1EQ0 A;  1IR0 A;  3NKY A;  5ETP A;  4LSL A;  3RUB L;  3H5S A;  4RL1 A;  5T7L B;  2NXE A;  5KG4 A;  3HT3 A;  2PA3 A;  4F4X A;  4I6A A;  1VQ9 S;  1U8W A;  3CCE S;  2DNO A;  4EWT A;  2CPI A;  2YH1 A;  1ZH5 A;  1UJ6 A;  3PR4 A;  1D9D A;  3I6P A;  1F2H A;  2ZBP A;  2FGC A;  2XM3 A;  2ASL A;  3Q24 A;  2LYV A;  4ZLL A;  4IRC A;  2BAB A;  1X9M A;  2FYX A;  1U2C A;  4X62 J;  2HBR B;  5M2U A;  4ZVS B;  3GYN A;  3MR3 A;  2CAJ A;  4U7U D;  4KRW A;  3PG9 A;  1HBN B;  2YQ3 A;  2RAQ A;  3V6K A;  3D0G E;  3L95 X;  3NBP B;  4NWB A;  4DFP A;  1FCA A;  2LU2 A;  1Q8L A;  4NML A;  4KGZ B;  1HFE L;  4X4Q A;  3T3F A;  2EBE A;  3PEH A;  3BO4 A;  2VKR A;  2K7J A;  3DKD A;  4LMZ A;  1HAR A;  1UET A;  3GFH A;  4DCO B;  2HW3 A;  1KDN A;  3K58 A;  1WNE A;  2BX6 A;  5HAO A;  2BJ3 A;  5IC4 B;  1Y00 A;  2E5I A;  3FCH A;  1QSS A;  2HVH A;  4OI3 A;  3M2R A;  4DG1 A;  4WU2 A;  5HVF A;  3KNG A;  2WAQ D;  2OPR A;  1UPP A;  1NDL A;  4EUV A;  2KYZ A;  2PI5 A;  3O3L A;  3QRR A;  1KNZ A;  4N47 A;  3HZG A;  3TOQ A;  4B9V A;  2PGC A;  3MM7 A;  5KFK A;  1SQG A;  3I9Z A;  1B7F A;  1F5A A;  2WHO A;  2VON A;  1R0A A;  3MMC A;  4NLY A;  1YJU A;  4H4M A;  3BKF A;  3MMB B;  4HTI A;  5I3P A;  1IM6 A;  1TUV A;  2AZ3 A;  3MM6 B;  3ZZO A;  3M2U B;  4ECX A;  4EEY A;  2V8D A;  2MGZ B;  4CT8 A;  3MI7 X;  1BQM B;  2YNH B;  3GTY X;  2F8M A;  4NMX A;  4OYI A;  9RUB A;  4ES2 A;  1DTT B;  4RNF A;  2OTL S;  1Z1Z A;  2XY6 A;  2V2V A;  5JUM A;  5AXM A;  5JVG Q;  2IAJ B;  4CQ1 A;  3TVK A;  2HIQ A;  3M30 B;  5K8O A;  2AX0 A;  1IN0 A;  4FXW A;  4QWE A;  1SPB P;  3BM7 A;  5IQQ A;  5L9X A;  1NXI A;  2MKK A;  3KK1 B;  2VA3 A;  2DNM A;  2VFT A;  1NK0 A;  4OX9 J;  2QL5 B;  2VUG A;  3L4B C;  4TQS A;  4DSJ A;  3KUH A;  3DLG B;  4IO9 Q;  4X4S A;  3KLH B;  3BR9 A;  2ZWP A;  4C7Q A;  4WFB Q;  3SQG B;  1ZM3 A;  4J9Q A;  3K5O A;  2XGP A;  4WP3 A;  2AYG A;  4DDF A;  2PMW A;  1T7P A;  5AJ3 J;  4LRF A;  3CTR A;  4J5O A;  2MZ1 A;  4KAI A;  5HMY A;  4RUC A;  3O6Q A;  2HKE A;  4ZA1 A;  2K7K A;  5HSP A;  3I5B A;  2CA9 A;  1T9Y A;  3NGT A;  2ROP A;  2VU5 A;  4ZCM A;  2IBO A;  4XO0 A;  4PUO A;  3MM5 B;  1K73 T;  2GVZ A;  3QAE A;  3UE2 A;  3T19 A;  3FRY A;  1Q8K A;  2J7U A;  1WKK A;  3GLJ A;  1TK5 A;  3RR8 A;  2FJE B;  3QJJ A;  1LWX A;  2GX8 A;  2GC8 A;  4LRE A;  4IG0 A;  4B17 A;  3CJ2 A;  4EO8 A;  1VS3 A;  2K1R A;  2HHW A;  4OZ0 A;  5HMZ A;  1NPK A;  1T05 B;  1AUD A;  3J7A N;  2YQ1 A;  2NYI A;  3MUM P;  2CZ4 A;  2J7W A;  2ZH6 A;  3NS7 B;  4J9N A;  4ETZ A;  1H6K X;  1UW4 A;  4NYO A;  3DRS B;  5LM7 E;  2HFO A;  5EX0 A;  3PXG a;  4NLP A;  3TR5 A;  1N34 J;  4FF3 A;  4CO5 A;  3BS9 A;  2R8G A;  4CO0 A;  2PFD A;  1S9G B;  2IM1 A;  3W62 A;  2FY8 A;  3G4S S;  1U0H B;  3BEG B;  3ILL A;  2YVS A;  5KFS A;  3OLA A;  3TVZ A;  1G1X A;  4GRS A;  3VQS A;  1B3T A;  2DY1 A;  2OKQ A;  3CCZ A;  1RTI B;  5AXL A;  5D4O A;  2VBY A;  3NOG A;  3W7B A;  2YWE A;  1FRK A;  1RAC B;  2EFQ A;  3FSX A;  4EU0 A;  3CXC R;  2LA6 A;  4DV6 F;  4C8Z A;  1ELO A;  3DXB A;  4A8F A;  4YDD B;  4C0B A;  5BR8 F;  1CJK A;  1I6J A;  2HLT A;  5KFQ A;  2RSQ A;  1TZ0 A;  2DIT A;  1XMB A;  1NKC A;  2VPX B;  3QLH A;  3AOC A;  3ENW A;  3HSD A;  1WC6 A;  2V2K A;  2ZKU A;  2BUN A;  3O2I A;  4F0K A;  1N5Q A;  2LVW A;  3ELH A;  2Y1J A;  4QIG A;  2ZE2 B;  1WKL A;  3ENQ A;  3BGR B;  5DO2 A;  4K4U A;  4OZ1 A;  2HNZ B;  3T6J A;  3OFG A;  2DGU A;  3UO0 A;  1BQM A;  4DCJ B;  4DN9 A;  3OW2 R;  2Z2Z A;  2HS0 A;  4O44 B;  3RGI A;  2RDD A;  5F8H A;  5EHH A;  2ZIT A;  3FZB A;  3CUL A;  4UT4 A;  3I4P A;  5DZ6 A;  4GKK F;  2RDI A;  1YJW S;  5LSO A;  4QWA A;  1FWL A;  1WHW A;  4OX8 A;  2K1R B;  4AL6 A;  1XMQ F;  1J2V A;  1RAB B;  3N79 A;  2A6M A;  3KHH A;  4NE9 C;  2FJV A;  1CLF A;  3C14 B;  2LCW A;  3VVU A;  3W61 A;  5F9L A;  2MQP A;  3CCU S;  1GMW D;  1M5H A;  1XR6 A;  3OJU A;  5D4P A;  3M9M B;  4DV0 J;  2C2O B;  4M5K A;  3GFX A;  2CDQ A;  2NUU G;  3A4T A;  3BGO P;  3CJR A;  2B6A B;  3MEE A;  4C8N A;  4NX9 A;  1WSV A;  2OPP B;  2VPY B;  1F5B A;  1N88 A;  2QLB B;  3GIR A;  3C19 A;  1U1O A;  1IQT A;  3PTW A;  2ACY A;  2PII A;  4CLK A;  2ZZN A;  3EGN A;  2EVZ A;  4JI0 F;  2UUC F;  5K5M A;  1F2G A;  3G6V A;  2CPY A;  1OJ4 A;  1NUE A;  1QE1 B;  3DM2 A;  1TKZ B;  3L9Z A;  4FYV B;  5ADZ A;  4DSK A;  1RIS A;  4PYD A;  4F2S A;  1IKV B;  1JKH A;  3MUT P;  2A6O A;  2C2Z B;  2G1H A;  3VF0 B;  5JJB A;  3ITH B;  4CZC A;  1GH8 A;  3IBC B;  1RT7 B;  4K50 A;  2YKN A;  5AE1 A;  2YKA A;  5CYM B;  5E3C A;  4CWB A;  3SZ2 A;  1UMJ A;  2HVZ A;  1KP6 