4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
2OFNA 1FKJA 2MPHA 4DRMA 1QPLA 1J4HA 2RSEA 2XP4A 2Q5AA 4GGQA 4J4NA 4ODNA 2DG3A 4DZ3A 4GIVA 4TX0A 1J6YA 4DRJA 2ZQSA 4DRQA 3KAFA 4QIBA 2PPOA 1KT1A 4DROA 5D75A 3EY6A 4NNRA 5DIVA 3JXVA 3KABA 4R0XA 1KT0A 2F4EA 1JVWA 2RUDA 3B7XA 3PA7A 4ITZA 1J4RA 2JZVA 4MGVA 2XP7A 4TW7A 1FKDA 2XP3A 3KAIA 1EQ3A 4DT4A 1ZK6A 1C9HA 4W9OA 4FN2A 3JYJA 3OOBA 3UQIA 4DRHA 2KR7A 3IKGA 4FAPA 4J4OA 1N1AA 3O5OA 3O5PA 1ROTA 3IKDA 4DRNA 5HWCA 2KFWA 1YW5A 4QT3A 1FKTA 2RQSA 2K8IA 3VAWA 1NSGA 1D7HA 4LAWA 4TNSA 1FD9A 2FAPA 4ODKA 2XP8A 3IK8A 2ZR5A 2PV2A 3TDBA 4DH0A 1L1PA 2LKNA 2M08A 3KAHA 3NTPA 4ODLA 4JFLA 1Q6IA 2PPNA 2F2DA 1F40A 1F8AB 2KE0A 1FKRA 4N19A 4QT2A 1Q6UA 4O2TA 1FKFA 1FKHA 1U79A 1EYMA 1D6OA 4ODQA 5DIUA 4DRPA 1ZCNA 3TCZA 1QPFA 4ODOA 3LUOA 1FKGA 1FKBA 1PINA 1NMVA 3O5FA 4W9QA 3KCEA 2LPVA 2PV1A 3NRKA 2RUCA 4G50A 4JFMA 4MSPA 3O5GA 5I98A 2DG9A 2XP5A 5GPGA 1BL4A 2MLZA 3WH0A 3I6CA 3O5JA 4IPXA 5HW7A 2FKEA 1R9HA 1W26A 3O5KA 4G2PA 3IHZA 3O5QA 3JYMA 4TW6A 2XPAA 1PBKA 4LAYA 4U86A 4BF8A 2MF9A 1FKLA 2XP9A 1BKFA 2MLXA 4IQ2A 2KO7A 2DG4A 3GPKA 4JFJA 1Q6HA 4TW8A 2L2SA 4JFKA 2PPPA 3KZ7A 5HKGA 5HTGA 1Q1CA 1FKKA 3RFWA 2RURA 3CGNA 2PBCA 4LAXA 2F21A 3FAPA 4U84A 1P5QA 2MLYA 1FKSA 2AWGA 3UQAA 3KACA 3ODKA 3UI4A 4ODPA 3UF8A 1JNSA 2KGJA 3KADA 1NMWA 3O5RA 3O5IA 1TCOC 1FKIA 4JFIA 3UQBA 1FJDA 1D7JA 4IQCA 2Y78A 4JYSA 4DIPA 2VCDA 5J6EA 1J4IA 2XP6A 3MDYB 4TYOA 5HW8A 1ROUA 2D9FA 1FAPA 2LGOA 3H9RB 3PRDA 1A7XA 2ZR4A 4ODMA 1Y0OA 2IF4A 2LJ4A 3UI5A 3O5DA 4DZ2A 1YATA 2ZQUA 3KAGA 4W9PA 3RGCA 5HUAA 2ZQTA 3PRBA 5BXJA 5HW6A 5HWBA 1B6CA 4ODRA 3O5EA 1HXVA 2M1IA 1QZ2A 2M2AA 2ITKA 3CGMA 2ZQVA 3O5MA 3TC5A 2N87A 3NI6A 5DITA 4C02B 4DRKA 5HT1A 1JNTA 1M5YA 2KI3A 2MNTA 2XPBA 4U85A 4DRIA 2UZ5A 2VN1A 2PV3A 3O5LA 2ZR6A 5B8IC 2RUQA 1D7IA 1T11A 4LAVA 3UI6A
chains in the Genus database with same CATH superfamily
1FKJA 2B31A 1EIBA 4GGQA 1J4HA 2RSEA 4J4NA 2Q5AA 4P8VA 2DG3A 1JCHB 4GIVA 4Q7NA 2QF8A 4DROA 5D75A 3JXVA 1XRVA 2RUDA 1E6PA 1UR8A 1FKDA 2XP3A 3KAIA 1EQ3A 1VF8A 1ZK6A 3UQIA 3AQUA 4DRHA 1W1PA 3IKDA 2KFWA 1YW5A 1FKTA 2K8IA 2PI6A 4LAWA 2FAPA 5GQBA 1L1PA 4Z2LA 2LKNA 4ODLA 1K9TA 4JFLA 1F40A 1F8AB 4MNJA 4O2TA 1EYMA 2DT0A 1FKGA 3ARYA 3O5FA 1EDQA 3KCEA 5DEZA 4W5UA 1ZBKA 1WB0A 5HW7A 4ZPVR 2FKEA 1W26A 3IHZA 1XHGA 1CTNA 3JYMA 4TW6A 2MF9A 2XP9A 1BKFA 2KO7A 4TW8A 4JFKA 3WD2A 5HTGA 1HKJA 1W1YA 2F21A 4L72B 1SR0A 3CH9A 3KADA 1FKIA 4IQCA 2Y78A 4JYSA 4MNMA 2VCDA 4DIPA 3MDYB 1ROUA 3H9RB 2LGOA 3PRDA 1A7XA 4ODMA 2IF4A 4DZ2A 3KAGA 5HUAA 1HJWA 3PRBA 5BXJA 5HW6A 4L3NA 1B6CA 1HXVA 3CZ8A 2ITKA 3CGMA 2ZQVA 3NI6A 