4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
molecule tags Isomerase
source organism Homo sapiens
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
1NMWA 2F21A 2L2SA 3I6CA 3KAGA 4DZ2A 3LUOA 5HKGA 3O5GA 3CGMA 2RUCA 2Q5AA 4ODNA 2ZR5A 4DT4A 3O5LA 4NNRA 4W9OA 5DITA 3PRBA 1J6YA 4DRQA 5HW6A 1ZK6A 4G50A 5I98A 3CGNA 1Q6IA 1N1AA 3TC5A 4JFJA 2RUQA 3WH0A 2XP4A 1FKBA 3KAHA 1JNSA 1A7XA 2JZVA 4DRNA 5HW8A 1EYMA 3UI4A 1FD9A 5D75A 3O5PA 4ODOA 4GIVA 1ZCNA 1FAPA 1KT0A 4ODRA 2M08A 2MLZA 1NMVA 3IK8A 1Q6UA 3O5QA 1F8AB 1J4HA 2XP5A 4DRMA 3H9RB 3UQIA 2VN1A 1PBKA 4DZ3A 3KAIA 4DRPA 1FKDA 4U85A 1Q6HA 4LAWA 2KE0A 3KABA 5BXJA 2VCDA 1FKHA 3O5OA 4ODKA 2KR7A 2AWGA 2KFWA 3FAPA 4MSPA 1P5QA 3B7XA 4GGQA 4U86A 2XPBA 2Y78A 3NRKA 3PA7A 4QT2A 5DIVA 2FKEA 4LAYA 4ODMA 5DIUA 2DG3A 3TCZA 2MF9A 1ROUA 4JFLA 3VAWA 4BF8A 4QT3A 1JVWA 4ODLA 3JYJA 1J4IA 1J4RA 2RURA 4ODQA 2N87A 1FKIA 1FJDA 1D7HA 4LAXA 3IKGA 3KADA 2LJ4A 3O5EA 4IPXA 5J6EA 1BL4A 2F2DA 2FAPA 4W9QA 1FKSA 1U79A 1FKTA 1B6CA 1W26A 4N19A 4JFKA 1QZ2A 4DRJA 1HXVA 4LAVA 2XP8A 1EQ3A 3IKDA 3KACA 1F40A 4DH0A 2PBCA 2XPAA 3KAFA 2PV1A 4ITZA 3UF8A 5HTGA 3UQBA 3GPKA 3RFWA 1FKGA 1FKLA 4JFIA 4TW6A 2PV2A 3O5JA 5HUAA 3RGCA 2F4EA 2ITKA 4IQ2A 2OFNA 4R0XA 1Q1CA 1TCOC 5HWCA 2MLYA 3JYMA 1FKKA 2LGOA 2ZQTA 4DRIA 1KT1A 2UZ5A 1FKFA 4MGVA 4ODPA 2KO7A 5GPGA 2XP9A 1PINA 4DROA 4FAPA 4J4NA 2PPOA 2MPHA 1T11A 2PV3A 2D9FA 4J4OA 3UI6A 2LPVA 2PPNA 3O5DA 3UQAA 5HWBA 2PPPA 4U84A 1FKJA 3TDBA 2KI3A 4JFMA 2RSEA 3O5IA 4W9PA 1QPFA 1ROTA 4QIBA 1QPLA 4TX0A 2RQSA 4IQCA 1BKFA 1D6OA 3OOBA 4DIPA 2ZQUA 4TW8A 1Y0OA 3O5RA 3JXVA 5B8IC 2MLXA 3KZ7A 3PRDA 4TYOA 3KCEA 2XP6A 4TNSA 2MNTA 4TW7A 3O5MA 1NSGA 1JNTA 2RUDA 2ZQVA 3MDYB 2XP3A 3ODKA 2M2AA 4FN2A 4C02B 1L1PA 3NI6A 2ZR6A 4DRHA 5HT1A 2XP7A 2IF4A 2M1IA 2DG4A 2ZR4A 2DG9A 1D7IA 2KGJA 4O2TA 2ZQSA 4DRKA 5HW7A 4JYSA 3O5KA 1FKRA 2K8IA 1YATA 3NTPA 1M5YA 3O5FA 3UI5A 1D7JA 1R9HA 3IHZA 4G2PA 3EY6A 1C9HA 2LKNA 1YW5A
chains in the Genus database with same CATH superfamily
3KAGA 4DWSB 1EDQA 3O5LA 3PRBA 3QOKA 4Z2JA 5HW6A 3WIJA 2RUQA 4ZPVR 1FKBA 1HJVA 1JNSA 2JZVA 4L72B 3O5PA 3ALFA 1W9PA 1ZCNA 3G6LA 2M08A 1TFVA 2P4VA 2FDMA 1OGGA 3B9AA 2ESCA 2ETNA 2QF8A 3B8SA 3ARWA 1Q6HA 1W1VA 3WD2A 4Q22A 2KR7A 3WD3A 3B7XA 2Y78A 3AROA 1ZU8A 4ODMA 4L3NA 3VAWA 4HBOA 4BF8A 4QT3A 1JVWA 2N87A 4KQZA 4Z2IA 3ARRA 4DWSD 1NWSA 1W9VA 4MNJA 1E9LA 1WNOA 3RM9A 5J6EA 2B31A 4W9QA 4N19A 2DSWA 1E6ZA 4S3KA 1F40A 2PBCA 3UF8A 3RFWA 4KR0B 3WQVA 1Q1CA 3OA5A 4ZPTR 1OWQA 1TCOC 3PRAA 4AY1A 5HWCA 1FKKA 4ODPA 1SR0A 4W5UA 3AQUA 4HARA 1SYTA 4S3JA 2WLYA 3ARVA 3B9EA 3CHDA 1WAWA 5HWBA 2PPPA 4U84A 3ARSA 1BKFA 