4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
2PBCA 2LGOA 1D7JA 1YATA 4JFJA 1NMVA 2FKEA 3JXVA 1QPFA 1B6CA 1FKKA 3KCEA 3O5OA 4BF8A 1FKDA 4IQCA 5BXJA 4TNSA 2PPNA 2RUCA 4LAVA 1J4HA 2ITKA 2KO7A 3VAWA 4ODRA 2M2AA 5HWCA 1PINA 4W9PA 2LPVA 1J4IA 4TYOA 5DITA 3TC5A 3B7XA 3PRBA 2F4EA 4DZ2A 5HUAA 5HKGA 1A7XA 4DRQA 1P5QA 2L2SA 1Q1CA 3IK8A 4GIVA 4DRMA 2PPPA 4G2PA 4TW6A 4TW8A 4U84A 4DRJA 3O5KA 4DRHA 3IKDA 5B8IC 1M5YA 3JYJA 4IPXA 4DRPA 3UQBA 2KI3A 1T11A 4IQ2A 4DT4A 1L1PA 2ZQUA 2ZR6A 5J6EA 2XP7A 3O5PA 2PV2A 3UQAA 2XP9A 2RSEA 3O5EA 1FKSA 2PV1A 2XP5A 3TCZA 2PV3A 2XPBA 4JFIA 4FAPA 2MLXA 3FAPA 3ODKA 5HW7A 2UZ5A 4DIPA 1D7HA 1NMWA 3KZ7A 4DRIA 4DZ3A 5DIUA 2Q5AA 4ODLA 2MNTA 2M08A 4W9QA 3IKGA 3O5LA 4N19A 4TX0A 3LUOA 4ODOA 5HW6A 3PA7A 3RGCA 1JNTA 4ITZA 5GPGA 4ODNA 1N1AA 1PBKA 2XP6A 4JFKA 4QIBA 3RFWA 2ZQTA 1FKLA 1J4RA 2XP4A 4U86A 4DRKA 1R9HA 3NRKA 3KAHA 3NI6A 4J4OA 1ZCNA 3H9RB 4DRNA 2RQSA 4DH0A 3JYMA 2MF9A 1U79A 4JYSA 1QPLA 2ZQSA 3O5DA 2VN1A 3MDYB 1ROUA 3UF8A 1BKFA 1FD9A 2ZR4A 4U85A 2DG9A 3O5QA 1FKRA 3KADA 1W26A 2K8IA 4FN2A 1J6YA 1FKTA 5I98A 4DROA 1Q6IA 1TCOC 1FKJA 3KACA 3TDBA 4C02B 2D9FA 4MSPA 1FKBA 2JZVA 2Y78A 3NTPA 1FKFA 4R0XA 1QZ2A 5HT1A 3CGMA 4JFLA 3KAGA 1EQ3A 2RUQA 4QT2A 1FKHA 1NSGA 2ZQVA 2LKNA 4G50A 4ODQA 2MLYA 1ZK6A 1Q6UA 3EY6A 3KAIA 3UQIA 1JNSA 1HXVA 3UI4A 4GGQA 2ZR5A 4ODKA 5HW8A 3O5IA 3PRDA 2MPHA 1BL4A 2MLZA 5D75A 2F21A 2VCDA 2FAPA 4QT3A 3CGNA 1F40A 2KR7A 5HWBA 2XPAA 3GPKA 1F8AB 1EYMA 1KT1A 1FKIA 3O5GA 3O5FA 2OFNA 3O5MA 4J4NA 1ROTA 1Y0OA 3O5JA 1FKGA 3UI5A 3KABA 1D6OA 4W9OA 3O5RA 2N87A 5DIVA 4NNRA 3WH0A 2XP8A 1D7IA 3IHZA 4TW7A 2F2DA 2AWGA 2DG4A 4O2TA 3KAFA 4LAYA 2DG3A 4ODMA 1YW5A 4MGVA 4ODPA 1FAPA 2M1IA 2RURA 4JFMA 2LJ4A 4LAWA 3I6CA 2PPOA 1FJDA 1JVWA 1Q6HA 1KT0A 2IF4A 2RUDA 3UI6A 1C9HA 2XP3A 2KE0A 4LAXA 3OOBA 2KFWA 5HTGA 2KGJA
chains in the Genus database with same CATH superfamily
2G41A 1SR0A 4AY1A 1QPFA 1FKKA 3O5OA 4TNSA 4XAKA 2QF8A 5HWCA 1PINA 1E9LA 1XHGA 5DITA 2F4EA 5HUAA 4DRQA 1P5QA 3WD4A 1Q1CA 4DRMA 4WKHA 4G2PA 4WJXA 4U84A 4DRJA 3O5KA 3CHCA 4IQ2A 1L1PA 2XP9A 2RSEA 4DWSB 2PV3A 1E6RA 4JFIA 3RMEA 1SYTA 4DIPA 4Z2LA 3AS2A 2WK2A 5DIUA 4W9QA 4WKFA 2DSUA 3LUOA 3PA7A 5GPGA 2O92A 3ALFA 4DRKA 1ITXA 1R9HA 1KFWA 3ARQA 3ARSA 3WQVA 3KAHA 4HARA 4DH0A 1NWRA 1ZB5A 2VN1A 4DWSD 1FD9A 2ZR4A 3PRAA 3KADA 4FN2A 2F23A 3TDBA 3KACA 2A3EA 2Y78A 5GQBA 4R0XA 1FKFA 1QZ2A 1EQ3A 4JFLA 2RUQA 3W4RA 1EDQA 1ZBWA 1W9PA 4G50A 4ODQA 2MLYA 3G6MA 1HXVA 3UI4A 2ZR5A 4IT4A 4UDMA 1UR9A 3CHEA 2FAPA 1EIBA 2OLHA 2XPAA 1F8AB 1EYMA 3O5FA 1FKIA 1OGGA 4WK9A 3O5MA 1Y0OA 3O5JA 3UI5A 3KABA 1D6OA 5DIVA 3O5RA 