4C02B 4P8XA 4DRKA 5HT1A 2KI3A 5I98A 2PV3A 3O5LA 1GOIA 1ZBCA 3CHFA 4LAVA 2OFNA 3RM9A 4IT6A 4HARA 4DRJA 4XAKA 4DRQA 1X6NA 3W4RA 4NNRA 4ML4A 2FDMA 4R0XA 1KT0A 2F4EA 1JVWA 3B7XA 4TW7A 3ALFA 5HBFA 2G8ZA 4DT4A 2AOSA 1H0GA 4W9OA 3OOBA 2WLZA 1D2KA 4P8UA 4DRNA 3WL0A 4QT3A 1ITXA 1GUVA 1LJYA 3VAWA 1D7HA 4TNSA 1WNOA 2PV2A 3TDBA 3KAHA 3NTPA 1Q6IA 1FFRA 3AS3A 1FKHA 2ESCA 4KR0B 4ODQA 5DIUA 4DRPA 1ZL1A 4ODOA 3RM4A 1PINA 1NMVA 3FXYA 4W9QA 2LPVA 4G50A 1E6NA 2XP5A 4ZPWR 5GPGA 1BL4A 2O9OA 3WH0A 2ETNA 1GRJA 1PBKA 4LAYA 4Z2KA 4BF8A 4URIA 1FKLA 1W9UA 5DO2A 1LG1A 3ARPA 1LG2A 2MLXA 4JFJA 2L2SA 1E6RA 3KZ7A 3CHDA 5HKGA 3CGNA 3G6MA 2MLYA 3ODKA 3UI4A 3PRAA 2A3EA 1OGGA 4JFIA 1NMWA 1FJDA 1TFVA 2YBUA 5J6EA 2D9FA 2ZR4A 1LL6A 2LJ4A 4S3KA 1E9LA 1YATA 2WK2A 2ZQTA 4ODRA 4UDMA 3O5EA 2M2AA 3ARRA 3TC5A 2N87A 5DITA 4MTVA 2EULA 2XPBA 5B8IC 4DWSC 2DT1A 4NZCA 2RUQA 2OLHA 4WKAA 5HWCA 3UI6A 2DSUA 4DRMA 1IX5A 4Z2IA 4R5EA 2ZQSA 4QIBA 2PPOA 1KT1A 5DIVA 3KABA 1WAWA 4ITZA 3WD0A 2JZVA 2XP7A 3ARZA 1C9HA 3JYJA 4AY1A 1LL7A 3RM8A 3ARWA 4J4OA 1N1AA 3O5OA 4S3JA 1ROTA 1JNDA 1KFWA 3WL1A 4NSBA 3IK8A 4WK9A 2ZR5A 1NWUA 4Q22A 2P4VA 1OGBA 2F2DA 3ARXA 2KE0A 1NWTA 1FKFA 1U79A 1D6OA 3TCZA 1QPFA 4DWSA 3LUOA 4DWSD 2O92A 3BXWA 4MNKA 2PV1A 2RUCA 4JFMA 4MAVA 3O5GA 2IUZA 2A3BA 4Z2GA 2DG9A 2MLZA 4IPXA 4G2PA 3O5KA 4Z2JA 2XPAA 3GPKA 2DPEA 3EIPA 1X6LA 2PPPA 1Q1CA 4MNLA 1FKKA 3RFWA 2PBCA 4LAXA 3FAPA 1W1VA 4U84A 1P5QA 3AS1A 2B5UB 2F23A 3KACA 4ODPA 3UF8A 1JNSA 2KGJA 3O5IA 3O5RA 4WKHA 4DWSB 1D7JA 1J4IA 2XP6A 3AROA 5HW8A 2DT2A 1ZBWA 3O5DA 1NWRA 4HBOA 2ZQUA 1SYTA 3RGCA 4LGXA 5HWBA 3ARSA 3B9EA 1NWSA 2G41A 4QZVB 3ARUA 1HKKA 2DSZA 2MNTA 4U85A 3UQBA 2UZ5A 2ZR6A 1D7IA 2XP4A 1T11A 4ODNA 1JNEA 2MPHA 1QPLA 3OA5A 4DZ3A 4MPKA 1H0IA 4TX0A 4ZPTR 1J6YA 1HJXA 1W9PA 1HJVA 3KAFA 3CHEA 3WKZA 1HKIA 3EY6A 3PA7A 2WLYA 1EHNA 3BMBA 1J4RA 4MGVA 3WQWA 4FN2A 4FAPA 3CHCA 2KR7A 3IKGA 3AS0A 3O5PA 2RQSA 1NSGA 1E44A 2DSVA 1FD9A 4ODKA 2XP8A 5DF0A 3WD1A 1ZB5A 4DH0A 2M08A 1ZU8A 3B9DA 3WIJA 3RMEA 2A3CA 2PPNA 1UR9A 1FKRA 4IT4A 1LQ0A 4N19A 4QT2A 1Q6UA 2YBTA 3B8SA 4Z2HA 1FFQA 1ZCNA 4KQZA 3AS2A 1E6ZA 1FKBA 1OWQA 1RD6A 2DSWA 1LL4A 3NRKA 4MSPA 4WIWA 1GPFA 2WM0A 3I6CA 4HBEA 3O5JA 3QOKA 1R9HA 4WKFA 3O5QA 3WQVA 1ZBVA 3WD4A 1W9VA 4U86A 2A3AA 4IQ2A 1E15A 2DG4A 1Q6HA 3ARVA 3B9AA 3WD3A 2RURA 5JH8A 3GU0A 1NH6A 1FKSA 2AWGA 3UQAA 3ARQA 2DT3A 1TCOC 4TYOA 4WJXA 1FAPA 4ZS6A 5GPRA 1Y0OA 3UI5A 3G6LA 3ARTA 4W9PA 1HKMA 1W1TA 3ALGA 1O6IA 2M1IA 1QZ2A 3PR9A 4PTMA 3GTYX 3O5MA 3FY1A 1JNTA 1M5YA 4DRIA 2VN1A 2PN0A 4P8WA
chains in the Genus database with same CATH topology
