4DJ3A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
298
Chain Sequence
b'GRLEDVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNCAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Period circadian protein homolog 3
molecule tags Protein binding
source organism Mus musculus
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
total genus 65
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A02
2HV1A 3GDIA 2V9AA 2M1CA 4PKYA 4WF0A 3FG8A 4WL9A 2V1BA 1F9IA 4H6JB 1KOUA 3UMDA 4HQAA 1OJ5A 2ZOHA 1OT6A 2BASA 2Z6DA 1BYWA 5F69A 4EXOA 4F3LA 4EETB 2KX6A 2R78A 1P97A 1LSXA 1N9OA 3CLOA 3NOUC 5IU1A 1S4RA 1D7EA 5G4YA 4B9OA 4HP9A 1DP8A 1XFQA 4F3LB 5F68A 3F1NB 4EQ1A 1T19A 1N9NA 2PD7A 2PDRA 5AVEA 3LIBA 1GSVA 1X0OA 3CWFA 4WN5A 4WUJA 1NWZA 4EERA 2W27A 3H7WA 1LSWA 5J4EA 1T1CA 3MJQA 5A8BA 2PHYA 4LPZA 1LSVA 3GECA 4NXGA 1G28A 1XJ4A 3NOTC 3PYPA 4XT2A 1TS6A 3H7WB 4GCZA 4GS9B 5HWWA 1V9YA 3LYXA 4BBTA 4I38A 4I3AA 2QJ7A 2V1AA 4NXBA 1Y28A 3UB8A 3MXQA 4LRYC 4L9FA 5HZHA 1N9LA 3IS2B 3A0VA 1GSXA 3EEHA 4L9GA 3MQOA 3MFXA 3NOPC 2KDKA 3IBRA 5HSQA 1S67L 2PYRA 1F98A 2B02A 2PD8A 3E4PA 1OTAA 2PYPA 3LIDA 1DP6A 4JGOA 3IS2A 3E4QA 4HY8A 4R38A 5HD5A 3K3DA 2QKPA 5TBMB 1T18A 2H28A 5HWVA 1XFNA 2GJ3A 4K08A 1XJ3A 2A24B 1UWNX 3E4OA 3H82A 3LIEA 2VV6A 5F6AA 2OOLA 3T50A 3VE3A 5DKKA 5TBMA 4R70A 3VOLA 2D01A 2PR5A 2V0WA 3UB9A 5J7EA 3PHYA 4KUOA 2EA9A 1XJ2A 1OT9A 2A24A 3FC7A 2PR6A 5HDSA 3SW1A 4YWZA 4NXFA 2D02A 1S1YA 2JN7A 3LIAA 5IS1A 4HNBA 4HH2A 1XJ6A 2ZOIA 3HJKA 1TS8A 1JNUA 2WKPA 2W0NA 1VB6A 3G6OA 3H9WA 3MQQA 3B33A 3NJAA 3NHQA 4JGRA 5DJUA 3A0RA 4BBUA 3LUQA 3VE4A 3CAXA 1S66L 3OLOA 3UB7A 1D06A 2VV7A 1UWPX 2WKQA 2ZBBA 3F1NA 4H6JA 2J80A 2QJ5A 4LLOB 2WKRA 3C8CA 4LRZE 1TS0A 2INWA 2VLGA 2OWJA 1GSWA 1OTEA 3EWKA 1LT0A 1MZUA 4HJ4A 4NXEA 5F5YA 2L0WA 3BY8A 2JHEA 3BY9A 4PKYG 3ULFA 4HHDA 5DKLA 1ODVA 2Z6CA 4M4XA 3RH8B 5J3WA 3LI8A 4I3JA 1S4SA 4XT2B 4BBVA 2YKFA 1OTBA 4HP4A 4I39A 2L1MA 1EW0A 1OTIA 3LICA 3RTYA 4KUKA 5G4ZA 4EW7A 4I3IA 3UMEA 3KX0X 4HI4A 5AVFA 3UE6A 5KIZA 5DJTA 3LI9A 1UGUA 3LIFA 2CMNA 4R6LA 4GHIA 1LL8A 4HIAA 3C2WA 1DRMA 1P0ZA 1T1AA 3F1PB 4HJ6A 4DJ2A 4EEPA 1WA9A 2OWHA 4GS9A 4WLAA 4EEUA 2I9VA 2L4RA 4GHIB 4HOIA 3HJIA 1OJGA 3F1PA 3ICYA 4RQ9A 5HDCA 5HD3A 4HH3A 5HWTA 1DP9A 1T1BA 3F1OB 2K7SA 3P7NA 3D72A 3MR0A 2QWSA 4JGQA 2YKHA 3K3CA 5EFWA 4GW9A 1OTDA 2P7JA 2V0UA 4I5SA 1V9ZA 3BWLA 4JGPA 4LRXC 2VEAA 3F1OA 4MN5A 4MN6A 4R3AA 5HDDA 5I5LA 4DJ3A 4KQDA 4HJ3A 4E04A 4L9EA 3ZQ5A 3A0SA 3H82B 1TS7A 1S1ZA 2QHKA 4EESA 3UB6A 2VV8A
chains in the Genus database with same CATH superfamily
1PW8A 2V8CA 4QB8A 5FAPA 5A90A 3W4PA 4B4XA 4M3KA 2Z6DA 4PM7A 2ZMVA 5M19A 1HLUP 5BOHA 3HUOA 1FILA 2Y79A 2WKHA 3LFVA 3H7WA 3N7WA 3UY6A 1LSWA 4NXGA 1ES2A 1MWUA 3BFEA 3M2KA 2XLNA 1Z09A 4BL2A 3C4PA 3IXGA 4QU3A 5EVEA 3SS5A 1G6OA 2Y59A 3HLCA 3FWLA 3EEHA 4P6ZS 1LLBA 2VGLS 1L3LA 1MXOA 4XXRA 4K08A 3SH8A 1STZA 2A24B 3T50A 1BSGA 1KE3A 3VOLA 3E2KA 5HX9A 5U47A 4HNBA 4HH2A 1W5DA 1W79A 2RCXA 2Y2PA 4X53A 3KYQA 2VGKA 4UA9A 2ZM0A 3A0RA 4KZ3A 5EM1A 4C75A 1S66L 5AQBA 3W2ZA 2VLGA 3BY8A 1K55C 2VA0A 4DXCA 4HHDA 4Z1WA 4WMCA 1OTBA 2EX6A 2VGJA 1Q2PA 1BT5A 2XQZA 4GHIA 4DJ2A 4HJ6A 1JWPA 4MBKA 1OJGA 3Q7ZA 4OPYA 4GN2A 1YAXA 2P08A 4L9EA 2JKRM 2IWDA 2QHKA 5EVIC 2ZC3B 1NLZA 5L8MA 4HQAA 2BASA 1BYWA 1CI9A 3CLOA 1DP8A 3R7WA 1BLPA 1ESUA 1T19A 4OPZA 4DE0A 3BFGA 3P98A 3BFDA 3CWFA 1XKZA 2BG1A 5HPIA 3LY3A 1IELA 1JWZA 3NECA 4L9FA 5CHUA 3IBRA 5CHJA 3IWQA 4Y7PA 2W1TA 2XEPA 3KSGA 3IX4A 5TBMA 3TRCA 3NCKA 5HAQA 1I2SA 4WBGA 5KMWA 4OOLA 4S2NC 2W0NA 3OPRA 1YKDA 2XF3A 3UB7A 3VFFA 3W4OA 2L0WA 4WEKA 2JKRI 3MXRA 3ZG7B 4JXVA 1OTIA 1PNEA 4E3OA 4HIAA 2R9WA 2XGNA 4DMZA 4EEUA 4EUZA 4C6YA 2C5WB 3EQVA 4FUWA 3QNCA 2H0YA 3PBTA 1OTDA 3BWLA 1H8MA 3O5YA 3ZNYA 3QP8A 3H82B 4CLCB 1GA9A 1O07A 3TSGA 4JPMA 4YFMA 1IEMA 2A2LA 4WZ4A 4BQMA 3T4SA 2R78A 1KVLA 4KZ7A 3C38A 3MZDA 2Y2KA 5I94A 3T1RA 2JE5A 4LGWA 1K56A 4GCZA 5CTMA 2KOIA 1Q2QA 3HVFA 2HDQA 4IBRA 1N9LA 2XDMA 3IS2B 3WS4A 5HWVA 3QP1A 4GKUA 1NZUA 5E2GA 1WYBA 1HVBA 4GJ4A 2PR5A 3MXSA 1IKGA 3S7OA 2HP9A 4GD8A 1HD8A 1ONGA 4GNUA 3T4KA 3V39A 4X56A 3BQAA 4MBFA 3VE4A 5E2EA 4NK3A 1PWCA 4DDYA 1FOFA 1K38A 1ES5A 2P04A 1CQAA 1CEGA 3V3SA 3VOZA 3HLDA 2O9CA 2ZC6B 1VQQA 5AVFA 5KIZA 2Y2QA 4PPRA 1FCOA 5AQ9A 3V50A 1DRMA 2J3TD 4G3WA 3A3IA 4K0XA 2L4RA 5E2FA 4XUXA 4EUVA 3D72A 2EWWA 2ZC4B 2P7JA 2V0UA 1FIKA 3ZQ5A 2PU2A 1A0KA 3ZG5A 3A0SA 1NZOA 2VV8A 2V2FF 4YNRA 1IFQA 3RXWA 3PAEA 4ETXA 3MKFA 5KSCA 1YPRA 4KZ8A 3NOUC 2HDSA 1D7EA 4II7A 5F68A 3NI9A 3HLBA 1YSPA 2DCFA 2OLUA 3UE0A 5TFQA 3EQUA 3MJQA 1G28A 3AGFA 4I3AA 3BM6A 1NY0A 3MFXA 2B02A 3TJZC 1YLTA 4JGOA 4KG6A 3FZCA 5TBMB 1T18A 1SCWA 4Z9QA 1UWNX 2VZWA 3R4KA 2ZC5B 4Q0IA 3T1QB 1W7FA 1GHMA 2JKTM 2ZMFA 3LO7A 2W3HA 3NJAA 3S1YA 3LUQA 4FTXA 2VV7A 1YLWA 3JVVA 3C8CA 4BMWA 2JC7A 3U2AA 2VKSA 3N6IA 4MNRA 4N9KA 4PKYG 2WGWB 3ZHHA 4UA6A 2ZQ7A 1XA7A 2WZXA 4MEZA 3LICA 3RTYA 4I3IA 3GMWA 3WS0A 5DJTA 4R6LA 1LL8A 2NUPC 2W3GA 3W8KA 4JXWA 4BJPA 5GL9A 3ICYA 3F1OB 2K7SA 1SHVA 1N4OA 3G2YA 2EX2A 5E43A 2WK0A 1S1ZA 3G35A 3UB6A 2Q0OA 