2N87A 2XP8A 2F2DA 3WD0A 1W1VA 2DG4A 1W1YA 4MPKA 4ODMA 4ODPA 2M1IA 2RURA 3BXWA 3ALGA 2ETNA 2DT0A 2IF4A 3CZ8A 2RUDA 1HKMA 1C9HA 2XP3A 2KE0A 2YBTA 4LAXA 2XP4A 5HTGA 4URIA 1D7JA 4JFJA 1NMVA 1B6CA 1FKDA 2PPNA 2ITKA 3VAWA 4ODRA 2LPVA 3RM9A 2P4VA 4TW8A 3B9DA 1W9UA 3PR9A 3WL0A 1TFVA 1T11A 2A3CA 2PV2A 1W9VA 4MTVA 4MAVA 2XPBA 4W5UA 4FAPA 1LL7A 2MLXA 3ODKA 3KZ7A 1OGBA 2A3AA 4WIWA 4ODLA 2MNTA 2M08A 3IKGA 1UR8A 3OA5A 4MNMA 4ODOA 3RGCA 1N1AA 2XP6A 2WLYA 3ARWA 2ZQTA 1J4RA 4U86A 1NWTA 3H9RB 4MNJA 3ARPA 3MDYB 1ROUA 3UF8A 4U85A 1W26A 1J6YA 4ML4A 4DROA 4S3KA 1FKJA 1GPFA 4C02B 4MSPA 3FY1A 5HT1A 1K9TA 3KAGA 3ARRA 3ARZA 2ZQVA 2LKNA 1ZBVA 3KAIA 3UQIA 1JNSA 4GGQA 4ODKA 3AROA 2MLZA 1BL4A 2DPEA 2VCDA 4QT3A 3CGNA 1F40A 2PN0A 5HWBA 1ZBCA 3G6LA 4W9OA 4LGXA 2O9OA 4WKAA 3WH0A 4NNRA 1HJXA 1LJYA 4PTMA 1E15A 3IHZA 2WM0A 4O2TA 4IT6A 4LAYA 1YW5A 1D2KA 1IX5A 3WL1A 3CHDA 5DEZA 3CHFA 1KT0A 3UI6A 3OOBA 2KGJA 2PBCA 2LGOA 3JXVA 1CTNA 3ARVA 4BF8A 4IQCA 4KR0B 2RUCA 1ZU8A 4Q7NA 1E6ZA 4TYOA 1J4IA 2DT1A 3TC5A 1FFQA 3PRBA 1W1TA 4DZ2A 2G8ZA 5HKGA 2L2SA 4GIVA 2B5UB 4DWSC 4DRHA 5B8IC 5JH8A 4DRPA 1HKIA 2KI3A 1NWUA 4DT4A 2ZR6A 5J6EA 4ZPWR 3O5PA 3UQAA 2DSWA 2XP5A 1HKJA 4NZCA 5HW7A 2UZ5A 1O6IA 1D7HA 1NMWA 4DRIA 4DZ3A 2Q5AA 3AQUA 3O5LA 3GU0A 5HW6A 1JNTA 4QIBA 2DSVA 4MNKA 4MNLA 4S3JA 4J4OA 1ZCNA 2RQSA 2MF9A 1U79A 1BKFA 1HJWA 2DG9A 3O5QA 1FKRA 1FKTA 5HBFA 5I98A 1Q6IA 3ARTA 2D9FA 3GTYX 1FKBA 3NTPA 3CH9A 4QT2A 4P8WA 4Z2IA 1W1PA 3O5IA 2AOSA 4HBEA 5D75A 1E6NA 4Q22A 2KR7A 1KT1A 2OFNA 1LL6A 1ROTA 1EHNA 1FKGA 1GRJA 1D7IA 4TW7A 3WD3A 4L72B 1ZBKA 4L3NA 3KAFA 3WKZA 4MGVA 1X6LA 1X6NA 3B8SA 4P8VA 4ZPTR 1LL4A 2PPOA 1JVWA 1Q6HA 1JNDA 1JCHB 3O5GA 2DT3A 1YATA 2FKEA 3KCEA 1GOIA 2EULA 5BXJA 2IUZA 4LAVA 1J4HA 1H0GA 2KO7A 2M2AA 4W9PA 1H0IA 3WD2A 1LG2A 3B7XA 1A7XA 3EIPA 1FFRA 3ARXA 3IK8A 2ESCA 2PPPA 4TW6A 3IKDA 1M5YA 3JYJA 4IPXA 3WQWA 1OWQA 2ZQUA 3B9AA 2XP7A 1E44A 3O5EA 5GPRA 1FKSA 2PV1A 3TCZA 4R5EA 3RM8A 1HKKA 3FAPA 1RD6A 4NSBA 4N19A 4TX0A 3WIJA 1LQ0A 2DSZA 4ITZA 4ODNA 1PBKA 3QOKA 4JFKA 4KQZA 3RFWA 1NWSA 1FKLA 3ARUA 4ZPVR 3NRKA 3NI6A 4DRNA 4Z2JA 3JYMA 2PI6A 4JYSA 1QPLA 2ZQSA 3O5DA 1LG1A 2K8IA 3WD1A 3BMBA 4Z2KA 1TCOC 4Z2HA 3UQBA 2JZVA 3CGMA 3AS0A 4QZVB 1FKHA 1NH6A 1ZL1A 1WAWA 1NSGA 3FXYA 3RM4A 1ZK6A 1Q6UA 3EY6A 3AS3A 1VF8A 5HW8A 3PRDA 2MPHA 2F21A 2WLZA 2B31A 2A3BA 4P8UA 4P8XA 3AS1A 3ARYA 3GPKA 5DF0A 4J4NA 1XRVA 4HBOA 3B9EA 4DWSA 1WB0A 4Z2GA 1GUVA 2YBUA 5DO2A 2AWGA 2DG3A 1FAPA 1HJVA 1WNOA 2FDMA 4JFMA 2DT2A 2LJ4A 4LAWA 3I6CA 1FJDA 1E6PA 1JNEA 2KFWA 4ZS6A
chains in the Genus database with same CATH topology
