4DIPA

Crystal structure of human peptidyl-prolyl cis-trans isomerase fkbp14
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
MGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP14
publication title Crystal structure of human Peptidyl-prolyl cis-trans isomerase FKBP14
rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 27
structure length 121
sequence length 121
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2012-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4dipA00
4W9PA 3UQAA 2D9FA 1KT0A 1JNSA 1Y0OA 1P5QA 3CGNA 1EQ3A 5HUAA 2MLYA 1Q6HA 1Q6UA 4NNRA 3NRKA 3UI5A 2MPHA 2AWGA 3UQBA 2XPBA 1FAPA 3O5FA 4GGQA 4DRIA 2M2AA 1R9HA 2PPNA 4G2PA 2MNTA 5BXJA 1FKHA 1YW5A 2LGOA 2RURA 4LAYA 1D7JA 1JNTA 1U79A 2PV2A 1D6OA 3O5OA 4W9QA 4IQ2A 5HW8A 2MLXA 1FKFA 1FD9A 4G50A 3UI4A 1L1PA 1QPLA 3LUOA 4JFKA 3ODKA 4R0XA 3NI6A 4TW6A 4U84A 1HXVA 2KO7A 3B7XA 5D75A 4ODOA 5HWBA 4TW8A 2M08A 1FKRA 4JFIA 1FKKA 2MLZA 5HTGA 2LPVA 3NTPA 1N1AA 2FKEA 1FKSA 2PV3A 2ZQSA 3IKGA 3KACA 3PA7A 4GIVA 4LAXA 3TC5A 4C02B 3O5QA 5I98A 3JYJA 1J4HA 1J4IA 4DT4A 2JZVA 2XP9A 3UF8A 3MDYB 1ROUA 2XP5A 4TNSA 3TCZA 4J4NA 5HWCA 2N87A 1FKDA 1F8AB 4JFLA 3UI6A 2IF4A 4W9OA 2RUQA 1D7HA 4DRNA 4ODQA 4O2TA 3JYMA 1FKIA 2VN1A 2OFNA 1FKJA 2RSEA 3O5EA 5HW6A 1ZK6A 2ZQTA 4JFJA 1W26A 2XP3A 2PBCA 3IK8A 1TCOC 2DG9A 4ODKA 1NSGA 3FAPA 3UQIA 2VCDA 2DG4A 1T11A 4FAPA 2F4EA 3PRDA 4MGVA 2PV1A 2ZQVA 1Q6IA 2K8IA 1FKTA 2ZR4A 3KAHA 4QT2A 4N19A 3O5KA 5DIUA 4ODLA 3VAWA 4DH0A 2ZQUA 3O5IA 1D7IA 4IQCA 4DRJA 1PBKA 4DZ2A 2ZR6A 1BL4A 2LKNA 5HW7A 1M5YA 3GPKA 2ITKA 2Y78A 5DITA 3O5DA 1NMVA 1NMWA 5HT1A 3IKDA 3KABA 4TW7A 2XP4A 2UZ5A 1FJDA 4J4OA 3RFWA 2KFWA 3IHZA 3KAGA 4U85A 5HKGA 4BF8A 2FAPA 4DRKA 4DRMA 3EY6A 1J6YA 2Q5AA 2KE0A 4ITZA 4DIPA 3RGCA 3OOBA 2M1IA 2MF9A 3KAFA 3WH0A 3O5LA 1FKLA 4DRPA 2KI3A 3KCEA 2XP8A 2LJ4A 3CGMA 3I6CA 3O5JA 1B6CA 3O5MA 3TDBA 1YATA 1FKGA 2RUDA 2RQSA 4DRHA 4LAWA 1F40A 4ODNA 3KZ7A 1ZCNA 2F2DA 1PINA 4JFMA 3H9RB 5DIVA 3JXVA 1J4RA 1QPFA 2ZR5A 4LAVA 4QIBA 5GPGA 1BKFA 1EYMA 4IPXA 1Q1CA 3KAIA 4DRQA 4ODPA 1JVWA 1ROTA 2DG3A 2XP6A 4TYOA 1A7XA 2F21A 2PPPA 2XP7A 4DROA 3O5RA 1FKBA 2RUCA 5B8IC 2L2SA 4DZ3A 4QT3A 4MSPA 3PRBA 4TX0A 3KADA 4ODRA 3O5PA 4JYSA 2PPOA 3O5GA 4FN2A 1KT1A 4U86A 4ODMA 2KGJA 2KR7A 2XPAA 1QZ2A 5J6EA 1C9HA
chains in the Genus database with same CATH superfamily