1FKJA 2B31A 1EIBA 4GGQA 1J4HA 2RSEA 4J4NA 2Q5AA 4P8VA 2DG3A 4GIVA 4Q7NA 2QF8A 4DROA 5D75A 3JXVA 1XRVA 2RUDA 1E6PA 1UR8A 1FKDA 2XP3A 3KAIA 1EQ3A 1VF8A 1ZK6A 3UQIA 3AQUA 4DRHA 1W1PA 3IKDA 2KFWA 1YW5A 1FKTA 2K8IA 2PI6A 4LAWA 2FAPA 5GQBA 1L1PA 4Z2LA 2LKNA 4ODLA 1K9TA 4JFLA 1F40A 1F8AB 4MNJA 4O2TA 1EYMA 2DT0A 1FKGA 3ARYA 3O5FA 1EDQA 3KCEA 5DEZA 4W5UA 1ZBKA 1WB0A 5HW7A 4ZPVR 2FKEA 1W26A 3IHZA 1XHGA 1CTNA 3JYMA 4TW6A 2MF9A 2XP9A 1BKFA 2KO7A 4TW8A 4JFKA 3WD2A 5HTGA 1HKJA 1W1YA 2F21A 4L72B 1SR0A 3CH9A 3KADA 1FKIA 4IQCA 2Y78A 4JYSA 4MNMA 2VCDA 4DIPA 3MDYB 1ROUA 3H9RB 2LGOA 3PRDA 1A7XA 4ODMA 2IF4A 4DZ2A 3KAGA 5HUAA 1HJWA 3PRBA 5BXJA 5HW6A 4L3NA 1B6CA 1HXVA 3CZ8A 2ITKA 3CGMA 2ZQVA 3NI6A 4C02B 4P8XA 4DRKA 5HT1A 2KI3A 5I98A 2PV3A 3O5LA 1GOIA 1ZBCA 3CHFA 4LAVA 2OFNA 3RM9A 4IT6A 4HARA 4DRJA 4XAKA 4DRQA 1X6NA 3W4RA 4NNRA 4ML4A 2FDMA 4R0XA 1KT0A 2F4EA 1JVWA 3B7XA 4TW7A 3ALFA 5HBFA 2G8ZA 4DT4A 2AOSA 1H0GA 4W9OA 3OOBA 2WLZA 1D2KA 4P8UA 4DRNA 3WL0A 4QT3A 1ITXA 1GUVA 1LJYA 3VAWA 1D7HA 4TNSA 1WNOA 2PV2A 3TDBA 3KAHA 3NTPA 1Q6IA 1FFRA 3AS3A 1FKHA 2ESCA 4KR0B 4ODQA 5DIUA 4DRPA 1ZL1A 4ODOA 3RM4A 1PINA 1NMVA 3FXYA 4W9QA 2LPVA 4G50A 1E6NA 2XP5A 4ZPWR 5GPGA 1BL4A 2O9OA 3WH0A 1PBKA 4LAYA 4Z2KA 4BF8A 4URIA 1FKLA 1W9UA 5DO2A 1LG1A 3ARPA 1LG2A 2MLXA 4JFJA 2L2SA 1E6RA 3KZ7A 3CHDA 5HKGA 3CGNA 3G6MA 2MLYA 3ODKA 3UI4A 3PRAA 2A3EA 1OGGA 4JFIA 1NMWA 1FJDA 1TFVA 2YBUA 5J6EA 2D9FA 2ZR4A 1LL6A 2LJ4A 4S3KA 1E9LA 1YATA 2WK2A 2ZQTA 4ODRA 3O5EA 2M2AA 3ARRA 3TC5A 2N87A 5DITA 4MTVA 2XPBA 5B8IC 4DWSC 2DT1A 4NZCA 2RUQA 2OLHA 4WKAA 5HWCA 3UI6A 2DSUA 4DRMA 1IX5A 4Z2IA 4R5EA 2ZQSA 4QIBA 2PPOA 1KT1A 5DIVA 3KABA 1WAWA 4ITZA 3WD0A 2JZVA 2XP7A 3ARZA 1C9HA 3JYJA 4AY1A 1LL7A 3RM8A 3ARWA 4J4OA 1N1AA 3O5OA 4S3JA 1ROTA 1JNDA 1KFWA 3WL1A 4NSBA 3IK8A 4WK9A 2ZR5A 1NWUA 4Q22A 1OGBA 2F2DA 3ARXA 2KE0A 1NWTA 1FKFA 1U79A 1D6OA 3TCZA 1QPFA 4DWSA 3LUOA 4DWSD 2O92A 3BXWA 4MNKA 2PV1A 2RUCA 4JFMA 4MAVA 3O5GA 2IUZA 2A3BA 4Z2GA 2DG9A 2MLZA 4IPXA 4G2PA 3O5KA 4Z2JA 2XPAA 3GPKA 2DPEA 1X6LA 2PPPA 1Q1CA 4MNLA 1FKKA 3RFWA 2PBCA 4LAXA 3FAPA 1W1VA 4U84A 1P5QA 3AS1A 3KACA 4ODPA 3UF8A 1JNSA 2KGJA 3O5IA 3O5RA 4WKHA 4DWSB 1D7JA 1J4IA 2XP6A 3AROA 5HW8A 2DT2A 1ZBWA 3O5DA 1NWRA 4HBOA 2ZQUA 1SYTA 3RGCA 4LGXA 5HWBA 3ARSA 3B9EA 1NWSA 2G41A 4QZVB 3ARUA 1HKKA 2DSZA 2MNTA 4U85A 3UQBA 2UZ5A 2ZR6A 1D7IA 2XP4A 1T11A 4ODNA 1JNEA 2MPHA 1QPLA 3OA5A 4DZ3A 4MPKA 1H0IA 4TX0A 4ZPTR 1J6YA 1HJXA 1W9PA 1HJVA 3KAFA 3CHEA 3WKZA 1HKIA 3EY6A 3PA7A 2WLYA 1EHNA 1J4RA 4MGVA 3WQWA 4FN2A 4FAPA 3CHCA 2KR7A 3IKGA 3AS0A 3O5PA 2RQSA 1NSGA 2DSVA 1FD9A 4ODKA 2XP8A 5DF0A 3WD1A 1ZB5A 4DH0A 