3WD1A 4DIPA 1JNEA 3O5RA 4Z2GA 3PRDA 1E44A 4TYOA 3WD4A 2XP6A 4TNSA 4TW7A 3WQWA 1JNTA 4C02B 3ODKA 4FN2A 4NZCA 2ZR6A 3EIPA 1HKIA 1LG2A 1E15A 2IF4A 2ZR4A 2DG4A 2WK2A 4WKFA 1FKRA 4JYSA 1K9TA 2K8IA 3NTPA 4UDMA 1O6IA 1YW5A 3GTYX 4XAKA 3LUOA 3CGMA 1W1TA 2Q5AA 2ZR5A 1JNDA 4NNRA 4W9OA 4Z2LA 1UR8A 2A3BA 4R5EA 4G50A 3AS0A 3TC5A 4JFJA 3WH0A 3KAHA 1FFRA 4QZVB 4ODOA 1FAPA 1KT0A 3CHFA 4DRMA 3H9RB 3UQIA 2PN0A 2VN1A 1H0GA 3CHEA 4IT4A 3O5OA 4ODKA 3ARZA 2AWGA 3FAPA 4MSPA 1RD6A 4QT2A 4DWSA 4LAYA 4JFLA 2WLZA 2O9OA 4WK9A 3JYJA 1GRJA 4MAVA 2YBTA 4MTVA 2LJ4A 1BL4A 1FKSA 1U79A 3FY1A 1ZBVA 2B5UB 4DH0A 2XPAA 4WJXA 1FKGA 1GUVA 1E6RA 3O5JA 3GU0A 1W1YA 5HUAA 1E6PA 1HJWA 1EIBA 3JYMA 5GPRA 1FKFA 4MGVA 1PINA 3ARPA 4DROA 1NWUA 4J4OA 2OLHA 3O5DA 3AS1A 2DSUA 2WM0A 1FKJA 3TDBA 4JFMA 3O5IA 1ROTA 4TX0A 2RQSA 1ZL1A 2ZQUA 2DSVA 1Y0OA 4TW8A 1W1PA 3JXVA 5B8IC 1NSGA 3BXWA 1HKMA 2DSZA 4ML4A 3NI6A 1LG1A 3WKZA 5HT1A 1LJYA 1IX5A 4URIA 4DRKA 3ARYA 1M5YA 3O5FA 3UI5A 3IHZA 3AS3A 4G2PA 3EY6A 2LKNA 1NMWA 2L2SA 4DZ2A 3O5GA 4PTMA 4DT4A 5DITA 1J6YA 5I98A 3CGNA 2XP4A 1A7XA 4DRNA 1GPFA 5HW8A 1EYMA 5D75A 2G8ZA 4WKAA 4ODRA 1CTNA 1NMVA 3IK8A 1LL4A 1NWTA 1LL7A 4MNMA 4P8XA 4DZ3A 4Q7NA 5JH8A 4U85A 4LAWA 1VF8A 3RM8A 2VCDA 1FKHA 4HBEA 4U86A 1P5QA 4GGQA 2XPBA 3NRKA 2FKEA 5DIUA 2DG3A 3TCZA 1J4RA 2RURA 1FKIA 1FJDA 3ARXA 4LAXA 3KADA 1WB0A 2FAPA 1FKTA 1HXVA 1QZ2A 2XP8A 3ARUA 4ZS6A 3IKDA 3CHCA 3KACA 1EQ3A 3KAFA 1X6NA 2PV1A 3GPKA 4JFIA 4TW6A 2PV2A 3RGCA 2F4EA 4IQ2A 4P8UA 4R0XA 3CH9A 3ARQA 2MLYA 4DRIA 2UZ5A 4WIWA 5GPGA 4FAPA 1LL6A 1KFWA 2PV3A 3RMEA 1ZB5A 3UQAA 2O92A 1JCHB 4WKHA 2RSEA 4W9PA 1H0IA 1QPFA 4QIBA 1QPLA 1OGBA 3OOBA 1GOIA 2MLXA 4IT6A 3KZ7A 2G41A 2DPEA 3FXYA 2MNTA 2RUDA 2ZQVA 2XP3A 4DRHA 2DT2A 4MNKA 1LQ0A 4O2TA 2DG9A 1D7IA 2KGJA 2ZQSA 3O5KA 4NSBA 1R9HA 3I6CA 2F21A 5HKGA 2RUCA 4ODNA 1W9UA 2F23A 4DRQA 1ZK6A 2PI6A 1Q6IA 1N1AA 3ARTA 1X6LA 3CZ8A 3UI4A 1FD9A 4GIVA 4LGXA 2MLZA 1Q6UA 4DWSC 3O5QA 1F8AB 1J4HA 3G6MA 3ALGA 1NH6A 2XP5A 1PBKA 2DT0A 3KAIA 4DRPA 1FKDA 5BXJA 2KE0A 3KABA 4P8VA 1EHNA 2IUZA 5GQBA 2KFWA 5DIVA 3PA7A 2YBUA 4P8WA 3WD0A 4ZPWR 2MF9A 1ROUA 1ZBCA 4ODLA 4Z2HA 1J4IA 4ODQA 2A3EA 1D7HA 1NWRA 3IKGA 4IPXA 3O5EA 1FFQA 2F2DA 1UR9A 3AS2A 1ZBKA 3RM4A 1W26A 1B6CA 4DRJA 4JFKA 4LAVA 5DO2A 3UQBA 4ITZA 5HTGA 1FKLA 3W4RA 2ITKA 2OFNA 4Z2KA 4MPKA 1ZBWA 2LGOA 1XHGA 2ZQTA 1KT1A 2KO7A 2XP9A 1E6NA 3WL1A 4J4NA 2PPOA 2MPHA 1T11A 3UI6A 2D9FA 3PR9A 2LPVA 2PPNA 1D2KA 2KI3A 2DT3A 3WL0A 1ITXA 4IQCA 3B9DA 1D6OA 4MNLA 3BMBA 5HBFA 5DF0A 3KCEA 2A3AA 3O5MA 3MDYB 2M2AA 1L1PA 1HKJA 1HJXA 2XP7A 2M1IA 5HW7A 1XRVA 2EULA 1YATA 2A3CA 2AOSA 5DEZA 1D7JA 1HKKA 1C9HA 2DT1A
