4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
1BL4A 2UZ5A 2XP8A 3JYMA 4IPXA 4DH0A 5HUAA 3WH0A 2DG4A 4J4NA 1FAPA 4ODOA 5I98A 5DITA 5HT1A 3UQAA 4QT3A 4DRIA 5HW8A 3RFWA 3KCEA 2PPNA 1D7IA 2RUQA 2KO7A 3KAIA 1EQ3A 1FJDA 2L2SA 3PRDA 1YW5A 2RQSA 1PINA 1Q6HA 3KAGA 3O5DA 4R0XA 4U86A 4BF8A 5BXJA 5J6EA 1BKFA 4GGQA 2ZQSA 4DRMA 3JYJA 4JFMA 2K8IA 2M1IA 3OOBA 4FN2A 3JXVA 4JFIA 3O5LA 1FKGA 4DRPA 1FKBA 1J4IA 1FD9A 2Q5AA 2LKNA 2ZR6A 4LAXA 4MSPA 4DRJA 1P5QA 5HKGA 2RUDA 3O5JA 2LPVA 4ODLA 3UI4A 3GPKA 2MF9A 4JYSA 4LAVA 2XPBA 1ROUA 2MLZA 4ITZA 1TCOC 1A7XA 5D75A 5HWBA 2XP3A 2XP7A 3TC5A 2N87A 2ZQUA 1FKIA 4W9QA 2XP9A 4DROA 1Q6UA 4LAYA 2MLXA 3EY6A 2ITKA 3NTPA 3O5EA 4G2PA 4QIBA 2LGOA 4G50A 4TX0A 1FKFA 1M5YA 2M08A 4FAPA 4DZ2A 3NI6A 1PBKA 2XP6A 3MDYB 4C02B 2DG3A 2ZQTA 3IHZA 1FKDA 3O5RA 4ODPA 2VCDA 3TDBA 1HXVA 5DIUA 1QZ2A 2JZVA 1JNTA 3UI6A 3KABA 2F21A 1JNSA 1L1PA 3PRBA 1FKLA 1ZCNA 5HTGA 1QPFA 4DT4A 4ODKA 4DRNA 1JVWA 1KT1A 2FAPA 2XPAA 3CGNA 2IF4A 3ODKA 1U79A 2MNTA 2PPOA 3O5FA 4NNRA 1NMVA 4ODQA 1EYMA 5HW6A 4TNSA 1Q6IA 3H9RB 3IK8A 4TYOA 4ODNA 2KE0A 1FKTA 1J4RA 4GIVA 3FAPA 1N1AA 3KAFA 1Q1CA 3KACA 4JFKA 1ROTA 2PPPA 3UQIA 5HW7A 4N19A 2DG9A 2RUCA 3O5PA 3UI5A 3UF8A 1B6CA 1FKHA 1Y0OA 2M2AA 2MLYA 2OFNA 3LUOA 3VAWA 3O5OA 2VN1A 4O2TA 2KR7A 2RSEA 2Y78A 4J4OA 1F8AB 4JFLA 1FKKA 2LJ4A 2PV1A 4DRKA 3O5IA 2F2DA 2PV2A 2ZR5A 1FKJA 1FKSA 5B8IC 1NMWA 1D7HA 4QT2A 4W9PA 4DRHA 1J4HA 4DZ3A 1F40A 4W9OA 4ODMA 3KAHA 2PBCA 3TCZA 1W26A 4JFJA 2D9FA 4DRQA 3CGMA 2XP5A 3O5KA 2KI3A 3O5MA 3IKDA 4MGVA 1C9HA 2FKEA 1QPLA 2RURA 4ODRA 3KADA 1R9HA 3O5GA 1D6OA 3O5QA 4IQ2A 1T11A 1ZK6A 4TW7A 5DIVA 5GPGA 3RGCA 3IKGA 3B7XA 4IQCA 3NRKA 1KT0A 4LAWA 3I6CA 4U84A 4TW6A 2KFWA 3UQBA 1NSGA 2PV3A 5HWCA 4U85A 1J6YA 2AWGA 4DIPA 2F4EA 3KZ7A 2ZQVA 2MPHA 1YATA 2ZR4A 1FKRA 2KGJA 2XP4A 1D7JA 3PA7A 4TW8A
chains in the Genus database with same CATH superfamily
4KQZA 4WJXA 2UZ5A 2WLZA 4IPXA 4HARA 4QT3A 1SR0A 2PPNA 1D7IA 3RMEA 2L2SA 2A3CA 4BF8A 3WQWA 3ALFA 3OOBA 1LL4A 3JXVA 3O5LA 1FKBA 4MSPA 4LAXA 2PI6A 4DRJA 2RUDA 3CZ8A 1LL7A 1JCHB 1ZBVA 2B31A 3UI4A 1LG1A 1WNOA 5D75A 5HWBA 4HBEA 2XP9A 3ARYA 2ITKA 3CHDA 4TX0A 2LGOA 1FKFA 1M5YA 2M08A 1PBKA 3WIJA 1NWSA 3ARWA 3TDBA 2VCDA 1QZ2A 4URIA 1E6PA 2AOSA 2B5UB 2DT1A 1RD6A 1L1PA 2DT2A 1FKLA 1ZBKA 4DRNA 1LQ0A 3QOKA 2MNTA 1HKIA 2DPEA 3G6MA 3ARRA 1H0IA 4QZVB 1Q6IA 1HKKA 1J4RA 2DSWA 3AS2A 4N19A 4WKFA 3RM4A 3VAWA 2M2AA 4HBOA 3B9DA 2RSEA 4J4OA 1F8AB 4JFLA 1FKKA 2LJ4A 4DRKA 4W5UA 4Z2HA 3RM8A 4DRHA 3WD0A 4W9OA 2P4VA 1W26A 1SYTA 2WM0A 4P8VA 5HBFA 2D9FA 1QPLA 1R9HA 1IX5A 3RGCA 1W1YA 3UQBA 4UDMA 2ESCA 4ZPWR 4U85A 