2M08A 1ZU8A 3B9DA 3WIJA 3RMEA 2A3CA 2PPNA 1UR9A 1FKRA 4IT4A 1LQ0A 4N19A 4QT2A 1Q6UA 2YBTA 3B8SA 4Z2HA 1FFQA 1ZCNA 4KQZA 3AS2A 1E6ZA 1FKBA 1OWQA 1RD6A 2DSWA 1LL4A 3NRKA 4MSPA 4WIWA 1GPFA 2WM0A 3I6CA 4HBEA 3O5JA 3QOKA 1R9HA 4WKFA 3O5QA 3WQVA 1ZBVA 3WD4A 1W9VA 4U86A 2A3AA 4IQ2A 1E15A 2DG4A 1Q6HA 3ARVA 3B9AA 3WD3A 2RURA 5JH8A 1NH6A 1FKSA 2AWGA 3UQAA 3ARQA 2DT3A 1TCOC 4TYOA 4WJXA 1FAPA 4ZS6A 5GPRA 1Y0OA 3UI5A 3G6LA 3ARTA 4W9PA 1HKMA 1W1TA 3ALGA 1O6IA 2M1IA 1QZ2A 3PR9A 4PTMA 3O5MA 3FY1A 1JNTA 1M5YA 4DRIA 2VN1A 4P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OFN A;  1FKJ A;  2MPH A;  4DRM A;  1QPL A;  1J4H A;  2RSE A;  2XP4 A;  2Q5A A;  4GGQ A;  4J4N A;  4ODN A;  2DG3 A;  4DZ3 A;  4GIV A;  4TX0 A;  1J6Y A;  4DRJ A;  2ZQS A;  4DRQ A;  3KAF A;  4QIB A;  2PPO A;  1KT1 A;  4DRO A;  5D75 A;  3EY6 A;  4NNR A;  5DIV A;  3JXV A;  3KAB A;  4R0X A;  1KT0 A;  2F4E A;  1JVW A;  2RUD A;  3B7X A;  3PA7 A;  4ITZ A;  1J4R A;  2JZV A;  4MGV A;  2XP7 A;  4TW7 A;  1FKD A;  2XP3 A;  3KAI A;  1EQ3 A;  4DT4 A;  1ZK6 A;  1C9H A;  4W9O A;  4FN2 A;  3JYJ A;  3OOB A;  3UQI A;  4DRH A;  2KR7 A;  3IKG A;  4FAP A;  4J4O A;  1N1A A;  3O5O A;  3O5P A;  1ROT A;  3IKD A;  4DRN A;  5HWC A;  2KFW A;  1YW5 A;  4QT3 A;  1FKT A;  2RQS A;  2K8I A;  3VAW A;  1NSG A;  1D7H A;  4LAW A;  4TNS A;  1FD9 A;  2FAP A;  4ODK A;  2XP8 A;  3IK8 A;  2ZR5 A;  2PV2 A;  3TDB A;  4DH0 A;  1L1P A;  2LKN A;  2M08 A;  3KAH A;  3NTP A;  4ODL A;  4JFL A;  1Q6I A;  2PPN A;  2F2D A;  1F40 A;  1F8A B;  2KE0 A;  1FKR A;  4N19 A;  4QT2 A;  1Q6U A;  4O2T A;  1FKF A;  1FKH A;  1U79 A;  1EYM A;  1D6O A;  4ODQ A;  5DIU A;  4DRP A;  1ZCN A;  3TCZ A;  1QPF A;  4ODO A;  3LUO A;  1FKG A;  1FKB A;  1PIN A;  1NMV A;  3O5F A;  4W9Q A;  3KCE A;  2LPV A;  2PV1 A;  3NRK A;  2RUC A;  4G50 A;  4JFM A;  4MSP A;  3O5G A;  5I98 A;  2DG9 A;  2XP5 A;  5GPG A;  1BL4 A;  2MLZ A;  3WH0 A;  3I6C A;  3O5J A;  4IPX A;  5HW7 A;  2FKE A;  1R9H A;  1W26 A;  3O5K A;  4G2P A;  3IHZ A;  3O5Q A;  3JYM A;  4TW6 A;  2XPA A;  1PBK A;  4LAY A;  4U86 A;  4BF8 A;  2MF9 A;  1FKL A;  2XP9 A;  1BKF A;  2MLX A;  4IQ2 A;  2KO7 A;  2DG4 A;  3GPK A;  4JFJ A;  1Q6H A;  4TW8 A;  2L2S A;  4JFK A;  2PPP A;  3KZ7 A;  5HKG A;  5HTG A;  1Q1C A;  1FKK A;  3RFW A;  2RUR A;  3CGN A;  2PBC A;  4LAX A;  2F21 A;  3FAP A;  4U84 A;  1P5Q A;  2MLY A;  1FKS A;  2AWG A;  3UQA A;  3KAC A;  3ODK A;  3UI4 A;  4ODP A;  3UF8 A;  1JNS A;  2KGJ A;  3KAD A;  1NMW A;  3O5R A;  3O5I A;  1TCO C;  1FKI A;  4JFI A;  3UQB A;  1FJD A;  1D7J A;  4IQC A;  2Y78 A;  4JYS A;  4DIP A;  2VCD A;  5J6E