chains in the Genus database with same CATH topology
3KAGA 4DWSB 1EDQA 3O5LA 3PRBA 3QOKA 4Z2JA 5HW6A 3WIJA 2RUQA 4ZPVR 1FKBA 1HJVA 1JNSA 2JZVA 4L72B 3O5PA 3ALFA 1W9PA 1ZCNA 3G6LA 2M08A 1TFVA 2FDMA 1OGGA 3B9AA 2ESCA 2QF8A 3B8SA 3ARWA 1Q6HA 1W1VA 3WD2A 4Q22A 2KR7A 3WD3A 3B7XA 2Y78A 3AROA 1ZU8A 4ODMA 4L3NA 3VAWA 4HBOA 4BF8A 4QT3A 1JVWA 2N87A 4KQZA 4Z2IA 3ARRA 4DWSD 1NWSA 1W9VA 4MNJA 1E9LA 1WNOA 3RM9A 5J6EA 2B31A 4W9QA 4N19A 2DSWA 1E6ZA 4S3KA 1F40A 2PBCA 3UF8A 3RFWA 4KR0B 3WQVA 1Q1CA 3OA5A 4ZPTR 1OWQA 1TCOC 3PRAA 4AY1A 5HWCA 1FKKA 4ODPA 1SR0A 4W5UA 3AQUA 4HARA 1SYTA 4S3JA 2WLYA 3ARVA 3B9EA 3CHDA 1WAWA 5HWBA 2PPPA 4U84A 3ARSA 1BKFA 3WD1A 4DIPA 1JNEA 3O5RA 4Z2GA 3PRDA 4TYOA 3WD4A 2XP6A 4TNSA 4TW7A 3WQWA 1JNTA 4C02B 3ODKA 4FN2A 4NZCA 2ZR6A 1HKIA 1LG2A 1E15A 2IF4A 2ZR4A 2DG4A 2WK2A 4WKFA 1FKRA 4JYSA 1K9TA 2K8IA 3NTPA 1O6IA 1YW5A 4XAKA 3LUOA 3CGMA 1W1TA 2Q5AA 2ZR5A 1JNDA 4NNRA 4W9OA 4Z2LA 1UR8A 2A3BA 4R5EA 4G50A 3AS0A 3TC5A 4JFJA 3WH0A 3KAHA 1FFRA 4QZVB 4ODOA 1FAPA 1KT0A 3CHFA 4DRMA 3H9RB 3UQIA 2VN1A 1H0GA 3CHEA 4IT4A 3O5OA 4ODKA 3ARZA 2AWGA 3FAPA 4MSPA 1RD6A 4QT2A 4DWSA 4LAYA 4JFLA 2WLZA 2O9OA 4WK9A 3JYJA 4MAVA 2YBTA 4MTVA 2LJ4A 1BL4A 1FKSA 1U79A 3FY1A 1ZBVA 4DH0A 2XPAA 4WJXA 1FKGA 1GUVA 1E6RA 3O5JA 1W1YA 5HUAA 1E6PA 1HJWA 1EIBA 3JYMA 5GPRA 1FKFA 4MGVA 1PINA 3ARPA 4DROA 4J4OA 1NWUA 2OLHA 3O5DA 3AS1A 2DSUA 2WM0A 1FKJA 3TDBA 4JFMA 3O5IA 1ROTA 4TX0A 2RQSA 1ZL1A 2ZQUA 2DSVA 1Y0OA 4TW8A 1W1PA 3JXVA 5B8IC 1NSGA 3BXWA 1HKMA 2DSZA 4ML4A 3NI6A 1LG1A 3WKZA 5HT1A 1LJYA 1IX5A 4URIA 4DRKA 3ARYA 1M5YA 3O5FA 3UI5A 3IHZA 3AS3A 4G2PA 3EY6A 2LKNA 1NMWA 2L2SA 4DZ2A 3O5GA 4PTMA 4DT4A 5DITA 1J6YA 5I98A 3CGNA 2XP4A 1A7XA 4DRNA 1GPFA 5HW8A 1EYMA 5D75A 2G8ZA 4WKAA 4ODRA 1CTNA 1NMVA 3IK8A 1LL4A 1NWTA 1LL7A 4MNMA 4P8XA 4DZ3A 4Q7NA 5JH8A 4U85A 4LAWA 1VF8A 3RM8A 2VCDA 1FKHA 4HBEA 4U86A 1P5QA 4GGQA 2XPBA 3NRKA 2FKEA 5DIUA 2DG3A 3TCZA 1J4RA 2RURA 1FKIA 1FJDA 3ARXA 4LAXA 3KADA 1WB0A 2FAPA 1FKTA 1HXVA 1QZ2A 2XP8A 3ARUA 4ZS6A 3IKDA 3CHCA 3KACA 1EQ3A 3KAFA 1X6NA 2PV1A 3GPKA 4JFIA 4TW6A 2PV2A 3RGCA 2F4EA 4IQ2A 4P8UA 4R0XA 3CH9A 3ARQA 2MLYA 4DRIA 2UZ5A 4WIWA 5GPGA 4FAPA 1LL6A 1KFWA 2PV3A 3RMEA 1ZB5A 3UQAA 2O92A 4WKHA 2RSEA 4W9PA 1H0IA 1QPFA 4QIBA 1QPLA 1OGBA 3OOBA 1GOIA 2MLXA 4IT6A 3KZ7A 2G41A 2DPEA 3FXYA 2MNTA 2RUDA 2ZQVA 2XP3A 4DRHA 2DT2A 4MNKA 1LQ0A 4O2TA 2DG9A 1D7IA 2KGJA 2ZQSA 3O5KA 4NSBA 1R9HA 3I6CA 2F21A 5HKGA 2RUCA 4ODNA 1W9UA 4DRQA 1ZK6A 2PI6A 1Q6IA 1N1AA 3ARTA 1X6LA 3CZ8A 3UI4A 1FD9A 4GIVA 4LGXA 2MLZA 1Q6UA 4DWSC 3O5QA 1F8AB 1J4HA 2XP5A 3ALGA 1NH6A 3G6MA 1PBKA 2DT0A 3KAIA 4DRPA 1FKDA 