1W1VA 4DIPA 2F4EA 1OGBA 2ZR4A 2ZQVA 3FY1A 1VF8A 1CTNA 1HKMA 4DH0A 5HUAA 1HJVA 3WH0A 4DWSD 1FAPA 4ODOA 5I98A 5HT1A 5HW8A 4DRIA 4Z2GA 1WB0A 1FJDA 4MAVA 2DT0A 3KAGA 1Q6HA 4L72B 4U86A 5BXJA 5J6EA 4R5EA 3WD4A 2QF8A 4GGQA 2ZQSA 3ALGA 3JYJA 4JFMA 4FN2A 4DRPA 1J4IA 1FD9A 2ZR6A 1LG2A 4P8UA 4S3JA 1K9TA 3O5JA 2LPVA 4ODLA 4DWSB 4DWSA 2XPBA 3ARZA 2N87A 3AQUA 2ZQUA 3EY6A 4PTMA 3GU0A 4QIBA 3AROA 2XP6A 1GPFA 3MDYB 2ZQTA 3AS0A 4XAKA 5DIUA 4Q22A 3KABA 1QPFA 1OWQA 4DT4A 3ARUA 4ODKA 1W1TA 2FAPA 3ODKA 1NH6A 3O5FA 4TNSA 2PN0A 4TYOA 2YBUA 1ITXA 2KE0A 2YBTA 1Q1CA 3CHCA 4JFKA 2PPPA 1E6ZA 3O5PA 1Y0OA 1GOIA 1EIBA 1NWTA 2Y78A 1X6LA 4P8WA 1D2KA 3W4RA 3O5IA 1HJXA 1FKSA 1HKJA 3WL1A 1FFQA 2WLYA 4ZPTR 4QT2A 1F40A 1J4HA 3KAHA 1ZU8A 3O5MA 2KI3A 3IKDA 1E15A 2FKEA 1E6RA 2WK2A 3O5QA 1D6OA 1TFVA 1X6NA 1FFRA 3B7XA 3NRKA 4Z2KA 4U84A 4L3NA 1NSGA 2EULA 2PV3A 5HWCA 2O9OA 4TW8A 4MNJA 5GPRA 1O6IA 1BL4A 2DG4A 2IUZA 1H0GA 3UQAA 3RFWA 3KCEA 2FDMA 2RUQA 2KO7A 3ARTA 3PRDA 1LL6A 1YW5A 2RQSA 4R0XA 3EIPA 1BKFA 4DRMA 2K8IA 4JFIA 1FKGA 3AS1A 1OGGA 1P5QA 1ROUA 1JNDA 5DF0A 1A7XA 3WL0A 1WAWA 3ARSA 4WKAA 3TC5A 1W1PA 1FKIA 4W9QA 1Q6UA 4LAYA 2MLXA 4G2PA 3GTYX 4WIWA 4FAPA 3B9EA 3NI6A 4MPKA 1NWRA 4C02B 2DG3A 3IHZA 1FKDA 3O5RA 1HXVA 3CHEA 2JZVA 1JNTA 2F23A 4KR0B 3PRBA 5DO2A 5HTGA 1KT1A 3B9AA 4MTVA 1ZB5A 3CGNA 3ARPA 3G6LA 4IT6A 4NNRA 3CHFA 5HW6A 3H9RB 4ODNA 2G8ZA 4GIVA 3FAPA 3PRAA 1N1AA 4S3KA 1E9LA 2DG9A 2O92A 1B6CA 1FKHA 2MLYA 3LUOA 3ARVA 2OFNA 3O5OA 2VN1A 1GUVA 4O2TA 2KR7A 2PV1A 2F2DA 2PV2A 4Z2JA 5B8IC 1NMWA 1D7HA 4DZ3A 4ODMA 2PBCA 4MNKA 1W9PA 4JFJA 4MGVA 4NZCA 4P8XA 1E6NA 4ODRA 1E44A 4ML4A 2DT3A 4IQ2A 1T11A 5GPGA 3AS3A 4IQCA 1KT0A 1EDQA 3ARQA 4TW6A 2KFWA 1ZBWA 1UR8A 1J6YA 4Q7NA 2G41A 1FKRA 1W9VA 3PA7A 3ARXA 4WK9A 3JYMA 2XP8A 4DWSC 4J4NA 5DITA 5JH8A 2A3BA 4IT4A 3KAIA 1EQ3A 3PR9A 1KFWA 1PINA 3O5DA 2A3EA 2M1IA 2Q5AA 2LKNA 4LGXA 5HKGA 3WQVA 3GPKA 2MF9A 4JYSA 4LAVA 4MNLA 4ITZA 2MLZA 1TCOC 2XP3A 2XP7A 3WD2A 4DROA 1XRVA 3NTPA 3O5EA 3RM9A 3BMBA 4Z2IA 4DZ2A 3WD3A 1GRJA 1HJWA 1JNEA 4ODPA 3BXWA 4Z2LA 3UI6A 2ETNA 2F21A 1JNSA 4WKHA 1ZCNA 1JVWA 2XPAA 1ZL1A 2IF4A 1U79A 1LJYA 2PPOA 1NMVA 4ODQA 1EYMA 1XHGA 3IK8A 5DEZA 1FKTA 4NSBA 3KAFA 3KACA 1ROTA 3UQIA 5HW7A 1ZBCA 2RUCA 3UI5A 4AY1A 3UF8A 2A3AA 3WD1A 1EHNA 2DSUA 1W9UA 2ZR5A 1FKJA 3WKZA 5GQBA 4W9PA 4ZPVR 3OA5A 4MNMA 3TCZA 4ZS6A 2DSZA 1NWUA 3B8SA 4DRQA 3CGMA 2XP5A 3O5KA 1C9HA 2RURA 3KADA 3O5GA 5DIVA 4TW7A 1ZK6A 2DSVA 3IKGA 1UR9A 3CH9A 4LAWA 3I6CA 2AWGA 3FXYA 3KZ7A 2OLHA 2MPHA 1YATA 2KGJA 2XP4A 1D7JA 4G50A
chains in the Genus database with same CATH topology