A;  1J4I A;  2XP6 A;  3MDY B;  4TYO A;  5HW8 A;  1ROU A;  2D9F A;  1FAP A;  2LGO A;  3H9R B;  3PRD A;  1A7X A;  2ZR4 A;  4ODM A;  1Y0O A;  2IF4 A;  2LJ4 A;  3UI5 A;  3O5D A;  4DZ2 A;  1YAT A;  2ZQU A;  3KAG A;  4W9P A;  3RGC A;  5HUA A;  2ZQT A;  3PRB A;  5BXJ A;  5HW6 A;  5HWB A;  1B6C A;  4ODR A;  3O5E A;  1HXV A;  2M1I A;  1QZ2 A;  2M2A A;  2ITK A;  3CGM A;  2ZQV A;  3O5M A;  3TC5 A;  2N87 A;  3NI6 A;  5DIT A;  4C02 B;  4DRK A;  5HT1 A;  1JNT A;  1M5Y A;  2KI3 A;  2MNT A;  2XPB A;  4U85 A;  4DRI A;  2UZ5 A;  2VN1 A;  2PV3 A;  3O5L A;  2ZR6 A;  5B8I C;  2RUQ A;  1D7I A;  1T11 A;  4LAV A;  3UI6 A; 
#chains in the Genus database with same CATH topology
 1FKJ A;  2B31 A;  1EIB A;  4GGQ A;  1J4H A;  2RSE A;  4J4N A;  2Q5A A;  4P8V A;  2DG3 A;  1JCH B;  4GIV A;  4Q7N A;  2QF8 A;  4DRO A;  5D75 A;  3JXV A;  1XRV A;  2RUD A;  1E6P A;  1UR8 A;  1FKD A;  2XP3 A;  3KAI A;  1EQ3 A;  1VF8 A;  1ZK6 A;  3UQI A;  3AQU A;  4DRH A;  1W1P A;  3IKD A;  2KFW A;  1YW5 A;  1FKT A;  2K8I A;  2PI6 A;  4LAW A;  2FAP A;  5GQB A;  1L1P A;  4Z2L A;  2LKN A;  4ODL A;  1K9T A;  4JFL A;  1F40 A;  1F8A B;  4MNJ A;  4O2T A;  1EYM A;  2DT0 A;  1FKG A;  3ARY A;  3O5F A;  1EDQ A;  3KCE A;  5DEZ A;  4W5U A;  1ZBK A;  1WB0 A;  5HW7 A;  4ZPV R;  2FKE A;  1W26 A;  3IHZ A;  1XHG A;  1CTN A;  3JYM A;  4TW6 A;  2MF9 A;  2XP9 A;  1BKF A;  2KO7 A;  4TW8 A;  4JFK A;  3WD2 A;  5HTG A;  1HKJ A;  1W1Y A;  2F21 A;  4L72 B;  1SR0 A;  3CH9 A;  3KAD A;  1FKI A;  4IQC A;  2Y78 A;  4JYS A;  4MNM A;  2VCD A;  4DIP A;  3MDY B;  1ROU A;  3H9R B;  2LGO A;  3PRD A;  1A7X A;  4ODM A;  2IF4 A;  4DZ2 A;  3KAG A;  5HUA A;  1HJW A;  3PRB A;  5BXJ A;  5HW6 A;  4L3N A;  1B6C A;  1HXV A;  3CZ8 A;  2ITK A;  3CGM A;  2ZQV A;  3NI6 A;  4C02 B;  4P8X A;  4DRK A;  5HT1 A;  2KI3 A;  5I98 A;  2PV3 A;  3O5L A;  1GOI A;  1ZBC A;  3CHF A;  4LAV A;  2OFN A;  3RM9 A;  4IT6 A;  4HAR A;  4DRJ A;  4XAK A;  4DRQ A;  1X6N A;  3W4R A;  4NNR A;  4ML4 A;  2FDM A;  4R0X A;  1KT0 A;  2F4E A;  1JVW A;  3B7X A;  4TW7 A;  3ALF A;  5HBF A;  2G8Z A;  4DT4 A;  2AOS A;  1H0G A;  4W9O A;  3OOB A;  2WLZ A;  1D2K A;  4P8U A;  4DRN A;  3WL0 A;  4QT3 A;  1ITX A;  1GUV A;  1LJY A;  3VAW A;  1D7H A;  4TNS A;  1WNO A;  2PV2 A;  3TDB A;  3KAH A;  3NTP A;  1Q6I A;  1FFR A;  3AS3 A;  1FKH A;  2ESC A;  4KR0 B;  4ODQ A;  5DIU A;  4DRP A;  1ZL1 A;  4ODO A;  3RM4 A;  1PIN A;  1NMV A;  3FXY A;  4W9Q A;  2LPV A;  4G50 A;  1E6N A;  2XP5 A;  4ZPW R;  5GPG A;  1BL4 A;  2O9O A;  3WH0 A;  2ETN A;  1GRJ A;  1PBK A;  4LAY A;  4Z2K A;  4BF8 A;  4URI A;  1FKL A;  