5BXJA 2KE0A 3KABA 4P8VA 1EHNA 2IUZA 5GQBA 2KFWA 5DIVA 3PA7A 2YBUA 4P8WA 3WD0A 4ZPWR 2MF9A 1ROUA 1ZBCA 4ODLA 4Z2HA 1J4IA 4ODQA 2A3EA 1D7HA 1NWRA 3IKGA 4IPXA 3O5EA 1FFQA 2F2DA 1UR9A 3AS2A 1ZBKA 3RM4A 1W26A 1B6CA 4DRJA 4JFKA 4LAVA 5DO2A 3UQBA 4ITZA 5HTGA 1FKLA 3W4RA 2ITKA 2OFNA 4Z2KA 4MPKA 1ZBWA 2LGOA 1XHGA 2ZQTA 1KT1A 2KO7A 2XP9A 1E6NA 3WL1A 4J4NA 2PPOA 2MPHA 1T11A 3UI6A 2D9FA 3PR9A 2LPVA 2PPNA 1D2KA 2KI3A 2DT3A 3WL0A 1ITXA 4IQCA 3B9DA 1D6OA 4MNLA 5HBFA 5DF0A 3KCEA 2A3AA 3O5MA 3MDYB 2M2AA 1L1PA 1HKJA 1HJXA 2XP7A 2M1IA 5HW7A 1XRVA 1YATA 2A3CA 2AOSA 5DEZA 1D7JA 1HKKA 1C9HA 2DT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NMW A;  2F21 A;  2L2S A;  3I6C A;  3KAG A;  4DZ2 A;  3LUO A;  5HKG A;  3O5G A;  3CGM A;  2RUC A;  2Q5A A;  4ODN A;  2ZR5 A;  4DT4 A;  3O5L A;  4NNR A;  4W9O A;  5DIT A;  3PRB A;  1J6Y A;  4DRQ A;  5HW6 A;  1ZK6 A;  4G50 A;  5I98 A;  3CGN A;  1Q6I A;  1N1A A;  3TC5 A;  4JFJ A;  2RUQ A;  3WH0 A;  2XP4 A;  1FKB A;  3KAH A;  1JNS A;  1A7X A;  2JZV A;  4DRN A;  5HW8 A;  1EYM A;  3UI4 A;  1FD9 A;  5D75 A;  3O5P A;  4ODO A;  4GIV A;  1ZCN A;  1FAP A;  1KT0 A;  4ODR A;  2M08 A;  2MLZ A;  1NMV A;  3IK8 A;  1Q6U A;  3O5Q A;  1F8A B;  1J4H A;  2XP5 A;  4DRM A;  3H9R B;  3UQI A;  2VN1 A;  1PBK A;  4DZ3 A;  3KAI A;  4DRP A;  1FKD A;  4U85 A;  1Q6H A;  4LAW A;  2KE0 A;  3KAB A;  5BXJ A;  2VCD A;  1FKH A;  3O5O A;  4ODK A;  2KR7 A;  2AWG A;  2KFW A;  3FAP A;  4MSP A;  1P5Q A;  3B7X A;  4GGQ A;  4U86 A;  2XPB A;  2Y78 A;  3NRK A;  3PA7 A;  4QT2 A;  5DIV A;  2FKE A;  4LAY A;  4ODM A;  5DIU A;  2DG3 A;  3TCZ A;  2MF9 A;  1ROU A;  4JFL A;  3VAW A;  4BF8 A;  4QT3 A;  1JVW A;  4ODL A;  3JYJ A;  1J4I A;  1J4R A;  2RUR A;  4ODQ A;  2N87 A;  1FKI A;  1FJD A;  1D7H A;  4LAX A;  3IKG A;  3KAD A;  2LJ4 A;  3O5E A;  4IPX A;  5J6E A;  1BL4 A;  2F2D A;  2FAP A;  4W9Q A;  1FKS A;  1U79 A;  1FKT A;  1B6C A;  1W26 A;  4N19 A;  4JFK A;  1QZ2 A;  4DRJ A;  1HXV A;  4LAV A;  2XP8 A;  1EQ3 A;  3IKD A;  3KAC A;  1F40 A;  4DH0 A;  2PBC A;  2XPA A;  3KAF A;  2PV1 A;  4ITZ A;  3UF8 A;  5HTG A;  3UQB A;  3GPK A;  3RFW A;  1FKG A;  1FKL A;  4JFI A;  4TW6 A;  2PV2 A;  3O5J A;  5HUA A;  3RGC A;  2F4E A;  2ITK A;  4IQ2 A;  2OFN A;  4R0X A;  1Q1C A;  1TCO C;  5HWC A;  2MLY A;  3JYM A;  1FKK A;  2LGO A;  2ZQT A;  4DRI A;  1KT1 A;  2UZ5 A;  1FKF A;  4MGV A;  4ODP A;  2KO7 A;  5GPG A;  2XP9 A;  1PIN A;  4DRO A;  4FAP A;  4J4N A;  2PPO A;  2MPH A;  1T11 A;  2PV3 A;  2D9F A;  4J4O A;  3UI6 A;  2LPV A;  2PPN A;  3O5D A;  3UQA A;  5HWB A;  2PPP A;  4U84 A;  1FKJ A;  3TDB A;  2KI3 A;  4JFM A;  2RSE