1CTNA 3RM4A 1P5QA 3GU0A 2DT1A 5GPRA 3O5FA 2M2AA 2PPNA 5DF0A 3RM9A 4ML4A 5BXJA 1YW5A 5JH8A 2O92A 2RURA 4WJXA 1U79A 2B31A 4JFKA 4TW6A 4WKAA 2KO7A 4Q7NA 4ODOA 1NH6A 3CZ8A 4JFIA 4P8UA 2FKEA 3IKGA 4C02B 3O5QA 5I98A 3JYJA 1W1TA 1J4IA 2XP9A 5HWCA 2XP5A 2EULA 2IF4A 4IT6A 2RUQA 4MNJA 3WKZA 4O2TA 1FKIA 2OFNA 1FKJA 3ARZA 1HJVA 1ZK6A 2ZQTA 3CH9A 4ODKA 4KQZA 4FAPA 3WD4A 4MGVA 4DZ2A 1PBKA 3PRAA 1BL4A 2LKNA 1LG1A 1H0GA 1EIBA 3GPKA 2ITKA 5DITA 1NMWA 3WD1A 1OGGA 3KABA 3GTYX 2A3CA 3KAGA 1HJXA 1W9VA 2WK2A 4DRMA 2KE0A 4ITZA 4DIPA 4DRPA 1XHGA 2FDMA 1FFQA 2G8ZA 3WD0A 4DRHA 2RQSA 4MNKA 3PR9A 1F40A 1ZCNA 1IX5A 3JXVA 3WQVA 5GPGA 1Q1CA 4S3JA 4Z2IA 1ROTA 1A7XA 2F21A 3O5RA 1ZBCA 2WLYA 3PRBA 1O6IA 4ZPTR 3EIPA 4ODRA 3O5PA 2PPOA 3AS2A 3G6LA 3B9DA 3O5GA 4Z2KA 2KR7A 3ARPA 1W1VA 5J6EA 1E6PA 2PV3A 1C9HA 4W9PA 2AOSA 2D9FA 1KT0A 1OWQA 2MLYA 1Q6HA 2AWGA 4GGQA 1R9HA 2MNTA 1FKHA 3OA5A 2LGOA 1ZBVA 3ARRA 4MTVA 3ARQA 1E6NA 4G50A 1FKFA 2ETNA 2A3EA 3ODKA 4WKHA 3B7XA 4HBEA 2M08A 3WD3A 5HTGA 2LPVA 1N1AA 2ZQSA 1JNSA 3KACA 3WQWA 2JZVA 3MDYB 2N87A 1F8AB 4JFLA 3QOKA 1HKIA 1W9UA 1D7HA 3ARWA 4AY1A 3ARUA 1LQ0A 4JFJA 1W26A 2PBCA 2DG9A 4MNMA 2PI6A 3UQIA 2A3BA 1LL7A 2ZR4A 1EHNA 4N19A 5DIUA 2ZQUA 2IUZA 2DSZA 4DRJA 4QZVB 2ZR6A 1NWTA 5HW7A 1RD6A 4ZPVR 1VF8A 2Y78A 1SYTA 2UZ5A 3RFWA 1OGBA 2KFWA 4BF8A 4UDMA 3EY6A 1NWRA 5DEZA 3RMEA 3WH0A 2PN0A 1SR0A 1WB0A 1K9TA 4LAWA 4ODNA 3CHDA 3G6MA 4JFMA 5DIVA 1QPFA 2ZR5A 1GRJA 4IPXA 1EYMA 4HBOA 3KAIA 1LL4A 4P8VA 2DG3A 4TYOA 4DZ3A 3FXYA 3BXWA 1LG2A 3KADA 4Q22A 1UR9A 4Z2JA 1E15A 1GUVA 1FFRA 3CGNA 1EQ3A 3NRKA 2MPHA 1FAPA 1WNOA 3AROA 4G2PA 4WIWA 1JNTA 1D6OA 1H0IA 1L1PA 2ESCA 1FD9A 3UI4A 1X6NA 2DT2A 3LUOA 2F23A 3RM8A 1LJYA 1HKJA 4HARA 4W5UA 1ITXA 3PA7A 4GIVA 3CHCA 4DWSB 4DT4A 4L72B 3UF8A 1ROUA 4TNSA 1NWSA 4J4NA 1ZB5A 3UI6A 3BMBA 4W9OA 4DRNA 1E6ZA 1KFWA 4ODQA 3JYMA 3O5EA 4LGXA 3ARTA 2XP3A 3IK8A 3FAPA 2VCDA 2DG4A 1T11A 2YBUA 3PRDA 2ZQVA 4QT2A 2K8IA 4DWSA 3VAWA 4ODLA 5DO2A 3WL1A 5HBFA 3CHEA 3O5IA 2YBTA 1XRVA 1W9PA 3CHFA 2XP4A 4U85A 3WIJA 4PTMA 1E6RA 2O9OA 4NSBA 3OOBA 4ZPWR 3AS1A 3B9AA 1GOIA 3O5MA 2LJ4A 2DSVA 1B6CA 3TDBA 4MPKA 4S3KA 1HJWA 4XAKA 3H9RB 1LL6A 3AS3A 1BKFA 2B5UB 3ALGA 4URIA 1GPFA 1UR8A 1JCHB 2RUCA 4MSPA 2OLHA 4KR0B 4JYSA 4FN2A 4ODMA 2XPAA 3UQAA 1ZBWA 4ZS6A 1Y0OA 1ZL1A 5HUAA 1Q6UA 4NNRA 3ARYA 3UI5A 3UQBA 2XPBA 4DRIA 3B9EA 4NZCA 1ZBKA 4LAYA 1D7JA 2PV2A 4W9QA 3O5OA 4IQ2A 5HW8A 2MLXA 1EDQA 1HKMA 1QPLA 1ZU8A 4R0XA 3NI6A 4U84A 2WM0A 1HXVA 5D75A 1WAWA 4TW8A 1FKRA 4Z2LA 1FKKA 4WKFA 2MLZA 1W1PA 3NTPA 2DSUA 1FKSA 3TC5A 4LAXA 5HWBA 2WLZA 1J4HA 1D2KA 4MAVA 3TCZA 3ARSA 1W1YA 1FKDA 5GQBA 3W4RA 1TFVA 2DPEA 4R5EA 2VN1A 2RSEA 5HW6A 4DWSC 1TCOC 1JNDA 3AS0A 2DT3A 1NSGA 2DSWA 3ARVA 2F4EA 2PV1A 1Q6IA 3KAHA 1FKTA 1X6LA 4WK9A 4DWSD 3O5KA 4DH0A 4P8WA 1D7IA 4L3NA 4IQCA 1NWUA 1M5YA 3O5DA 1NMVA 5HT1A 3IKDA 4TW7A 4Z2GA 3ARXA 1FJDA 4J4OA 3WD2A 4P8XA 5HKGA 3IHZA 4MNLA 2FAPA 4DRKA 2DT0A 1J6YA 2Q5AA 3RGCA 2M1IA 2MF9A 3KAFA 3O5LA 1FKLA 2KI3A 3B8SA 3WL0A 3KCEA 2XP8A 3CGMA 3I6CA 3O5JA 1YATA 1FKGA 2RUDA 3KZ7A 2F2DA 1PINA 4Z2HA 1J4RA 4LAVA 4QIBA 3ALFA 4DRQA 1HKKA 1JNEA 1JVWA 4ODPA 2XP6A 3AQUA 2QF8A 4DROA 2PPPA 2XP7A 1FKBA 1E9LA 2L2SA 5B8IC 1E44A 4QT3A 4TX0A 3FY1A 2G41A 1KT1A 4U86A 2KGJA 4IT4A 1QZ2A 2P4VA 2A3AA