1W9U A;  5DO2 A;  1LG1 A;  3ARP A;  1LG2 A;  2MLX A;  4JFJ A;  2L2S A;  1E6R A;  3KZ7 A;  3CHD A;  5HKG A;  3CGN A;  3G6M A;  2MLY A;  3ODK A;  3UI4 A;  3PRA A;  2A3E A;  1OGG A;  4JFI A;  1NMW A;  1FJD A;  1TFV A;  2YBU A;  5J6E A;  2D9F A;  2ZR4 A;  1LL6 A;  2LJ4 A;  4S3K A;  1E9L A;  1YAT A;  2WK2 A;  2ZQT A;  4ODR A;  4UDM A;  3O5E A;  2M2A A;  3ARR A;  3TC5 A;  2N87 A;  5DIT A;  4MTV A;  2EUL A;  2XPB A;  5B8I C;  4DWS C;  2DT1 A;  4NZC A;  2RUQ A;  2OLH A;  4WKA A;  5HWC A;  3UI6 A;  2DSU A;  4DRM A;  1IX5 A;  4Z2I A;  4R5E A;  2ZQS A;  4QIB A;  2PPO A;  1KT1 A;  5DIV A;  3KAB A;  1WAW A;  4ITZ A;  3WD0 A;  2JZV A;  2XP7 A;  3ARZ A;  1C9H A;  3JYJ A;  4AY1 A;  1LL7 A;  3RM8 A;  3ARW A;  4J4O A;  1N1A A;  3O5O A;  4S3J A;  1ROT A;  1JND A;  1KFW A;  3WL1 A;  4NSB A;  3IK8 A;  4WK9 A;  2ZR5 A;  1NWU A;  4Q22 A;  2P4V A;  1OGB A;  2F2D A;  3ARX A;  2KE0 A;  1NWT A;  1FKF A;  1U79 A;  1D6O A;  3TCZ A;  1QPF A;  4DWS A;  3LUO A;  4DWS D;  2O92 A;  3BXW A;  4MNK A;  2PV1 A;  2RUC A;  4JFM A;  4MAV A;  3O5G A;  2IUZ A;  2A3B A;  4Z2G A;  2DG9 A;  2MLZ A;  4IPX A;  4G2P A;  3O5K A;  4Z2J A;  2XPA A;  3GPK A;  2DPE A;  3EIP A;  1X6L A;  2PPP A;  1Q1C A;  4MNL A;  1FKK A;  3RFW A;  2PBC A;  4LAX A;  3FAP A;  1W1V A;  4U84 A;  1P5Q A;  3AS1 A;  2B5U B;  2F23 A;  3KAC A;  4ODP A;  3UF8 A;  1JNS A;  2KGJ A;  3O5I A;  3O5R A;  4WKH A;  4DWS B;  1D7J A;  1J4I A;  2XP6 A;  3ARO A;  5HW8 A;  2DT2 A;  1ZBW A;  3O5D A;  1NWR A;  4HBO A;  2ZQU A;  1SYT A;  3RGC A;  4LGX A;  5HWB A;  3ARS A;  3B9E A;  1NWS A;  2G41 A;  4QZV B;  3ARU A;  1HKK A;  2DSZ A;  2MNT A;  4U85 A;  3UQB A;  2UZ5 A;  2ZR6 A;  1D7I A;  2XP4 A;  1T11 A;  4ODN A;  1JNE A;  2MPH A;  1QPL A;  3OA5 A;  4DZ3 A;  4MPK A;  1H0I A;  4TX0 A;  4ZPT R;  1J6Y A;  1HJX A;  1W9P A;  1HJV A;  3KAF A;  3CHE A;  3WKZ A;  1HKI A;  3EY6 A;  3PA7 A;  2WLY A;  1EHN A;  3BMB A;  1J4R A;  4MGV A;  3WQW A;  4FN2 A;  4FAP A;  3CHC A;  2KR7 A;  3IKG A;  3AS0 A;  3O5P A;  2RQS A;  1NSG A;  1E44 A;  2DSV A;  1FD9 A;  4ODK A;  2XP8 A;  5DF0 A;  3WD1 A;  1ZB5 A;  4DH0 A;  2M08 A;  1ZU8 A;  3B9D A;  3WIJ A;  3RME A;  2A3C A;  2PPN A;  1UR9 A;  1FKR A;  4IT4 A;  1LQ0 A;  4N19 A;  4QT2 A;  1Q6U A;  2YBT A;  3B8S A;  4Z2H A;  1FFQ A;  1ZCN A;  4KQZ A;  3AS2 A;  1E6Z A;  1FKB A;  1OWQ A;  1RD6 A;  2DSW A;  1LL4 A;  3NRK A;  4MSP A;  4WIW A;  1GPF A;  2WM0 A;  3I6C A;  4HBE A;  3O5J A;  3QOK A;  1R9H A;  4WKF A;  3O5Q A;  3WQV A;  1ZBV A;  3WD4 A;  1W9V A;  4U86 A;  2A3A A;  4IQ2 A;  1E15 A;  2DG4 A;  1Q6H A;  3ARV A;  3B9A A;  3WD3 A;  2RUR A;  5JH8 A;  3GU0 A;  1NH6 A;  1FKS A;  2AWG A;  3UQA A;  3ARQ A;  2DT3 A;  1TCO C;  4TYO A;  4WJX A;  1FAP A;  4ZS6 A;  5GPR A;  1Y0O A;  3UI5 A;  3G6L A;  3ART A;  4W9P A;  1HKM A;  1W1T A;  3ALG A;  1O6I A;  2M1I A;  1QZ2 A;  3PR9 A;  4PTM A;  3GTY X;  3O5M A;  3FY1 A;  1JNT A;  1M5Y A;  4DRI A;  2VN1 A;  2PN0 A;  4P8W A; 