A;  3O5I A;  4W9P A;  1QPF A;  1ROT A;  4QIB A;  1QPL A;  4TX0 A;  2RQS A;  4IQC A;  1BKF A;  1D6O A;  3OOB A;  4DIP A;  2ZQU A;  4TW8 A;  1Y0O A;  3O5R A;  3JXV A;  5B8I C;  2MLX A;  3KZ7 A;  3PRD A;  4TYO A;  3KCE A;  2XP6 A;  4TNS A;  2MNT A;  4TW7 A;  3O5M A;  1NSG A;  1JNT A;  2RUD A;  2ZQV A;  3MDY B;  2XP3 A;  3ODK A;  2M2A A;  4FN2 A;  4C02 B;  1L1P A;  3NI6 A;  2ZR6 A;  4DRH A;  5HT1 A;  2XP7 A;  2IF4 A;  2M1I A;  2DG4 A;  2ZR4 A;  2DG9 A;  1D7I A;  2KGJ A;  4O2T A;  2ZQS A;  4DRK A;  5HW7 A;  4JYS A;  3O5K A;  1FKR A;  2K8I A;  1YAT A;  3NTP A;  1M5Y A;  3O5F A;  3UI5 A;  1D7J A;  1R9H A;  3IHZ A;  4G2P A;  3EY6 A;  1C9H A;  2LKN A;  1YW5 A; 
#chains in the Genus database with same CATH topology
 3KAG A;  4DWS B;  1EDQ A;  3O5L A;  3PRB A;  3QOK A;  4Z2J A;  5HW6 A;  3WIJ A;  2RUQ A;  4ZPV R;  1FKB A;  1HJV A;  1JNS A;  2JZV A;  4L72 B;  3O5P A;  3ALF A;  1W9P A;  1ZCN A;  3G6L A;  2M08 A;  1TFV A;  2P4V A;  2FDM A;  1OGG A;  3B9A A;  2ESC A;  2ETN A;  2QF8 A;  3B8S A;  3ARW A;  1Q6H A;  1W1V A;  3WD2 A;  4Q22 A;  2KR7 A;  3WD3 A;  3B7X A;  2Y78 A;  3ARO A;  1ZU8 A;  4ODM A;  4L3N A;  3VAW A;  4HBO A;  4BF8 A;  4QT3 A;  1JVW A;  2N87 A;  4KQZ A;  4Z2I A;  3ARR A;  4DWS D;  1NWS A;  1W9V A;  4MNJ A;  1E9L A;  1WNO A;  3RM9 A;  5J6E A;  2B31 A;  4W9Q A;  4N19 A;  2DSW A;  1E6Z A;  4S3K A;  1F40 A;  2PBC A;  3UF8 A;  3RFW A;  4KR0 B;  3WQV A;  1Q1C A;  3OA5 A;  4ZPT R;  1OWQ A;  1TCO C;  3PRA A;  4AY1 A;  5HWC A;  1FKK A;  4ODP A;  1SR0 A;  4W5U A;  3AQU A;  4HAR A;  1SYT A;  4S3J A;  2WLY A;  3ARV A;  3B9E A;  3CHD A;  1WAW A;  5HWB A;  2PPP A;  4U84 A;  3ARS A;  1BKF A;  3WD1 A;  4DIP A;  1JNE A;  3O5R A;  4Z2G A;  3PRD A;  1E44 A;  4TYO A;  3WD4 A;  2XP6 A;  4TNS A;  4TW7 A;  3WQW A;  1JNT A;  4C02 B;  3ODK A;  4FN2 A;  4NZC A;  2ZR6 A;  3EIP A;  1HKI A;  1LG2 A;  1E15 A;  2IF4 A;  2ZR4 A;  2DG4 A;  2WK2 A;  4WKF A;  1FKR A;  4JYS A;  1K9T A;  2K8I A;  3NTP A;  4UDM A;  1O6I A;  1YW5 A;  3GTY X;  4XAK A;  3LUO A;  3CGM A;  1W1T A;  2Q5A A;  2ZR5 A;  1JND A;  4NNR A;  4W9O A;  4Z2L A;  1UR8 A;  2A3B A;  4R5E A;  4G50 A;  3AS0 A;  3TC5 A;  4JFJ A;  3WH0 A;  3KAH A;  1FFR A;  4QZV B;  4ODO A;  1FAP A;  1KT0 A;  3CHF A;  4DRM A;  3H9R B;  3UQI A;  2PN0 A;  2VN1 A;  1H0G A;  3CHE A;  4IT4 A;  3O5O A;  4ODK A;  3ARZ A;  2AWG A;  3FAP A;  4MSP A;  1RD6 A;  4QT2 A;  4DWS A;  4LAY A;  4JFL A;  2WLZ A;  2O9O A;  4WK9 A;  3JYJ A;  1GRJ A;  4MAV A;  2YBT A;  4MTV A;  2LJ4 A;  1BL4 A;  1FKS A;  1U79 A;  3FY1 A;  1ZBV A;  2B5U B;  4DH0 A;  2XPA A;  4WJX A;  1FKG