4DJ3A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
298
Chain Sequence
GRLEDVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNCAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Period circadian protein homolog 3
total genus 65
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A02
1DP9A 1DP6A 3F1NB 3BY9A 4EEUA 2QKPA 3BWLA 3F1OA 2V1BA 3MXQA 5F69A 4KQDA 1LT0A 5HDSA 3IS2B 1F9IA 1X0OA 2ZOHA 1OT6A 3F1NA 2M1CA 3LUQA 1OTBA 4H6JB 3C2WA 1MZUA 1OTIA 1OT9A 3LIEA 4LRYC 4WN5A 5DJTA 1NWZA 3UB8A 4EW7A 4EXOA 1OTDA 4HQAA 1OTAA 1XFQA 4HP9A 1P0ZA 2VV6A 4M4XA 1LSXA 1TS0A 2HV1A 2PR5A 2YKHA 3H7WA 4L9GA 1DRMA 5TBMB 2B02A 2ZBBA 2VLGA 3LIAA 3D72A 4WLAA 2L4RA 4B9OA 4HIAA 4BBTA 4PKYG 1OJGA 4BBVA 5HSQA 1T19A 3UB6A 4GCZA 1S4RA 1LSWA 3A0SA 1XJ2A 2R78A 2P7JA 4HH3A 4KUKA 1GSVA 1S1YA 1T18A 3ICYA 5I5LA 1Y28A 3LIBA 3G6OA 2JN7A 3LI9A 3UMDA 3UB7A 3CAXA 3CLOA 3PYPA 1UWPX 5HWWA 1S1ZA 4LPZA 3F1OB 4MN5A 1S66L 5DKKA 5IU1A 4WUJA 4XT2B 3IS2A 3UE6A 5AVEA 4H6JA 4HY8A 4NXGA 4R70A 1LSVA 4WF0A 4XT2A 4F3LA 2BASA 2PD8A 2A24B 1ODVA 3H82B 5HD5A 5HWVA 3SW1A 4F3LB 4L9EA 1GSWA 2QWSA 4EESA 2W27A 3LIDA 3E4PA 3MR0A 5HD3A 3VE4A 5J4EA 3NOPC 4I39A 3MJQA 1T1AA 5TBMA 1D7EA 3KX0X 2L0WA 2K7SA 2Z6DA 2WKPA 3EEHA 4LRXC 1VB6A 1F98A 2INWA 3E4OA 4HP4A 4NXEA 4EETB 3RTYA 4E04A 1UWNX 2V0WA 4GW9A 4GS9A 2J80A 4R38A 4EEPA 4HNBA 3GDIA 2QJ7A 2H28A 2V0UA 1N9LA 1XJ6A 2V9AA 4JGPA 1N9NA 1KOUA 2L1MA 4LRZE 3ZQ5A 1S4SA 1XJ4A 2CMNA 5F5YA 5F68A 5DJUA 4I3AA 3LYXA 3MQQA 2PD7A 4HI4A 4WL9A 4GHIA 1OJ5A 2KX6A 3LIFA 3MQOA 4KUOA 2KDKA 4NXBA 4HH2A 5HDDA 1JNUA 1D06A 1T1CA 3EWKA 3H7WB 3K3CA 3NOTC 5AVFA 3MFXA 5KIZA 3FG8A 4I3JA 2VEAA 3IBRA 2Z6CA 1GSXA 1XJ3A 1V9ZA 4K08A 1S67L 3F1PA 1TS6A 3VOLA 3CWFA 2PYRA 3OLOA 4HOIA 1DP8A 3C8CA 2VV7A 5HZHA 3F1PB 3HJIA 5J3WA 5EFWA 4JGOA 3E4QA 1TS8A 1P97A 4GS9B 5F6AA 2V1AA 4YWZA 5HWTA 1V9YA 3UMEA 2YKFA 3K3DA 2OWHA 1EW0A 4HJ6A 3NJAA 5G4ZA 2WKRA 3H9WA 4BBUA 3GECA 3ULFA 2D02A 3LI8A 4HJ4A 3LICA 5HDCA 1G28A 3NOUC 4GHIB 4I38A 3RH8B 2PHYA 2QHKA 2QJ5A 2PDRA 5DKLA 4R3AA 2W0NA 4DJ3A 3A0RA 3A0VA 3FC7A 3P7NA 4R6LA 1UGUA 3VE3A 4EERA 2WKQA 4I3IA 4L9FA 5J7EA 1TS7A 2VV8A 1BYWA 1T1BA 4NXFA 5IS1A 2EA9A 1WA9A 4LLOB 3BY8A 3PHYA 3UB9A 2A24A 2PR6A 3HJKA 3H82A 4JGQA 4JGRA 1XFNA 5G4YA 4DJ2A 1LL8A 2PYPA 4MN6A 4RQ9A 1OTEA 3T50A 2OOLA 4PKYA 4EQ1A 2ZOIA 4HJ3A 1N9OA 5A8BA 2OWJA 3NHQA 4HHDA 4I5SA 2D01A 3B33A 2GJ3A 2JHEA 2I9VA
chains in the Genus database with same CATH superfamily
1DP9A 2QMIA 2Y59A 4P6ZM 4WEKA 4H6JB 5F83A 4WN5A 3PBTA 5DJTA 4X1MA 1OTDA 2J3TD 3IH9A 5EVID 3IHBA 3S4XA 3IHAA 4CLCB 1YMXA 5HL1A 2Y2QA 1TD5A 2O9CA 3HLFA 1CEGA 4OQIA 3IWIA 5CGXA 3C4PA 1S1YA 2VX8A 3EGDC 3F1OB 2KLIA 1IYQA 2FZ0A 4QD4A 1L2SA 3V67A 1SCWA 4EESA 3HUOA 1ESUA 4R23A 4NETA 1CEFA 3B47A 1H5XA 4OQGA 4NKPA 5GL9A 4EEPA 2HDSA 5K5BA 3VFFA 1BTLA 4UHUA 2ZL1B 3RFBA 4GHIA 3BYDA 3SS5A 4Y13A 1SKOA 5CRFA 3R7WB 3TSGA 3MZEA 4I3JA 4IHQA 3CWFA 2XGNA 4OONA 4S2MA 5CEDA 3OBFA 5EV0A 3NJAA 3N4IA 5HARA 1MXOA 4BBUA 3FKVA 1K54C 3S1YA 4DJ3A 3HLDA 2WADA 1K38A 3CJMA 2OAP1 2EA9A 4GDNA 2H10A 2A24A 4QB8A 2VJWA 2W3DA 4ETZA 3JVUA 5M1AA 3G32A 4XUXA 3LEQA 3CUEC 1MKMA 3BY9A 1ZHHB 3F1OA 2CC1A 4X56A 2ZOHA 3GRJA 3IXDA 2A3UA 4HBTA 5I94A 4HQAA 4NEED 3BLMA 1P0ZA 5CEBA 2ZM0A 2VGKA 1XA1A 1MWUA 2B02A 3V5MA 2Y4AA 1W63Q 3JPUA 4KUKA 4Q0IA 1GHPA 1N9BA 3WS1A 3R7WA 3LO7A 3LR5A 3MF0A 2P74A 1MWSA 4MCWA 3GV9A 3MMHA 4LV2A 1ACFA 4X6TA 2WKIA 2J3WA 3PBOA 3E4OA 3PAGA 1NJ4A 2QYBA 1CJFA 2L1MA 5BOHA 5DJUA 