2G41A 1SR0A 4AY1A 1QPFA 1FKKA 3O5OA 4TNSA 4XAKA 2QF8A 5HWCA 1PINA 1E9LA 1XHGA 5DITA 2F4EA 5HUAA 4DRQA 1P5QA 3WD4A 1Q1CA 4DRMA 4WKHA 4G2PA 4WJXA 4U84A 4DRJA 3O5KA 3CHCA 4IQ2A 1L1PA 2XP9A 2RSEA 4DWSB 2PV3A 1E6RA 4JFIA 3RMEA 1SYTA 4DIPA 4Z2LA 3AS2A 2WK2A 5DIUA 4W9QA 4WKFA 2DSUA 3LUOA 3PA7A 5GPGA 2O92A 3ALFA 4DRKA 1ITXA 1R9HA 1KFWA 3ARQA 3ARSA 3WQVA 3KAHA 4HARA 4DH0A 1NWRA 1ZB5A 2VN1A 4DWSD 1FD9A 2ZR4A 3PRAA 3KADA 4FN2A 3TDBA 3KACA 2A3EA 2Y78A 5GQBA 4R0XA 1FKFA 1QZ2A 1EQ3A 4JFLA 2RUQA 3W4RA 1EDQA 1ZBWA 1W9PA 4G50A 4ODQA 2MLYA 3G6MA 1HXVA 3UI4A 2ZR5A 4IT4A 1UR9A 3CHEA 2FAPA 1EIBA 2OLHA 2XPAA 1F8AB 1EYMA 3O5FA 1FKIA 1OGGA 4WK9A 3O5MA 1Y0OA 3O5JA 3UI5A 3KABA 1D6OA 5DIVA 3O5RA 2N87A 2XP8A 2F2DA 3WD0A 1W1VA 2DG4A 1W1YA 4MPKA 4ODMA 4ODPA 2M1IA 2RURA 3BXWA 3ALGA 2DT0A 2IF4A 3CZ8A 2RUDA 1HKMA 1C9HA 2XP3A 2KE0A 2YBTA 4LAXA 2XP4A 5HTGA 4URIA 1D7JA 4JFJA 1NMVA 1B6CA 1FKDA 2PPNA 2ITKA 3VAWA 4ODRA 2LPVA 3RM9A 4TW8A 3B9DA 1W9UA 3PR9A 3WL0A 1TFVA 1T11A 2A3CA 2PV2A 1W9VA 4MTVA 4MAVA 2XPBA 4W5UA 4FAPA 1LL7A 2MLXA 3ODKA 3KZ7A 1OGBA 2A3AA 4WIWA 4ODLA 2MNTA 2M08A 3IKGA 1UR8A 3OA5A 4MNMA 4ODOA 3RGCA 1N1AA 2XP6A 2WLYA 3ARWA 2ZQTA 1J4RA 4U86A 1NWTA 3H9RB 4MNJA 3ARPA 3MDYB 1ROUA 3UF8A 4U85A 1W26A 1J6YA 4ML4A 4DROA 4S3KA 1FKJA 1GPFA 4C02B 4MSPA 3FY1A 5HT1A 1K9TA 3KAGA 3ARRA 3ARZA 2ZQVA 2LKNA 1ZBVA 3KAIA 3UQIA 1JNSA 4GGQA 4ODKA 3AROA 2MLZA 1BL4A 2DPEA 2VCDA 4QT3A 3CGNA 1F40A 5HWBA 1ZBCA 3G6LA 4W9OA 4LGXA 2O9OA 4WKAA 3WH0A 4NNRA 1HJXA 1LJYA 4PTMA 1E15A 3IHZA 2WM0A 4O2TA 4IT6A 4LAYA 1YW5A 1D2KA 1IX5A 3WL1A 3CHDA 5DEZA 3CHFA 1KT0A 3UI6A 3OOBA 2KGJA 2PBCA 2LGOA 3JXVA 1CTNA 3ARVA 4BF8A 4IQCA 4KR0B 2RUCA 1ZU8A 4Q7NA 1E6ZA 4TYOA 1J4IA 2DT1A 3TC5A 1FFQA 3PRBA 1W1TA 4DZ2A 2G8ZA 5HKGA 2L2SA 4GIVA 4DWSC 4DRHA 5B8IC 5JH8A 4DRPA 1HKIA 2KI3A 1NWUA 4DT4A 2ZR6A 5J6EA 4ZPWR 3O5PA 3UQAA 2DSWA 2XP5A 1HKJA 4NZCA 5HW7A 2UZ5A 1O6IA 1D7HA 1NMWA 4DRIA 4DZ3A 2Q5AA 3AQUA 3O5LA 5HW6A 1JNTA 4QIBA 2DSVA 4MNKA 4MNLA 4S3JA 4J4OA 1ZCNA 2RQSA 2MF9A 1U79A 1BKFA 1HJWA 2DG9A 3O5QA 1FKRA 1FKTA 5HBFA 5I98A 1Q6IA 3ARTA 2D9FA 1FKBA 3NTPA 3CH9A 4QT2A 4P8WA 4Z2IA 1W1PA 3O5IA 2AOSA 4HBEA 5D75A 1E6NA 4Q22A 2KR7A 1KT1A 2OFNA 1LL6A 1ROTA 1EHNA 1FKGA 1D7IA 4TW7A 3WD3A 4L72B 1ZBKA 4L3NA 3KAFA 3WKZA 4MGVA 1X6LA 1X6NA 3B8SA 4P8VA 4ZPTR 1LL4A 2PPOA 1JVWA 1Q6HA 1JNDA 3O5GA 2DT3A 1YATA 2FKEA 3KCEA 1GOIA 5BXJA 2IUZA 4LAVA 1J4HA 1H0GA 2KO7A 2M2AA 4W9PA 1H0IA 3WD2A 1LG2A 3B7XA 1A7XA 1FFRA 3ARXA 3IK8A 2ESCA 2PPPA 4TW6A 3IKDA 1M5YA 3JYJA 4IPXA 3WQWA 1OWQA 2ZQUA 3B9AA 2XP7A 3O5EA 5GPRA 1FKSA 2PV1A 3TCZA 4R5EA 3RM8A 1HKKA 3FAPA 1RD6A 4NSBA 4N19A 4TX0A 