4KQZA 4WJXA 2UZ5A 2WLZA 4IPXA 4HARA 4QT3A 1SR0A 2PPNA 1D7IA 3RMEA 2L2SA 2A3CA 4BF8A 3WQWA 3ALFA 3OOBA 1LL4A 3JXVA 3O5LA 1FKBA 4MSPA 4LAXA 2PI6A 4DRJA 2RUDA 3CZ8A 1LL7A 1ZBVA 2B31A 3UI4A 1LG1A 1WNOA 5D75A 5HWBA 4HBEA 2XP9A 3ARYA 2ITKA 3CHDA 4TX0A 2LGOA 1FKFA 1M5YA 2M08A 1PBKA 3WIJA 1NWSA 3ARWA 3TDBA 2VCDA 1QZ2A 4URIA 1E6PA 2AOSA 2DT1A 1RD6A 1L1PA 2DT2A 1FKLA 1ZBKA 4DRNA 1LQ0A 3QOKA 2MNTA 1HKIA 2DPEA 3G6MA 3ARRA 1H0IA 4QZVB 1Q6IA 1HKKA 1J4RA 2DSWA 3AS2A 4N19A 4WKFA 3RM4A 3VAWA 2M2AA 4HBOA 3B9DA 4J4OA 2RSEA 4JFLA 1F8AB 1FKKA 2LJ4A 4DRKA 4W5UA 4Z2HA 3RM8A 4DRHA 3WD0A 4W9OA 1W26A 1SYTA 2WM0A 4P8VA 5HBFA 2D9FA 1QPLA 1R9HA 1IX5A 3RGCA 1W1YA 3UQBA 2ESCA 4ZPWR 4U85A 1W1VA 4DIPA 2F4EA 1OGBA 2ZR4A 2ZQVA 3FY1A 1VF8A 1CTNA 1HKMA 4DH0A 5HUAA 1HJVA 3WH0A 4DWSD 1FAPA 4ODOA 5I98A 5HT1A 5HW8A 4DRIA 4Z2GA 1WB0A 1FJDA 4MAVA 2DT0A 3KAGA 1Q6HA 4L72B 4U86A 5BXJA 5J6EA 4R5EA 3WD4A 2QF8A 4GGQA 2ZQSA 3ALGA 3JYJA 4JFMA 4FN2A 4DRPA 1J4IA 1FD9A 2ZR6A 1LG2A 4P8UA 4S3JA 1K9TA 3O5JA 2LPVA 4ODLA 4DWSB 4DWSA 2XPBA 3ARZA 2N87A 3AQUA 2ZQUA 3EY6A 4PTMA 4QIBA 3AROA 2XP6A 1GPFA 3MDYB 2ZQTA 3AS0A 4XAKA 5DIUA 4Q22A 3KABA 1QPFA 1OWQA 4DT4A 3ARUA 4ODKA 1W1TA 2FAPA 3ODKA 1NH6A 3O5FA 4TNSA 4TYOA 2YBUA 1ITXA 2KE0A 2YBTA 1Q1CA 3CHCA 4JFKA 2PPPA 1E6ZA 3O5PA 1Y0OA 1GOIA 1EIBA 1NWTA 2Y78A 1X6LA 4P8WA 1D2KA 3W4RA 3O5IA 1HJXA 1FKSA 1HKJA 3WL1A 1FFQA 2WLYA 4ZPTR 4QT2A 1F40A 1J4HA 3KAHA 1ZU8A 3O5MA 2KI3A 3IKDA 1E15A 2FKEA 1E6RA 2WK2A 3O5QA 1D6OA 1TFVA 1X6NA 1FFRA 3B7XA 3NRKA 4Z2KA 4U84A 4L3NA 1NSGA 2PV3A 5HWCA 2O9OA 4TW8A 4MNJA 5GPRA 1O6IA 1BL4A 2DG4A 2IUZA 1H0GA 3UQAA 3RFWA 3KCEA 2FDMA 2RUQA 2KO7A 3ARTA 1LL6A 1YW5A 2RQSA 3PRDA 4R0XA 1BKFA 4DRMA 2K8IA 4JFIA 1FKGA 3AS1A 1OGGA 1P5QA 1ROUA 1JNDA 5DF0A 1A7XA 3WL0A 1WAWA 3ARSA 4WKAA 3TC5A 1W1PA 1FKIA 4W9QA 1Q6UA 4LAYA 2MLXA 4G2PA 4WIWA 4FAPA 3B9EA 3NI6A 4MPKA 1NWRA 4C02B 2DG3A 3IHZA 1FKDA 3O5RA 1HXVA 3CHEA 2JZVA 1JNTA 4KR0B 3PRBA 5DO2A 5HTGA 1KT1A 3B9AA 4MTVA 1ZB5A 3CGNA 3ARPA 3G6LA 4IT6A 4NNRA 3CHFA 5HW6A 3H9RB 4ODNA 2G8ZA 4GIVA 3FAPA 3PRAA 1N1AA 4S3KA 1E9LA 2DG9A 2O92A 1B6CA 1FKHA 2MLYA 3LUOA 3ARVA 2OFNA 3O5OA 2VN1A 1GUVA 4O2TA 2KR7A 2PV1A 2F2DA 2PV2A 4Z2JA 5B8IC 1NMWA 1D7HA 4DZ3A 4ODMA 2PBCA 4MNKA 1W9PA 4JFJA 4MGVA 4NZCA 4P8XA 1E6NA 4ODRA 4ML4A 2DT3A 4IQ2A 1T11A 5GPGA 3AS3A 4IQCA 1KT0A 1EDQA 3ARQA 4TW6A 2KFWA 1ZBWA 1UR8A 1J6YA 4Q7NA 2G41A 1FKRA 1W9VA 3PA7A 3ARXA 4WK9A 3JYMA 2XP8A 4DWSC 4J4NA 5DITA 5JH8A 2A3BA 4IT4A 3KAIA 1EQ3A 3PR9A 1KFWA 1PINA 3O5DA 2A3EA 2M1IA 2Q5AA 2LKNA 4LGXA 5HKGA 3WQVA 3GPKA 2MF9A 4JYSA 4LAVA 4MNLA 4ITZA 2MLZA 1TCOC 2XP3A 2XP7A 3WD2A 4DROA 1XRVA 