#chains in the Genus database with same CATH homology
 1FKJ A;  2B31 A;  1EIB A;  4GGQ A;  1J4H A;  2RSE A;  4J4N A;  2Q5A A;  4P8V A;  2DG3 A;  4GIV A;  4Q7N A;  2QF8 A;  4DRO A;  5D75 A;  3JXV A;  1XRV A;  2RUD A;  1E6P A;  1UR8 A;  1FKD A;  2XP3 A;  3KAI A;  1EQ3 A;  1VF8 A;  1ZK6 A;  3UQI A;  3AQU A;  4DRH A;  1W1P A;  3IKD A;  2KFW A;  1YW5 A;  1FKT A;  2K8I A;  2PI6 A;  4LAW A;  2FAP A;  5GQB A;  1L1P A;  4Z2L A;  2LKN A;  4ODL A;  1K9T A;  4JFL A;  1F40 A;  1F8A B;  4MNJ A;  4O2T A;  1EYM A;  2DT0 A;  1FKG A;  3ARY A;  3O5F A;  1EDQ A;  3KCE A;  5DEZ A;  4W5U A;  1ZBK A;  1WB0 A;  5HW7 A;  4ZPV R;  2FKE A;  1W26 A;  3IHZ A;  1XHG A;  1CTN A;  3JYM A;  4TW6 A;  2MF9 A;  2XP9 A;  1BKF A;  2KO7 A;  4TW8 A;  4JFK A;  3WD2 A;  5HTG A;  1HKJ A;  1W1Y A;  2F21 A;  4L72 B;  1SR0 A;  3CH9 A;  3KAD A;  1FKI A;  4IQC A;  2Y78 A;  4JYS A;  4MNM A;  2VCD A;  4DIP A;  3MDY B;  1ROU A;  3H9R B;  2LGO A;  3PRD A;  1A7X A;  4ODM A;  2IF4 A;  4DZ2 A;  3KAG A;  5HUA A;  1HJW A;  3PRB A;  5BXJ A;  5HW6 A;  4L3N A;  1B6C A;  1HXV A;  3CZ8 A;  2ITK A;  3CGM A;  2ZQV A;  3NI6 A;  4C02 B;  4P8X A;  4DRK A;  5HT1 A;  2KI3 A;  5I98 A;  2PV3 A;  3O5L A;  1GOI A;  1ZBC A;  3CHF A;  4LAV A;  2OFN A;  3RM9 A;  4IT6 A;  4HAR A;  4DRJ A;  4XAK A;  4DRQ A;  1X6N A;  3W4R A;  4NNR A;  4ML4 A;  2FDM A;  4R0X A;  1KT0 A;  2F4E A;  1JVW A;  3B7X A;  4TW7 A;  3ALF A;  5HBF A;  2G8Z A;  4DT4 A;  2AOS A;  1H0G A;  4W9O A;  3OOB A;  2WLZ A;  1D2K A;  4P8U A;  4DRN A;  3WL0 A;  4QT3 A;  1ITX A;  1GUV A;  1LJY A;  3VAW A;  1D7H A;  4TNS A;  1WNO A;  2PV2 A;  3TDB A;  3KAH A;  3NTP A;  1Q6I A;  1FFR A;  3AS3 A;  1FKH A;  2ESC A;  4KR0 B;  4ODQ A;  5DIU A;  4DRP A;  1ZL1 A;  4ODO A;  3RM4 A;  1PIN A;  1NMV A;  3FXY A;  4W9Q A;  2LPV A;  4G50 A;  1E6N A;  2XP5 A;  4ZPW R;  5GPG A;  1BL4 A;  2O9O A;  3WH0 A;  1PBK A;  4LAY A;  4Z2K A;  4BF8 A;  4URI A;  1FKL A;  1W9U A;  5DO2 A;  1LG1 A;  3ARP A;  1LG2 A;  2MLX A;  4JFJ A;  2L2S A;  1E6R A;  3KZ7 A;  3CHD A;  5HKG A;  3CGN A;  3G6M A;  2MLY A;  3ODK A;  3UI4 A;  3PRA A;  2A3E A;  1OGG A;  4JFI A;  1NMW A;  1FJD A;  1TFV A;  2YBU A;  5J6E A;  2D9F A;  2ZR4 A;  1LL6 A;  2LJ4 A;  4S3K A;  1E9L A;  1YAT