4WF0A 3W4QA 2QPNA 4E3JA 5F69A 2DRWA 3QP6A 3ZCZA 5IU1A 4S2NA 2GZAA 1YMSA 3HCYA 3F1NB 1FQGA 4P87A 4LFUA 5E2HA 5AVEA 1K55A 3P01A 1NYYA 4WUJA 5FI2A 3C7UA 4GD6A 2WAEA 3T4TA 3PYPA 2XA7M 3ZVWA 2XR0A 4K0WA 3AGEA 4OQ0A 1OTAA 2PYPA 5FI6A 3IS2A 3RJUA 1W8YA 3GV9A 1I5QA 3GQZA 3UN7A 2H28A 1XPBA 2GJ3A 4WM9A 2XD5A 1RGYA 2ZM8A 5HARA 3UE3A 1VHMA 4KUOA 3UPOA 2WKPA 4CLCD 2WUQA 1VEUB 3CAXA 3CI6A 3JPUA 4E6WA 1D06A 3FYZA 5CXWA 2PT7A 4LRZE 4NXEA 2ZC7A 3BY9A 3ZVTA 1BZAA 3E0YA 1MPLA 1D1JA 1S4SA 1EW0A 2EXBA 2X01A 1J9MA 2LB5A 3T4QA 4EBLA 3BEBA 4UAAA 3BJNA 3MF0A 4EWFA 4R3JA 2UV0E 4P6ZM 4E04A 1M6KA 2FFYA 5HL1A 1CK3A 3A3EA 5FATA 3BRMA 1WYCA 1AXBA 3A3FA 2ZL1A 2HV1A 3KYZA 4MMNA 1YLJA 4JF4A 4H6JB 5CGXA 4EBPA 2J8YA 1OT6A 3T4OA 4EETB 4Q0JA 2KLIA 4HP9A 2AVXA 4JXSA 3S7NA 4O7DA 4ZJ1A 3ZFZA 2WYXA 2M7VA 4O0PA 4PM5A 3S7PA 2DNSA 3BLSA 3FKWA 2EX8A 3SH9A 1XJ4A 2EX9A 1DJAA 3V67A 4GS9B 5HWWA 4BBTA 1ZC2A 5F1FA 3EOIA 3UB8A 1YT4A 4HEFA 1K25A 2HGVA 1G68A 1FCMA 1F98A 2H10A 4PM6A 4DE1A 4N9LA 3K3DA 2B5RA 2Y2OA 3H82A 4D60A 4QPRA 2M7UA 1CEFA 2Y2JA 4NXFA 3LCEA 3GR2A 5IS1A 3IF6B 1PW1A 4DE3A 3LY4A 4GDNA 3F1NA 3HL9A 2WKRA 2J3TC 3Q82A 3SH7A 3C7VA 4JXGA 3TOIA 1ZTUA 3UNWA 1JTGA 4XT2B 3WRTA 2YKFA 5FEGA 3WS5A 5CEBA 5FL3A 1K54C 3LI9A 2Y2GA 1P0ZA 2QMIA 1WA9A 4U0XA 2O9BA 4B93A 4R0QA 4O01A 3IXBA 5A93A 4LCLA 3EEAA 2PBDP 4CLCC 4MN5A 5F83A 1W8QA 3RXXA 2Y2IA 1O7EA 1SDEA 3D9YA 4K91A 3T1SA 1IOUA 4Y2FA 5EVIA 1F9IA 1W63Q 3CITA 2HDUA 2O99A 3TE8A 4ZTKA 5FDHA 2PU4A 4F3LB 2Y91A 3KSIA 3S22A 1N9NA 3LIBA 1NWZA 1GA0A 5A8BA 2HP5A 2WGIA 3LR4A 1K0KA 4ARZA 4R3BA 2HP6A 3HLFA 5FA7A 2W3FA 5CECA 3A0VA 3ZGAB 5GHXA 4L9GA 2KDKA 3CUEA 2J7VA 2D01A 1QMEA 2EA9A 1DJCA 2JN7A 1K6RA 4ESPA 3B33A 1NJ4A 4B4ZA 4OLDA 1PI4A 5HAPA 2ZBBA 2B18A 1ZKJA 4HJ4A 4WMCD 1FSYA 2EFUA 5G4ZA 5G18A 2X02A 1DJBA 3UDXA 3F1PB 4KZ4A 5DVAA 2E8IA 1MWSA 3SOIA 3TW8A 3FKVA 4BLMA 3UE1A 2Y2HA 4OPQA 3CUEC 3OPPA 4RQ9A 4KQRA 1T1BA 2EWVA 2HF6A 3CPTB 3P7NA 4ETZA 1RGZA 3M2JA 4I5SA 1V9ZA 4Q0HA 2PBYA 4S2PA 3V3RA 2XA7S 5C5KA 1XGJA 1FR6A 5D3OA 4EESA 3O86A 1H3QA 2O9AA 4EU0A 1GHIA 4MCWA 2O0YA 4ZDXA 1L0EA 2KX6A 3HUMA 3N4IA 1G5UA 4RA7A 1K4FA 4GDBA 5DTSA 2ZD8A 3MQ0A 4DDSA 3MSHA 2B95A 3I7JA 1RCJA 5J4EA 1EWZA 5JYOA 2PHYA 4LPZA 3GECA 3CMZA 5FDSA 1TD5A 4EQIA 3MXQA 2HJ9C 3DTKA 4Y5FA 5FQIA 4Y17A 4EXOA 3CG5A 3MZFA 2W3DA 3VSKA 1XJ3A 3LIEA 3VE3A 3VP1A 3GTCA 5EVID 3NIAA 5FQMA 1F2KA 3ZG9B 1BLCA 1E4DA 4QHCA 1JNUA 4UA7A 3NHQA 3N8RA 4PM9A 2J9OA 2XK1A 1VEUA 1MZUA 3IWOA 4OP8A 2Y2LA 3PBNA 4M4XA 2K31A 1MKMA 5EOEA 5EECA 3HLWA 1LL5A 2DMWA 4Y3IA 2V8FA 1SZVA 1KDWA 5EOOA 2I9VA 3F1PA 1DP9A 1HZOA 4GW9A 4E3IA 3NY4A 5FQKA 5M18A 1L0FA 4S2KA 2V1BA 3VP4A 3UMDA 2I72A 1LL9A 1P97A 1LSXA 2PAVP 1SDNA 2BLSA 3N8SA 1YSQA 3PBOA 2QYBA 3SZTA 3IH9A 4NETA 2J9PA 4MBHA 4S2MA 4U0TA 4LV0A 3MZEA 4XT2A 3H7WB 1E3UA 3VP3A 1V9YA 4I38A 2V1AA 3D4FA 1IYSA 3VFHA 3UB5P 3ITAA 5HSQA 2P9VB 3ISGA 4R38A 2FH5A 5AJGA 2Y2NA 1MKIA 4AFIA 4KZ9A 5JYPA 1PRQA 3LIAA 4BBUA 3OC2A 3VOYA 4WZ5C 5CX7A 4ME4A 3HREA 5TR7A 3RFBA 4FSFA 1VETB 4QY6A 3ULFA 4I3JA 4HP4A 2VK3A 4A5RA 1PYYA 3FPWA 4ZJ2A 2VJWA 4N1XA 1PZOA 3G2ZA 4KZBA 2Z2MB 4HBUA 1S0WA 2VGLM 4HOIA 4MLLA 3P09A 4FOFA 1ESIA 2QWSA 5CHMA 1LI9A 3G32A 4D2OA 3SS4A 4R3AA 4LRXC 4MN6A 2VEAA 2Q9NA 1MBLA 1I2WA 2W1TB 4HJ3A 4DXBA 1ZG4A 3MMHA 4ZAMA 1TS7A 4X69A 1FR1A 4G3VA 4HESA 1OJ5A 3VV4A 3O87A 3L9KA 1C3BA 3LR5A 4KZAA 4Y0UA 3DTEA 4Y13A 4WZ5A 3BW6A 1BLSA 2PDRA 3BLMA 1MY8A 2W27A 4OOMA 1PFLA 5HW3A 3VMAA 5KSHA 3HLGA 2QJ7A 2Y8HA 2WKEA 2XRNA 1DP6A 4RX3A 2LB9A 3CJMA 4KENB 4N1HA 3T12B 2OOLA 5CGSA 4FCFA 3PHYA 3A3DA 2PR6A 1FSWA 2OAQ1 4X1MA 2XROA 3B42A 5I5LA 1VB6A 5F1GA 1ALQA 2PRFA 4IUKA 2JHEA 4L0LA 4IUHA 4KG2A 1FCNA 3B47A 4CQHA 3IF5A 4Y0TA 1UGUA 2WADA 3C2WA 3Q07A 5FEFA 4WEJA 4IVKA 2A3UA 3NDGA 3ZYTA 4JF5A 1XX2A 1CI8A 3DWZA 2FFFB 4B88A 3QHYA 1N9BA 2EFXA 1YLPA 2V9AA 2R9XA 4NEED 2JBFA 4IJGA 2G2WA 3G34A 4P85A 5FI7A 2IWBA 3LR0A 3DW0A 4EERA 1BLHA 4IEDA 3PBSA 5GLCA 2GNXA 4F94A 1TS6A 3CHWP 4E6XA 1ERMA 4Y0OA 1RP5A 1VM1A 3DBAA 1KGEA 3A3JA 5DTTA 1GSXA 3MQOA 3IXHA 1P9RA 2XFSA 3UPPA 2PYRA 1NRJA 1XFNA 4R23A 1L0DA 3E2LA 3EGXC 1XJ2A 3FC7A 2WKIA 1GHPA 4X68A 3T4JA 2Q9MA 3G6OA 3R7WB 2Y55A 5EM0A 4LLOB 4S2LA 1WE4A 1YLZA 5K5BA 1GSWA 1LT0A 3V5MA 2FZ0A 2GX5A 1H5XA 4BBVA 3VSLA 4I39A 2L1MA 3E98A 3IX3A 3UE6A 1K54A 1JTDA 4E3MA 2RL3A 4UHUA 3N8LA 1PI5A 1Z6FA 5HL6A 2ZQ9A 1JWVA 3CPTA 3KYEA 3MFDA 5EE8A 3G31A 3LR3A 5MC7A 1ES4A 2K2NA 2H5SA 2VX8A 4DKIA 1Y4OA 1NYMA 4F3LA 5GLAA 3QP4A 3IBJA 5L09A 5G4YA 3KO6A 3UDIA 4EBNA 1BULA 2JCHA 1PWGA 5F82A 2GDNA 4X25A 3OCNA 1K57A 1T1CA 2JKTI 3GRJA 2X71A 3IWIA 3NOTC 2QZ6A 3G30A 4LRYC 1P9WA 2Y4AA 4X6TA 5CGWA 2ACGA 3D3OA 3E4PA 5HD5A 4EW7A 4HY8A 2QKPA 4PM8A 3Q81A 3PBQA 1NRFA 3BYDA 1U60A 3IT9A 1IYPA 3C5AA 1OT9A 5HDSA 2D02A 3G4PA 5CEDA 5GLDA 3T1XA 3HJKA 3MQQA 5DJUA 4H8RA 1H0MA 4H6JA 4NG2A 1VETA 2J80A 1JVJA 4CPKA 5CERA 1HTZA 1ODVA 4S2IA 1K6SA 3TG9A 3U4LP 5DFXA 4OH0A 1KDSA 3UDFA 4P0MA 3GVBA 4QY5A 1L2SA 4OVDA 5A91A 5GHZA 2W3EA 3Q7VA 1CF0A 3HBRA 3UO9A 3ZDJA 5CTNA 5HWTA 3WRZA 2WAFA 2YKHA 3IXDA 2XSSA 4DJ3A 4JLFA 1TDLA 