3NTPA 3O5EA 3RM9A 4Z2IA 4DZ2A 3WD3A 1HJWA 1JNEA 4ODPA 3BXWA 4Z2LA 3UI6A 2F21A 1JNSA 4WKHA 1ZCNA 1JVWA 2XPAA 1ZL1A 2IF4A 1U79A 1LJYA 2PPOA 1NMVA 4ODQA 1EYMA 1XHGA 3IK8A 5DEZA 1FKTA 4NSBA 3KAFA 3KACA 1ROTA 3UQIA 5HW7A 1ZBCA 2RUCA 3UI5A 4AY1A 3UF8A 2A3AA 3WD1A 1EHNA 2DSUA 1W9UA 2ZR5A 1FKJA 3WKZA 5GQBA 4W9PA 4ZPVR 3OA5A 4MNMA 3TCZA 4ZS6A 2DSZA 1NWUA 3B8SA 4DRQA 3CGMA 2XP5A 3O5KA 1C9HA 2RURA 3KADA 3O5GA 5DIVA 4TW7A 1ZK6A 2DSVA 3IKGA 1UR9A 3CH9A 4LAWA 3I6CA 2AWGA 3FXYA 3KZ7A 2OLHA 2MPHA 1YATA 2KGJA 2XP4A 1D7JA 4G50A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  2UZ5 A;  2XP8 A;  3JYM A;  4IPX A;  4DH0 A;  5HUA A;  3WH0 A;  2DG4 A;  4J4N A;  1FAP A;  4ODO A;  5I98 A;  5DIT A;  5HT1 A;  3UQA A;  4QT3 A;  4DRI A;  5HW8 A;  3RFW A;  3KCE A;  2PPN A;  1D7I A;  2RUQ A;  2KO7 A;  3KAI A;  1EQ3 A;  1FJD A;  2L2S A;  3PRD A;  1YW5 A;  2RQS A;  1PIN A;  1Q6H A;  3KAG A;  3O5D A;  4R0X A;  4U86 A;  4BF8 A;  5BXJ A;  5J6E A;  1BKF A;  4GGQ A;  2ZQS A;  4DRM A;  3JYJ A;  4JFM A;  2K8I A;  2M1I A;  3OOB A;  4FN2 A;  3JXV A;  4JFI A;  3O5L A;  1FKG A;  4DRP A;  1FKB A;  1J4I A;  1FD9 A;  2Q5A A;  2LKN A;  2ZR6 A;  4LAX A;  4MSP A;  4DRJ A;  1P5Q A;  5HKG A;  2RUD A;  3O5J A;  2LPV A;  4ODL A;  3UI4 A;  3GPK A;  2MF9 A;  4JYS A;  4LAV A;  2XPB A;  1ROU A;  2MLZ A;  4ITZ A;  1TCO C;  1A7X A;  5D75 A;  5HWB A;  2XP3 A;  2XP7 A;  3TC5 A;  2N87 A;  2ZQU A;  1FKI A;  4W9Q A;  2XP9 A;  4DRO A;  1Q6U A;  4LAY A;  2MLX A;  3EY6 A;  2ITK A;  3NTP A;  3O5E A;  4G2P A;  4QIB A;  2LGO A;  4G50 A;  4TX0 A;  1FKF A;  1M5Y A;  2M08 A;  4FAP A;  4DZ2 A;  3NI6 A;  1PBK A;  2XP6 A;  3MDY B;  4C02 B;  2DG3 A;  2ZQT A;  3IHZ A;  1FKD A;  3O5R A;  4ODP A;  2VCD A;  3TDB A;  1HXV A;  5DIU A;  1QZ2 A;  2JZV A;  1JNT A;  3UI6 A;  3KAB A;  2F21 A;  1JNS A;  1L1P A;  3PRB A;  1FKL A;  1ZCN A;  5HTG A;  1QPF A;  4DT4 A;  4ODK A;  4DRN A;  1JVW A;  1KT1 A;  2FAP A;  2XPA A;  3CGN A;  2IF4 A;  3ODK A;  1U79 A;  2MNT A;  2PPO A;  3O5F A;  4NNR A;  1NMV A;  4ODQ A;  1EYM A;  5HW6 A;  4TNS A;  1Q6I A;  3H9R B;  3IK8 A;  4TYO A;  4ODN A;  2KE0 A;  1FKT A;  1J4R A;  4GIV A;  3FAP A;  1N1A A;  3KAF A;  1Q1C A;  3KAC A;  4JFK A;  1ROT A;  2PPP A;  3UQI A;  5HW7 A;  4N19 A;  2DG9 A;  2RUC A;  3O5P A;  3UI5 A;  3UF8 A;  1B6C A;  1FKH A;  1Y0O A;  2M2A A;  2MLY A;  2OFN A;  3LUO A;  3VAW A;  3O5O A;  2VN1 A;  4O2T A;  2KR7 A;  2RSE A;  2Y78 A;  4J4O A;  1F8A B;  4JFL A;  1FKK A;  2LJ4 A;  2PV1 A;  4DRK A;  3O5I A;  2F2D A;  2PV2 A;  2ZR5 A;  1FKJ A;  1FKS A;  5B8I C;  1NMW A;  1D7H A;  4QT2 A;  4W9P