2B5RA 4H8RA 4Y17A 4OQ0A 3UPNA 4GD8A 5FL3A 2KDKA 1T1CA 3PBRA 3MFXA 4M3KA 4QPRA 3FG8A 3A3FA 1V9ZA 4P85A 1S67L 4MNRA 3WRTA 1IYSA 3BRMA 1TS8A 1VQQA 2YKFA 2BTFP 2VGLM 3PBNA 1L0DA 3BW6A 3MXSA 3VE3A 4EERA 2V8CA 4OLDA 3BJNA 1PI4A 4E6XA 2H0TA 1AXBA 4JGRA 4CLCD 4PKYA 4R3JA 2GNXA 4JXWA 4HJ3A 4JXVA 5HAQA 4S2JA 4BQMA 2I9VA 1K54A 1Y54A 4ME4A 5AJGA 3VSKA 3IX4A 1XX2A 2J8YA 4B93A 4EUZA 1F2KA 1F9IA 5CHMA 4R3BA 5JYOA 2EX9A 5CGWA 3MQ0A 1DJCA 1G5UA 3W2ZA 3IT9A 5FI2A 4ZBEA 4E3KA 5FDHA 4IEDA 1ONGA 3O88A 4BBTA 1ERMA 5L09A 4GCZA 4OH0A 4GOGA 3Q7ZA 3EQUA 4FCFA 1BSGA 2Z2LB 3RXWA 3UMDA 3RJUA 5CXWA 2R9WA 4JPMA 2B95A 1W63M 3SW1A 2PT7A 2W27A 5TFQA 5HD3A 4FH4A 5TBMA 3G34A 2VGLS 3T4SA 4S2KA 3Q81A 1STZA 4HNBA 2H28A 1XJ6A 3UO9A 4DDYA 1VHMA 1ONHA 3ZNTA 3BQ8A 5FQ9A 1CF0A 3IX8A 3G35A 4GB7A 2VEAA 2X02A 1K56A 3ZNYA 3PR6A 4KG2A 3A3JA 3F1PB 3G30A 1MPLA 2OWHA 3DAVA 1I2WA 1TDLA 3A3DA 1XGJA 3KSFA 4IJGA 2PDRA 2Y2OA 4DF6A 4R6LA 3B3XA 5CHJA 2XEPA 3KSHA 4NXFA 4EW7A 4RQ9A 4G3VA 4FUWA 2EXBA 2IWCA 5HDSA 3OZHA 4WZ5C 1MZUA 1OTIA 1OT9A 2EWVA 4WMCA 2HP5A 2ZC3B 1GCEA 3ISGA 3R4KA 3U4LP 4WM9A 1XFQA 1M6KA 1LSXA 5EVIC 4E3OA 2WGIA 5TBMB 5DTTA 3LIAA 2V2FF 5FI7A 3DTEA 4P6ZS 4YNRA 4PPRA 3TG9A 2JN7A 3CAXA 1TDGA 1NZOA 4WZ5A 3IXGA 4F3LA 5GLBA 2HP6A 1E4DA 1IEMA 5EOEA 3SH7A 4Q8IA 2L0WA 2Z6DA 3IH8A 4HP4A 2ZMFA 4GS9A 2V9AA 1FCOA 2ZQ9A 3SH9A 3HLBA 1YLZA 3M2KA 4QWOA 5KMWA 1GA9A 1D06A 1XGIA 1PWGA 4S2IA 1ERQA 1SDEA 1FSWA 3T4TA 3TW8A 3CITA 4X55A 5HZHA 3C8CA 1JVJA 4JGOA 4PM9A 5FATA 5DF8A 4MBKA 5F6AA 2G7UA 1IOUA 2M7VA 2ZM8A 3FKWA 4FSFA 4IUHA 3UY6A 2ZC7A 2ZC6B 3JVVA 3FC7A 1PWCA 1WYBA 2ZL1A 4E3NA 3CPTB 5AQ9A 5G4YA 1LL8A 4MN6A 5A90A 4ETXA 4HHDA 3S7OA 4R1GA 3LGOA 2JHEA 3V39A 4IVKA 4KENB 5F69A 3UB7A 4JBFA 3IS2B 1OTBA 4OVDA 4PM6A 3ZDJA 4EXOA 3KYEA 2ZBBA 4HBUA 2L4RA 3GSGA 4PKYG 1KE3A 1ZC2A 1K4EA 1S4RA 3A3EA 5AQ7A 2E8JA 2HJ9C 4HH3A 1QMFA 5FAQA 4EWFA 1UWPX 3I7JA 3WWXA 4DKIA 2OSUA 5IU1A 4HEFA 1Z09A 1LSVA 1H8YA 3E0YA 4UA7A 1G6AA 3N8SA 1ODVA 4KZBA 5EVIB 4ZRRA 3NY4A 2DRWA 3OCLA 2WAEA 2J80A 2VKSA 1NY0A 5A92A 3P09A 1MWTA 2B18A 5F1GA 2QPNA 3MQOA 1C3BA 5HDDA 1JNUA 3NOTC 3T12B 4K08A 4LCLA 3MZFA 1K4FA 3ITBA 5HAPA 2XK1A 4UAAA 1D1JA 5FDSA 3LICA 3B42A 2R9XA 4JF5A 4GKUA 4YOFA 3OPLA 3K2NA 2XR0A 4QHCA 4BD1A 1WA9A 1K56D 3NHQA 2D01A 4Y0OA 2FFYA 1GA0A 2JKTM 4EEUA 1LT0A 1PYYA 4U0XA 2M1CA 2WGVA 3QP6A 3UNWA 4KZ6A 4BL2A 2W1TB 1SKFA 5E2EA 4P6BA 4PHTA 2VLGA 3V3RA 1FCMA 1K6SA 3O5YA 4BMWA 1NLYA 2Y55A 5I5LA 2XFSA 2DMWA 3QNCA 3UE6A 4WUJA 2ZMVA 4GN2A 4O01A 4WF0A 2RCXA 2WUQA 3H82B 5DTKA 3MFDA 1BULA 1BLCA 1VETB 2JBFA 1YAXA 4LV1A 1FOFA 2Y91A 3LFVA 3SH8A 1K55A 3G31A 3T4OA 3M6BA 1YMSA 5M18A 4CLCA 3OPRA 1AWIA 3T4KA 3HUNA 1GSXA 4MDZA 2OLUA 1CI8A 1N4OA 1DP8A 5J3WA 1CK3A 4GS9B 5HWTA 2V1AA 3VFHA 3K3DA 5G4ZA 1P9WA 4WZ4A 3EOIA 1F5MA 1Z6FA 4QY5A 3FWLA 3UPPA 4E3JA 3A0VA 4RA7A 2K2NA 3ZG5A 1T1BA 2OAQ1 1HTZA 4P0MA 4LLOB 2HGVA 4AFIA 2PR6A 3S7PA 5MC7A 3CI6A 4U3TA 2E8IA 1KGFA 4Y0TA 2HJEA 4DXBA 1PNEA 1XKZA 1EROA 1K6RA 4R0QA 4GDBA 4JLFA 3F1NA 1CI9A 3CPTA 3N8LA 4HP9A 2ZLYA 3MKEA 1Q2PA 4O0PA 4UA9A 4EU0A 2WK0A 4HIAA 4BBVA 5HSQA 4OLGA 3A0SA 4O7DA 3BECA 1PW8A 2W3HA 3ICYA 5DFYA 3LIBA 3G6OA 1TEMA 1S6RA 2JKRM 3G4PA 4HY8A 3DW0A 3UDIA 2PD8A 2A24B 3PTEA 3OOVA 4BD0A 4PM5A 4S2NA 3W8KA 4I39A 2V1ZA 4FOFA 2K7SA 5E2GA 1VB6A 2EX2A 3BFGA 5L8MA 3D9YA 1N9LA 2P9VA 5F68A 4B4ZA 3DWZA 1JWZA 5DF7A 1NLZA 3BEBA 2KX6A 3BQAA 1XP4A 2BLSA 5AVFA 4EUVA 3LR0A 3NCKA 3UB5P 3GVBA 3E2KA 3VOLA 4DDSA 4YWZA 2XLNA 2WKRA 2Y79A 