3KSHA 5L07A 5EPHA 3GSGA 1ZG6A 2M1CA 3FG8A 4WL9A 1PIOA 1YQSA 1GCEA 3LGOA 3WS2A 2XH9A 2OAP1 1XFQA 5TJJA 1KE0A 1PWDA 3MS6A 1MWRA 1GSVA 1Y54A 4PMAA 3S4XA 2A49A 4QD4A 1XP4A 1ACFA 4E3LA 3NULA 5DF8A 2ZMAA 3PXPA 1K57C 1KGGA 2V20A 4DN0A 5HZHA 4IBXA 1TVFA 4E3NA 3M6BA 3BQ8A 2PD8A 5FASA 5DF7A 1CJFA 5EVIB 2A24A 3O88A 1TS8A 5M1AA 4YOFA 3IHAA 1H8YA 3AGDA 2OSUA 3M6HA 2INWA 1ERQA 2OWJA 4OKPA 4BD1A 1XA1A 1SKOB 5F5YA 4UEYA 5DKLA 2Z6CA 4UQIS 5FAOA 5HFOA 3LI8A 3QNBA 4ARZB 2WZZA 4LV1A 2WGWA 4HI4A 4YINA 3DTIA 5FQQA 3ZG0A 1H8ZA 1KVMA 4EEPA 5IHVA 2XD1A 4KZ6A 5CRFA 4GZBA 3HUNA 3HJIA 5HD3A 2ZQAA 2IWCA 5EFWA 1LHYA 3O3VA 4LCMA 2CC1A 1S6RA 3MBZA 2BTFP 4KQDA 1W63M 2OV5A 1NLYA 5DFYA 3GDIA 1TEMA 3WWXA 4QWOA 4UQIM 4X55A 3OPLA 4EV4A 2ZQDA 5DF9A 2ZOHA 1S4RA 1YM1A 3NDEA 3C4OA 4IVIA 4E3KA 1OPXA 3PAGA 5L2FA 1AWIA 2PD7A 4JKTA 1XXMA 4WN5A 3T4LA 1SKOA 2E8JA 3DTMA 4IHQA 2V1ZA 1NXYA 3FV7A 3Q7VB 3VP2A 4GB7A 4RVAA 4NXBA 1ES3A 1Y28A 2J3WA 2WGVA 3LIDA 4OLGA 3E4QA 1EROA 3IH8A 2VV6A 3WS1A 5DKKA 1IYOA 1PZPA 3BFCA 4LV3A 1S1YA 4R4RA 4JGRA 4ZBEA 3MKEA 5FQ9A 3ZG8B 5GHYA 2JKFA 3IX8A 3K2NA 4RYEA 4KZ5A 1YMXA 3PR6A 5A92A 3EWKA 2XFTA 3LEQA 5FAQA 3QP2A 1IYQA 2MJ6A 3B3XA 4MDZA 5FQJA 4HBTA 3KX0X 1KGFA 1J3WA 3OOVA 1T1AA 1TDGA 3NC8A 4U3TA 4GS9A 1ONHA 4P6BA 1QMFA 3F1OA 2OLVA 4NKPA 5HPFA 3DWKA 2HZ5A 4PKYA 3ZNTA 3LEZA 3SS3A 3JVUA 5J8XA 1KE4A 1F5MA 1L0GA 2ZQCA 1N9OA 4O8GA 1BUEA 4R4SA 4B9OA 1TF1A 1YLYA 4EQ1A 2G2UA 3UPNA 1X0OA 3HLEA 1LSVA 3RH8B 4LV2A 5DTKA 2H0TA 3LYXA 3OCLA 2HJEA 3ITBA 1M40A 4XUZA 3BECA 4KG5A 3VP0A 4KQQA 1LI0A 3OPHA 5F6AA 4BL3A 2ZJ9A 4CLCA 5J7EA 4QJGA 3UB9A 2V0WA 4ID4A 4MN7A 1IKIA 5FSRA 1MWTA 4YWZA 4DRTA 1BTLA 3OBFA 4ZJ3A 1G6AA 1XJ6A 1SKFA 2JKGA 3BFFA 3H9WA 2ZL1B 5AQ7A 1UWPX 4PHTA 1K56D 3KSFA 1OTEA 3PBRA 4BWIA 4OQHA 4CJNA 2UWXA 2G7UA 5J3WA 4OP5A 4C3QA 4KUKA 5EV0A 5LBRA 3LIFA 2CMNA 5EUAA 2EXAA 2HPBA 2P9VA 2W1RA 5HDCA 4RX2A 3MR0A 3OZHA 5HDDA 3FPVA 4Y15A 2ZLYA 5L10A 1KOUA 4OONA 5AQAA 1OMEA 1E3UD 1EI5A 3JYIA 4OPRA 3QP5A 1E25A 1ZHHB 4G3KA 5KZHA 4X1LA 4GLQA 5TGFA 2ZQ8A 4GOGA 3PTEA 4N92A 4KQOA 3S7QA 1K4EA 4PAUA 3NOPC 3DAVA 1S67L 4JBFA 4DF6A 4LENA 3E4OA 4DE2A 2ZM2A 4FH4A 2Y2MA 4R70A 4OOYA 3IF6C 3SW1A 4S2OA 4WELA 4CLCE 4Q8IA 3IQAA 2ZOIA 1MC0A 3L7HA 5EVLA 4FD8A 4FH2A 3OLOA 2WKQA 5IT5A 2QJ5A 2Z2LB 4BENA 1TS0A 1XGIA 4OQIA 2P74A 4OQGA 2HDRA 5HAIA 3C30A 1DY6A 3CZDA 2IA2A 3UMEA 3EGDC 4ZRRA 2NUTC 2OWHA 4WLAA 4JF6A 4GHIB 4BD0A 3NBLA 4HH3A 5GLBA 4JGQA 3K3CA 4S2JA 4JGPA 4WYYA 2C6WB 3IHBA 4R1GA 3Q1FA 3IF6A
chains in the Genus database with same CATH topology
2M1CA 4WF0A 3FG8A 4WL9A 2V1BA 3UMDA 2Z6DA 5F69A 2ZMVA 1P97A 1LSXA 5IU1A 2Y79A 2GZAA 2OAP1 1XFQA 3LFVA 5TJJA 1YSQA 3HCYA 3PBOA 3F1NB 2QYBA 5AVEA 1GSVA 3P01A 4WUJA 3H7WA 1LSWA 3T4TA 4NXGA 3PYPA 4XT2A 3H7WB 2XA7M 1V9YA 3PXPA 4I38A 2V1AA 4DN0A 5HZHA 1G6OA 3EEHA 4P6ZS 5HSQA 2VGLS 3BQ8A 2PD8A 1OTAA 2PYPA 3IS2A 4R38A 2FH5A 5AJGA 2H28A 2GJ3A 4K08A 1STZA 2A24B 4AFIA 3T50A 3VOLA 3UE3A 1VHMA 4KUOA 2A24A 3LIAA 4HNBA 4HH2A 1TS8A 2WKPA 3KYQA 4BBUA 4CLCD 3A0RA 3OC2A 3CAXA 1S66L 4YOFA 3CI6A 1D06A 5CX7A 4ME4A 2PT7A 4LRZE 3W2ZA 2INWA 2VLGA 3RFBA 2OWJA 4NXEA 5F5YA 3BY8A 4FSFA 4UEYA 2VA0A 3BY9A 3ULFA 4HHDA 5DKLA 3E0YA 2Z6CA 4UQIS 4Z1WA 3LI8A 4I3JA 1S4SA 4ARZB 1OTBA 4HP4A 1EW0A 3FPWA 2VJWA 4HI4A 2LB5A 3T4QA 4GHIA 4DJ2A 4HJ6A 4EEPA 3BJNA 3MF0A 2VGLM 4HOIA 3HJIA 1OJGA 5HD3A 4P6ZM 4E04A 4FOFA 2QWSA 5EFWA 4R3AA 4LRXC 4MN6A 2VEAA 1YAXA 4KQDA 2P08A 2W1TB 4HJ3A 1W63M 4L9EA 2JKRM 3MMHA 1NLYA 5DFYA 1TS7A 2QHKA 3KYZA 2HV1A 3GDIA 4MMNA 4G3VA 1NLZA 4UQIM 4H6JB 5L8MA 4HQAA 5DF9A 1OJ5A 2ZOHA 3VV4A 1OT6A 2BASA 3T4OA 1BYWA 3LR5A 4EETB 3CLOA 1S4RA 4Q0JA 2KLIA 4HP9A 3BW6A 1DP8A 3R7WA 3S7NA 1OPXA 1T19A 2M7VA 2PD7A 2PDRA 4O0PA 3CWFA 4WN5A 3S7PA 3T4LA 2W27A 4OOMA 5HPIA 4IHQA 1XJ4A 5HWWA 3V67A 4GS9B 5KSHA 4BBTA 2QJ7A 4NXBA 1Y28A 2Y8HA 3EOIA 3UB8A 2J3WA 4L9FA 2HGVA 2XRNA 3IBRA 3LIDA 1F98A 1DP6A 3E4QA 2W1TA 3K3DA 2LB9A 3KSGA 3H82A 2VV6A 2OOLA 4QPRA 5DKKA 5TBMA 3TRCA 3PHYA 2M7UA 2PR6A 4NXFA 1S1YA 2OAQ1 5IS1A 2XROA 3B42A 5I5LA 4OOLA 4JGRA 2W0NA 1VB6A 1YKDA 3UB7A 3K2NA 3F1NA 4IUKA 2WKRA 2J3TC 3PR6A 3EWKA 2L0WA 4WEKA 1ZTUA 2JHEA 4L0LA 2JKRI 4IUHA 3B47A 4XT2B 2YKFA 4CQHA 1OTIA 2MJ6A 4MDZA 5FL3A 3KX0X 3LI9A 1UGUA 3OOVA 3C2WA 4HIAA 1P0ZA 1T1AA 4DMZA 1WA9A 4GS9A 4EEUA 2O9BA 4B93A 3EQVA 4WEJA 4O01A 3PBTA 3EEAA 4CLCC 3ZYTA 1OTDA 4MN5A 3BWLA 3F1OA 1H8MA 3O5YA 3H82B 4CLCB 4NKPA 5HPFA 1IOUA 2V9AA 4Y2FA 4PKYA 1F9IA 1W63Q 3JVUA 4NEED 2A2LA 3CITA 4IJGA 2O99A 1F5MA 3TE8A 3T4SA 2R78A 1N9OA 4O8GA 4B9OA 4F3LB 1TF1A 4EQ1A 3KSIA 1N9NA 3C38A 3LR0A 3LIBA 1X0OA 4EERA 1NWZA 5A8BA 3LR4A 1LSVA 3PBSA 3RH8B 2GNXA 1TS6A 4GCZA 4ARZA 3LYXA 3OCLA 2KOIA 2HJEA 3DBAA 2W3FA 1N9LA 3IS2B 3A0VA 1GSXA 4L9GA 3MQOA 1P9RA 2KDKA 2PYRA 1NRJA 5HWVA 1XFNA 5F6AA 4CLCA 3CUEA 4GJ4A 5J7EA 2D01A 2PR5A 2V0WA 3UB9A 3EGXC 4MN7A 2EA9A 1XJ2A 3S7OA 3FC7A 4YWZA 2JN7A 3T4KA 3OBFA 1XJ6A 3T4JA 3H9WA 3G6OA 3B33A 3BQAA 3VE4A 3R7WB 2ZBBA 2B18A 1UWPX 4LLOB 4PHTA 5K5BA 3KSFA 1GSWA 1OTEA 1LT0A 3PBRA 4HJ4A 4BWIA 2P04A 2FZ0A 2GX5A 2G7UA 5J3WA 4BBVA 4I39A 2L1MA 3E98A 2O9CA 4KUKA 5G4ZA 5LBRA 3UE6A 5AVFA 5KIZA 3LIFA 2CMNA 1DRMA 3F1PB 2J3TD 4G3WA 3TW8A 2L4RA 2W1RA 4RQ9A 3CUEC 5HDCA 4ETZA 1T1BA 2EWVA 2HF6A 3P7NA 4EUVA 3D72A 3MR0A 5HL6A 2EWWA 2P7JA 2V0UA 4I5SA 1V9ZA 4Q0HA 5HDDA 2XA7S 5C5KA 3FPVA 3ZQ5A 3A0SA 4EESA 2VV8A 4YNRA 3LR3A 1IFQA 1H3QA 5MC7A 2O9AA 4EU0A 4MCWA 2K2NA 2VX8A 4ETXA 1KOUA 2O0YA 4F3LA 2KX6A 3NOUC 3IBJA 1D7EA 5G4YA 4II7A 3KO6A 5F68A 1ZHHB 1YSPA 4G3KA 3MQ0A 5J4EA 3OCNA 1T1CA 2JKTI 3MJQA 3EQUA 4GLQA 2PHYA 4LPZA 3GECA 1G28A 3NOTC 1TD5A 4I3AA 4KQOA 3S7QA 3MXQA 4LRYC 2HJ9C 4PAUA 1P9WA 4Y5FA 3NOPC 3MFXA 3D3OA 1S67L 2B02A 3E4PA 3TJZC 4EXOA 5HD5A 4EW7A 4JGOA 4HY8A 2W3DA 5TBMB 2QKPA 1T18A 3PBQA 1XJ3A 3LIEA 1UWNX 3E4OA 3VE3A 2VZWA 4R70A 3R4KA 1OT9A 3SW1A 5HDSA 4Q0IA 4WELA 4CLCE 2D02A 2JKTM 2ZMFA 2W3HA 3MQQA 2ZOIA 3HJKA 1JNUA 1MC0A 3NJAA 5DJUA 3NHQA 3LUQA 3OLOA 2VV7A 4H6JA 2WKQA 5IT5A 2J80A 2QJ5A 3JVVA 3C8CA 1TS0A 4BMWA 3U2AA 2VKSA 1MZUA 3C30A 3PBNA 4PKYG 1ODVA 4M4XA 2K31A 5DFXA 3LICA 2IA2A 3RTYA 1MKMA 4I3IA 3UMEA 3EGDC 5DJTA 4R6LA 1LL8A 4ZRRA 2NUPC 2NUTC 2W3GA 2DMWA 2W3EA 4Y3IA 4BJPA 2OWHA 4WLAA 2I9VA 4GHIB 3ICYA 3F1PA 5HWTA 4HH3A 1DP9A 3F1OB 2K7SA 4JGQA 2YKHA 3K3CA 4GW9A 2XSSA 4JGPA 4DJ3A 3KSHA 1S1ZA 3UB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HV1 A;  3GDI A;  2V9A A;  2M1C A;  4PKY A;  4WF0 A;  3FG8 A;  4WL9 A;  2V1B A;  1F9I A;  4H6J B;  1KOU A;  3UMD A;  4HQA A;  1OJ5 A;  2ZOH A;  1OT6 A;  2BAS A;  2Z6D A;  1BYW A;  5F69 A;  4EXO A;  4F3L A;  4EET B;  2KX6 A;  2R78 A;  1P97 A;  1LSX A;  1N9O A;  3CLO A;  3NOU C;  5IU1 A;  1S4R A;  1D7E A;  5G4Y A;  4B9O A;  4HP9 A;  1DP8 A;  1XFQ A;  4F3L B;  5F68 A;  3F1N B;  4EQ1 A;  1T19 A;  1N9N A;  2PD7 A;  2PDR A;  5AVE A;  3LIB A;  1GSV A;  1X0O A;  3CWF A;  4WN5 A;  4WUJ A;  1NWZ A;  4EER A;  2W27 A;  3H7W A;  1LSW A;  5J4E A;  1T1C A;  3MJQ A;  5A8B A;  2PHY A;  4LPZ A;  1LSV A;  3GEC A;  4NXG A;  1G28 A;  1XJ4 A;  3NOT C;  3PYP A;  4XT2 A;  1TS6 A;  3H7W B;  4GCZ A;  4GS9 B;  5HWW A;  1V9Y A;  3LYX A;  4BBT A;  4I38 A;  4I3A A;  2QJ7 A;  2V1A A;  4NXB A;  1Y28 A;  3UB8 A;  3MXQ A;  4LRY C;  4L9F A;  5HZH A;  1N9L A;  3IS2 B;  3A0V A;  1GSX A;  3EEH A;  4L9G A;  3MQO A;  3MFX A;  3NOP C;  2KDK A;  3IBR A;  5HSQ A;  1S67 L;  2PYR A;  1F98 A;  2B02 A;  2PD8 A;  3E4P A;  1OTA A;  2PYP A;  3LID A;  1DP6 A;  4JGO A;  3IS2 A;  3E4Q A;  4HY8 A;  4R38 A;  5HD5 A;  3K3D A;  2QKP A;  5TBM B;  1T18 A;  2H28 A;  5HWV A;  1XFN A;  2GJ3 A;  4K08 A;  1XJ3 A;  2A24 B;  1UWN X;  3E4O A;  3H82 A;  3LIE A;  2VV6 A;  5F6A A;  2OOL A;  3T50 A;  3VE3 A;  5DKK A;  5TBM A;  4R70 A;  3VOL A;  2D01 A;  2PR5 A;  2V0W A;  3UB9 A;  5J7E A;  3PHY A;  4KUO A;  2EA9 A;  1XJ2 A;  1OT9 A;  2A24 A;  3FC7 A;  2PR6 A;  5HDS A;  3SW1 A;  4YWZ A;  4NXF A;  2D02 A;  1S1Y A;  2JN7 A;  3LIA A;  5IS1 A;  4HNB A;  4HH2 A;  1XJ6 A;  2ZOI A;  3HJK A;  1TS8 A;  1JNU A;  2WKP A;  2W0N A;  1VB6 A;  3G6O A;  3H9W A;  3MQQ A;  3B33 A;  3NJA A;  3NHQ A;  4JGR A;  5DJU A;  3A0R A;  4BBU A;  3LUQ A;  3VE4 A;  3CAX A;  1S66 L;  3OLO A;  3UB7 A;  1D06 A;  2VV7 A;  1UWP X;  2WKQ A;  2ZBB A;  3F1N A;  4H6J A;  2J80 A;  2QJ5 A;  4LLO B;  2WKR A;  3C8C A;  4LRZ E;  1TS0 A;  2INW A;  2VLG A;  2OWJ A;  1GSW A;  1OTE A;  3EWK A;  1LT0 A;  1MZU A;  4HJ4 A;  4NXE A;  5F5Y A;  2L0W A;  3BY8 A;  2JHE A;  3BY9 A;  4PKY G;  3ULF A;  4HHD A;  5DKL A;  1ODV A;  2Z6C A;  4M4X A;  3RH8 B;  5J3W A;  3LI8 A;  4I3J A;  1S4S A;  4XT2 B;  4BBV A;  2YKF A;  1OTB A;  4HP4 A;  4I39 A;  2L1M A;  1EW0 A;  1OTI A;  3LIC A;  3RTY A;  4KUK A;  5G4Z A;  4EW7 A;  4I3I A;  3UME A;  3KX0 X;  4HI4 A;  5AVF A;  3UE6 A;  5KIZ A;  5DJT A;  3LI9 A;  1UGU A;  3LIF A;  2CMN A;  4R6L A;  4GHI A;  1LL8 A;  4HIA A;  3C2W A;  1DRM A;  1P0Z A;  1T1A A;  3F1P B;  4HJ6 A;  4DJ2 A;  4EEP A;  1WA9 A;  2OWH A;  4GS9 A;  4WLA A;  4EEU A;  2I9V A;  2L4R A;  4GHI B;  4HOI A;  3HJI A;  1OJG A;  3F1P A;  3ICY A;  4RQ9 A;  5HDC A;  5HD3 A;  4HH3 A;  5HWT A;  1DP9 A;  1T1B A;  3F1O B;  2K7S A;  3P7N A;  3D72 A;  3MR0 A;  2QWS A;  4JGQ A;  2YKH A;  3K3C A;  5EFW A;  4GW9 A;  1OTD A;  2P7J A;  2V0U A;  4I5S A;  1V9Z A;  3BWL A;  4JGP A;  4LRX C;  2VEA A;  3F1O A;  4MN5 A;  4MN6 A;  4R3A A;  5HDD A;  5I5L A;  4DJ3 A;  4KQD A;  4HJ3 A;  4E04 A;  4L9E A;  3ZQ5 A;  3A0S A;  3H82 B;  1TS7 A;  1S1Z A;  2QHK A;  4EES A;  3UB6 A;  2VV8 A; 
#chains in the Genus database with same CATH topology