chains in the Genus database with same CATH topology
1CTNA 3RM4A 1P5QA 2DT1A 5GPRA 3O5FA 2M2AA 2PPNA 5DF0A 3RM9A 4ML4A 5BXJA 1YW5A 5JH8A 2O92A 2RURA 4WJXA 1U79A 2B31A 4JFKA 4TW6A 4WKAA 2KO7A 4Q7NA 4ODOA 1NH6A 3CZ8A 4JFIA 4P8UA 2FKEA 3IKGA 4C02B 3O5QA 5I98A 3JYJA 1W1TA 1J4IA 2XP9A 5HWCA 2XP5A 2IF4A 4IT6A 2RUQA 4MNJA 3WKZA 4O2TA 1FKIA 2OFNA 1FKJA 3ARZA 1HJVA 1ZK6A 2ZQTA 3CH9A 4ODKA 4KQZA 4FAPA 3WD4A 4MGVA 4DZ2A 1PBKA 3PRAA 1BL4A 2LKNA 1LG1A 1H0GA 1EIBA 3GPKA 2ITKA 5DITA 1NMWA 3WD1A 1OGGA 3KABA 2A3CA 3KAGA 1HJXA 1W9VA 2WK2A 4DRMA 2KE0A 4ITZA 4DIPA 4DRPA 1XHGA 2FDMA 1FFQA 2G8ZA 3WD0A 4DRHA 2RQSA 4MNKA 3PR9A 1F40A 1ZCNA 1IX5A 3JXVA 3WQVA 5GPGA 1Q1CA 4S3JA 4Z2IA 1ROTA 1A7XA 2F21A 3O5RA 1ZBCA 2WLYA 3PRBA 1O6IA 4ZPTR 4ODRA 3O5PA 2PPOA 3AS2A 3G6LA 3B9DA 3O5GA 4Z2KA 2KR7A 3ARPA 1W1VA 5J6EA 1E6PA 2PV3A 1C9HA 4W9PA 2AOSA 2D9FA 1KT0A 1OWQA 2MLYA 1Q6HA 2AWGA 4GGQA 1R9HA 2MNTA 1FKHA 3OA5A 2LGOA 1ZBVA 3ARRA 4MTVA 3ARQA 1E6NA 4G50A 1FKFA 2A3EA 3ODKA 4WKHA 3B7XA 4HBEA 2M08A 3WD3A 5HTGA 2LPVA 1N1AA 2ZQSA 1JNSA 3KACA 3WQWA 2JZVA 3MDYB 2N87A 1F8AB 4JFLA 3QOKA 1HKIA 1W9UA 1D7HA 3ARWA 4AY1A 3ARUA 1LQ0A 4JFJA 1W26A 2PBCA 2DG9A 4MNMA 2PI6A 3UQIA 2A3BA 1LL7A 2ZR4A 1EHNA 4N19A 5DIUA 2ZQUA 2IUZA 2DSZA 4DRJA 4QZVB 2ZR6A 1NWTA 5HW7A 1RD6A 4ZPVR 1VF8A 2Y78A 1SYTA 2UZ5A 3RFWA 1OGBA 2KFWA 4BF8A 3EY6A 1NWRA 5DEZA 3RMEA 3WH0A 1SR0A 1WB0A 1K9TA 4LAWA 4ODNA 3CHDA 3G6MA 4JFMA 5DIVA 1QPFA 2ZR5A 4IPXA 1EYMA 4HBOA 3KAIA 1LL4A 4P8VA 2DG3A 4TYOA 4DZ3A 3FXYA 3BXWA 1LG2A 3KADA 4Q22A 1UR9A 4Z2JA 1E15A 1GUVA 1FFRA 3CGNA 1EQ3A 3NRKA 2MPHA 1FAPA 1WNOA 3AROA 4G2PA 4WIWA 1JNTA 1D6OA 1H0IA 1L1PA 2ESCA 1FD9A 3UI4A 1X6NA 2DT2A 3LUOA 3RM8A 1LJYA 1HKJA 4HARA 4W5UA 1ITXA 3PA7A 4GIVA 3CHCA 4DWSB 4DT4A 4L72B 3UF8A 1ROUA 4TNSA 1NWSA 4J4NA 1ZB5A 3UI6A 4W9OA 4DRNA 1E6ZA 1KFWA 4ODQA 3JYMA 3O5EA 4LGXA 3ARTA 2XP3A 3IK8A 3FAPA 2VCDA 2DG4A 1T11A 2YBUA 3PRDA 2ZQVA 4QT2A 2K8IA 4DWSA 3VAWA 4ODLA 5DO2A 3WL1A 5HBFA 3CHEA 3O5IA 2YBTA 1XRVA 1W9PA 3CHFA 2XP4A 4U85A 3WIJA 4PTMA 1E6RA 2O9OA 4NSBA 3OOBA 4ZPWR 3AS1A 3B9AA 1GOIA 3O5MA 2LJ4A 2DSVA 1B6CA 3TDBA 4MPKA 4S3KA 1HJWA 4XAKA 3H9RB 1LL6A 3AS3A 1BKFA 3ALGA 4URIA 1GPFA 1UR8A 2RUCA 4MSPA 2OLHA 4KR0B 4JYSA 4FN2A 4ODMA 2XPAA 3UQAA 1ZBWA 4ZS6A 1Y0OA 1ZL1A 5HUAA 1Q6UA 4NNRA 3ARYA 3UI5A 3UQBA 2XPBA 4DRIA 3B9EA 4NZCA 1ZBKA 4LAYA 1D7JA 2PV2A 4W9QA 3O5OA 4IQ2A 5HW8A 2MLXA 1EDQA 