3C38A 2WGWB 2KOIA 1H8MA 2EFUA 4B4XA 3O87A 4NG2A 3LR4A 1NRJA 3OPHA 3WRZA 3UDFA 4II7A 1NXYA 4N9LA 1KVLA 4X69A 1DJBA 1OTEA 5E2FA 3HUMA 4IBXA 4BENA 4PM8A 4ARZB 5EOOA 3VP1A 4KQDA 1K57A 1P9RA 4LRYC 2J3TC 3NECA 5FQMA 4R4RA 2ZC4B 3D3OA 4WYYA 3H7WA 1E25A 1G68A 3ZG8B 2JCHA 1OJGA 1XXMA 1YSPA 1HVBA 2P9VB 1EWZA 2P7JA 2O9AA 3IXBA 3LI9A 2VK3A 2DNSA 2ZMAA 5DKKA 5HWWA 3KYZA 2XDMA 3IS2A 4JXSA 5HFOA 1IKGA 1PW1A 2WKHA 1H3QA 3Q82A 1T1AA 4N9KA 1ES4A 2Q9MA 4O8GA 1UWNX 1FCNA 2JKFA 1YT4A 3ZQ5A 1XJ4A 2CMNA 1BLHA 1ES5A 4PAUA 3P98A 3E98A 5FEFA 3HLCA 4KZ9A 4S2NC 5J8XA 1IYPA 3TOIA 1KVMA 1EW0A 1DY6A 3GECA 4HJ4A 1LI0A 3LR3A 5LBRA 3HLGA 1BYWA 4LFUA 5IS1A 2HDQA 1ZKJA 5EE8A 5F82A 4DJ2A 4BWIA 3N6IA 4RX3A 3MSHA 2UV0E 4LV0A 1VEUB 4HJ6A 3QP1A 2XA7M 1LHYA 3LIEA 3BFFA 1IELA 5EVEA 5FQIA 5EM0A 3IQAA 4FTXA 4D60A 3UPOA 2XRNA 5GHZA 1GHIA 2Y2PA 1DRMA 1JWPA 3GMWA 3MZDA 3IF6B 1GSVA 3PAEA 1K55C 5TGFA 2A49A 3ZCZA 2H0YA 2H5SA 3JYIA 4XT2A 1YQSA 1DJAA 1ZTUA 4DRTA 4L9EA 1BLSA 2RL3A 4GNUA 5C5KA 2GX5A 3HREA 3S7NA 3MXRA 4F94A 2FFFB 4GW9A 1PZPA 4JXGA 4OP8A 2GZAA 3BFCA 1A0KA 4LGWA 3SOIA 3GR2A 3LIFA 3RH8B 3WS2A 5CGSA 1I2SA 1BZAA 1XJ3A 2PBDP 1O7EA 3UE1A 3C5AA 4ZDXA 1LL5A 1HZOA 1TVFA 1K0KA 3KSGA 2LB5A 3NOUC 2HPBA 3A0RA 3T4QA 1YKDA 2VV8A 3ZYTA 4NK3A 5DTSA 4QY6A 2WZXA 3UB9A 4JGQA 4EQIA 2GDNA 4LENA 5FAPA 3NBLA 4HOIA 1Y28A 3LY3A 2ZQCA 4U0TA 3UB8A 1LI9A 1NWZA 3BFEA 3FPWA 4Z1WA 2WAFA 3KSIA 2VV6A 4E3MA 2YKHA 5E2HA 4L9GA 1FQGA 5EECA 2ZM2A 1MKIA 3T1XA 4DE1A 2VGJA 4ARZA 3IX3A 1L0FA 2BG1A 2UWXA 5AQAA 2HF6A 3TE8A 4NXGA 3CZDA 4N92A 4CQHA 5HD5A 2JKGA 3ZG7B 4JKTA 4UQIM 4KG5A 3BLSA 2G2WA 3VV4A 4MBHA 1KE0A 1KDSA 5DF9A 1D7EA 5E43A 3HLWA 4XUZA 4RVAA 1XPBA 5F5YA 5CHUA 4CLCE 3LYXA 2A2LA 3MQQA 4WL9A 1KGEA 4KG6A 3LCEA 5FQJA 3EWKA 3EGXC 2WZZA 5DVAA 1OMEA 3T1RA 2Y2JA 5U47A 1TS6A 3NULA 2I72A 3H9WA 2NUPC 3ULFA 1PI5A 4QU3A 2JKTI 3KO6A 4FH2A 2K31A 3KYQA 4X1LA 5DFXA 3BY8A 3M6HA 4Y7PA 3QHYA 1Y4OA 4EQ1A 2Q0OA 2MJ6A 1W7FA 3ZGAB 2GJ3A 3F1NB 3V50A 1K25A 4OPRA 3QP2A 5IT5A 3IXHA 3VP3A 2WGWA 2M7UA 4ZTKA 3M2JA 5HL6A 3C4OA 4C3QA 3V3SA 3QNBA 4WLAA 1T19A 3D4FA 2X71A 2JE5A 2OV5A 4EBPA 4KQRA 1FR1A 5AVEA 4RX2A 1HLUP 4OQHA 2P08A 1YLYA 2QWSA 3OPPA 4PM7A 3IF6A 3E4PA 5G18A 3KX0X 2WKPA 1F98A 4MMNA 3HLEA 4DE3A 4Y15A 4LRZE 2ACGA 2G2UA 4KZ7A 3T4LA 1VM1A 3VOYA 5FQQA 3IF5A 3UE0A 3F1PA 3Q1FA 2VV7A 3IF6C 1MWRA 5GHYA 1WYCA 2PU2A 3QP8A 4K0WA 3VP4A 1G28A 3FPVA 2QHKA 3UDXA 1SHVA 1UGUA 2HDUA 3NDGA 2ZQDA 2WKQA 4I3IA 4UQIS 1H0MA 2ZD8A 3Q07A 1PIOA 4MLLA 3T50A 3SZTA 2OOLA 3OC2A 2OWJA 1JTGA 2XQZA 3Q7VB 2HP9A 1G6OA 4YFMA 1PRQA 4KUOA 1J3WA 4ZJ3A 2XD1A 1TS0A 3NI9A 2EXAA 3ZVTA 1XA7A 1LSWA 2IWDA 1T18A 2AVXA 2J7VA 4LV3A 2C5WB 1SDNA 1E3UD 2Y2IA 4MN5A 4XXRA 1YLTA 3FZCA 1LLBA 2BASA 5HWVA 4F3LB 5HPIA 1ALQA 3O86A 4UEYA 4E3IA 3EEHA 2O0YA 3ZFZA 3ITAA 1L0EA 1BLPA 2V0WA 3GDIA 4ZJ2A 2DCFA 4IVIA 4L0LA 1S4SA 4ZAMA 1MBLA 3AGFA 4Y0UA 2JC7A 1ES3A 1FSYA 3C7VA 4G3KA 5CX7A 1M40A 5FSRA 1V9YA 4GJ4A 3UMEA 1CQAA 2XH9A 2EFXA 2W1RA 5A93A 3BFDA 5FAOA 5FQKA 4CLCC 1TS7A 1RGZA 1W79A 1YLPA 3H82A 4KZAA 2EWWA 4X25A 4WBGA 2V20A 1VEUA 1IYOA 1YPRA 1DP6A 3IWQA 1JTDA 1PWDA 1PZOA 1S0WA 2QKPA 2V1BA 1X0OA 3DTIA 5CECA 3UE3A 4BL3A 1PFLA 4KZ3A 2HV1A 4OPYA 3U2AA 2Q9NA 3SS3A 1ES2A 5KSHA 1I5QA 4Q0HA 2R78A 2PAVP 1QMEA 1ZG4A 3CLOA 3PYPA 1H8ZA 2IA2A 4E6WA 1S66L 4XT2B 5EVIA 2ZQAA 3RXXA 4A5RA 1GSWA 2X01A 3LIDA 2OLVA 5J4EA 3NOPC 4DN0A 3T1SA 5FEGA 2HDRA 4OPQA 3RTYA 4E04A 4MEZA 4UA6A 4R38A 5FI6A 1EI5A 1N9NA 5EUAA 3E2LA 4DXCA 