 1PW8 A;  2V8C A;  4QB8 A;  5FAP A;  5A90 A;  3W4P A;  4B4X A;  4M3K A;  2Z6D A;  4PM7 A;  2ZMV A;  5M19 A;  1HLU P;  5BOH A;  3HUO A;  1FIL A;  2Y79 A;  2WKH A;  3LFV A;  3H7W A;  3N7W A;  3UY6 A;  1LSW A;  4NXG A;  1ES2 A;  1MWU A;  3BFE A;  3M2K A;  2XLN A;  1Z09 A;  4BL2 A;  3C4P A;  3IXG A;  4QU3 A;  5EVE A;  3SS5 A;  1G6O A;  2Y59 A;  3HLC A;  3FWL A;  3EEH A;  4P6Z S;  1LLB A;  2VGL S;  1L3L A;  1MXO A;  4XXR A;  4K08 A;  3SH8 A;  1STZ A;  2A24 B;  3T50 A;  1BSG A;  1KE3 A;  3VOL A;  3E2K A;  5HX9 A;  5U47 A;  4HNB A;  4HH2 A;  1W5D A;  1W79 A;  2RCX A;  2Y2P A;  4X53 A;  3KYQ A;  2VGK A;  4UA9 A;  2ZM0 A;  3A0R A;  4KZ3 A;  5EM1 A;  4C75 A;  1S66 L;  5AQB A;  3W2Z A;  2VLG A;  3BY8 A;  1K55 C;  2VA0 A;  4DXC A;  4HHD A;  4Z1W A;  4WMC A;  1OTB A;  2EX6 A;  2VGJ A;  1Q2P A;  1BT5 A;  2XQZ A;  4GHI A;  4DJ2 A;  4HJ6 A;  1JWP A;  4MBK A;  1OJG A;  3Q7Z A;  4OPY A;  4GN2 A;  1YAX A;  2P08 A;  4L9E A;  2JKR M;  2IWD A;  2QHK A;  5EVI C;  2ZC3 B;  1NLZ A;  5L8M A;  4HQA A;  2BAS A;  1BYW A;  1CI9 A;  3CLO A;  1DP8 A;  3R7W A;  1BLP A;  1ESU A;  1T19 A;  4OPZ A;  4DE0 A;  3BFG A;  3P98 A;  3BFD A;  3CWF A;  1XKZ A;  2BG1 A;  5HPI A;  3LY3 A;  1IEL A;  1JWZ A;  3NEC A;  4L9F A;  5CHU A;  3IBR A;  5CHJ A;  3IWQ A;  4Y7P A;  2W1T A;  2XEP A;  3KSG A;  3IX4 A;  5TBM A;  3TRC A;  3NCK A;  5HAQ A;  1I2S A;  4WBG A;  5KMW A;  4OOL A;  4S2N C;  2W0N A;  3OPR A;  1YKD A;  2XF3 A;  3UB7 A;  3VFF A;  3W4O A;  2L0W A;  4WEK A;  2JKR I;  3MXR A;  3ZG7 B;  4JXV A;  1OTI A;  1PNE A;  4E3O A;  4HIA A;  2R9W A;  2XGN A;  4DMZ A;  4EEU A;  4EUZ A;  4C6Y A;  2C5W B;  3EQV A;  4FUW A;  3QNC A;  2H0Y A;  3PBT A;  1OTD A;  3BWL A;  1H8M A;  3O5Y A;  3ZNY A;  3QP8 A;  3H82 B;  4CLC B;  1GA9 A;  1O07 A;  3TSG A;  4JPM A;  4YFM A;  1IEM A;  2A2L A;  4WZ4 A;  4BQM A;  3T4S A;  2R78 A;  1KVL A;  4KZ7 A;  3C38 A;  3MZD A;  2Y2K A;  5I94 A;  3T1R A;  2JE5 A;  4LGW A;  1K56 A;  4GCZ A;  5CTM A;  2KOI A;  1Q2Q A;  3HVF A;  2HDQ A;  4IBR A;  1N9L A;  2XDM A;  3IS2 B;  3WS4 A;  5HWV A;  3QP1 A;  4GKU A;  1NZU A;  5E2G A;  1WYB A;  1HVB A;  4GJ4 A;  2PR5 A;  3MXS A;  1IKG A;  3S7O A;  2HP9 A;  4GD8 A;  1HD8 A;  1ONG A;  4GNU A;  3T4K A;  3V39 A;  4X56 A;  3BQA A;  4MBF A;  3VE4 A;  5E2E A;  4NK3 A;  1PWC A;  4DDY A;  1FOF A;  1K38 A;  1ES5 A;  2P04 A;  1CQA A;  1CEG A;  3V3S A;  3VOZ A;  3HLD A;  2O9C A;  2ZC6 B;  1VQQ A;  5AVF A;  5KIZ A;  2Y2Q A;  4PPR A;  1FCO A;  5AQ9 A;  3V50 A;  1DRM A;  2J3T D;  4G3W A;  3A3I A;  4K0X A;  2L4R A;  5E2F A;  4XUX A;  4EUV A;  3D72 A;  2EWW A;  2ZC4 B;  2P7J A;  2V0U A;  1FIK A;  3ZQ5 A;  2PU2 A;  1A0K A;  3ZG5 A;  3A0S A;  1NZO A;  2VV8 A;  2V2F F;  4YNR A;  1IFQ A;  3RXW A;  3PAE A;  4ETX A;  3MKF A;  5KSC A;  1YPR A;  4KZ8 A;  3NOU C;  2HDS A;  1D7E A;  4II7 A;  5F68 A;  3NI9 A;  3HLB A;  1YSP A;  2DCF A;  2OLU A;  3UE0 A;  5TFQ A;  3EQU A;  3MJQ A;  1G28 A;  3AGF A;  4I3A A;  3BM6 A;  1NY0 A;  3MFX A;  2B02 A;  3TJZ C;  1YLT A;  4JGO A;  4KG6 A;  3FZC A;  5TBM B;  1T18 A;  1SCW A;  4Z9Q A;  1UWN X;  2VZW A;  3R4K A;  2ZC5 B;  4Q0I A;  3T1Q B;  1W7F A;  1GHM A;  2JKT M;  2ZMF A;  3LO7 A;  2W3H A;  3NJA A;  3S1Y A;  3LUQ A;  4FTX A;  2VV7 A;  1YLW A;  3JVV A;  3C8C A;  4BMW A;  2JC7 A;  3U2A A;  2VKS A;  3N6I A;  4MNR A;  4N9K A;  4PKY G;  2WGW B;  3ZHH A;  4UA6 A;  2ZQ7 A;  1XA7 A;  2WZX A;  4MEZ A;  3LIC A;  3RTY A;  4I3I A;  3GMW A;  3WS0 A;  5DJT A;  4R6L A;  1LL8 A;  2NUP C;  2W3G A;  3W8K A;  4JXW A;  4BJP A;  5GL9 A;  3ICY A;  3F1O B;  2K7S A;  1SHV A;  1N4O A;  3G2Y A;  2EX2 A;  5E43 A;  2WK0 A;  1S1Z A;  3G35 A;  3UB6 A;  2Q0O A;  4WF0 A;  3W4Q A;  2QPN A;  4E3J A;  5F69 A;  2DRW A;  3QP6 A;  3ZCZ A;  5IU1 A;  4S2N A;  2GZA A;  1YMS A;  3HCY A;  3F1N B;  1FQG A;  4P87 A;  4LFU A;  5E2H A;  5AVE A;  1K55 A;  3P01 A;  1NYY A;  4WUJ A;  5FI2 A;  3C7U A;  4GD6 A;  2WAE A;  3T4T A;  3PYP A;  2XA7 M;  3ZVW A;  2XR0 A;  4K0W A;  3AGE A;  4OQ0 A;  1OTA A;  2PYP A;  5FI6 A;  3IS2 A;  3RJU A;  1W8Y A;  3GV9 A;  1I5Q A;  3GQZ A;  3UN7 A;  2H28 A;  1XPB A;  2GJ3 A;  4WM9 A;  2XD5 A;  1RGY A;  2ZM8 A;  5HAR A;  3UE3 A;  1VHM A;  4KUO A;  3UPO A;  2WKP A;  4CLC D;  2WUQ A;  1VEU B;  3CAX A;  3CI6 A;  3JPU A;  4E6W A;  1D06 A;  3FYZ A;  5CXW A;  2PT7 A;  4LRZ E;  4NXE A;  2ZC7 A;  3BY9 A;  3ZVT A;  1BZA A;  3E0Y A;  1MPL A;  1D1J A;  1S4S A;  1EW0 A;  2EXB A;  2X01 A;  1J9M A;  2LB5 A;  3T4Q A;  4EBL A;  3BEB A;  4UAA A;  3BJN A;  3MF0 A;  4EWF A;  4R3J A;  2UV0 E;  4P6Z M;  4E04 A;  1M6K A;  2FFY A;  5HL1 A;  1CK3 A;  3A3E A;  5FAT A;  3BRM A;  1WYC A;  1AXB A;  3A3F A;  2ZL1 A;  2HV1 A;  3KYZ A;  4MMN A;  1YLJ A;  4JF4 A;  4H6J B;  5CGX A;  4EBP A;  2J8Y A;  1OT6 A;  3T4O A;  4EET B;  4Q0J A;  2KLI A;  4HP9 A;  2AVX A;  4JXS A;  3S7N A;  4O7D A;  4ZJ1 A;  3ZFZ A;  2WYX A;  2M7V A;  4O0P A;  4PM5 A;  3S7P A;  2DNS A;  3BLS A;  3FKW A;  2EX8 A;  3SH9 A;  1XJ4 A;  2EX9 A;  1DJA A;  3V67 A;  4GS9 B;  5HWW A;  4BBT A;  1ZC2 A;  5F1F A;  3EOI A;  3UB8 A;  1YT4 A;  4HEF A;  1K25 A;  2HGV A;  1G68 A;  1FCM A;  1F98 A;  2H10 A;  4PM6 A;  4DE1 A;  4N9L A;  3K3D A;  2B5R A;  2Y2O A;  3H82 A;  4D60 A;  4QPR A;  2M7U A;  1CEF A;  2Y2J A;  4NXF A;  3LCE A;  3GR2 A;  5IS1 A;  3IF6 B;  1PW1 A;  4DE3 A;  3LY4 A;  4GDN A;  3F1N A;  3HL9 A;  2WKR A;  2J3T C;  3Q82 A;  3SH7 A;  3C7V A;  4JXG A;  3TOI A;  1ZTU A;  3UNW A;  1JTG A;  4XT2 B;  3WRT A;  2YKF A;  5FEG A;  3WS5 A;  5CEB A;  5FL3 A;  1K54 C;  3LI9 A;  2Y2G A;  1P0Z A;  2QMI A;  