1HKMA 1QPLA 1ZU8A 4R0XA 3NI6A 4U84A 2WM0A 1HXVA 5D75A 1WAWA 4TW8A 1FKRA 4Z2LA 1FKKA 4WKFA 2MLZA 1W1PA 3NTPA 2DSUA 1FKSA 3TC5A 4LAXA 5HWBA 2WLZA 1J4HA 1D2KA 4MAVA 3TCZA 3ARSA 1W1YA 1FKDA 5GQBA 3W4RA 1TFVA 2DPEA 4R5EA 2VN1A 2RSEA 5HW6A 4DWSC 1TCOC 1JNDA 3AS0A 2DT3A 1NSGA 2DSWA 3ARVA 2F4EA 2PV1A 1Q6IA 3KAHA 1FKTA 1X6LA 4WK9A 4DWSD 3O5KA 4DH0A 4P8WA 1D7IA 4L3NA 4IQCA 1NWUA 1M5YA 3O5DA 1NMVA 5HT1A 3IKDA 4TW7A 4Z2GA 3ARXA 1FJDA 4J4OA 3WD2A 4P8XA 5HKGA 3IHZA 4MNLA 2FAPA 4DRKA 2DT0A 1J6YA 2Q5AA 3RGCA 2M1IA 2MF9A 3KAFA 3O5LA 1FKLA 2KI3A 3B8SA 3WL0A 3KCEA 2XP8A 3O5JA 3CGMA 3I6CA 1YATA 1FKGA 2RUDA 3KZ7A 2F2DA 1PINA 4Z2HA 1J4RA 4LAVA 4QIBA 3ALFA 4DRQA 1HKKA 1JNEA 1JVWA 4ODPA 2XP6A 3AQUA 2QF8A 4DROA 2PPPA 2XP7A 1FKBA 1E9LA 2L2SA 5B8IC 4QT3A 4TX0A 3FY1A 2G41A 1KT1A 4U86A 2KGJA 4IT4A 1QZ2A 2A3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9P A;  3UQA A;  2D9F A;  1KT0 A;  1JNS A;  1Y0O A;  1P5Q A;  3CGN A;  1EQ3 A;  5HUA A;  2MLY A;  1Q6H A;  1Q6U A;  4NNR A;  3NRK A;  3UI5 A;  2MPH A;  2AWG A;  3UQB A;  2XPB A;  1FAP A;  3O5F A;  4GGQ A;  4DRI A;  2M2A A;  1R9H A;  2PPN A;  4G2P A;  2MNT A;  5BXJ A;  1FKH A;  1YW5 A;  2LGO A;  2RUR A;  4LAY A;  1D7J A;  1JNT A;  1U79 A;  2PV2 A;  1D6O A;  3O5O A;  4W9Q A;  4IQ2 A;  5HW8 A;  2MLX A;  1FKF A;  1FD9 A;  4G50 A;  3UI4 A;  1L1P A;  1QPL A;  3LUO A;  4JFK A;  3ODK A;  4R0X A;  3NI6 A;  4TW6 A;  4U84 A;  1HXV A;  2KO7 A;  3B7X A;  5D75 A;  4ODO A;  5HWB A;  4TW8 A;  2M08 A;  1FKR A;  4JFI A;  1FKK A;  2MLZ A;  5HTG A;  2LPV A;  3NTP A;  1N1A A;  2FKE A;  1FKS A;  2PV3 A;  2ZQS A;  3IKG A;  3KAC A;  3PA7 A;  4GIV A;  4LAX A;  3TC5 A;  4C02 B;  3O5Q A;  5I98 A;  3JYJ A;  1J4H A;  1J4I A;  4DT4 A;  2JZV A;  2XP9 A;  3UF8 A;  3MDY B;  1ROU A;  2XP5 A;  4TNS A;  3TCZ A;  4J4N A;  5HWC A;  2N87 A;  1FKD A;  1F8A B;  4JFL A;  3UI6 A;  2IF4 A;  4W9O A;  2RUQ A;  1D7H A;  4DRN A;  4ODQ A;  4O2T A;  3JYM A;  1FKI A;  2VN1 A;  2OFN A;  1FKJ A;  2RSE A;  3O5E A;  5HW6 A;  1ZK6 A;  2ZQT A;  4JFJ A;  1W26 A;  2XP3 A;  2PBC A;  3IK8 A;  1TCO C;  2DG9 A;  4ODK A;  1NSG A;  3FAP A;  3UQI A;  2VCD A;  2DG4 A;  1T11 A;  4FAP A;  2F4E A;  3PRD A;  4MGV A;  2PV1 A;  2ZQV A;  1Q6I A;  2K8I A;  1FKT A;  2ZR4 A;  3KAH A;  4QT2 A;  4N19 A;  3O5K A;  5DIU A;  4ODL A;  3VAW A;  4DH0 A;  2ZQU A;  3O5I A;  1D7I A;  4IQC A;  4DRJ A;  1PBK A;  4DZ2 A;  2ZR6 A;  1BL4 A;  2LKN A;  5HW7 A;  1M5Y A;  3GPK A;  2ITK A;  2Y78 A;  5DIT A;  3O5D A;  1NMV A;  1NMW A;  5HT1 A;  3IKD A;  3KAB A;  4TW7 A;  2XP4 A;  2UZ5 A;  1FJD A;  4J4O A;  3RFW A;  2KFW A;  3IHZ A;  3KAG A;  4U85 A;  5HKG A;  4BF8 A;  2FAP A;  