A;  1GUV A;  1E6R A;  3O5J A;  3GU0 A;  1W1Y A;  5HUA A;  1E6P A;  1HJW A;  1EIB A;  3JYM A;  5GPR A;  1FKF A;  4MGV A;  1PIN A;  3ARP A;  4DRO A;  1NWU A;  4J4O A;  2OLH A;  3O5D A;  3AS1 A;  2DSU A;  2WM0 A;  1FKJ A;  3TDB A;  4JFM A;  3O5I A;  1ROT A;  4TX0 A;  2RQS A;  1ZL1 A;  2ZQU A;  2DSV A;  1Y0O A;  4TW8 A;  1W1P A;  3JXV A;  5B8I C;  1NSG A;  3BXW A;  1HKM A;  2DSZ A;  4ML4 A;  3NI6 A;  1LG1 A;  3WKZ A;  5HT1 A;  1LJY A;  1IX5 A;  4URI A;  4DRK A;  3ARY A;  1M5Y A;  3O5F A;  3UI5 A;  3IHZ A;  3AS3 A;  4G2P A;  3EY6 A;  2LKN A;  1NMW A;  2L2S A;  4DZ2 A;  3O5G A;  4PTM A;  4DT4 A;  5DIT A;  1J6Y A;  5I98 A;  3CGN A;  2XP4 A;  1A7X A;  4DRN A;  1GPF A;  5HW8 A;  1EYM A;  5D75 A;  2G8Z A;  4WKA A;  4ODR A;  1CTN A;  1NMV A;  3IK8 A;  1LL4 A;  1NWT A;  1LL7 A;  4MNM A;  4P8X A;  4DZ3 A;  4Q7N A;  5JH8 A;  4U85 A;  4LAW A;  1VF8 A;  3RM8 A;  2VCD A;  1FKH A;  4HBE A;  4U86 A;  1P5Q A;  4GGQ A;  2XPB A;  3NRK A;  2FKE A;  5DIU A;  2DG3 A;  3TCZ A;  1J4R A;  2RUR A;  1FKI A;  1FJD A;  3ARX A;  4LAX A;  3KAD A;  1WB0 A;  2FAP A;  1FKT A;  1HXV A;  1QZ2 A;  2XP8 A;  3ARU A;  4ZS6 A;  3IKD A;  3CHC A;  3KAC A;  1EQ3 A;  3KAF A;  1X6N A;  2PV1 A;  3GPK A;  4JFI A;  4TW6 A;  2PV2 A;  3RGC A;  2F4E A;  4IQ2 A;  4P8U A;  4R0X A;  3CH9 A;  3ARQ A;  2MLY A;  4DRI A;  2UZ5 A;  4WIW A;  5GPG A;  4FAP A;  1LL6 A;  1KFW A;  2PV3 A;  3RME A;  1ZB5 A;  3UQA A;  2O92 A;  1JCH B;  4WKH A;  2RSE A;  4W9P A;  1H0I A;  1QPF A;  4QIB A;  1QPL A;  1OGB A;  3OOB A;  1GOI A;  2MLX A;  4IT6 A;  3KZ7 A;  2G41 A;  2DPE A;  3FXY A;  2MNT A;  2RUD A;  2ZQV A;  2XP3 A;  4DRH A;  2DT2 A;  4MNK A;  1LQ0 A;  4O2T A;  2DG9 A;  1D7I A;  2KGJ A;  2ZQS A;  3O5K A;  4NSB A;  1R9H A;  3I6C A;  2F21 A;  5HKG A;  2RUC A;  4ODN A;  1W9U A;  2F23 A;  4DRQ A;  1ZK6 A;  2PI6 A;  1Q6I A;  1N1A A;  3ART A;  1X6L A;  3CZ8 A;  3UI4 A;  1FD9 A;  4GIV A;  4LGX A;  2MLZ A;  1Q6U A;  4DWS C;  3O5Q A;  1F8A B;  1J4H A;  3G6M A;  3ALG A;  1NH6 A;  2XP5 A;  1PBK A;  2DT0 A;  3KAI A;  4DRP A;  1FKD A;  5BXJ A;  2KE0 A;  3KAB A;  4P8V A;  1EHN A;  2IUZ A;  5GQB A;  2KFW A;  5DIV A;  3PA7 A;  2YBU A;  4P8W A;  3WD0 A;  4ZPW R;  2MF9 A;  1ROU A;  1ZBC A;  4ODL A;  4Z2H A;  1J4I A;  4ODQ A;  2A3E A;  1D7H A;  1NWR A;  3IKG A;  4IPX A;  3O5E A;  1FFQ A;  2F2D A;  1UR9 A;  3AS2 A;  1ZBK A;  3RM4 A;  1W26 A;  1B6C A;  4DRJ A;  4JFK A;  4LAV A;  5DO2 A;  3UQB A;  4ITZ A;  5HTG A;  1FKL A;  3W4R A;  2ITK A;  2OFN A;  4Z2K A;  4MPK A;  1ZBW A;  2LGO A;  1XHG A;  2ZQT A;  1KT1 A;  2KO7 A;  2XP9 A;  1E6N A;  3WL1 A;  4J4N A;  2PPO A;  2MPH A;  1T11 A;  3UI6 A;  2D9F A;  3PR9 A;  2LPV A;  2PPN A;  1D2K A;  2KI3 A;  2DT3 A;  3WL0 A;  1ITX A;  4IQC A;  3B9D A;  1D6O A;  4MNL A;  3BMB A;  5HBF A;  5DF0 A;  3KCE A;  2A3A A;  3O5M A;  3MDY B;  2M2A A;  1L1P A;  1HKJ A;  1HJX A;  2XP7 A;  2M1I A;  5HW7 A;  1XRV A;  2EUL A;  1YAT A;  2A3C A;  2AOS A;  5DEZ A;  1D7J A;  1HKK A;  1C9H A;  2DT1 A; 