3WIJA 1LQ0A 2DSZA 4ITZA 4ODNA 1PBKA 3QOKA 4JFKA 4KQZA 3RFWA 1NWSA 1FKLA 3ARUA 4ZPVR 3NRKA 3NI6A 4DRNA 4Z2JA 3JYMA 2PI6A 4JYSA 1QPLA 2ZQSA 3O5DA 1LG1A 2K8IA 3WD1A 4Z2KA 1TCOC 4Z2HA 3UQBA 2JZVA 3CGMA 3AS0A 4QZVB 1FKHA 1NH6A 1ZL1A 1WAWA 1NSGA 3FXYA 3RM4A 1ZK6A 1Q6UA 3EY6A 3AS3A 1VF8A 5HW8A 3PRDA 2MPHA 2F21A 2WLZA 2B31A 2A3BA 4P8UA 4P8XA 3AS1A 3ARYA 3GPKA 5DF0A 4J4NA 1XRVA 4HBOA 3B9EA 4DWSA 1WB0A 4Z2GA 1GUVA 2YBUA 5DO2A 2AWGA 2DG3A 1FAPA 1HJVA 1WNOA 2FDMA 4JFMA 2DT2A 2LJ4A 4LAWA 3I6CA 1FJDA 1E6PA 1JNEA 2KFWA 4ZS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBC A;  2LGO A;  1D7J A;  1YAT A;  4JFJ A;  1NMV A;  2FKE A;  3JXV A;  1QPF A;  1B6C A;  1FKK A;  3KCE A;  3O5O A;  4BF8 A;  1FKD A;  4IQC A;  5BXJ A;  4TNS A;  2PPN A;  2RUC A;  4LAV A;  1J4H A;  2ITK A;  2KO7 A;  3VAW A;  4ODR A;  2M2A A;  5HWC A;  1PIN A;  4W9P A;  2LPV A;  1J4I A;  4TYO A;  5DIT A;  3TC5 A;  3B7X A;  3PRB A;  2F4E A;  4DZ2 A;  5HUA A;  5HKG A;  1A7X A;  4DRQ A;  1P5Q A;  2L2S A;  1Q1C A;  3IK8 A;  4GIV A;  4DRM A;  2PPP A;  4G2P A;  4TW6 A;  4TW8 A;  4U84 A;  4DRJ A;  3O5K A;  4DRH A;  3IKD A;  5B8I C;  1M5Y A;  3JYJ A;  4IPX A;  4DRP A;  3UQB A;  2KI3 A;  1T11 A;  4IQ2 A;  4DT4 A;  1L1P A;  2ZQU A;  2ZR6 A;  5J6E A;  2XP7 A;  3O5P A;  2PV2 A;  3UQA A;  2XP9 A;  2RSE A;  3O5E A;  1FKS A;  2PV1 A;  2XP5 A;  3TCZ A;  2PV3 A;  2XPB A;  4JFI A;  4FAP A;  2MLX A;  3FAP A;  3ODK A;  5HW7 A;  2UZ5 A;  4DIP A;  1D7H A;  1NMW A;  3KZ7 A;  4DRI A;  4DZ3 A;  5DIU A;  2Q5A A;  4ODL A;  2MNT A;  2M08 A;  4W9Q A;  3IKG A;  3O5L A;  4N19 A;  4TX0 A;  3LUO A;  4ODO A;  5HW6 A;  3PA7 A;  3RGC A;  1JNT A;  4ITZ A;  5GPG A;  4ODN A;  1N1A A;  1PBK A;  2XP6 A;  4JFK A;  4QIB A;  3RFW A;  2ZQT A;  1FKL A;  1J4R A;  2XP4 A;  4U86 A;  4DRK A;  1R9H A;  3NRK A;  3KAH A;  3NI6 A;  4J4O A;  1ZCN A;  3H9R B;  4DRN A;  2RQS A;  4DH0 A;  3JYM A;  2MF9 A;  1U79 A;  4JYS A;  1QPL A;  2ZQS A;  3O5D A;  2VN1 A;  3MDY B;  1ROU A;  3UF8 A;  1BKF A;  1FD9 A;  2ZR4 A;  4U85 A;  2DG9 A;  3O5Q A;  1FKR A;  3KAD A;  1W26 A;  2K8I A;  4FN2 A;  1J6Y A;  1FKT A;  5I98 A;  4DRO A;  1Q6I A;  1TCO C;  1FKJ A;  3KAC A;  3TDB A;  4C02 B;  2D9F A;  4MSP A;  1FKB A;  2JZV A;  2Y78 A;  3NTP A;  1FKF A;  4R0X A;  1QZ2 A;  5HT1 A;  3CGM A;  4JFL A;  3KAG A;  1EQ3 A;  2RUQ A;  4QT2 A;  1FKH A;  1NSG A;  2ZQV A;  2LKN A;  4G50 A;  4ODQ A;  2MLY A;  1ZK6 A;  1Q6U A;  3EY6 A;  3KAI A;  3UQI A;  1JNS A;  1HXV A;  3UI4 A;  4GGQ A;  2ZR5 A;  4ODK A;  5HW8 A;  3O5I A;  3PRD A;  2MPH A;  1BL4 A;  2MLZ A;  5D75 A;  2F21 A;  2VCD A;  2FAP