1WA9 A;  4U0X A;  2O9B A;  4B93 A;  4R0Q A;  4O01 A;  3IXB A;  5A93 A;  4LCL A;  3EEA A;  2PBD P;  4CLC C;  4MN5 A;  5F83 A;  1W8Q A;  3RXX A;  2Y2I A;  1O7E A;  1SDE A;  3D9Y A;  4K91 A;  3T1S A;  1IOU A;  4Y2F A;  5EVI A;  1F9I A;  1W63 Q;  3CIT A;  2HDU A;  2O99 A;  3TE8 A;  4ZTK A;  5FDH A;  2PU4 A;  4F3L B;  2Y91 A;  3KSI A;  3S22 A;  1N9N A;  3LIB A;  1NWZ A;  1GA0 A;  5A8B A;  2HP5 A;  2WGI A;  3LR4 A;  1K0K A;  4ARZ A;  4R3B A;  2HP6 A;  3HLF A;  5FA7 A;  2W3F A;  5CEC A;  3A0V A;  3ZGA B;  5GHX A;  4L9G A;  2KDK A;  3CUE A;  2J7V A;  2D01 A;  1QME A;  2EA9 A;  1DJC A;  2JN7 A;  1K6R A;  4ESP A;  3B33 A;  1NJ4 A;  4B4Z A;  4OLD A;  1PI4 A;  5HAP A;  2ZBB A;  2B18 A;  1ZKJ A;  4HJ4 A;  4WMC D;  1FSY A;  2EFU A;  5G4Z A;  5G18 A;  2X02 A;  1DJB A;  3UDX A;  3F1P B;  4KZ4 A;  5DVA A;  2E8I A;  1MWS A;  3SOI A;  3TW8 A;  3FKV A;  4BLM A;  3UE1 A;  2Y2H A;  4OPQ A;  3CUE C;  3OPP A;  4RQ9 A;  4KQR A;  1T1B A;  2EWV A;  2HF6 A;  3CPT B;  3P7N A;  4ETZ A;  1RGZ A;  3M2J A;  4I5S A;  1V9Z A;  4Q0H A;  2PBY A;  4S2P A;  3V3R A;  2XA7 S;  5C5K A;  1XGJ A;  1FR6 A;  5D3O A;  4EES A;  3O86 A;  1H3Q A;  2O9A A;  4EU0 A;  1GHI A;  4MCW A;  2O0Y A;  4ZDX A;  1L0E A;  2KX6 A;  3HUM A;  3N4I A;  1G5U A;  4RA7 A;  1K4F A;  4GDB A;  5DTS A;  2ZD8 A;  3MQ0 A;  4DDS A;  3MSH A;  2B95 A;  3I7J A;  1RCJ A;  5J4E A;  1EWZ A;  5JYO A;  2PHY A;  4LPZ A;  3GEC A;  3CMZ A;  5FDS A;  1TD5 A;  4EQI A;  3MXQ A;  2HJ9 C;  3DTK A;  4Y5F A;  5FQI A;  4Y17 A;  4EXO A;  3CG5 A;  3MZF A;  2W3D A;  3VSK A;  1XJ3 A;  3LIE A;  3VE3 A;  3VP1 A;  3GTC A;  5EVI D;  3NIA A;  5FQM A;  1F2K A;  3ZG9 B;  1BLC A;  1E4D A;  4QHC A;  1JNU A;  4UA7 A;  3NHQ A;  3N8R A;  4PM9 A;  2J9O A;  2XK1 A;  1VEU A;  1MZU A;  3IWO A;  4OP8 A;  2Y2L A;  3PBN A;  4M4X A;  2K31 A;  1MKM A;  5EOE A;  5EEC A;  3HLW A;  1LL5 A;  2DMW A;  4Y3I A;  2V8F A;  1SZV A;  1KDW A;  5EOO A;  2I9V A;  3F1P A;  1DP9 A;  1HZO A;  4GW9 A;  4E3I A;  3NY4 A;  5FQK A;  5M18 A;  1L0F A;  4S2K A;  2V1B A;  3VP4 A;  3UMD A;  2I72 A;  1LL9 A;  1P97 A;  1LSX A;  2PAV P;  1SDN A;  2BLS A;  3N8S A;  1YSQ A;  3PBO A;  2QYB A;  3SZT A;  3IH9 A;  4NET A;  2J9P A;  4MBH A;  4S2M A;  4U0T A;  4LV0 A;  3MZE A;  4XT2 A;  3H7W B;  1E3U A;  3VP3 A;  1V9Y A;  4I38 A;  2V1A A;  3D4F A;  1IYS A;  3VFH A;  3UB5 P;  3ITA A;  5HSQ A;  2P9V B;  3ISG A;  4R38 A;  2FH5 A;  5AJG A;  2Y2N A;  1MKI A;  4AFI A;  4KZ9 A;  5JYP A;  1PRQ A;  3LIA A;  4BBU A;  3OC2 A;  3VOY A;  4WZ5 C;  5CX7 A;  4ME4 A;  3HRE A;  5TR7 A;  3RFB A;  4FSF A;  1VET B;  4QY6 A;  3ULF A;  4I3J A;  4HP4 A;  2VK3 A;  4A5R A;  1PYY A;  3FPW A;  4ZJ2 A;  2VJW A;  4N1X A;  1PZO A;  3G2Z A;  4KZB A;  2Z2M B;  4HBU A;  1S0W A;  2VGL M;  4HOI A;  4MLL A;  3P09 A;  4FOF A;  1ESI A;  2QWS A;  5CHM A;  1LI9 A;  3G32 A;  4D2O A;  3SS4 A;  4R3A A;  4LRX C;  4MN6 A;  2VEA A;  2Q9N A;  1MBL A;  1I2W A;  2W1T B;  4HJ3 A;  4DXB A;  1ZG4 A;  3MMH A;  4ZAM A;  1TS7 A;  4X69 A;  1FR1 A;  4G3V A;  4HES A;  1OJ5 A;  3VV4 A;  3O87 A;  3L9K A;  1C3B A;  3LR5 A;  4KZA A;  4Y0U A;  3DTE A;  4Y13 A;  4WZ5 A;  3BW6 A;  1BLS A;  2PDR A;  3BLM A;  1MY8 A;  2W27 A;  4OOM A;  1PFL A;  5HW3 A;  3VMA A;  5KSH A;  3HLG A;  2QJ7 A;  2Y8H A;  2WKE A;  2XRN A;  1DP6 A;  4RX3 A;  2LB9 A;  3CJM A;  4KEN B;  4N1H A;  3T12 B;  2OOL A;  5CGS A;  4FCF A;  3PHY A;  3A3D A;  2PR6 A;  1FSW A;  2OAQ 1;  4X1M A;  2XRO A;  3B42 A;  5I5L A;  1VB6 A;  5F1G A;  1ALQ A;  2PRF A;  4IUK A;  2JHE A;  4L0L A;  4IUH A;  4KG2 A;  1FCN A;  3B47 A;  4CQH A;  3IF5 A;  4Y0T A;  1UGU A;  2WAD A;  3C2W A;  3Q07 A;  5FEF A;  4WEJ A;  4IVK A;  2A3U A;  3NDG A;  3ZYT A;  4JF5 A;  1XX2 A;  1CI8 A;  3DWZ A;  2FFF B;  4B88 A;  3QHY A;  1N9B A;  2EFX A;  1YLP A;  2V9A A;  2R9X A;  4NEE D;  2JBF A;  4IJG A;  2G2W A;  3G34 A;  4P85 A;  5FI7 A;  2IWB A;  3LR0 A;  3DW0 A;  4EER A;  1BLH A;  4IED A;  3PBS A;  5GLC A;  2GNX A;  4F94 A;  1TS6 A;  3CHW P;  4E6X A;  1ERM A;  4Y0O A;  1RP5 A;  1VM1 A;  3DBA A;  1KGE A;  3A3J A;  5DTT A;  1GSX A;  3MQO A;  3IXH A;  1P9R A;  2XFS A;  3UPP A;  2PYR A;  1NRJ A;  1XFN A;  4R23 A;  1L0D A;  3E2L A;  3EGX C;  1XJ2 A;  3FC7 A;  2WKI A;  1GHP A;  4X68 A;  3T4J A;  2Q9M A;  3G6O A;  3R7W B;  2Y55 A;  5EM0 A;  4LLO B;  4S2L A;  1WE4 A;  1YLZ A;  5K5B A;  1GSW A;  1LT0 A;  3V5M A;  2FZ0 A;  2GX5 A;  1H5X A;  4BBV A;  3VSL A;  4I39 A;  2L1M A;  3E98 A;  3IX3 A;  3UE6 A;  1K54 A;  1JTD A;  4E3M A;  2RL3 A;  4UHU A;  3N8L A;  1PI5 A;  1Z6F A;  5HL6 A;  2ZQ9 A;  1JWV A;  3CPT A;  3KYE A;  3MFD A;  5EE8 A;  3G31 A;  3LR3 A;  5MC7 A;  1ES4 A;  2K2N A;  2H5S A;  2VX8 A;  4DKI A;  1Y4O A;  1NYM A;  4F3L A;  5GLA A;  3QP4 A;  3IBJ A;  5L09 A;  5G4Y A;  3KO6 A;  3UDI A;  4EBN A;  1BUL A;  2JCH A;  1PWG A;  5F82 A;  2GDN A;  4X25 A;  3OCN A;  1K57 A;  1T1C A;  2JKT I;  3GRJ A;  2X71 A;  3IWI A;  3NOT C;  2QZ6 A;  3G30 A;  4LRY C;  1P9W A;  2Y4A A;  4X6T A;  5CGW A;  2ACG A;  3D3O A;  3E4P A;  