4KQOA 1OJ5A 4DMZA 2JKRI 5GLDA 4HH2A 3H7WB 2Y2KA 1MC0A 3OLOA 3A3IA 3L7HA 1LL9A 1P97A 4QJGA 4MBFA 2W3EA 4LCMA 2QZ6A 2Y2GA 3G2YA 4E3LA 1HD8A 4GLQA 3SS4A 4OOYA 2Z2MB 3DWKA 4JF4A 2Y2HA 2XROA 4L9FA 3N7WA 1IKIA 3ZG9B 1NZUA 3CMZA 5HAIA 1RCJA 3WS0A 3C7UA 3G2ZA 3HVFA 2J9OA 3CG5A 4WMCD 3MXQA 1BT5A 1L0GA 1OT6A 5IHVA 3C2WA 1KGGA 3S7QA 2ZJ9A 2Y2MA 5D3OA 2W1TA 4KZ5A 3HCYA 4EV4A 1ESIA 4HESA 1FR6A 5JYPA 2O99A 2ZQ8A 4JF6A 3W4QA 1Q2QA 3OCNA 2J9PA 1VETA 1BUEA 1YM1A 4LRXC 2INWA 4OP5A 2ZC5B 2VA0A 5HW3A 2XSSA 4JGPA 4RYEA 1YLWA 3S22A 2PD7A 2P04A 5L10A 2NUTC 2PYRA 3HJIA 3T4JA 3ZVWA 4S2PA 4G3WA 3VP2A 3LI8A 3NC8A 2XA7S 3DTKA 4Z9QA 2QJ5A 1OPXA 4KQQA 2IWBA 2W3FA 2C6WB 4MN7A 5J7EA 3VSLA 4ZJ1A 1YLJA 4C75A 2Y8HA 4IUKA 1YSQA 1WE4A 4K91A 5FA7A 5CERA 1ZG6A 2W3GA 3P01A 5KZHA 2ZOIA 3W4PA 5A8BA 5FASA 3B33A 4FD8A 4S2LA 1NRFA 2EX8A 3AGEA 2Y2NA 1OTAA 3PBQA 3VMAA 4M4XA 5GLCA 4ESPA 2PR5A 3DBAA 4KZ4A 3CUEA 4CPKA 2LB9A 3HBRA 1NYYA 3CHWP 4DE0A 4B9OA 3UB6A 3N8RA 1XJ2A 3Q7VA 4N1HA 3UN7A 4Y3IA 2O9BA 3QP5A 3W4OA 4OOMA 5L07A 3VE4A 3MR0A 3MJQA 1J9MA 2EX6A 4X68A 4Y2FA 2QJ7A 2V0UA 2XF3A 3MBZA 4DE2A 4N1XA 1GHMA 3EEAA 1KDWA 4HI4A 3MS6A 5EM1A 5KSCA 4NXBA 4C6YA 5KIZA 3PXPA 5HX9A 3FV7A 2FH5A 3IBRA 4Y5FA 4EBLA 3WS5A 3ZG0A 5EFWA 5GHXA 2PU4A 3AGDA 5A91A 3WS4A 3TRCA 3L9KA 2D02A 1K57C 3VP0A 3IWOA 2PRFA 4GHIB 3GTCA 4I38A 2W0NA 4B88A 1O07A 4IBRA 5M19A 4GZBA 5L2FA 3TJZC 4Q0JA 1FILA 5AQBA 1XFNA 4GD6A 1L3LA 4K0XA 3T1QB 5CTMA 5EVLA 4D2OA 4WEJA 3BWLA 3LUQA 1RP5A 2XFTA 4OOLA 5EPHA 1E3UA 5GLAA 2V8FA 4YINA 5TR7A 5TJJA 5CTNA 5HPFA 1NYMA 3LY4A 1KE4A 3QP4A 3D72A 1W5DA 4P87A 3IBJA 3GQZA 4S2OA 3NDEA 3O3VA 1U60A 3ZHHA 1S1ZA 4LPZA 4H6JA 4R70A 4PMAA 1TF1A 4CJNA 2Y2LA 1MY8A 4EETB 4NXEA 1JWVA 4R4SA 4KZ8A 3PBSA 1SZVA 1KOUA 2WKEA 2HZ5A 3DTMA 4I3AA 1RGYA 4ID4A 3K3CA 2WYXA 2VZWA 2Z6CA 1W8QA 3VOZA 4EBNA 3E4QA 4BLMA 5F1FA 4OKPA 3HL9A 3BM6A 5HDCA 3MKFA 4BJPA 2PHYA 3C30A 2PBYA 4R3AA 5DKLA 3P7NA 1IFQA 3FYZA 1SKOB 3PHYA 3HJKA 3LEZA 1FIKA 2PYPA 2ZQ7A 2XD5A 1N9OA 3EQVA 4X53A 4I5SA 4OPZA 1W8YA 3NIAA 4WELA
chains in the Genus database with same CATH topology
1DP9A 1DP6A 2XA7M 2QKPA 5F69A 2V1BA 3UB7A 4P6ZM 4WEKA 3IS2B 1X0OA 4H6JB 1OTBA 4WN5A 3LIEA 3PBTA 5DJTA 3UE3A 4EXOA 1OTDA 2J3TD 2XRNA 2HV1A 3U2AA 1DRMA 2ZBBA 4CLCB 1TD5A 2O9CA 2L4RA 4PKYG 5KSHA 4Q0HA 1S4RA 2HJ9C 2R78A 4HH3A 1GSVA 1S1YA 2VX8A 3EGDC 3CLOA 3PYPA 1UWPX 2IA2A 5IU1A 3F1OB 1S66L 2KLIA 4XT2B 4XT2A 1LSVA 2FZ0A 3E0YA 1ZTUA 1ODVA 3V67A 4L9EA 1GSWA 4ZRRA 4EESA 3LIDA 5J4EA 3NOPC 4DN0A 5C5KA 2GX5A 3B47A 3OCLA 3S7NA 3RTYA 4NKPA 4E04A 4GW9A 4EEPA 4R38A 2J80A 2VKSA 5K5BA 1N9NA 2GZAA 2B18A 4KQOA 3RFBA 4GHIA 1OJ5A 3MQOA 3LIFA 4DMZA 2JKRI 5HDDA 4HH2A 3RH8B 1JNUA 3H7WB 3NOTC 3R7WB 4I3JA 4IHQA 1MC0A 1XJ3A 4K08A 3CWFA 3OLOA 1P97A 2W3EA 3OBFA 3NJAA 4BBUA 3KSGA 4GLQA 3LICA 2LB5A 3B42A 3NOUC 4DJ3A 3A0RA 3T4QA 2OAP1 4YOFA 2XROA 4L9FA 1YKDA 2VV8A 3ZYTA 3K2NA 2EA9A 1WA9A 3UB9A 2A24A 4JGQA 2VJWA 2W3DA 3NHQA 4ETZA 3JVUA 2D01A 4HOIA 1Y28A 3CUEC 1MKMA 2JKTM 3BY9A 4EEUA 1ZHHB 3F1OA 3MXQA 1LT0A 2ZOHA 1OT6A 2M1CA 3UB8A 3C2WA 1NWZA 3S7QA 2W1TB 4HQAA 3FPWA 4Z1WA 4NEED 3KSIA 1P0ZA 2W1TA 3HCYA 2VV6A 2YKHA 4L9GA 2B02A 4PHTA 2VLGA 3O5YA 4BMWA 1W63Q 1NLYA 4ARZA 4KUKA 5I5LA 4Q0IA 2DMWA 3UE6A 4WUJA 2O99A 2ZMVA 2HF6A 3TE8A 3R7WA 4NXGA 4O01A 3LR5A 4WF0A 4CQHA 3MF0A 5HD5A 3H82B 4UQIM 4MCWA 3OCNA 3MMHA 3VV4A 5DF9A 1D7EA 4LRXC 2J3WA 3PBOA 2INWA 3E4OA 4WELA 2VA0A 2XSSA 1YAXA 2QYBA 4JGPA 2L1MA 5F5YA 4CLCE 5DJUA 3LFVA 3LYXA 