A;  2F8H A;  3NLC A;  3KJQ B;  2LQ9 A;  2NXU A;  4YB5 A;  3HCX A;  4UOC A;  5J2N B;  3NAH A;  1QTN B;  3M1V A;  1NAQ A;  4IG0 B;  4LF5 F;  2W24 A;  1RWW B;  5B7W A;  2PMH A;  2VQF J;  4EBE A;  4B9S A;  3LAM A;  2VDI A;  4M5D B;  4YP3 A;  4H4K A;  4CI0 B;  5B09 A;  2XHW A;  2EXU A;  1PYO B;  4P52 A;  3H90 A;  1RYS A;  2V4J A;  3BSO A;  3FK4 A;  2AQ4 A;  4RUA A;  2OML A;  3I96 A;  2D74 B;  1UKU A;  3CJK A;  4DV1 J;  5IT9 Y;  1SC1 B;  1GX5 A;  1MW7 A;  5HBM A;  3TX8 A;  4S0M A;  1EJ7 L;  1RTJ B;  4OZ5 A;  5EWG A;  2DNP A;  2IFX A;  2HNZ A;  2KB2 A;  2VD3 A;  2RU3 A;  1IBM F;  1S9F A;  1LWF B;  4LBI A;  4KTQ A;  3KLE A;  1S0N A;  2UU9 J;  2APO A;  2J8S A;  1FNM A;  1Y4Z B;  2HQ3 A;  2ZC4 A;  5EWE A;  3KLG A;  5DLF A;  1APS A;  2AJ4 A;  5B0F A;  1KOO A;  5LMU F;  1H38 A;  2DPJ A;  2XY7 A;  3N9U C;  3PRB A;  5IZH A;  1FKO B;  2DNZ A;  2HBQ B;  4EI2 A;  3GP9 A;  2CQC A;  2CUY A;  5KG0 A;  3H40 A;  1NKB A;  2BOA A;  2ZFH A;  4RWX A;  4DR5 F;  3QWU A;  1AZS B;  2J0S D;  2DEI A;  3FFI B;  3UW1 A;  2VKZ G;  2JH3 A;  3FEY B;  2V4Q A;  3ZZU A;  4Y3C A;  4EO6 A;  2MQO A;  2GS8 A;  3CMQ A;  3MUV P;  1UFW A;  3CC2 S;  4BHQ A;  2R2T A;  3BYP A;  4NLG A;  2WSC C;  2IYI A;  2IVM A;  3BSA A;  4IH5 A;  1KQF B;  3N6L A;  1CSJ A;  1HPZ A;  1NH8 A;  3C8Y A;  2L08 A;  3BKU A;  3CO0 P;  5ETS A;  2Z2M A;  1B0P A;  3HSG A;  3W2W A;  2JC1 A;  3DGV A;  5ETT A;  1R7I A;  2CQ1 A;  1S0O A;  3CMA S;  3BBF A;  4LIW A;  5KT3 A;  3LP0 A;  5IM0 A;  1T8E A;  1R3N A;  4B3T F;  4LBP A;  4OX7 A;  1UWA A;  2DRD A;  4USM A;  1H73 A;  2P6T A;  2JNJ A;  2KJV A;  1C0T B;  1S6O A;  2CAD A;  1FDD A;  1DLO B;  4XAK A;  4YY3 J;  4FKX A;  3DYA A;  4P2M A;  4YHH J;  3EXY A;  3QGP A;  4J7C A;  2YNG B;  3MR7 A;  1VQP S;  1NDP A;  2DNY A;  2L3M A;  2QIF A;  2Z2Y B;  2W7O A;  1YI2 S;  2O1P A;  4B9M A;  3TUZ C;  3QQC D;  1VQO S;  2V68 A;  1U24 A;  5KG1 A;  4RW6 B;  3UD3 P;  4ZIV A;  2PEH A;  2EKY A;  1N8R T;  1HI0 P;  5DQH A;  2I38 A;  3KLE B;  4UQG A;  3RZA A;  2MSS A;  3PY8 A;  1WI6 A;  2F63 A;  4WPA A;  2N82 B;  1JKH B;  2HBZ B;  2QA1 A;  2V8V A;  3OQ2 A;  4ZVH A;  2CNK B;  2PT0 A;  2P5V A;  4LJM A;  5KFO A;  1LFW A;  2OFH X;  2IVY A;  1XMO J;  3T1Y F;  1GK8 A;  1VC5 A;  1H7W A;  4Y6I A;  