A;  2WK2 A;  2ZQT A;  4ODR A;  3O5E A;  2M2A A;  3ARR A;  3TC5 A;  2N87 A;  5DIT A;  4MTV A;  2XPB A;  5B8I C;  4DWS C;  2DT1 A;  4NZC A;  2RUQ A;  2OLH A;  4WKA A;  5HWC A;  3UI6 A;  2DSU A;  4DRM A;  1IX5 A;  4Z2I A;  4R5E A;  2ZQS A;  4QIB A;  2PPO A;  1KT1 A;  5DIV A;  3KAB A;  1WAW A;  4ITZ A;  3WD0 A;  2JZV A;  2XP7 A;  3ARZ A;  1C9H A;  3JYJ A;  4AY1 A;  1LL7 A;  3RM8 A;  3ARW A;  4J4O A;  1N1A A;  3O5O A;  4S3J A;  1ROT A;  1JND A;  1KFW A;  3WL1 A;  4NSB A;  3IK8 A;  4WK9 A;  2ZR5 A;  1NWU A;  4Q22 A;  1OGB A;  2F2D A;  3ARX A;  2KE0 A;  1NWT A;  1FKF A;  1U79 A;  1D6O A;  3TCZ A;  1QPF A;  4DWS A;  3LUO A;  4DWS D;  2O92 A;  3BXW A;  4MNK A;  2PV1 A;  2RUC A;  4JFM A;  4MAV A;  3O5G A;  2IUZ A;  2A3B A;  4Z2G A;  2DG9 A;  2MLZ A;  4IPX A;  4G2P A;  3O5K A;  4Z2J A;  2XPA A;  3GPK A;  2DPE A;  1X6L A;  2PPP A;  1Q1C A;  4MNL A;  1FKK A;  3RFW A;  2PBC A;  4LAX A;  3FAP A;  1W1V A;  4U84 A;  1P5Q A;  3AS1 A;  3KAC A;  4ODP A;  3UF8 A;  1JNS A;  2KGJ A;  3O5I A;  3O5R A;  4WKH A;  4DWS B;  1D7J A;  1J4I A;  2XP6 A;  3ARO A;  5HW8 A;  2DT2 A;  1ZBW A;  3O5D A;  1NWR A;  4HBO A;  2ZQU A;  1SYT A;  3RGC A;  4LGX A;  5HWB A;  3ARS A;  3B9E A;  1NWS A;  2G41 A;  4QZV B;  3ARU A;  1HKK A;  2DSZ A;  2MNT A;  4U85 A;  3UQB A;  2UZ5 A;  2ZR6 A;  1D7I A;  2XP4 A;  1T11 A;  4ODN A;  1JNE A;  2MPH A;  1QPL A;  3OA5 A;  4DZ3 A;  4MPK A;  1H0I A;  4TX0 A;  4ZPT R;  1J6Y A;  1HJX A;  1W9P A;  1HJV A;  3KAF A;  3CHE A;  3WKZ A;  1HKI A;  3EY6 A;  3PA7 A;  2WLY A;  1EHN A;  1J4R A;  4MGV A;  3WQW A;  4FN2 A;  4FAP A;  3CHC A;  2KR7 A;  3IKG A;  3AS0 A;  3O5P A;  2RQS A;  1NSG A;  2DSV A;  1FD9 A;  4ODK A;  2XP8 A;  5DF0 A;  3WD1 A;  1ZB5 A;  4DH0 A;  2M08 A;  1ZU8 A;  3B9D A;  3WIJ A;  3RME A;  2A3C A;  2PPN A;  1UR9 A;  1FKR A;  4IT4 A;  1LQ0 A;  4N19 A;  4QT2 A;  1Q6U A;  2YBT A;  3B8S A;  4Z2H A;  1FFQ A;  1ZCN A;  4KQZ A;  3AS2 A;  1E6Z A;  1FKB A;  1OWQ A;  1RD6 A;  2DSW A;  1LL4 A;  3NRK A;  4MSP A;  4WIW A;  1GPF A;  2WM0 A;  3I6C A;  4HBE A;  3O5J A;  3QOK A;  1R9H A;  4WKF A;  3O5Q A;  3WQV A;  1ZBV A;  3WD4 A;  1W9V A;  4U86 A;  2A3A A;  4IQ2 A;  1E15 A;  2DG4 A;  1Q6H A;  3ARV A;  3B9A A;  3WD3 A;  2RUR A;  5JH8 A;  1NH6 A;  1FKS A;  2AWG A;  3UQA A;  3ARQ A;  2DT3 A;  1TCO C;  4TYO A;  4WJX A;  1FAP A;  4ZS6 A;  5GPR A;  1Y0O A;  3UI5 A;  3G6L A;  3ART A;  4W9P A;  1HKM A;  1W1T A;  3ALG A;  1O6I A;  2M1I A;  1QZ2 A;  3PR9 A;  4PTM A;  3O5M A;  3FY1 A;  1JNT A;  1M5Y A;  4DRI A;  2VN1 A;  4P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...