4DRK A;  4DRM A;  3EY6 A;  1J6Y A;  2Q5A A;  2KE0 A;  4ITZ A;  4DIP A;  3RGC A;  3OOB A;  2M1I A;  2MF9 A;  3KAF A;  3WH0 A;  3O5L A;  1FKL A;  4DRP A;  2KI3 A;  3KCE A;  2XP8 A;  2LJ4 A;  3CGM A;  3I6C A;  3O5J A;  1B6C A;  3O5M A;  3TDB A;  1YAT A;  1FKG A;  2RUD A;  2RQS A;  4DRH A;  4LAW A;  1F40 A;  4ODN A;  3KZ7 A;  1ZCN A;  2F2D A;  1PIN A;  4JFM A;  3H9R B;  5DIV A;  3JXV A;  1J4R A;  1QPF A;  2ZR5 A;  4LAV A;  4QIB A;  5GPG A;  1BKF A;  1EYM A;  4IPX A;  1Q1C A;  3KAI A;  4DRQ A;  4ODP A;  1JVW A;  1ROT A;  2DG3 A;  2XP6 A;  4TYO A;  1A7X A;  2F21 A;  2PPP A;  2XP7 A;  4DRO A;  3O5R A;  1FKB A;  2RUC A;  5B8I C;  2L2S A;  4DZ3 A;  4QT3 A;  4MSP A;  3PRB A;  4TX0 A;  3KAD A;  4ODR A;  3O5P A;  4JYS A;  2PPO A;  3O5G A;  4FN2 A;  1KT1 A;  4U86 A;  4ODM A;  2KGJ A;  2KR7 A;  2XPA A;  1QZ2 A;  5J6E A;  1C9H A; 
#chains in the Genus database with same CATH topology
 1CTN A;  3RM4 A;  1P5Q A;  3GU0 A;  2DT1 A;  5GPR A;  3O5F A;  2M2A A;  2PPN A;  5DF0 A;  3RM9 A;  4ML4 A;  5BXJ A;  1YW5 A;  5JH8 A;  2O92 A;  2RUR A;  4WJX A;  1U79 A;  2B31 A;  4JFK A;  4TW6 A;  4WKA A;  2KO7 A;  4Q7N A;  4ODO A;  1NH6 A;  3CZ8 A;  4JFI A;  4P8U A;  2FKE A;  3IKG A;  4C02 B;  3O5Q A;  5I98 A;  3JYJ A;  1W1T A;  1J4I A;  2XP9 A;  5HWC A;  2XP5 A;  2EUL A;  2IF4 A;  4IT6 A;  2RUQ A;  4MNJ A;  3WKZ A;  4O2T A;  1FKI A;  2OFN A;  1FKJ A;  3ARZ A;  1HJV A;  1ZK6 A;  2ZQT A;  3CH9 A;  4ODK A;  4KQZ A;  4FAP A;  3WD4 A;  4MGV A;  4DZ2 A;  1PBK A;  3PRA A;  1BL4 A;  2LKN A;  1LG1 A;  1H0G A;  1EIB A;  3GPK A;  2ITK A;  5DIT A;  1NMW A;  3WD1 A;  1OGG A;  3KAB A;  3GTY X;  2A3C A;  3KAG A;  1HJX A;  1W9V A;  2WK2 A;  4DRM A;  2KE0 A;  4ITZ A;  4DIP A;  4DRP A;  1XHG A;  2FDM A;  1FFQ A;  2G8Z A;  3WD0 A;  4DRH A;  2RQS A;  4MNK A;  3PR9 A;  1F40 A;  1ZCN A;  1IX5 A;  3JXV A;  3WQV A;  5GPG A;  1Q1C A;  4S3J A;  4Z2I A;  1ROT A;  1A7X A;  2F21 A;  3O5R A;  1ZBC A;  2WLY A;  3PRB A;  1O6I A;  4ZPT R;  3EIP A;  4ODR A;  3O5P A;  2PPO A;  3AS2 A;  3G6L A;  3B9D A;  3O5G A;  4Z2K A;  2KR7 A;  3ARP A;  1W1V A;  5J6E A;  1E6P A;  2PV3 A;  1C9H A;  4W9P A;  2AOS A;  2D9F A;  1KT0 A;  1OWQ A;  2MLY A;  1Q6H A;  2AWG A;  4GGQ A;  1R9H A;  2MNT A;  1FKH A;  3OA5 A;  2LGO A;  1ZBV A;  3ARR A;  4MTV A;  3ARQ A;  1E6N A;  4G50 A;  1FKF A;  2ETN A;  2A3E A;  3ODK A;  4WKH A;  3B7X A;  4HBE A;  2M08 A;  3WD3 A;  5HTG A;  2LPV A;  1N1A A;  2ZQS A;  1JNS A;  3KAC A;  3WQW A;  2JZV A;  3MDY B;  2N87 A;  1F8A B;  4JFL A;  3QOK A;  1HKI A;  1W9U A;  1D7H A;  3ARW A;  4AY1 A;  3ARU A;  1LQ0 A;  4JFJ A;  1W26 A;  2PBC A;  2DG9 A;  4MNM A;  2PI6 A;  