A;  4QT3 A;  3CGN A;  1F40 A;  2KR7 A;  5HWB A;  2XPA A;  3GPK A;  1F8A B;  1EYM A;  1KT1 A;  1FKI A;  3O5G A;  3O5F A;  2OFN A;  3O5M A;  4J4N A;  1ROT A;  1Y0O A;  3O5J A;  1FKG A;  3UI5 A;  3KAB A;  1D6O A;  4W9O A;  3O5R A;  2N87 A;  5DIV A;  4NNR A;  3WH0 A;  2XP8 A;  1D7I A;  3IHZ A;  4TW7 A;  2F2D A;  2AWG A;  2DG4 A;  4O2T A;  3KAF A;  4LAY A;  2DG3 A;  4ODM A;  1YW5 A;  4MGV A;  4ODP A;  1FAP A;  2M1I A;  2RUR A;  4JFM A;  2LJ4 A;  4LAW A;  3I6C A;  2PPO A;  1FJD A;  1JVW A;  1Q6H A;  1KT0 A;  2IF4 A;  2RUD A;  3UI6 A;  1C9H A;  2XP3 A;  2KE0 A;  4LAX A;  3OOB A;  2KFW A;  5HTG A;  2KGJ A; 
#chains in the Genus database with same CATH topology
 2G41 A;  1SR0 A;  4AY1 A;  1QPF A;  1FKK A;  3O5O A;  4TNS A;  4XAK A;  2QF8 A;  5HWC A;  1PIN A;  1E9L A;  1XHG A;  5DIT A;  2F4E A;  5HUA A;  4DRQ A;  1P5Q A;  3WD4 A;  1Q1C A;  4DRM A;  4WKH A;  4G2P A;  4WJX A;  4U84 A;  4DRJ A;  3O5K A;  3CHC A;  4IQ2 A;  1L1P A;  2XP9 A;  2RSE A;  4DWS B;  2PV3 A;  1E6R A;  4JFI A;  3RME A;  1SYT A;  4DIP A;  4Z2L A;  3AS2 A;  2WK2 A;  5DIU A;  4W9Q A;  4WKF A;  2DSU A;  3LUO A;  3PA7 A;  5GPG A;  2O92 A;  3ALF A;  4DRK A;  1ITX A;  1R9H A;  1KFW A;  3ARQ A;  3ARS A;  3WQV A;  3KAH A;  4HAR A;  4DH0 A;  1NWR A;  1ZB5 A;  2VN1 A;  4DWS D;  1FD9 A;  2ZR4 A;  3PRA A;  3KAD A;  4FN2 A;  2F23 A;  3TDB A;  3KAC A;  2A3E A;  2Y78 A;  5GQB A;  4R0X A;  1FKF A;  1QZ2 A;  1EQ3 A;  4JFL A;  2RUQ A;  3W4R A;  1EDQ A;  1ZBW A;  1W9P A;  4G50 A;  4ODQ A;  2MLY A;  3G6M A;  1HXV A;  3UI4 A;  2ZR5 A;  4IT4 A;  4UDM A;  1UR9 A;  3CHE A;  2FAP A;  1EIB A;  2OLH A;  2XPA A;  1F8A B;  1EYM A;  3O5F A;  1FKI A;  1OGG A;  4WK9 A;  3O5M A;  1Y0O A;  3O5J A;  3UI5 A;  3KAB A;  1D6O A;  5DIV A;  3O5R A;  2N87 A;  2XP8 A;  2F2D A;  3WD0 A;  1W1V A;  2DG4 A;  1W1Y A;  4MPK A;  4ODM A;  4ODP A;  2M1I A;  2RUR A;  3BXW A;  3ALG A;  2ETN A;  2DT0 A;  2IF4 A;  3CZ8 A;  2RUD A;  1HKM A;  1C9H A;  2XP3 A;  2KE0 A;  2YBT A;  4LAX A;  2XP4 A;  5HTG A;  4URI A;  1D7J A;  4JFJ A;  1NMV A;  1B6C A;  1FKD A;  2PPN A;  2ITK A;  3VAW A;  4ODR A;  2LPV A;  3RM9 A;  2P4V A;  4TW8 A;  3B9D A;  1W9U A;  3PR9 A;  3WL0 A;  1TFV A;  1T11 A;  2A3C A;  2PV2 A;  1W9V A;  4MTV A;  4MAV A;  2XPB A;  4W5U A;  4FAP A;  1LL7 A;  2MLX A;  3ODK A;  3KZ7 A;  1OGB A;  2A3A A;  4WIW A;  4ODL A;  2MNT A;  2M08 A;  3IKG A;  1UR8 A;  3OA5 A;  4MNM A;  4ODO A;  3RGC A;  1N1A A;  2XP6 A;  2WLY A;  3ARW A;  2ZQT A;  1J4R A;  4U86 A;  1NWT A;  3H9R B;  4MNJ A;  3ARP A;  3MDY B;  1ROU A;  3UF8 A;  4U85 A;  1W26 A;  1J6Y A;  