A;  4DRH A;  1J4H A;  4DZ3 A;  1F40 A;  4W9O A;  4ODM A;  3KAH A;  2PBC A;  3TCZ A;  1W26 A;  4JFJ A;  2D9F A;  4DRQ A;  3CGM A;  2XP5 A;  3O5K A;  2KI3 A;  3O5M A;  3IKD A;  4MGV A;  1C9H A;  2FKE A;  1QPL A;  2RUR A;  4ODR A;  3KAD A;  1R9H A;  3O5G A;  1D6O A;  3O5Q A;  4IQ2 A;  1T11 A;  1ZK6 A;  4TW7 A;  5DIV A;  5GPG A;  3RGC A;  3IKG A;  3B7X A;  4IQC A;  3NRK A;  1KT0 A;  4LAW A;  3I6C A;  4U84 A;  4TW6 A;  2KFW A;  3UQB A;  1NSG A;  2PV3 A;  5HWC A;  4U85 A;  1J6Y A;  2AWG A;  4DIP A;  2F4E A;  3KZ7 A;  2ZQV A;  2MPH A;  1YAT A;  2ZR4 A;  1FKR A;  2KGJ A;  2XP4 A;  1D7J A;  3PA7 A;  4TW8 A; 
#chains in the Genus database with same CATH topology
 4KQZ A;  4WJX A;  2UZ5 A;  2WLZ A;  4IPX A;  4HAR A;  4QT3 A;  1SR0 A;  2PPN A;  1D7I A;  3RME A;  2L2S A;  2A3C A;  4BF8 A;  3WQW A;  3ALF A;  3OOB A;  1LL4 A;  3JXV A;  3O5L A;  1FKB A;  4MSP A;  4LAX A;  2PI6 A;  4DRJ A;  2RUD A;  3CZ8 A;  1LL7 A;  1JCH B;  1ZBV A;  2B31 A;  3UI4 A;  1LG1 A;  1WNO A;  5D75 A;  5HWB A;  4HBE A;  2XP9 A;  3ARY A;  2ITK A;  3CHD A;  4TX0 A;  2LGO A;  1FKF A;  1M5Y A;  2M08 A;  1PBK A;  3WIJ A;  1NWS A;  3ARW A;  3TDB A;  2VCD A;  1QZ2 A;  4URI A;  1E6P A;  2AOS A;  2B5U B;  2DT1 A;  1RD6 A;  1L1P A;  2DT2 A;  1FKL A;  1ZBK A;  4DRN A;  1LQ0 A;  3QOK A;  2MNT A;  1HKI A;  2DPE A;  3G6M A;  3ARR A;  1H0I A;  4QZV B;  1Q6I A;  1HKK A;  1J4R A;  2DSW A;  3AS2 A;  4N19 A;  4WKF A;  3RM4 A;  3VAW A;  2M2A A;  4HBO A;  3B9D A;  2RSE A;  4J4O A;  1F8A B;  4JFL A;  1FKK A;  2LJ4 A;  4DRK A;  4W5U A;  4Z2H A;  3RM8 A;  4DRH A;  3WD0 A;  4W9O A;  2P4V A;  1W26 A;  1SYT A;  2WM0 A;  4P8V A;  5HBF A;  2D9F A;  1QPL A;  1R9H A;  1IX5 A;  3RGC A;  1W1Y A;  3UQB A;  4UDM A;  2ESC A;  4ZPW R;  4U85 A;  1W1V A;  4DIP A;  2F4E A;  1OGB A;  2ZR4 A;  2ZQV A;  3FY1 A;  1VF8 A;  1CTN A;  1HKM A;  4DH0 A;  5HUA A;  1HJV A;  3WH0 A;  4DWS D;  1FAP A;  4ODO A;  5I98 A;  5HT1 A;  5HW8 A;  4DRI A;  4Z2G A;  1WB0 A;  1FJD A;  4MAV A;  2DT0 A;  3KAG A;  1Q6H A;  4L72 B;  4U86 A;  5BXJ A;  5J6E A;  4R5E A;  3WD4 A;  2QF8 A;  4GGQ A;  2ZQS A;  3ALG A;  3JYJ A;  4JFM A;  4FN2 A;  4DRP A;  1J4I A;  1FD9 A;  2ZR6 A;  1LG2 A;  4P8U A;  4S3J A;  1K9T A;  3O5J A;  2LPV A;  4ODL A;  4DWS B;  4DWS A;  2XPB A;  3ARZ A;  2N87 A;  3AQU A;  2ZQU A;  3EY6 A;  4PTM A;  3GU0 A;  4QIB A;  3ARO A;  2XP6 A;  1GPF A;  3MDY B;  2ZQT A;  3AS0 A;  4XAK A;  5DIU A;  4Q22 A;  3KAB A;  1QPF A;  1OWQ A;  4DT4 A;  3ARU A;  4ODK A;  1W1T A;  2FAP A;  3ODK A;  1NH6 A;  3O5F A;  4TNS A;  2PN0 A;  4TYO A;  2YBU A;  1ITX A;  2KE0 