2A2LA 2PD7A 3MQQA 4WL9A 5FL3A 2KDKA 1T1CA 3EWKA 2P04A 3PBRA 3EGXC 3MFXA 3T4OA 4QPRA 3FG8A 4CLCA 3T4KA 1GSXA 1V9ZA 4MDZA 1S67L 1TS6A 2NUTC 2PYRA 1DP8A 3HJIA 5J3WA 3T4JA 1TS8A 4GS9B 5HWTA 2V1AA 2YKFA 3K3DA 4G3WA 5G4ZA 1P9WA 3H9WA 2NUPC 3EOIA 3ULFA 1F5MA 2VGLM 3LI8A 3PBNA 2XA7S 2JKTI 2QJ5A 1OPXA 3BW6A 2W3FA 3KO6A 3A0VA 4MN7A 2K31A 3KYQA 3VE3A 4EERA 2K2NA 5J7EA 5DFXA 1T1BA 2Y8HA 4IUKA 1YSQA 2OAQ1 3BJNA 4AFIA 2HGVA 3BY8A 4LLOB 2PR6A 3S7PA 5MC7A 4JGRA 4CLCD 3CI6A 2W3GA 4EQ1A 3P01A 4PKYA 2GNXA 2ZOIA 4HJ3A 5A8BA 2HJEA 2MJ6A 3B33A 2GJ3A 2I9VA 4ME4A 5AJGA 3F1NB 4B93A 5IT5A 1F9IA 3F1NA 3MQ0A 1OTAA 2M7UA 3PBQA 3W2ZA 4HP9A 5HL6A 4M4XA 2PR5A 4O0PA 3DBAA 3CUEA 2LB9A 4EU0A 4WLAA 4B9OA 4HIAA 4BBTA 4BBVA 5HSQA 1T19A 3UB6A 4GCZA 3A0SA 1XJ2A 3EQUA 2W3HA 3ICYA 5DFYA 3LIBA 3G6OA 3UMDA 2JKRM 4Y3IA 2O9BA 5AVEA 4HY8A 2PD8A 4OOMA 1W63M 2A24B 2P08A 3SW1A 2PT7A 3OOVA 2QWSA 2W27A 3VE4A 3E4PA 3MR0A 5HD3A 4I39A 3MJQA 5TBMA 4FOFA 3KX0X 2K7SA 2WKPA 2VGLS 3T4SA 1VB6A 1F98A 4MMNA 5L8MA 4Y2FA 1STZA 4HNBA 2QJ7A 2H28A 2V0UA 1N9LA 1XJ6A 4LRZE 5F68A 3EEAA 1NLZA 4HI4A 1VHMA 2KX6A 3BQAA 3T4LA 4NXBA 3BQ8A 5AVFA 4EUVA 5KIZA 3LR0A 3PXPA 2VEAA 2FH5A 3IBRA 4Y5FA 3F1PA 3VOLA 3PR6A 2VV7A 3F1PB 5EFWA 4YWZA 2OWHA 2WKRA 3TRCA 2D02A 3KSFA 2Y79A 1G28A 4I38A 4GHIB 3C38A 3FPVA 4IJGA 2QHKA 2KOIA 2PDRA 2W0NA 1H8MA 4R6LA 1UGUA 4UQIS 2WKQA 4I3IA 3LR4A 3KSHA 4NXFA 1NRJA 3TJZC 4EW7A 4II7A 4Q0JA 1XFNA 4RQ9A 1OTEA 4G3VA 2OOLA 3T50A 3OC2A 2OWJA 1G6OA 4WEJA 3BWLA 5HDSA 4ARZB 4KQDA 3LUQA 4KUOA 4OOLA 1P9RA 1MZUA 1OTIA 1OT9A 2EWVA 4LRYC 3R4KA 2J3TC 5TJJA 1XFQA 3D3OA 5HPFA 1LSXA 1TS0A 3H7WA 5TBMB 3LIAA 3D72A 1OJGA 1YSPA 1LSWA 4P6ZS 2P7JA 2O9AA 4YNRA 1T18A 3IBJA 2JN7A 3LI9A 3CAXA 1S1ZA 4LPZA 4MN5A 3KYZA 5DKKA 5HWWA 3IS2A 4H6JA 4R70A 4F3LA 2BASA 1TF1A 5HWVA 4F3LB 5HPIA 1H3QA 4UEYA 1T1AA 2L0WA 2Z6DA 3EEHA 4O8GA 4EETB 4HP4A 2O0YA 4NXEA 2ZMFA 1UWNX 2V0WA 4GS9A 3PBSA 3GDIA 2V9AA 1KOUA 4L0LA 3ZQ5A 1S4SA 1XJ4A 2CMNA 4I3AA 4PAUA 3E98A 1D06A 3K3CA 3T4TA 3TW8A 3CITA 2VZWA 2Z6CA 5HZHA 3C8CA 4G3KA 5CX7A 4JGOA 3E4QA 5F6AA 2G7UA 1V9YA 4GJ4A 3UMEA 1EW0A 1IOUA 2M7VA 3GECA 4FSFA 4IUHA 4HJ4A 5HDCA 2W1RA 4BJPA 3LR3A 2PHYA 3JVVA 3C30A 5DKLA 4R3AA 3FC7A 3P7NA 5LBRA 4CLCC 1TS7A 1IFQA 1BYWA 5IS1A 3PHYA 3HJKA 4DJ2A 5G4YA 3H82A 4BWIA 1LL8A 2PYPA 4MN6A 4ETXA 2EWWA 1N9OA 4HHDA 4I5SA 3S7OA 3EQVA 2JHEA 4HJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP9 A;  1DP6 A;  3F1N B;  3BY9 A;  4EEU A;  2QKP A;  3BWL A;  3F1O A;  2V1B A;  3MXQ A;  5F69 A;  4KQD A;  1LT0 A;  5HDS A;  3IS2 B;  1F9I A;  1X0O A;  2ZOH A;  1OT6 A;  3F1N A;  2M1C A;  3LUQ A;  1OTB A;  4H6J B;  3C2W A;  1MZU A;  1OTI A;  1OT9 A;  3LIE A;  4LRY C;  4WN5 A;  5DJT A;  1NWZ A;  3UB8 A;  4EW7 A;  4EXO A;  1OTD A;  4HQA A;  1OTA A;  1XFQ A;  4HP9 A;  1P0Z A;  2VV6 A;  4M4X A;  1LSX A;  1TS0 A;  2HV1 A;  2PR5 A;  2YKH A;  3H7W A;  4L9G A;  1DRM A;  5TBM B;  2B02 A;  2ZBB A;  2VLG A;  3LIA A;  3D72 A;  4WLA A;  2L4R A;  4B9O A;  4HIA A;  4BBT A;  4PKY G;  1OJG A;  4BBV A;  5HSQ A;  1T19 A;  3UB6 A;  4GCZ A;  1S4R A;  1LSW A;  3A0S A;  1XJ2 A;  2R78 A;  2P7J A;  4HH3 A;  4KUK A;  1GSV A;  1S1Y A;  1T18 A;  3ICY A;  5I5L A;  1Y28 A;  3LIB A;  3G6O A;  2JN7 A;  3LI9 A;  3UMD A;  3UB7 A;  3CAX A;  3CLO A;  3PYP A;  1UWP X;  5HWW A;  1S1Z A;  4LPZ A;  3F1O B;  4MN5 A;  1S66 L;  5DKK A;  5IU1 A;  4WUJ A;  4XT2 B;  3IS2 A;  3UE6 A;  5AVE A;  4H6J A;  4HY8 A;  4NXG A;  4R70 A;  1LSV