#chains in the Genus database with same CATH homology
 3KAG A;  4DWS B;  1EDQ A;  3O5L A;  3PRB A;  3QOK A;  4Z2J A;  5HW6 A;  3WIJ A;  2RUQ A;  4ZPV R;  1FKB A;  1HJV A;  1JNS A;  2JZV A;  4L72 B;  3O5P A;  3ALF A;  1W9P A;  1ZCN A;  3G6L A;  2M08 A;  1TFV A;  2FDM A;  1OGG A;  3B9A A;  2ESC A;  2QF8 A;  3B8S A;  3ARW A;  1Q6H A;  1W1V A;  3WD2 A;  4Q22 A;  2KR7 A;  3WD3 A;  3B7X A;  2Y78 A;  3ARO A;  1ZU8 A;  4ODM A;  4L3N A;  3VAW A;  4HBO A;  4BF8 A;  4QT3 A;  1JVW A;  2N87 A;  4KQZ A;  4Z2I A;  3ARR A;  4DWS D;  1NWS A;  1W9V A;  4MNJ A;  1E9L A;  1WNO A;  3RM9 A;  5J6E A;  2B31 A;  4W9Q A;  4N19 A;  2DSW A;  1E6Z A;  4S3K A;  1F40 A;  2PBC A;  3UF8 A;  3RFW A;  4KR0 B;  3WQV A;  1Q1C A;  3OA5 A;  4ZPT R;  1OWQ A;  1TCO C;  3PRA A;  4AY1 A;  5HWC A;  1FKK A;  4ODP A;  1SR0 A;  4W5U A;  3AQU A;  4HAR A;  1SYT A;  4S3J A;  2WLY A;  3ARV A;  3B9E A;  3CHD A;  1WAW A;  5HWB A;  2PPP A;  4U84 A;  3ARS A;  1BKF A;  3WD1 A;  4DIP A;  1JNE A;  3O5R A;  4Z2G A;  3PRD A;  4TYO A;  3WD4 A;  2XP6 A;  4TNS A;  4TW7 A;  3WQW A;  1JNT A;  4C02 B;  3ODK A;  4FN2 A;  4NZC A;  2ZR6 A;  1HKI A;  1LG2 A;  1E15 A;  2IF4 A;  2ZR4 A;  2DG4 A;  2WK2 A;  4WKF A;  1FKR A;  4JYS A;  1K9T A;  2K8I A;  3NTP A;  1O6I A;  1YW5 A;  4XAK A;  3LUO A;  3CGM A;  1W1T A;  2Q5A A;  2ZR5 A;  1JND A;  4NNR A;  4W9O A;  4Z2L A;  1UR8 A;  2A3B A;  4R5E A;  4G50 A;  3AS0 A;  3TC5 A;  4JFJ A;  3WH0 A;  3KAH A;  1FFR A;  4QZV B;  4ODO A;  1FAP A;  1KT0 A;  3CHF A;  4DRM A;  3H9R B;  3UQI A;  2VN1 A;  1H0G A;  3CHE A;  4IT4 A;  3O5O A;  4ODK A;  3ARZ A;  2AWG A;  3FAP A;  4MSP A;  1RD6 A;  4QT2 A;  4DWS A;  4LAY A;  4JFL A;  2WLZ A;  2O9O A;  4WK9 A;  3JYJ A;  4MAV A;  2YBT A;  4MTV A;  2LJ4 A;  1BL4 A;  1FKS A;  1U79 A;  3FY1 A;  1ZBV A;  4DH0 A;  2XPA A;  4WJX A;  1FKG A;  1GUV A;  1E6R A;  3O5J A;  1W1Y A;  5HUA A;  1E6P A;  1HJW A;  1EIB A;  3JYM A;  5GPR A;  1FKF A;  4MGV A;  1PIN A;  3ARP A;  4DRO A;  4J4O A;  1NWU A;  2OLH A;  3O5D A;  3AS1 A;  2DSU A;  2WM0 A;  1FKJ A;  3TDB A;  4JFM A;  3O5I A;  1ROT A;  4TX0 A;  2RQS A;  1ZL1 A;  2ZQU A;  2DSV A;  1Y0O A;  4TW8 A;  1W1P A;  3JXV A;  5B8I C;  1NSG A;  3BXW A;  1HKM A;  2DSZ A;  