A;  2YBT A;  1Q1C A;  3CHC A;  4JFK A;  2PPP A;  1E6Z A;  3O5P A;  1Y0O A;  1GOI A;  1EIB A;  1NWT A;  2Y78 A;  1X6L A;  4P8W A;  1D2K A;  3W4R A;  3O5I A;  1HJX A;  1FKS A;  1HKJ A;  3WL1 A;  1FFQ A;  2WLY A;  4ZPT R;  4QT2 A;  1F40 A;  1J4H A;  3KAH A;  1ZU8 A;  3O5M A;  2KI3 A;  3IKD A;  1E15 A;  2FKE A;  1E6R A;  2WK2 A;  3O5Q A;  1D6O A;  1TFV A;  1X6N A;  1FFR A;  3B7X A;  3NRK A;  4Z2K A;  4U84 A;  4L3N A;  1NSG A;  2EUL A;  2PV3 A;  5HWC A;  2O9O A;  4TW8 A;  4MNJ A;  5GPR A;  1O6I A;  1BL4 A;  2DG4 A;  2IUZ A;  1H0G A;  3UQA A;  3RFW A;  3KCE A;  2FDM A;  2RUQ A;  2KO7 A;  3ART A;  3PRD A;  1LL6 A;  1YW5 A;  2RQS A;  4R0X A;  3EIP A;  1BKF A;  4DRM A;  2K8I A;  4JFI A;  1FKG A;  3AS1 A;  1OGG A;  1P5Q A;  1ROU A;  1JND A;  5DF0 A;  1A7X A;  3WL0 A;  1WAW A;  3ARS A;  4WKA A;  3TC5 A;  1W1P A;  1FKI A;  4W9Q A;  1Q6U A;  4LAY A;  2MLX A;  4G2P A;  3GTY X;  4WIW A;  4FAP A;  3B9E A;  3NI6 A;  4MPK A;  1NWR A;  4C02 B;  2DG3 A;  3IHZ A;  1FKD A;  3O5R A;  1HXV A;  3CHE A;  2JZV A;  1JNT A;  2F23 A;  4KR0 B;  3PRB A;  5DO2 A;  5HTG A;  1KT1 A;  3B9A A;  4MTV A;  1ZB5 A;  3CGN A;  3ARP A;  3G6L A;  4IT6 A;  4NNR A;  3CHF A;  5HW6 A;  3H9R B;  4ODN A;  2G8Z A;  4GIV A;  3FAP A;  3PRA A;  1N1A A;  4S3K A;  1E9L A;  2DG9 A;  2O92 A;  1B6C A;  1FKH A;  2MLY A;  3LUO A;  3ARV A;  2OFN A;  3O5O A;  2VN1 A;  1GUV A;  4O2T A;  2KR7 A;  2PV1 A;  2F2D A;  2PV2 A;  4Z2J A;  5B8I C;  1NMW A;  1D7H A;  4DZ3 A;  4ODM A;  2PBC A;  4MNK A;  1W9P A;  4JFJ A;  4MGV A;  4NZC A;  4P8X A;  1E6N A;  4ODR A;  1E44 A;  4ML4 A;  2DT3 A;  4IQ2 A;  1T11 A;  5GPG A;  3AS3 A;  4IQC A;  1KT0 A;  1EDQ A;  3ARQ A;  4TW6 A;  2KFW A;  1ZBW A;  1UR8 A;  1J6Y A;  4Q7N A;  2G41 A;  1FKR A;  1W9V A;  3PA7 A;  3ARX A;  4WK9 A;  3JYM A;  2XP8 A;  4DWS C;  4J4N A;  5DIT A;  5JH8 A;  2A3B A;  4IT4 A;  3KAI A;  1EQ3 A;  3PR9 A;  1KFW A;  1PIN A;  3O5D A;  2A3E A;  2M1I A;  2Q5A A;  2LKN A;  4LGX A;  5HKG A;  3WQV A;  3GPK A;  2MF9 A;  4JYS A;  4LAV A;  4MNL A;  4ITZ A;  2MLZ A;  1TCO C;  2XP3 A;  2XP7 A;  3WD2 A;  4DRO A;  1XRV A;  3NTP A;  3O5E A;  3RM9 A;  3BMB A;  4Z2I A;  4DZ2 A;  3WD3 A;  1GRJ A;  1HJW A;  1JNE A;  4ODP A;  3BXW A;  4Z2L A;  3UI6 A;  2ETN A;  2F21 A;  1JNS A;  4WKH A;  1ZCN A;  1JVW A;  2XPA A;  1ZL1 A;  2IF4 A;  1U79 A;  1LJY A;  2PPO A;  1NMV A;  4ODQ A;  1EYM A;  1XHG A;  3IK8 A;  5DEZ A;  1FKT A;  4NSB A;  3KAF A;  3KAC A;  1ROT A;  3UQI A;  5HW7 A;  1ZBC A;  2RUC A;  3UI5 A;  4AY1 A;  3UF8 A;  2A3A A;  3WD1 A;  1EHN A;  2DSU A;  1W9U A;  2ZR5 A;  1FKJ A;  3WKZ A;  5GQB A;  4W9P A;  4ZPV R;  3OA5 A;  4MNM A;  3TCZ A;  4ZS6 A;  2DSZ A;  1NWU A;  3B8S A;  4DRQ A;  3CGM A;  2XP5 A;  3O5K A;  1C9H A;  2RUR A;  3KAD A;  3O5G A;  5DIV A;  4TW7 A;  1ZK6 A;  2DSV A;  3IKG A;  1UR9 A;  3CH9 A;  4LAW A;  3I6C A;  2AWG A;  3FXY A;  3KZ7 A;  2OLH A;  2MPH A;  1YAT A;  2KGJ A;  2XP4 A;  1D7J A;  4G50 A; 