A;  4WF0 A;  4XT2 A;  4F3L A;  2BAS A;  2PD8 A;  2A24 B;  1ODV A;  3H82 B;  5HD5 A;  5HWV A;  3SW1 A;  4F3L B;  4L9E A;  1GSW A;  2QWS A;  4EES A;  2W27 A;  3LID A;  3E4P A;  3MR0 A;  5HD3 A;  3VE4 A;  5J4E A;  3NOP C;  4I39 A;  3MJQ A;  1T1A A;  5TBM A;  1D7E A;  3KX0 X;  2L0W A;  2K7S A;  2Z6D A;  2WKP A;  3EEH A;  4LRX C;  1VB6 A;  1F98 A;  2INW A;  3E4O A;  4HP4 A;  4NXE A;  4EET B;  3RTY A;  4E04 A;  1UWN X;  2V0W A;  4GW9 A;  4GS9 A;  2J80 A;  4R38 A;  4EEP A;  4HNB A;  3GDI A;  2QJ7 A;  2H28 A;  2V0U A;  1N9L A;  1XJ6 A;  2V9A A;  4JGP A;  1N9N A;  1KOU A;  2L1M A;  4LRZ E;  3ZQ5 A;  1S4S A;  1XJ4 A;  2CMN A;  5F5Y A;  5F68 A;  5DJU A;  4I3A A;  3LYX A;  3MQQ A;  2PD7 A;  4HI4 A;  4WL9 A;  4GHI A;  1OJ5 A;  2KX6 A;  3LIF A;  3MQO A;  4KUO A;  2KDK A;  4NXB A;  4HH2 A;  5HDD A;  1JNU A;  1D06 A;  1T1C A;  3EWK A;  3H7W B;  3K3C A;  3NOT C;  5AVF A;  3MFX A;  5KIZ A;  3FG8 A;  4I3J A;  2VEA A;  3IBR A;  2Z6C A;  1GSX A;  1XJ3 A;  1V9Z A;  4K08 A;  1S67 L;  3F1P A;  1TS6 A;  3VOL A;  3CWF A;  2PYR A;  3OLO A;  4HOI A;  1DP8 A;  3C8C A;  2VV7 A;  5HZH A;  3F1P B;  3HJI A;  5J3W A;  5EFW A;  4JGO A;  3E4Q A;  1TS8 A;  1P97 A;  4GS9 B;  5F6A A;  2V1A A;  4YWZ A;  5HWT A;  1V9Y A;  3UME A;  2YKF A;  3K3D A;  2OWH A;  1EW0 A;  4HJ6 A;  3NJA A;  5G4Z A;  2WKR A;  3H9W A;  4BBU A;  3GEC A;  3ULF A;  2D02 A;  3LI8 A;  4HJ4 A;  3LIC A;  5HDC A;  1G28 A;  3NOU C;  4GHI B;  4I38 A;  3RH8 B;  2PHY A;  2QHK A;  2QJ5 A;  2PDR A;  5DKL A;  4R3A A;  2W0N A;  4DJ3 A;  3A0R A;  3A0V A;  3FC7 A;  3P7N A;  4R6L A;  1UGU A;  3VE3 A;  4EER A;  2WKQ A;  4I3I A;  4L9F A;  5J7E A;  1TS7 A;  2VV8 A;  1BYW A;  1T1B A;  4NXF A;  5IS1 A;  2EA9 A;  1WA9 A;  4LLO B;  3BY8 A;  3PHY A;  3UB9 A;  2A24 A;  2PR6 A;  3HJK A;  3H82 A;  4JGQ A;  4JGR A;  1XFN A;  5G4Y A;  4DJ2 A;  1LL8 A;  2PYP A;  4MN6 A;  4RQ9 A;  1OTE A;  3T50 A;  2OOL A;  4PKY A;  4EQ1 A;  2ZOI A;  4HJ3 A;  1N9O A;  5A8B A;  2OWJ A;  3NHQ A;  4HHD A;  4I5S A;  2D01 A;  3B33 A;  2GJ3 A;  2JHE A;  2I9V A; 
#chains in the Genus database with same CATH topology
 1DP9 A;  2QMI A;  2Y59 A;  4P6Z M;  4WEK A;  4H6J B;  5F83 A;  4WN5 A;  3PBT A;  5DJT A;  4X1M A;  1OTD A;  2J3T D;  3IH9 A;  5EVI D;  3IHB A;  3S4X A;  3IHA A;  4CLC B;  1YMX A;  5HL1 A;  2Y2Q A;  1TD5 A;  2O9C A;  3HLF A;  1CEG A;  4OQI A;  3IWI A;  5CGX A;  3C4P A;  1S1Y A;  2VX8 A;  3EGD C;  3F1O B;  2KLI A;  1IYQ A;  2FZ0 A;  4QD4 A;  1L2S A;  3V67 A;  1SCW A;  4EES A;  3HUO A;  1ESU A;  4R23 A;  4NET A;  1CEF A;  3B47 A;  1H5X A;  4OQG A;  4NKP A;  5GL9 A;  4EEP A;  2HDS A;  5K5B A;  3VFF A;  1BTL A;  4UHU A;  2ZL1 B;  3RFB A;  4GHI A;  3BYD A;  3SS5 A;  4Y13 A;  1SKO A;  5CRF A;  3R7W B;  3TSG A;  3MZE A;  4I3J A;  4IHQ A;  3CWF A;  2XGN A;  4OON A;  4S2M A;  5CED A;  3OBF A;  5EV0 A;  3NJA A;  3N4I A;  5HAR A;  1MXO A;  4BBU A;  3FKV A;  1K54 C;  3S1Y A;  4DJ3 A;  3HLD A;  2WAD A;  1K38 A;  3CJM A;  2OAP 1;  2EA9 A;  4GDN A;  2H10 A;  2A24 A;  4QB8 A;  2VJW A;  2W3D A;  4ETZ A;  3JVU A;  5M1A A;  3G32 A;  4XUX A;  3LEQ A;  3CUE C;  1MKM A;  3BY9 A;  1ZHH B;  3F1O A;  2CC1 A;  4X56 A;  2ZOH A;  3GRJ A;  3IXD A;  2A3U A;  4HBT A;  5I94 A;  4HQA A;  4NEE D;  3BLM A;  1P0Z A;  5CEB A;  2ZM0 A;  2VGK A;  1XA1 A;  1MWU A;  2B02 A;  3V5M A;  2Y4A A;  1W63 Q;  3JPU A;  4KUK A;  4Q0I A;  1GHP A;  1N9B A;  3WS1 A;  3R7W A;  3LO7 A;  3LR5 A;  3MF0 A;  