4ML4 A;  4DRO A;  4S3K A;  1FKJ A;  1GPF A;  4C02 B;  4MSP A;  3FY1 A;  5HT1 A;  1K9T A;  3KAG A;  3ARR A;  3ARZ A;  2ZQV A;  2LKN A;  1ZBV A;  3KAI A;  3UQI A;  1JNS A;  4GGQ A;  4ODK A;  3ARO A;  2MLZ A;  1BL4 A;  2DPE A;  2VCD A;  4QT3 A;  3CGN A;  1F40 A;  2PN0 A;  5HWB A;  1ZBC A;  3G6L A;  4W9O A;  4LGX A;  2O9O A;  4WKA A;  3WH0 A;  4NNR A;  1HJX A;  1LJY A;  4PTM A;  1E15 A;  3IHZ A;  2WM0 A;  4O2T A;  4IT6 A;  4LAY A;  1YW5 A;  1D2K A;  1IX5 A;  3WL1 A;  3CHD A;  5DEZ A;  3CHF A;  1KT0 A;  3UI6 A;  3OOB A;  2KGJ A;  2PBC A;  2LGO A;  3JXV A;  1CTN A;  3ARV A;  4BF8 A;  4IQC A;  4KR0 B;  2RUC A;  1ZU8 A;  4Q7N A;  1E6Z A;  4TYO A;  1J4I A;  2DT1 A;  3TC5 A;  1FFQ A;  3PRB A;  1W1T A;  4DZ2 A;  2G8Z A;  5HKG A;  2L2S A;  4GIV A;  2B5U B;  4DWS C;  4DRH A;  5B8I C;  5JH8 A;  4DRP A;  1HKI A;  2KI3 A;  1NWU A;  4DT4 A;  2ZR6 A;  5J6E A;  4ZPW R;  3O5P A;  3UQA A;  2DSW A;  2XP5 A;  1HKJ A;  4NZC A;  5HW7 A;  2UZ5 A;  1O6I A;  1D7H A;  1NMW A;  4DRI A;  4DZ3 A;  2Q5A A;  3AQU A;  3O5L A;  3GU0 A;  5HW6 A;  1JNT A;  4QIB A;  2DSV A;  4MNK A;  4MNL A;  4S3J A;  4J4O A;  1ZCN A;  2RQS A;  2MF9 A;  1U79 A;  1BKF A;  1HJW A;  2DG9 A;  3O5Q A;  1FKR A;  1FKT A;  5HBF A;  5I98 A;  1Q6I A;  3ART A;  2D9F A;  3GTY X;  1FKB A;  3NTP A;  3CH9 A;  4QT2 A;  4P8W A;  4Z2I A;  1W1P A;  3O5I A;  2AOS A;  4HBE A;  5D75 A;  1E6N A;  4Q22 A;  2KR7 A;  1KT1 A;  2OFN A;  1LL6 A;  1ROT A;  1EHN A;  1FKG A;  1GRJ A;  1D7I A;  4TW7 A;  3WD3 A;  4L72 B;  1ZBK A;  4L3N A;  3KAF A;  3WKZ A;  4MGV A;  1X6L A;  1X6N A;  3B8S A;  4P8V A;  4ZPT R;  1LL4 A;  2PPO A;  1JVW A;  1Q6H A;  1JND A;  1JCH B;  3O5G A;  2DT3 A;  1YAT A;  2FKE A;  3KCE A;  1GOI A;  2EUL A;  5BXJ A;  2IUZ A;  4LAV A;  1J4H A;  1H0G A;  2KO7 A;  2M2A A;  4W9P A;  1H0I A;  3WD2 A;  1LG2 A;  3B7X A;  1A7X A;  3EIP A;  1FFR A;  3ARX A;  3IK8 A;  2ESC A;  2PPP A;  4TW6 A;  3IKD A;  1M5Y A;  3JYJ A;  4IPX A;  3WQW A;  1OWQ A;  2ZQU A;  3B9A A;  2XP7 A;  1E44 A;  3O5E A;  5GPR A;  1FKS A;  2PV1 A;  3TCZ A;  4R5E A;  3RM8 A;  1HKK A;  3FAP A;  1RD6 A;  4NSB A;  4N19 A;  4TX0 A;  3WIJ A;  1LQ0 A;  2DSZ A;  4ITZ A;  4ODN A;  1PBK A;  3QOK A;  4JFK A;  4KQZ A;  3RFW A;  1NWS A;  1FKL A;  3ARU A;  4ZPV R;  3NRK A;  3NI6 A;  4DRN A;  4Z2J A;  3JYM A;  2PI6 A;  4JYS A;  1QPL A;  2ZQS A;  3O5D A;  1LG1 A;  2K8I A;  3WD1 A;  3BMB A;  4Z2K A;  1TCO C;  4Z2H A;  3UQB A;  2JZV A;  3CGM A;  3AS0 A;  4QZV B;  1FKH A;  1NH6 A;  1ZL1 A;  1WAW A;  1NSG A;  3FXY A;  3RM4 A;  1ZK6 A;  1Q6U A;  3EY6 A;  3AS3 A;  1VF8 A;  5HW8 A;  3PRD A;  2MPH A;  2F21 A;  2WLZ A;  2B31 A;  2A3B A;  4P8U A;  4P8X A;  3AS1 A;  3ARY A;  3GPK A;  5DF0 A;  4J4N A;  1XRV A;  4HBO A;  3B9E A;  4DWS A;  1WB0 A;  4Z2G A;  1GUV A;  2YBU A;  5DO2 A;  2AWG A;  2DG3 A;  1FAP A;  1HJV A;  1WNO A;  2FDM A;  4JFM A;  2DT2 A;  2LJ4 A;  4LAW A;  3I6C A;  1FJD A;  1E6P A;  1JNE A;  2KFW A;  4ZS6 A; 