#chains in the Genus database with same CATH homology
 4KQZ A;  4WJX A;  2UZ5 A;  2WLZ A;  4IPX A;  4HAR A;  4QT3 A;  1SR0 A;  2PPN A;  1D7I A;  3RME A;  2L2S A;  2A3C A;  4BF8 A;  3WQW A;  3ALF A;  3OOB A;  1LL4 A;  3JXV A;  3O5L A;  1FKB A;  4MSP A;  4LAX A;  2PI6 A;  4DRJ A;  2RUD A;  3CZ8 A;  1LL7 A;  1ZBV A;  2B31 A;  3UI4 A;  1LG1 A;  1WNO A;  5D75 A;  5HWB A;  4HBE A;  2XP9 A;  3ARY A;  2ITK A;  3CHD A;  4TX0 A;  2LGO A;  1FKF A;  1M5Y A;  2M08 A;  1PBK A;  3WIJ A;  1NWS A;  3ARW A;  3TDB A;  2VCD A;  1QZ2 A;  4URI A;  1E6P A;  2AOS A;  2DT1 A;  1RD6 A;  1L1P A;  2DT2 A;  1FKL A;  1ZBK A;  4DRN A;  1LQ0 A;  3QOK A;  2MNT A;  1HKI A;  2DPE A;  3G6M A;  3ARR A;  1H0I A;  4QZV B;  1Q6I A;  1HKK A;  1J4R A;  2DSW A;  3AS2 A;  4N19 A;  4WKF A;  3RM4 A;  3VAW A;  2M2A A;  4HBO A;  3B9D A;  4J4O A;  2RSE A;  4JFL A;  1F8A B;  1FKK A;  2LJ4 A;  4DRK A;  4W5U A;  4Z2H A;  3RM8 A;  4DRH A;  3WD0 A;  4W9O A;  1W26 A;  1SYT A;  2WM0 A;  4P8V A;  5HBF A;  2D9F A;  1QPL A;  1R9H A;  1IX5 A;  3RGC A;  1W1Y A;  3UQB A;  2ESC A;  4ZPW R;  4U85 A;  1W1V A;  4DIP A;  2F4E A;  1OGB A;  2ZR4 A;  2ZQV A;  3FY1 A;  1VF8 A;  1CTN A;  1HKM A;  4DH0 A;  5HUA A;  1HJV A;  3WH0 A;  4DWS D;  1FAP A;  4ODO A;  5I98 A;  5HT1 A;  5HW8 A;  4DRI A;  4Z2G A;  1WB0 A;  1FJD A;  4MAV A;  2DT0 A;  3KAG A;  1Q6H A;  4L72 B;  4U86 A;  5BXJ A;  5J6E A;  4R5E A;  3WD4 A;  2QF8 A;  4GGQ A;  2ZQS A;  3ALG A;  3JYJ A;  4JFM A;  4FN2 A;  4DRP A;  1J4I A;  1FD9 A;  2ZR6 A;  1LG2 A;  4P8U A;  4S3J A;  1K9T A;  3O5J A;  2LPV A;  4ODL A;  4DWS B;  4DWS A;  2XPB A;  3ARZ A;  2N87 A;  3AQU A;  2ZQU A;  3EY6 A;  4PTM A;  4QIB A;  3ARO A;  2XP6 A;  1GPF A;  3MDY B;  2ZQT A;  3AS0 A;  4XAK A;  5DIU A;  4Q22 A;  3KAB A;  1QPF A;  1OWQ A;  4DT4 A;  3ARU A;  4ODK A;  1W1T A;  2FAP A;  3ODK A;  1NH6 A;  3O5F A;  4TNS A;  4TYO A;  2YBU A;  1ITX A;  2KE0 A;  2YBT A;  1Q1C A;  3CHC A;  4JFK A;  2PPP A;  1E6Z A;  3O5P A;  1Y0O A;  1GOI A;  1EIB A;  1NWT A;  2Y78 A;  1X6L A;  4P8W A;  1D2K A;  3W4R A;  3O5I A;  1HJX A;  1FKS A;  1HKJ A;  3WL1 A;  1FFQ A;  2WLY A;  4ZPT R;  4QT2 A;  1F40 A;  1J4H A;  3KAH A;  1ZU8 A;  3O5M A;  2KI3 A;  3IKD A;  1E15 A;  2FKE A;  1E6R A;  