3UQI A;  2A3B A;  1LL7 A;  2ZR4 A;  1EHN A;  4N19 A;  5DIU A;  2ZQU A;  2IUZ A;  2DSZ A;  4DRJ A;  4QZV B;  2ZR6 A;  1NWT A;  5HW7 A;  1RD6 A;  4ZPV R;  1VF8 A;  2Y78 A;  1SYT A;  2UZ5 A;  3RFW A;  1OGB A;  2KFW A;  4BF8 A;  4UDM A;  3EY6 A;  1NWR A;  5DEZ A;  3RME A;  3WH0 A;  2PN0 A;  1SR0 A;  1WB0 A;  1K9T A;  4LAW A;  4ODN A;  3CHD A;  3G6M A;  4JFM A;  5DIV A;  1QPF A;  2ZR5 A;  1GRJ A;  4IPX A;  1EYM A;  4HBO A;  3KAI A;  1LL4 A;  4P8V A;  2DG3 A;  4TYO A;  4DZ3 A;  3FXY A;  3BXW A;  1LG2 A;  3KAD A;  4Q22 A;  1UR9 A;  4Z2J A;  1E15 A;  1GUV A;  1FFR A;  3CGN A;  1EQ3 A;  3NRK A;  2MPH A;  1FAP A;  1WNO A;  3ARO A;  4G2P A;  4WIW A;  1JNT A;  1D6O A;  1H0I A;  1L1P A;  2ESC A;  1FD9 A;  3UI4 A;  1X6N A;  2DT2 A;  3LUO A;  2F23 A;  3RM8 A;  1LJY A;  1HKJ A;  4HAR A;  4W5U A;  1ITX A;  3PA7 A;  4GIV A;  3CHC A;  4DWS B;  4DT4 A;  4L72 B;  3UF8 A;  1ROU A;  4TNS A;  1NWS A;  4J4N A;  1ZB5 A;  3UI6 A;  3BMB A;  4W9O A;  4DRN A;  1E6Z A;  1KFW A;  4ODQ A;  3JYM A;  3O5E A;  4LGX A;  3ART A;  2XP3 A;  3IK8 A;  3FAP A;  2VCD A;  2DG4 A;  1T11 A;  2YBU A;  3PRD A;  2ZQV A;  4QT2 A;  2K8I A;  4DWS A;  3VAW A;  4ODL A;  5DO2 A;  3WL1 A;  5HBF A;  3CHE A;  3O5I A;  2YBT A;  1XRV A;  1W9P A;  3CHF A;  2XP4 A;  4U85 A;  3WIJ A;  4PTM A;  1E6R A;  2O9O A;  4NSB A;  3OOB A;  4ZPW R;  3AS1 A;  3B9A A;  1GOI A;  3O5M A;  2LJ4 A;  2DSV A;  1B6C A;  3TDB A;  4MPK A;  4S3K A;  1HJW A;  4XAK A;  3H9R B;  1LL6 A;  3AS3 A;  1BKF A;  2B5U B;  3ALG A;  4URI A;  1GPF A;  1UR8 A;  1JCH B;  2RUC A;  4MSP A;  2OLH A;  4KR0 B;  4JYS A;  4FN2 A;  4ODM A;  2XPA A;  3UQA A;  1ZBW A;  4ZS6 A;  1Y0O A;  1ZL1 A;  5HUA A;  1Q6U A;  4NNR A;  3ARY A;  3UI5 A;  3UQB A;  2XPB A;  4DRI A;  3B9E A;  4NZC A;  1ZBK A;  4LAY A;  1D7J A;  2PV2 A;  4W9Q A;  3O5O A;  4IQ2 A;  5HW8 A;  2MLX A;  1EDQ A;  1HKM A;  1QPL A;  1ZU8 A;  4R0X A;  3NI6 A;  4U84 A;  2WM0 A;  1HXV A;  5D75 A;  1WAW A;  4TW8 A;  1FKR A;  4Z2L A;  1FKK A;  4WKF A;  2MLZ A;  1W1P A;  3NTP A;  2DSU A;  1FKS A;  3TC5 A;  4LAX A;  5HWB A;  2WLZ A;  1J4H A;  1D2K A;  4MAV A;  3TCZ A;  3ARS A;  1W1Y A;  1FKD A;  5GQB A;  3W4R A;  1TFV A;  2DPE A;  4R5E A;  2VN1 A;  2RSE A;  5HW6 A;  4DWS C;  1TCO C;  1JND A;  3AS0 A;  2DT3 A;  1NSG A;  2DSW A;  3ARV A;  2F4E A;  2PV1 A;  1Q6I A;  3KAH A;  1FKT A;  1X6L A;  4WK9 A;  4DWS D;  3O5K A;  4DH0 A;  4P8W A;  1D7I A;  4L3N A;  4IQC A;  1NWU A;  1M5Y A;  3O5D A;  1NMV A;  5HT1 A;  3IKD A;  4TW7 A;  4Z2G A;  3ARX A;  1FJD A;  4J4O A;  3WD2 A;  4P8X A;  5HKG A;  3IHZ A;  4MNL A;  2FAP A;  4DRK A;  2DT0 A;  1J6Y A;  2Q5A A;  3RGC A;  2M1I