5HD5 A;  4EW7 A;  4HY8 A;  2QKP A;  4PM8 A;  3Q81 A;  3PBQ A;  1NRF A;  3BYD A;  1U60 A;  3IT9 A;  1IYP A;  3C5A A;  1OT9 A;  5HDS A;  2D02 A;  3G4P A;  5CED A;  5GLD A;  3T1X A;  3HJK A;  3MQQ A;  5DJU A;  4H8R A;  1H0M A;  4H6J A;  4NG2 A;  1VET A;  2J80 A;  1JVJ A;  4CPK A;  5CER A;  1HTZ A;  1ODV A;  4S2I A;  1K6S A;  3TG9 A;  3U4L P;  5DFX A;  4OH0 A;  1KDS A;  3UDF A;  4P0M A;  3GVB A;  4QY5 A;  1L2S A;  4OVD A;  5A91 A;  5GHZ A;  2W3E A;  3Q7V A;  1CF0 A;  3HBR A;  3UO9 A;  3ZDJ A;  5CTN A;  5HWT A;  3WRZ A;  2WAF A;  2YKH A;  3IXD A;  2XSS A;  4DJ3 A;  4JLF A;  1TDL A;  3KSH A;  5L07 A;  5EPH A;  3GSG A;  1ZG6 A;  2M1C A;  3FG8 A;  4WL9 A;  1PIO A;  1YQS A;  1GCE A;  3LGO A;  3WS2 A;  2XH9 A;  2OAP 1;  1XFQ A;  5TJJ A;  1KE0 A;  1PWD A;  3MS6 A;  1MWR A;  1GSV A;  1Y54 A;  4PMA A;  3S4X A;  2A49 A;  4QD4 A;  1XP4 A;  1ACF A;  4E3L A;  3NUL A;  5DF8 A;  2ZMA A;  3PXP A;  1K57 C;  1KGG A;  2V20 A;  4DN0 A;  5HZH A;  4IBX A;  1TVF A;  4E3N A;  3M6B A;  3BQ8 A;  2PD8 A;  5FAS A;  5DF7 A;  1CJF A;  5EVI B;  2A24 A;  3O88 A;  1TS8 A;  5M1A A;  4YOF A;  3IHA A;  1H8Y A;  3AGD A;  2OSU A;  3M6H A;  2INW A;  1ERQ A;  2OWJ A;  4OKP A;  4BD1 A;  1XA1 A;  1SKO B;  5F5Y A;  4UEY A;  5DKL A;  2Z6C A;  4UQI S;  5FAO A;  5HFO A;  3LI8 A;  3QNB A;  4ARZ B;  2WZZ A;  4LV1 A;  2WGW A;  4HI4 A;  4YIN A;  3DTI A;  5FQQ A;  3ZG0 A;  1H8Z A;  1KVM A;  4EEP A;  5IHV A;  2XD1 A;  4KZ6 A;  5CRF A;  4GZB A;  3HUN A;  3HJI A;  5HD3 A;  2ZQA A;  2IWC A;  5EFW A;  1LHY A;  3O3V A;  4LCM A;  2CC1 A;  1S6R A;  3MBZ A;  2BTF P;  4KQD A;  1W63 M;  2OV5 A;  1NLY A;  5DFY A;  3GDI A;  1TEM A;  3WWX A;  4QWO A;  4UQI M;  4X55 A;  3OPL A;  4EV4 A;  2ZQD A;  5DF9 A;  2ZOH A;  1S4R A;  1YM1 A;  3NDE A;  3C4O A;  4IVI A;  4E3K A;  1OPX A;  3PAG A;  5L2F A;  1AWI A;  2PD7 A;  4JKT A;  1XXM A;  4WN5 A;  3T4L A;  1SKO A;  2E8J A;  3DTM A;  4IHQ A;  2V1Z A;  1NXY A;  3FV7 A;  3Q7V B;  3VP2 A;  4GB7 A;  4RVA A;  4NXB A;  1ES3 A;  1Y28 A;  2J3W A;  2WGV A;  3LID A;  4OLG A;  3E4Q A;  1ERO A;  3IH8 A;  2VV6 A;  3WS1 A;  5DKK A;  1IYO A;  1PZP A;  3BFC A;  4LV3 A;  1S1Y A;  4R4R A;  4JGR A;  4ZBE A;  3MKE A;  5FQ9 A;  3ZG8 B;  5GHY A;  2JKF A;  3IX8 A;  3K2N A;  4RYE A;  4KZ5 A;  1YMX A;  3PR6 A;  5A92 A;  3EWK A;  2XFT A;  3LEQ A;  5FAQ A;  3QP2 A;  1IYQ A;  2MJ6 A;  3B3X A;  4MDZ A;  5FQJ A;  4HBT A;  3KX0 X;  1KGF A;  1J3W A;  3OOV A;  1T1A A;  1TDG A;  3NC8 A;  4U3T A;  4GS9 A;  1ONH A;  4P6B A;  1QMF A;  3F1O A;  2OLV A;  4NKP A;  5HPF A;  3DWK A;  2HZ5 A;  4PKY A;  3ZNT A;  3LEZ A;  3SS3 A;  3JVU A;  5J8X A;  1KE4 A;  1F5M A;  1L0G A;  2ZQC A;  1N9O A;  4O8G A;  1BUE A;  4R4S A;  4B9O A;  1TF1 A;  1YLY A;  4EQ1 A;  2G2U A;  3UPN A;  1X0O A;  3HLE A;  1LSV A;  3RH8 B;  4LV2 A;  5DTK A;  2H0T A;  3LYX A;  3OCL A;  2HJE A;  3ITB A;  1M40 A;  4XUZ A;  3BEC A;  4KG5 A;  3VP0 A;  4KQQ A;  1LI0 A;  3OPH A;  5F6A A;  4BL3 A;  2ZJ9 A;  4CLC A;  5J7E A;  4QJG A;  3UB9 A;  2V0W A;  4ID4 A;  4MN7 A;  1IKI A;  5FSR A;  1MWT A;  4YWZ A;  4DRT A;  1BTL A;  3OBF A;  4ZJ3 A;  1G6A A;  1XJ6 A;  1SKF A;  2JKG A;  3BFF A;  3H9W A;  2ZL1 B;  5AQ7 A;  1UWP X;  4PHT A;  1K56 D;  3KSF A;  1OTE A;  3PBR A;  4BWI A;  4OQH A;  4CJN A;  2UWX A;  2G7U A;  5J3W A;  4OP5 A;  4C3Q A;  4KUK A;  5EV0 A;  5LBR A;  3LIF A;  2CMN A;  5EUA A;  2EXA A;  2HPB A;  2P9V A;  2W1R A;  5HDC A;  4RX2 A;  3MR0 A;  3OZH A;  5HDD A;  3FPV A;  4Y15 A;  2ZLY A;  5L10 A;  1KOU A;  4OON A;  5AQA A;  1OME A;  1E3U D;  1EI5 A;  3JYI A;  4OPR A;  3QP5 A;  1E25 A;  1ZHH B;  4G3K A;  5KZH A;  4X1L A;  4GLQ A;  5TGF A;  2ZQ8 A;  4GOG A;  3PTE A;  4N92 A;  4KQO A;  3S7Q A;  1K4E A;  4PAU A;  3NOP C;  3DAV A;  1S67 L;  4JBF A;  4DF6 A;  4LEN A;  3E4O A;  4DE2 A;  2ZM2 A;  4FH4 A;  2Y2M A;  4R70 A;  4OOY A;  3IF6 C;  3SW1 A;  4S2O A;  4WEL A;  4CLC E;  4Q8I A;  3IQA A;  2ZOI A;  1MC0 A;  3L7H A;  5EVL A;  4FD8 A;  4FH2 A;  3OLO A;  2WKQ A;  5IT5 A;  2QJ5 A;  2Z2L B;  4BEN A;  1TS0 A;  1XGI A;  4OQI A;  2P74 A;  4OQG A;  2HDR A;  5HAI A;  3C30 A;  1DY6 A;  3CZD A;  2IA2 A;  3UME A;  3EGD C;  4ZRR A;  2NUT C;  2OWH A;  4WLA A;  4JF6 A;  4GHI B;  4BD0 A;  3NBL A;  4HH3 A;  5GLB A;  4JGQ A;  3K3C A;  4S2J A;  4JGP A;  4WYY A;  2C6W B;  3IHB A;  4R1G A;  3Q1F A;  3IF6 A; 
#chains in the Genus database with same CATH homology