#chains in the Genus database with same CATH homology
 2G41 A;  1SR0 A;  4AY1 A;  1QPF A;  1FKK A;  3O5O A;  4TNS A;  4XAK A;  2QF8 A;  5HWC A;  1PIN A;  1E9L A;  1XHG A;  5DIT A;  2F4E A;  5HUA A;  4DRQ A;  1P5Q A;  3WD4 A;  1Q1C A;  4DRM A;  4WKH A;  4G2P A;  4WJX A;  4U84 A;  4DRJ A;  3O5K A;  3CHC A;  4IQ2 A;  1L1P A;  2XP9 A;  2RSE A;  4DWS B;  2PV3 A;  1E6R A;  4JFI A;  3RME A;  1SYT A;  4DIP A;  4Z2L A;  3AS2 A;  2WK2 A;  5DIU A;  4W9Q A;  4WKF A;  2DSU A;  3LUO A;  3PA7 A;  5GPG A;  2O92 A;  3ALF A;  4DRK A;  1ITX A;  1R9H A;  1KFW A;  3ARQ A;  3ARS A;  3WQV A;  3KAH A;  4HAR A;  4DH0 A;  1NWR A;  1ZB5 A;  2VN1 A;  4DWS D;  1FD9 A;  2ZR4 A;  3PRA A;  3KAD A;  4FN2 A;  3TDB A;  3KAC A;  2A3E A;  2Y78 A;  5GQB A;  4R0X A;  1FKF A;  1QZ2 A;  1EQ3 A;  4JFL A;  2RUQ A;  3W4R A;  1EDQ A;  1ZBW A;  1W9P A;  4G50 A;  4ODQ A;  2MLY A;  3G6M A;  1HXV A;  3UI4 A;  2ZR5 A;  4IT4 A;  1UR9 A;  3CHE A;  2FAP A;  1EIB A;  2OLH A;  2XPA A;  1F8A B;  1EYM A;  3O5F A;  1FKI A;  1OGG A;  4WK9 A;  3O5M A;  1Y0O A;  3O5J A;  3UI5 A;  3KAB A;  1D6O A;  5DIV A;  3O5R A;  2N87 A;  2XP8 A;  2F2D A;  3WD0 A;  1W1V A;  2DG4 A;  1W1Y A;  4MPK A;  4ODM A;  4ODP A;  2M1I A;  2RUR A;  3BXW A;  3ALG A;  2DT0 A;  2IF4 A;  3CZ8 A;  2RUD A;  1HKM A;  1C9H A;  2XP3 A;  2KE0 A;  2YBT A;  4LAX A;  2XP4 A;  5HTG A;  4URI A;  1D7J A;  4JFJ A;  1NMV A;  1B6C A;  1FKD A;  2PPN A;  2ITK A;  3VAW A;  4ODR A;  2LPV A;  3RM9 A;  4TW8 A;  3B9D A;  1W9U A;  3PR9 A;  3WL0 A;  1TFV A;  1T11 A;  2A3C A;  2PV2 A;  1W9V A;  4MTV A;  4MAV A;  2XPB A;  4W5U A;  4FAP A;  1LL7 A;  2MLX A;  3ODK A;  3KZ7 A;  1OGB A;  2A3A A;  4WIW A;  4ODL A;  2MNT A;  2M08 A;  3IKG A;  1UR8 A;  3OA5 A;  4MNM A;  4ODO A;  3RGC A;  1N1A A;  2XP6 A;  2WLY A;  3ARW A;  2ZQT A;  1J4R A;  4U86 A;  1NWT A;  3H9R B;  4MNJ A;  3ARP A;  3MDY B;  1ROU A;  3UF8 A;  4U85 A;  1W26 A;  1J6Y A;  4ML4 A;  4DRO A;  4S3K A;  1FKJ A;  1GPF A;  4C02 B;  4MSP A;  3FY1 A;  5HT1 A;  1K9T A;  3KAG A;  3ARR A;  3ARZ A;  2ZQV A;  2LKN A;  1ZBV A;  3KAI A;  3UQI A;  1JNS A;  4GGQ A;  4ODK A;  3ARO A;  2MLZ A;  1BL4 A;  2DPE A;  2VCD A;  4QT3 A;  3CGN A;  1F40 A;  5HWB A;  1ZBC A;  3G6L A;  4W9O A;  4LGX