A;  2MF9 A;  3KAF A;  3O5L A;  1FKL A;  2KI3 A;  3B8S A;  3WL0 A;  3KCE A;  2XP8 A;  3CGM A;  3I6C A;  3O5J A;  1YAT A;  1FKG A;  2RUD A;  3KZ7 A;  2F2D A;  1PIN A;  4Z2H A;  1J4R A;  4LAV A;  4QIB A;  3ALF A;  4DRQ A;  1HKK A;  1JNE A;  1JVW A;  4ODP A;  2XP6 A;  3AQU A;  2QF8 A;  4DRO A;  2PPP A;  2XP7 A;  1FKB A;  1E9L A;  2L2S A;  5B8I C;  1E44 A;  4QT3 A;  4TX0 A;  3FY1 A;  2G41 A;  1KT1 A;  4U86 A;  2KGJ A;  4IT4 A;  1QZ2 A;  2P4V A;  2A3A A; 
#chains in the Genus database with same CATH homology
 1CTN A;  3RM4 A;  1P5Q A;  2DT1 A;  5GPR A;  3O5F A;  2M2A A;  2PPN A;  5DF0 A;  3RM9 A;  4ML4 A;  5BXJ A;  1YW5 A;  5JH8 A;  2O92 A;  2RUR A;  4WJX A;  1U79 A;  2B31 A;  4JFK A;  4TW6 A;  4WKA A;  2KO7 A;  4Q7N A;  4ODO A;  1NH6 A;  3CZ8 A;  4JFI A;  4P8U A;  2FKE A;  3IKG A;  4C02 B;  3O5Q A;  5I98 A;  3JYJ A;  1W1T A;  1J4I A;  2XP9 A;  5HWC A;  2XP5 A;  2IF4 A;  4IT6 A;  2RUQ A;  4MNJ A;  3WKZ A;  4O2T A;  1FKI A;  2OFN A;  1FKJ A;  3ARZ A;  1HJV A;  1ZK6 A;  2ZQT A;  3CH9 A;  4ODK A;  4KQZ A;  4FAP A;  3WD4 A;  4MGV A;  4DZ2 A;  1PBK A;  3PRA A;  1BL4 A;  2LKN A;  1LG1 A;  1H0G A;  1EIB A;  3GPK A;  2ITK A;  5DIT A;  1NMW A;  3WD1 A;  1OGG A;  3KAB A;  2A3C A;  3KAG A;  1HJX A;  1W9V A;  2WK2 A;  4DRM A;  2KE0 A;  4ITZ A;  4DIP A;  4DRP A;  1XHG A;  2FDM A;  1FFQ A;  2G8Z A;  3WD0 A;  4DRH A;  2RQS A;  4MNK A;  3PR9 A;  1F40 A;  1ZCN A;  1IX5 A;  3JXV A;  3WQV A;  5GPG A;  1Q1C A;  4S3J A;  4Z2I A;  1ROT A;  1A7X A;  2F21 A;  3O5R A;  1ZBC A;  2WLY A;  3PRB A;  1O6I A;  4ZPT R;  4ODR A;  3O5P A;  2PPO A;  3AS2 A;  3G6L A;  3B9D A;  3O5G A;  4Z2K A;  2KR7 A;  3ARP A;  1W1V A;  5J6E A;  1E6P A;  2PV3 A;  1C9H A;  4W9P A;  2AOS A;  2D9F A;  1KT0 A;  1OWQ A;  2MLY A;  1Q6H A;  2AWG A;  4GGQ A;  1R9H A;  2MNT A;  1FKH A;  3OA5 A;  2LGO A;  1ZBV A;  3ARR A;  4MTV A;  3ARQ A;  1E6N A;  4G50 A;  1FKF A;  2A3E A;  3ODK A;  4WKH A;  3B7X A;  4HBE A;  2M08 A;  3WD3 A;  5HTG A;  2LPV A;  1N1A A;  2ZQS A;  1JNS A;  3KAC A;  3WQW A;  2JZV A;  3MDY B;  2N87 A;  1F8A B;  4JFL A;  3QOK A;  1HKI A;  1W9U A;  1D7H A;  3ARW A;  4AY1 A;  3ARU A;  1LQ0 A;  4JFJ A;  1W26 A;  2PBC A;  2DG9 A;  4MNM A;  2PI6 A;  3UQI A;  2A3B A;  1LL7 A;  2ZR4 A;  1EHN A;  4N19 A;  5DIU A;  2ZQU A;  2IUZ A;  2DSZ A;  4DRJ A;  4QZV B;  2ZR6 A;  1NWT A;  5HW7 A;  1RD6 A;  4ZPV R;  1VF8 A;  2Y78 A;  1SYT A;  2UZ5 A;  3RFW A;  1OGB A;  2KFW A;  4BF8 A;  3EY6 A;  1NWR A;  5DEZ A;  3RME A;  3WH0 A;  1SR0 A;  1WB0 A;  1K9T A;  4LAW A;  4ODN A;  3CHD A;  3G6M A;  4JFM A;  5DIV A;  1QPF A;  2ZR5 A;  4IPX A;  1EYM A;  4HBO A;  3KAI A;  1LL4 A;  4P8V