4ZP8 A;  1G6B A;  4UOF A;  4IR1 A;  1LFP A;  3QT6 A;  7FD1 A;  1QSY A;  3ZTO A;  4NXN J;  5FDL B;  2MZT A;  4NCB A;  4BC7 A;  1URR A;  3V6D A;  2JLF A;  3SIP B;  3FCV A;  4CLP A;  1R8C A;  1WG4 A;  4M5D A;  3VAH A;  4RX6 A;  1T9W A;  3GJS B;  1IR2 A;  3Q83 A;  3RU0 A;  2CQ4 A;  3WX8 A;  1G3O A;  5T7L A;  1OQ6 A;  4KO0 A;  4C98 A;  2XQC A;  2G13 A;  2W9C B;  1TVR B;  2CPH A;  4I1T A;  3M8R A;  5J2N A;  2E44 A;  2YNF B;  3OR1 B;  4KPY A;  3THT A;  4DL3 A;  1KVI A;  3OFH A;  3M7V A;  2IYG A;  5HVH A;  1VBK A;  2XUL A;  2ROG A;  3NGU A;  2JLG A;  2A1B A;  2NZC A;  3DMJ A;  2DR6 A;  1U25 A;  2KHD A;  3MFH A;  1AUS L;  4NLD A;  1RHU B;  2F9J A;  2ILZ A;  3SSR A;  2MGZ A;  2V4J B;  2DT9 A;  2NR0 A;  1RAJ A; 
#chains in the Genus database with same CATH homology
 4KPC A;  3FKB A;  1HHQ A;  1EHW A;  3FBC A;  1B99 A;  1NDC A;  1NSP A;  1PAE X;  2B8P A;  3DDI A;  1S5Z A;  1HIY A;  3ENA A;  5CAA A;  3R9L A;  1WKJ A;  3Q8V A;  2HVE A;  2HVD A;  3MPD A;  3EVO A;  3EE3 A;  3G2X A;  3PJ9 A;  2DXD A;  1VYA A;  4S0M A;  1LEO A;  3VGU A;  1XQI A;  3FC9 A;  3B54 A;  2HUR A;  3NGT A;  2VU5 A;  4EK2 A;  3VGT A;  3EJM A;  1WKK A;  1B4S A;  1LWX A;  3VGS A;  3GP9 A;  4UOH A;  1MN9 A;  3Q89 A;  1NPK A;  1NSK L;  4DI6 A;  3BH6 B;  4F4A A;  5IOL A;  3EVW A;  1BE4 A;  3GPA A;  3NGS A;  3EIC A;  1UCN A;  2CWK A;  4UOG A;  4ANC A;  4W98 A;  1BHN A;  3ETM A;  1F3F A;  3BBF A;  4CP5 A;  2AZ1 A;  2DXE A;  1NLK L;  5CAB A;  1U8W A;  4O0N A;  4DZ6 A;  4ANE A;  2BEF A;  4C6A A;  4FKX A;  5C7P A;  3FCW A;  3JS9 A;  1NDP A;  1S59 A;  4FKY A;  2B8Q A;  1HLW A;  2DXF A;  2ZUA A;  3ZTR A;  3BBC A;  3FBE A;  3EMT A;  3VVT A;  3ELH A;  5BXI A;  3Q8U A;  1WKL A;  2DY9 A;  3PRV A;  1JXV A;  3EM1 A;  4DUT A;  1NB2 A;  3B6B A;  3NGR A;  3FBB A;  3Q8Y A;  1XIQ A;  3Q86 A;  1ZS6 A;  1NDK A;  3DKD A;  1KDN A;  4UOF A;  1MN7 A;  2BX6 A;  4HR2 A;  3ZTO A;  3VVU A;  4ENO A;  1BUX A;  1NCL A;  1NDL A;  3FCV A;  3ZTP A;  2DYA A;  3Q83 A;  3L7U A;  3WX8 A;  3ZTS A;  1W7W A;  3BH7 B;  3FBF A;  3ZTQ A;  2AZ3 A;  2NCK L;  3NGU A;  1NHK L;  1PKU A;  1NSQ A;  3VGV A;  4F36 A;  1NUE A;  1S57 A;  4WBF A;  3EVM A;  1F6T A;  4AND A;  1K44 A;  3BBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...