A;  2O9O A;  4WKA A;  3WH0 A;  4NNR A;  1HJX A;  1LJY A;  4PTM A;  1E15 A;  3IHZ A;  2WM0 A;  4O2T A;  4IT6 A;  4LAY A;  1YW5 A;  1D2K A;  1IX5 A;  3WL1 A;  3CHD A;  5DEZ A;  3CHF A;  1KT0 A;  3UI6 A;  3OOB A;  2KGJ A;  2PBC A;  2LGO A;  3JXV A;  1CTN A;  3ARV A;  4BF8 A;  4IQC A;  4KR0 B;  2RUC A;  1ZU8 A;  4Q7N A;  1E6Z A;  4TYO A;  1J4I A;  2DT1 A;  3TC5 A;  1FFQ A;  3PRB A;  1W1T A;  4DZ2 A;  2G8Z A;  5HKG A;  2L2S A;  4GIV A;  4DWS C;  4DRH A;  5B8I C;  5JH8 A;  4DRP A;  1HKI A;  2KI3 A;  1NWU A;  4DT4 A;  2ZR6 A;  5J6E A;  4ZPW R;  3O5P A;  3UQA A;  2DSW A;  2XP5 A;  1HKJ A;  4NZC A;  5HW7 A;  2UZ5 A;  1O6I A;  1D7H A;  1NMW A;  4DRI A;  4DZ3 A;  2Q5A A;  3AQU A;  3O5L A;  5HW6 A;  1JNT A;  4QIB A;  2DSV A;  4MNK A;  4MNL A;  4S3J A;  4J4O A;  1ZCN A;  2RQS A;  2MF9 A;  1U79 A;  1BKF A;  1HJW A;  2DG9 A;  3O5Q A;  1FKR A;  1FKT A;  5HBF A;  5I98 A;  1Q6I A;  3ART A;  2D9F A;  1FKB A;  3NTP A;  3CH9 A;  4QT2 A;  4P8W A;  4Z2I A;  1W1P A;  3O5I A;  2AOS A;  4HBE A;  5D75 A;  1E6N A;  4Q22 A;  2KR7 A;  1KT1 A;  2OFN A;  1LL6 A;  1ROT A;  1EHN A;  1FKG A;  1D7I A;  4TW7 A;  3WD3 A;  4L72 B;  1ZBK A;  4L3N A;  3KAF A;  3WKZ A;  4MGV A;  1X6L A;  1X6N A;  3B8S A;  4P8V A;  4ZPT R;  1LL4 A;  2PPO A;  1JVW A;  1Q6H A;  1JND A;  3O5G A;  2DT3 A;  1YAT A;  2FKE A;  3KCE A;  1GOI A;  5BXJ A;  2IUZ A;  4LAV A;  1J4H A;  1H0G A;  2KO7 A;  2M2A A;  4W9P A;  1H0I A;  3WD2 A;  1LG2 A;  3B7X A;  1A7X A;  1FFR A;  3ARX A;  3IK8 A;  2ESC A;  2PPP A;  4TW6 A;  3IKD A;  1M5Y A;  3JYJ A;  4IPX A;  3WQW A;  1OWQ A;  2ZQU A;  3B9A A;  2XP7 A;  3O5E A;  5GPR A;  1FKS A;  2PV1 A;  3TCZ A;  4R5E A;  3RM8 A;  1HKK A;  3FAP A;  1RD6 A;  4NSB A;  4N19 A;  4TX0 A;  3WIJ A;  1LQ0 A;  2DSZ A;  4ITZ A;  4ODN A;  1PBK A;  3QOK A;  4JFK A;  4KQZ A;  3RFW A;  1NWS A;  1FKL A;  3ARU A;  4ZPV R;  3NRK A;  3NI6 A;  4DRN A;  4Z2J A;  3JYM A;  2PI6 A;  4JYS A;  1QPL A;  2ZQS A;  3O5D A;  1LG1 A;  2K8I A;  3WD1 A;  4Z2K A;  1TCO C;  4Z2H A;  3UQB A;  2JZV A;  3CGM A;  3AS0 A;  4QZV B;  1FKH A;  1NH6 A;  1ZL1 A;  1WAW A;  1NSG A;  3FXY A;  3RM4 A;  1ZK6 A;  1Q6U A;  3EY6 A;  3AS3 A;  1VF8 A;  5HW8 A;  3PRD A;  2MPH A;  2F21 A;  2WLZ A;  2B31 A;  2A3B A;  4P8U A;  4P8X A;  3AS1 A;  3ARY A;  3GPK A;  5DF0 A;  4J4N A;  1XRV A;  4HBO A;  3B9E A;  4DWS A;  1WB0 A;  4Z2G A;  1GUV A;  2YBU A;  5DO2 A;  2AWG A;  2DG3 A;  1FAP A;  1HJV A;  1WNO A;  2FDM A;  4JFM A;  2DT2 A;  2LJ4 A;  4LAW A;  3I6C A;  1FJD A;  1E6P A;  1JNE A;  2KFW A;  4ZS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...