2P74 A;  1MWS A;  4MCW A;  3GV9 A;  3MMH A;  4LV2 A;  1ACF A;  4X6T A;  2WKI A;  2J3W A;  3PBO A;  3E4O A;  3PAG A;  1NJ4 A;  2QYB A;  1CJF A;  2L1M A;  5BOH A;  5DJU A;  2B5R A;  4H8R A;  4Y17 A;  4OQ0 A;  3UPN A;  4GD8 A;  5FL3 A;  2KDK A;  1T1C A;  3PBR A;  3MFX A;  4M3K A;  4QPR A;  3FG8 A;  3A3F A;  1V9Z A;  4P85 A;  1S67 L;  4MNR A;  3WRT A;  1IYS A;  3BRM A;  1TS8 A;  1VQQ A;  2YKF A;  2BTF P;  2VGL M;  3PBN A;  1L0D A;  3BW6 A;  3MXS A;  3VE3 A;  4EER A;  2V8C A;  4OLD A;  3BJN A;  1PI4 A;  4E6X A;  2H0T A;  1AXB A;  4JGR A;  4CLC D;  4PKY A;  4R3J A;  2GNX A;  4JXW A;  4HJ3 A;  4JXV A;  5HAQ A;  4S2J A;  4BQM A;  2I9V A;  1K54 A;  1Y54 A;  4ME4 A;  5AJG A;  3VSK A;  3IX4 A;  1XX2 A;  2J8Y A;  4B93 A;  4EUZ A;  1F2K A;  1F9I A;  5CHM A;  4R3B A;  5JYO A;  2EX9 A;  5CGW A;  3MQ0 A;  1DJC A;  1G5U A;  3W2Z A;  3IT9 A;  5FI2 A;  4ZBE A;  4E3K A;  5FDH A;  4IED A;  1ONG A;  3O88 A;  4BBT A;  1ERM A;  5L09 A;  4GCZ A;  4OH0 A;  4GOG A;  3Q7Z A;  3EQU A;  4FCF A;  1BSG A;  2Z2L B;  3RXW A;  3UMD A;  3RJU A;  5CXW A;  2R9W A;  4JPM A;  2B95 A;  1W63 M;  3SW1 A;  2PT7 A;  2W27 A;  5TFQ A;  5HD3 A;  4FH4 A;  5TBM A;  3G34 A;  2VGL S;  3T4S A;  4S2K A;  3Q81 A;  1STZ A;  4HNB A;  2H28 A;  1XJ6 A;  3UO9 A;  4DDY A;  1VHM A;  1ONH A;  3ZNT A;  3BQ8 A;  5FQ9 A;  1CF0 A;  3IX8 A;  3G35 A;  4GB7 A;  2VEA A;  2X02 A;  1K56 A;  3ZNY A;  3PR6 A;  4KG2 A;  3A3J A;  3F1P B;  3G30 A;  1MPL A;  2OWH A;  3DAV A;  1I2W A;  1TDL A;  3A3D A;  1XGJ A;  3KSF A;  4IJG A;  2PDR A;  2Y2O A;  4DF6 A;  4R6L A;  3B3X A;  5CHJ A;  2XEP A;  3KSH A;  4NXF A;  4EW7 A;  4RQ9 A;  4G3V A;  4FUW A;  2EXB A;  2IWC A;  5HDS A;  3OZH A;  4WZ5 C;  1MZU A;  1OTI A;  1OT9 A;  2EWV A;  4WMC A;  2HP5 A;  2ZC3 B;  1GCE A;  3ISG A;  3R4K A;  3U4L P;  4WM9 A;  1XFQ A;  1M6K A;  1LSX A;  5EVI C;  4E3O A;  2WGI A;  5TBM B;  5DTT A;  3LIA A;  2V2F F;  5FI7 A;  3DTE A;  4P6Z S;  4YNR A;  4PPR A;  3TG9 A;  2JN7 A;  3CAX A;  1TDG A;  1NZO A;  4WZ5 A;  3IXG A;  4F3L A;  5GLB A;  2HP6 A;  1E4D A;  1IEM A;  5EOE A;  3SH7 A;  4Q8I A;  2L0W A;  2Z6D A;  3IH8 A;  4HP4 A;  2ZMF A;  4GS9 A;  2V9A A;  1FCO A;  2ZQ9 A;  3SH9 A;  3HLB A;  1YLZ A;  3M2K A;  4QWO A;  5KMW A;  1GA9 A;  1D06 A;  1XGI A;  1PWG A;  4S2I A;  1ERQ A;  1SDE A;  1FSW A;  3T4T A;  3TW8 A;  3CIT A;  4X55 A;  5HZH A;  3C8C A;  1JVJ A;  4JGO A;  4PM9 A;  5FAT A;  5DF8 A;  4MBK A;  5F6A A;  2G7U A;  1IOU A;  2M7V A;  2ZM8 A;  3FKW A;  4FSF A;  4IUH A;  3UY6 A;  2ZC7 A;  2ZC6 B;  3JVV A;  3FC7 A;  1PWC A;  1WYB A;  2ZL1 A;  4E3N A;  3CPT B;  5AQ9 A;  5G4Y A;  1LL8 A;  4MN6 A;  5A90 A;  4ETX A;  4HHD A;  3S7O A;  4R1G A;  3LGO A;  2JHE A;  3V39 A;  4IVK A;  4KEN B;  5F69 A;  3UB7 A;  4JBF A;  3IS2 B;  1OTB A;  4OVD A;  4PM6 A;  3ZDJ A;  4EXO A;  3KYE A;  2ZBB A;  4HBU A;  2L4R A;  3GSG A;  4PKY G;  1KE3 A;  1ZC2 A;  1K4E A;  1S4R A;  3A3E A;  5AQ7 A;  2E8J A;  2HJ9 C;  4HH3 A;  1QMF A;  5FAQ A;  4EWF A;  1UWP X;  3I7J A;  3WWX A;  4DKI A;  2OSU A;  5IU1 A;  4HEF A;  1Z09 A;  1LSV A;  1H8Y A;  3E0Y A;  4UA7 A;  1G6A A;  3N8S A;  1ODV A;  4KZB A;  5EVI B;  4ZRR A;  3NY4 A;  2DRW A;  3OCL A;  2WAE A;  2J80 A;  2VKS A;  1NY0 A;  5A92 A;  3P09 A;  1MWT A;  2B18 A;  5F1G A;  2QPN A;  3MQO A;  1C3B A;  5HDD A;  1JNU A;  3NOT C;  3T12 B;  4K08 A;  4LCL A;  3MZF A;  1K4F A;  3ITB A;  5HAP A;  2XK1 A;  4UAA A;  1D1J A;  5FDS A;  3LIC A;  3B42 A;  