 2M1C A;  4WF0 A;  3FG8 A;  4WL9 A;  2V1B A;  3UMD A;  2Z6D A;  5F69 A;  2ZMV A;  1P97 A;  1LSX A;  5IU1 A;  2Y79 A;  2GZA A;  2OAP 1;  1XFQ A;  3LFV A;  5TJJ A;  1YSQ A;  3HCY A;  3PBO A;  3F1N B;  2QYB A;  5AVE A;  1GSV A;  3P01 A;  4WUJ A;  3H7W A;  1LSW A;  3T4T A;  4NXG A;  3PYP A;  4XT2 A;  3H7W B;  2XA7 M;  1V9Y A;  3PXP A;  4I38 A;  2V1A A;  4DN0 A;  5HZH A;  1G6O A;  3EEH A;  4P6Z S;  5HSQ A;  2VGL S;  3BQ8 A;  2PD8 A;  1OTA A;  2PYP A;  3IS2 A;  4R38 A;  2FH5 A;  5AJG A;  2H28 A;  2GJ3 A;  4K08 A;  1STZ A;  2A24 B;  4AFI A;  3T50 A;  3VOL A;  3UE3 A;  1VHM A;  4KUO A;  2A24 A;  3LIA A;  4HNB A;  4HH2 A;  1TS8 A;  2WKP A;  3KYQ A;  4BBU A;  4CLC D;  3A0R A;  3OC2 A;  3CAX A;  1S66 L;  4YOF A;  3CI6 A;  1D06 A;  5CX7 A;  4ME4 A;  2PT7 A;  4LRZ E;  3W2Z A;  2INW A;  2VLG A;  3RFB A;  2OWJ A;  4NXE A;  5F5Y A;  3BY8 A;  4FSF A;  4UEY A;  2VA0 A;  3BY9 A;  3ULF A;  4HHD A;  5DKL A;  3E0Y A;  2Z6C A;  4UQI S;  4Z1W A;  3LI8 A;  4I3J A;  1S4S A;  4ARZ B;  1OTB A;  4HP4 A;  1EW0 A;  3FPW A;  2VJW A;  4HI4 A;  2LB5 A;  3T4Q A;  4GHI A;  4DJ2 A;  4HJ6 A;  4EEP A;  3BJN A;  3MF0 A;  2VGL M;  4HOI A;  3HJI A;  1OJG A;  5HD3 A;  4P6Z M;  4E04 A;  4FOF A;  2QWS A;  5EFW A;  4R3A A;  4LRX C;  4MN6 A;  2VEA A;  1YAX A;  4KQD A;  2P08 A;  2W1T B;  4HJ3 A;  1W63 M;  4L9E A;  2JKR M;  3MMH A;  1NLY A;  5DFY A;  1TS7 A;  2QHK A;  3KYZ A;  2HV1 A;  3GDI A;  4MMN A;  4G3V A;  1NLZ A;  4UQI M;  4H6J B;  5L8M A;  4HQA A;  5DF9 A;  1OJ5 A;  2ZOH A;  3VV4 A;  1OT6 A;  2BAS A;  3T4O A;  1BYW A;  3LR5 A;  4EET B;  3CLO A;  1S4R A;  4Q0J A;  2KLI A;  4HP9 A;  3BW6 A;  1DP8 A;  3R7W A;  3S7N A;  1OPX A;  1T19 A;  2M7V A;  2PD7 A;  2PDR A;  4O0P A;  3CWF A;  4WN5 A;  3S7P A;  3T4L A;  2W27 A;  4OOM A;  5HPI A;  4IHQ A;  1XJ4 A;  5HWW A;  3V67 A;  4GS9 B;  5KSH A;  4BBT A;  2QJ7 A;  4NXB A;  1Y28 A;  2Y8H A;  3EOI A;  3UB8 A;  2J3W A;  4L9F A;  2HGV A;  2XRN A;  3IBR A;  3LID A;  1F98 A;  1DP6 A;  3E4Q A;  2W1T A;  3K3D A;  2LB9 A;  3KSG A;  3H82 A;  2VV6 A;  2OOL A;  4QPR A;  5DKK A;  5TBM A;  3TRC A;  3PHY A;  2M7U A;  2PR6 A;  4NXF A;  1S1Y A;  2OAQ 1;  5IS1 A;  2XRO A;  3B42 A;  5I5L A;  4OOL A;  4JGR A;  2W0N A;  1VB6 A;  1YKD A;  3UB7 A;  3K2N A;  3F1N A;  4IUK A;  2WKR A;  2J3T C;  3PR6 A;  3EWK A;  2L0W A;  4WEK A;  1ZTU A;  2JHE A;  4L0L A;  2JKR I;  4IUH A;  3B47 A;  4XT2 B;  2YKF A;  4CQH A;  1OTI A;  2MJ6 A;  4MDZ A;  5FL3 A;  3KX0 X;  3LI9 A;  1UGU A;  3OOV A;  3C2W A;  4HIA A;  1P0Z A;  1T1A A;  4DMZ A;  1WA9 A;  4GS9 A;  4EEU A;  2O9B A;  4B93 A;  3EQV A;  4WEJ A;  4O01 A;  3PBT A;  3EEA A;  4CLC C;  3ZYT A;  1OTD A;  4MN5 A;  3BWL A;  3F1O A;  1H8M A;  3O5Y A;  3H82 B;  4CLC B;  4NKP A;  5HPF A;  1IOU A;  2V9A A;  4Y2F A;  4PKY A;  1F9I A;  1W63 Q;  3JVU A;  4NEE D;  2A2L A;  3CIT A;  4IJG A;  2O99 A;  1F5M A;  3TE8 A;  3T4S A;  2R78 A;  1N9O A;  4O8G A;  4B9O A;  4F3L B;  1TF1 A;  4EQ1 A;  3KSI A;  1N9N A;  3C38 A;  3LR0 A;  3LIB A;  1X0O A;  4EER A;  1NWZ A;  5A8B A;  3LR4 A;  1LSV A;  3PBS A;  3RH8 B;  2GNX A;  1TS6 A;  4GCZ A;  4ARZ A;  3LYX A;  3OCL A;  2KOI A;  2HJE A;  3DBA A;  2W3F A;  1N9L A;  3IS2 B;  3A0V A;  1GSX A;  4L9G A;  3MQO A;  1P9R A;  2KDK A;  2PYR A;  1NRJ A;  5HWV A;  1XFN A;  5F6A A;  4CLC A;  3CUE A;  4GJ4 A;  5J7E A;  2D01 A;  2PR5 A;  2V0W A;  3UB9 A;  3EGX C;  4MN7 A;  2EA9 A;  1XJ2 A;  3S7O A;  3FC7 A;  4YWZ A;  2JN7 A;  3T4K A;  3OBF A;  1XJ6 A;  3T4J A;  3H9W A;  3G6O A;  3B33 A;  3BQA A;  3VE4 A;  3R7W B;  2ZBB A;  2B18 A;  1UWP X;  4LLO B;  4PHT A;  5K5B A;  3KSF A;  1GSW A;  1OTE A;  1LT0 A;  3PBR A;  4HJ4 A;  4BWI A;  2P04 A;  2FZ0 A;  2GX5 A;  2G7U A;  5J3W A;  4BBV A;  4I39 A;  2L1M A;  3E98 A;  2O9C A;  4KUK A;  5G4Z A;  5LBR A;  3UE6 A;  5AVF A;  5KIZ A;  3LIF A;  2CMN A;  1DRM A;  3F1P B;  2J3T D;  4G3W A;  3TW8 A;  2L4R A;  2W1R A;  4RQ9 A;  3CUE C;  5HDC A;  4ETZ A;  1T1B A;  2EWV A;  2HF6 A;  3P7N A;  4EUV A;  3D72 A;  3MR0 A;  5HL6 A;  2EWW A;  2P7J A;  2V0U A;  4I5S A;  1V9Z A;  4Q0H A;  5HDD A;  2XA7 S;  5C5K A;  3FPV A;  3ZQ5 A;  3A0S A;  4EES A;  2VV8 A;  4YNR A;  3LR3 A;  1IFQ A;  1H3Q A;  5MC7 A;  2O9A A;  4EU0 A;  4MCW A;  2K2N A;  2VX8 A;  4ETX A;  1KOU A;  2O0Y A;  4F3L A;  2KX6 A;  3NOU C;  3IBJ A;  1D7E A;  5G4Y A;  4II7 A;  3KO6 A;  5F68 A;  1ZHH B;  1YSP A;  4G3K A;  3MQ0 A;  5J4E A;  3OCN A;  1T1C A;  2JKT I;  3MJQ A;  3EQU A;  4GLQ A;  2PHY A;  4LPZ A;  3GEC A;  1G28 A;  3NOT C;  1TD5 A;  4I3A A;  4KQO A;  3S7Q A;  3MXQ A;  4LRY C;  2HJ9 C;  4PAU A;  1P9W A;  4Y5F A;  3NOP C;  3MFX A;  3D3O A;  1S67 L;  2B02 A;  3E4P A;  3TJZ C;  4EXO A;  5HD5 A;  4EW7 A;  4JGO A;  4HY8 A;  2W3D A;  5TBM B;  2QKP A;  1T18 A;  3PBQ A;  1XJ3 A;  3LIE A;  1UWN X;  3E4O A;  3VE3 A;  2VZW A;  4R70 A;  3R4K A;  1OT9 A;  3SW1 A;  5HDS A;  4Q0I A;  4WEL A;  4CLC E;  2D02 A;  2JKT M;  2ZMF A;  2W3H A;  3MQQ A;  2ZOI A;  3HJK A;  1JNU A;  1MC0 A;  3NJA A;  5DJU A;  3NHQ A;  3LUQ A;  3OLO A;  2VV7 A;  4H6J A;  2WKQ A;  5IT5 A;  2J80 A;  2QJ5 A;  3JVV A;  3C8C A;  1TS0 A;  4BMW A;  3U2A A;  2VKS A;  1MZU A;  3C30 A;  3PBN A;  4PKY G;  1ODV A;  4M4X A;  2K31 A;  5DFX A;  3LIC A;  2IA2 A;  3RTY A;  1MKM A;  4I3I A;  3UME A;  3EGD C;  5DJT A;  4R6L A;  1LL8 A;  4ZRR A;  2NUP C;  2NUT C;  2W3G A;  2DMW A;  2W3E A;  4Y3I A;  4BJP A;  2OWH A;  4WLA A;  2I9V A;  4GHI B;  3ICY A;  3F1P A;  5HWT A;  4HH3 A;  1DP9 A;  3F1O B;  2K7S A;  4JGQ A;  2YKH A;  3K3C A;  4GW9 A;  2XSS A;  4JGP A;  4DJ3 A;  3KSH A;  1S1Z A;  3UB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...