A;  2DG3 A;  4TYO A;  4DZ3 A;  3FXY A;  3BXW A;  1LG2 A;  3KAD A;  4Q22 A;  1UR9 A;  4Z2J A;  1E15 A;  1GUV A;  1FFR A;  3CGN A;  1EQ3 A;  3NRK A;  2MPH A;  1FAP A;  1WNO A;  3ARO A;  4G2P A;  4WIW A;  1JNT A;  1D6O A;  1H0I A;  1L1P A;  2ESC A;  1FD9 A;  3UI4 A;  1X6N A;  2DT2 A;  3LUO A;  3RM8 A;  1LJY A;  1HKJ A;  4HAR A;  4W5U A;  1ITX A;  3PA7 A;  4GIV A;  3CHC A;  4DWS B;  4DT4 A;  4L72 B;  3UF8 A;  1ROU A;  4TNS A;  1NWS A;  4J4N A;  1ZB5 A;  3UI6 A;  4W9O A;  4DRN A;  1E6Z A;  1KFW A;  4ODQ A;  3JYM A;  3O5E A;  4LGX A;  3ART A;  2XP3 A;  3IK8 A;  3FAP A;  2VCD A;  2DG4 A;  1T11 A;  2YBU A;  3PRD A;  2ZQV A;  4QT2 A;  2K8I A;  4DWS A;  3VAW A;  4ODL A;  5DO2 A;  3WL1 A;  5HBF A;  3CHE A;  3O5I A;  2YBT A;  1XRV A;  1W9P A;  3CHF A;  2XP4 A;  4U85 A;  3WIJ A;  4PTM A;  1E6R A;  2O9O A;  4NSB A;  3OOB A;  4ZPW R;  3AS1 A;  3B9A A;  1GOI A;  3O5M A;  2LJ4 A;  2DSV A;  1B6C A;  3TDB A;  4MPK A;  4S3K A;  1HJW A;  4XAK A;  3H9R B;  1LL6 A;  3AS3 A;  1BKF A;  3ALG A;  4URI A;  1GPF A;  1UR8 A;  2RUC A;  4MSP A;  2OLH A;  4KR0 B;  4JYS A;  4FN2 A;  4ODM A;  2XPA A;  3UQA A;  1ZBW A;  4ZS6 A;  1Y0O A;  1ZL1 A;  5HUA A;  1Q6U A;  4NNR A;  3ARY A;  3UI5 A;  3UQB A;  2XPB A;  4DRI A;  3B9E A;  4NZC A;  1ZBK A;  4LAY A;  1D7J A;  2PV2 A;  4W9Q A;  3O5O A;  4IQ2 A;  5HW8 A;  2MLX A;  1EDQ A;  1HKM A;  1QPL A;  1ZU8 A;  4R0X A;  3NI6 A;  4U84 A;  2WM0 A;  1HXV A;  5D75 A;  1WAW A;  4TW8 A;  1FKR A;  4Z2L A;  1FKK A;  4WKF A;  2MLZ A;  1W1P A;  3NTP A;  2DSU A;  1FKS A;  3TC5 A;  4LAX A;  5HWB A;  2WLZ A;  1J4H A;  1D2K A;  4MAV A;  3TCZ A;  3ARS A;  1W1Y A;  1FKD A;  5GQB A;  3W4R A;  1TFV A;  2DPE A;  4R5E A;  2VN1 A;  2RSE A;  5HW6 A;  4DWS C;  1TCO C;  1JND A;  3AS0 A;  2DT3 A;  1NSG A;  2DSW A;  3ARV A;  2F4E A;  2PV1 A;  1Q6I A;  3KAH A;  1FKT A;  1X6L A;  4WK9 A;  4DWS D;  3O5K A;  4DH0 A;  4P8W A;  1D7I A;  4L3N A;  4IQC A;  1NWU A;  1M5Y A;  3O5D A;  1NMV A;  5HT1 A;  3IKD A;  4TW7 A;  4Z2G A;  3ARX A;  1FJD A;  4J4O A;  3WD2 A;  4P8X A;  5HKG A;  3IHZ A;  4MNL A;  2FAP A;  4DRK A;  2DT0 A;  1J6Y A;  2Q5A A;  3RGC A;  2M1I A;  2MF9 A;  3KAF A;  3O5L A;  1FKL A;  2KI3 A;  3B8S A;  3WL0 A;  3KCE A;  2XP8 A;  3O5J A;  3CGM A;  3I6C A;  1YAT A;  1FKG A;  2RUD A;  3KZ7 A;  2F2D A;  1PIN A;  4Z2H A;  1J4R A;  4LAV A;  4QIB A;  3ALF A;  4DRQ A;  1HKK A;  1JNE A;  1JVW A;  4ODP A;  2XP6 A;  3AQU A;  2QF8 A;  4DRO A;  2PPP A;  2XP7 A;  1FKB A;  1E9L A;  2L2S A;  5B8I C;  4QT3 A;  4TX0 A;  3FY1 A;  2G41 A;  1KT1 A;  4U86 A;  2KGJ A;  4IT4 A;  1QZ2 A;  2A3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...