4ML4 A;  3NI6 A;  1LG1 A;  3WKZ A;  5HT1 A;  1LJY A;  1IX5 A;  4URI A;  4DRK A;  3ARY A;  1M5Y A;  3O5F A;  3UI5 A;  3IHZ A;  3AS3 A;  4G2P A;  3EY6 A;  2LKN A;  1NMW A;  2L2S A;  4DZ2 A;  3O5G A;  4PTM A;  4DT4 A;  5DIT A;  1J6Y A;  5I98 A;  3CGN A;  2XP4 A;  1A7X A;  4DRN A;  1GPF A;  5HW8 A;  1EYM A;  5D75 A;  2G8Z A;  4WKA A;  4ODR A;  1CTN A;  1NMV A;  3IK8 A;  1LL4 A;  1NWT A;  1LL7 A;  4MNM A;  4P8X A;  4DZ3 A;  4Q7N A;  5JH8 A;  4U85 A;  4LAW A;  1VF8 A;  3RM8 A;  2VCD A;  1FKH A;  4HBE A;  4U86 A;  1P5Q A;  4GGQ A;  2XPB A;  3NRK A;  2FKE A;  5DIU A;  2DG3 A;  3TCZ A;  1J4R A;  2RUR A;  1FKI A;  1FJD A;  3ARX A;  4LAX A;  3KAD A;  1WB0 A;  2FAP A;  1FKT A;  1HXV A;  1QZ2 A;  2XP8 A;  3ARU A;  4ZS6 A;  3IKD A;  3CHC A;  3KAC A;  1EQ3 A;  3KAF A;  1X6N A;  2PV1 A;  3GPK A;  4JFI A;  4TW6 A;  2PV2 A;  3RGC A;  2F4E A;  4IQ2 A;  4P8U A;  4R0X A;  3CH9 A;  3ARQ A;  2MLY A;  4DRI A;  2UZ5 A;  4WIW A;  5GPG A;  4FAP A;  1LL6 A;  1KFW A;  2PV3 A;  3RME A;  1ZB5 A;  3UQA A;  2O92 A;  4WKH A;  2RSE A;  4W9P A;  1H0I A;  1QPF A;  4QIB A;  1QPL A;  1OGB A;  3OOB A;  1GOI A;  2MLX A;  4IT6 A;  3KZ7 A;  2G41 A;  2DPE A;  3FXY A;  2MNT A;  2RUD A;  2ZQV A;  2XP3 A;  4DRH A;  2DT2 A;  4MNK A;  1LQ0 A;  4O2T A;  2DG9 A;  1D7I A;  2KGJ A;  2ZQS A;  3O5K A;  4NSB A;  1R9H A;  3I6C A;  2F21 A;  5HKG A;  2RUC A;  4ODN A;  1W9U A;  4DRQ A;  1ZK6 A;  2PI6 A;  1Q6I A;  1N1A A;  3ART A;  1X6L A;  3CZ8 A;  3UI4 A;  1FD9 A;  4GIV A;  4LGX A;  2MLZ A;  1Q6U A;  4DWS C;  3O5Q A;  1F8A B;  1J4H A;  2XP5 A;  3ALG A;  1NH6 A;  3G6M A;  1PBK A;  2DT0 A;  3KAI A;  4DRP A;  1FKD A;  5BXJ A;  2KE0 A;  3KAB A;  4P8V A;  1EHN A;  2IUZ A;  5GQB A;  2KFW A;  5DIV A;  3PA7 A;  2YBU A;  4P8W A;  3WD0 A;  4ZPW R;  2MF9 A;  1ROU A;  1ZBC A;  4ODL A;  4Z2H A;  1J4I A;  4ODQ A;  2A3E A;  1D7H A;  1NWR A;  3IKG A;  4IPX A;  3O5E A;  1FFQ A;  2F2D A;  1UR9 A;  3AS2 A;  1ZBK A;  3RM4 A;  1W26 A;  1B6C A;  4DRJ A;  4JFK A;  4LAV A;  5DO2 A;  3UQB A;  4ITZ A;  5HTG A;  1FKL A;  3W4R A;  2ITK A;  2OFN A;  4Z2K A;  4MPK A;  1ZBW A;  2LGO A;  1XHG A;  2ZQT A;  1KT1 A;  2KO7 A;  2XP9 A;  1E6N A;  3WL1 A;  4J4N A;  2PPO A;  2MPH A;  1T11 A;  3UI6 A;  2D9F A;  3PR9 A;  2LPV A;  2PPN A;  1D2K A;  2KI3 A;  2DT3 A;  3WL0 A;  1ITX A;  4IQC A;  3B9D A;  1D6O A;  4MNL A;  5HBF A;  5DF0 A;  3KCE A;  2A3A A;  3O5M A;  3MDY B;  2M2A A;  1L1P A;  1HKJ A;  1HJX A;  2XP7 A;  2M1I A;  5HW7 A;  1XRV A;  1YAT A;  2A3C A;  2AOS A;  5DEZ A;  1D7J A;  1HKK A;  1C9H A;  2DT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...