2WK2 A;  3O5Q A;  1D6O A;  1TFV A;  1X6N A;  1FFR A;  3B7X A;  3NRK A;  4Z2K A;  4U84 A;  4L3N A;  1NSG A;  2PV3 A;  5HWC A;  2O9O A;  4TW8 A;  4MNJ A;  5GPR A;  1O6I A;  1BL4 A;  2DG4 A;  2IUZ A;  1H0G A;  3UQA A;  3RFW A;  3KCE A;  2FDM A;  2RUQ A;  2KO7 A;  3ART A;  1LL6 A;  1YW5 A;  2RQS A;  3PRD A;  4R0X A;  1BKF A;  4DRM A;  2K8I A;  4JFI A;  1FKG A;  3AS1 A;  1OGG A;  1P5Q A;  1ROU A;  1JND A;  5DF0 A;  1A7X A;  3WL0 A;  1WAW A;  3ARS A;  4WKA A;  3TC5 A;  1W1P A;  1FKI A;  4W9Q A;  1Q6U A;  4LAY A;  2MLX A;  4G2P A;  4WIW A;  4FAP A;  3B9E A;  3NI6 A;  4MPK A;  1NWR A;  4C02 B;  2DG3 A;  3IHZ A;  1FKD A;  3O5R A;  1HXV A;  3CHE A;  2JZV A;  1JNT A;  4KR0 B;  3PRB A;  5DO2 A;  5HTG A;  1KT1 A;  3B9A A;  4MTV A;  1ZB5 A;  3CGN A;  3ARP A;  3G6L A;  4IT6 A;  4NNR A;  3CHF A;  5HW6 A;  3H9R B;  4ODN A;  2G8Z A;  4GIV A;  3FAP A;  3PRA A;  1N1A A;  4S3K A;  1E9L A;  2DG9 A;  2O92 A;  1B6C A;  1FKH A;  2MLY A;  3LUO A;  3ARV A;  2OFN A;  3O5O A;  2VN1 A;  1GUV A;  4O2T A;  2KR7 A;  2PV1 A;  2F2D A;  2PV2 A;  4Z2J A;  5B8I C;  1NMW A;  1D7H A;  4DZ3 A;  4ODM A;  2PBC A;  4MNK A;  1W9P A;  4JFJ A;  4MGV A;  4NZC A;  4P8X A;  1E6N A;  4ODR A;  4ML4 A;  2DT3 A;  4IQ2 A;  1T11 A;  5GPG A;  3AS3 A;  4IQC A;  1KT0 A;  1EDQ A;  3ARQ A;  4TW6 A;  2KFW A;  1ZBW A;  1UR8 A;  1J6Y A;  4Q7N A;  2G41 A;  1FKR A;  1W9V A;  3PA7 A;  3ARX A;  4WK9 A;  3JYM A;  2XP8 A;  4DWS C;  4J4N A;  5DIT A;  5JH8 A;  2A3B A;  4IT4 A;  3KAI A;  1EQ3 A;  3PR9 A;  1KFW A;  1PIN A;  3O5D A;  2A3E A;  2M1I A;  2Q5A A;  2LKN A;  4LGX A;  5HKG A;  3WQV A;  3GPK A;  2MF9 A;  4JYS A;  4LAV A;  4MNL A;  4ITZ A;  2MLZ A;  1TCO C;  2XP3 A;  2XP7 A;  3WD2 A;  4DRO A;  1XRV A;  3NTP A;  3O5E A;  3RM9 A;  4Z2I A;  4DZ2 A;  3WD3 A;  1HJW A;  1JNE A;  4ODP A;  3BXW A;  4Z2L A;  3UI6 A;  2F21 A;  1JNS A;  4WKH A;  1ZCN A;  1JVW A;  2XPA A;  1ZL1 A;  2IF4 A;  1U79 A;  1LJY A;  2PPO A;  1NMV A;  4ODQ A;  1EYM A;  1XHG A;  3IK8 A;  5DEZ A;  1FKT A;  4NSB A;  3KAF A;  3KAC A;  1ROT A;  3UQI A;  5HW7 A;  1ZBC A;  2RUC A;  3UI5 A;  4AY1 A;  3UF8 A;  2A3A A;  3WD1 A;  1EHN A;  2DSU A;  1W9U A;  2ZR5 A;  1FKJ A;  3WKZ A;  5GQB A;  4W9P A;  4ZPV R;  3OA5 A;  4MNM A;  3TCZ A;  4ZS6 A;  2DSZ A;  1NWU A;  3B8S A;  4DRQ A;  3CGM A;  2XP5 A;  3O5K A;  1C9H A;  2RUR A;  3KAD A;  3O5G A;  5DIV A;  4TW7 A;  1ZK6 A;  2DSV A;  3IKG A;  1UR9 A;  3CH9 A;  4LAW A;  3I6C A;  2AWG A;  3FXY A;  3KZ7 A;  2OLH A;  2MPH A;  1YAT A;  2KGJ A;  2XP4 A;  1D7J A;  4G50 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...