2R9X A;  4JF5 A;  4GKU A;  4YOF A;  3OPL A;  3K2N A;  2XR0 A;  4QHC A;  4BD1 A;  1WA9 A;  1K56 D;  3NHQ A;  2D01 A;  4Y0O A;  2FFY A;  1GA0 A;  2JKT M;  4EEU A;  1LT0 A;  1PYY A;  4U0X A;  2M1C A;  2WGV A;  3QP6 A;  3UNW A;  4KZ6 A;  4BL2 A;  2W1T B;  1SKF A;  5E2E A;  4P6B A;  4PHT A;  2VLG A;  3V3R A;  1FCM A;  1K6S A;  3O5Y A;  4BMW A;  1NLY A;  2Y55 A;  5I5L A;  2XFS A;  2DMW A;  3QNC A;  3UE6 A;  4WUJ A;  2ZMV A;  4GN2 A;  4O01 A;  4WF0 A;  2RCX A;  2WUQ A;  3H82 B;  5DTK A;  3MFD A;  1BUL A;  1BLC A;  1VET B;  2JBF A;  1YAX A;  4LV1 A;  1FOF A;  2Y91 A;  3LFV A;  3SH8 A;  1K55 A;  3G31 A;  3T4O A;  3M6B A;  1YMS A;  5M18 A;  4CLC A;  3OPR A;  1AWI A;  3T4K A;  3HUN A;  1GSX A;  4MDZ A;  2OLU A;  1CI8 A;  1N4O A;  1DP8 A;  5J3W A;  1CK3 A;  4GS9 B;  5HWT A;  2V1A A;  3VFH A;  3K3D A;  5G4Z A;  1P9W A;  4WZ4 A;  3EOI A;  1F5M A;  1Z6F A;  4QY5 A;  3FWL A;  3UPP A;  4E3J A;  3A0V A;  4RA7 A;  2K2N A;  3ZG5 A;  1T1B A;  2OAQ 1;  1HTZ A;  4P0M A;  4LLO B;  2HGV A;  4AFI A;  2PR6 A;  3S7P A;  5MC7 A;  3CI6 A;  4U3T A;  2E8I A;  1KGF A;  4Y0T A;  2HJE A;  4DXB A;  1PNE A;  1XKZ A;  1ERO A;  1K6R A;  4R0Q A;  4GDB A;  4JLF A;  3F1N A;  1CI9 A;  3CPT A;  3N8L A;  4HP9 A;  2ZLY A;  3MKE A;  1Q2P A;  4O0P A;  4UA9 A;  4EU0 A;  2WK0 A;  4HIA A;  4BBV A;  5HSQ A;  4OLG A;  3A0S A;  4O7D A;  3BEC A;  1PW8 A;  2W3H A;  3ICY A;  5DFY A;  3LIB A;  3G6O A;  1TEM A;  1S6R A;  2JKR M;  3G4P A;  4HY8 A;  3DW0 A;  3UDI A;  2PD8 A;  2A24 B;  3PTE A;  3OOV A;  4BD0 A;  4PM5 A;  4S2N A;  3W8K A;  4I39 A;  2V1Z A;  4FOF A;  2K7S A;  5E2G A;  1VB6 A;  2EX2 A;  3BFG A;  5L8M A;  3D9Y A;  1N9L A;  2P9V A;  5F68 A;  4B4Z A;  3DWZ A;  1JWZ A;  5DF7 A;  1NLZ A;  3BEB A;  2KX6 A;  3BQA A;  1XP4 A;  2BLS A;  5AVF A;  4EUV A;  3LR0 A;  3NCK A;  3UB5 P;  3GVB A;  3E2K A;  3VOL A;  4DDS A;  4YWZ A;  2XLN A;  2WKR A;  2Y79 A;  3C38 A;  2WGW B;  2KOI A;  1H8M A;  2EFU A;  4B4X A;  3O87 A;  4NG2 A;  3LR4 A;  1NRJ A;  3OPH A;  3WRZ A;  3UDF A;  4II7 A;  1NXY A;  4N9L A;  1KVL A;  4X69 A;  1DJB A;  1OTE A;  5E2F A;  3HUM A;  4IBX A;  4BEN A;  4PM8 A;  4ARZ B;  5EOO A;  3VP1 A;  4KQD A;  1K57 A;  1P9R A;  4LRY C;  2J3T C;  3NEC A;  5FQM A;  4R4R A;  2ZC4 B;  3D3O A;  4WYY A;  3H7W A;  1E25 A;  1G68 A;  3ZG8 B;  2JCH A;  1OJG A;  1XXM A;  1YSP A;  1HVB A;  2P9V B;  1EWZ A;  2P7J A;  2O9A A;  3IXB A;  3LI9 A;  2VK3 A;  2DNS A;  2ZMA A;  5DKK A;  5HWW A;  3KYZ A;  2XDM A;  3IS2 A;  4JXS A;  5HFO A;  1IKG A;  1PW1 A;  2WKH A;  1H3Q A;  3Q82 A;  1T1A A;  4N9K A;  1ES4 A;  2Q9M A;  4O8G A;  1UWN X;  1FCN A;  2JKF A;  1YT4 A;  3ZQ5 A;  1XJ4 A;  2CMN A;  1BLH A;  1ES5 A;  4PAU A;  3P98 A;  3E98 A;  5FEF A;  3HLC A;  4KZ9 A;  4S2N C;  5J8X A;  1IYP A;  3TOI A;  1KVM A;  1EW0 A;  1DY6 A;  3GEC A;  4HJ4 A;  1LI0 A;  3LR3 A;  5LBR A;  3HLG A;  1BYW A;  4LFU A;  5IS1 A;  2HDQ A;  1ZKJ A;  5EE8 A;  5F82 A;  4DJ2 A;  4BWI A;  3N6I A;  4RX3 A;  3MSH A;  2UV0 E;  4LV0 A;  1VEU B;  4HJ6 A;  3QP1 A;  2XA7 M;  1LHY A;  3LIE A;  3BFF A;  1IEL A;  5EVE A;  5FQI A;  5EM0 A;  3IQA A;  4FTX A;  4D60 A;  3UPO A;  2XRN A;  5GHZ A;  1GHI A;  2Y2P A;  1DRM A;  1JWP A;  3GMW A;  3MZD A;  3IF6 B;  1GSV A;  3PAE A;  1K55 C;  5TGF A;  2A49 A;  3ZCZ A;  2H0Y A;  2H5S A;  3JYI A;  4XT2 A;  1YQS A;  1DJA A;  1ZTU A;  4DRT A;  4L9E A;  1BLS A;  2RL3 A;  4GNU A;  5C5K A;  2GX5 A;  3HRE A;  3S7N A;  3MXR A;  4F94 A;  2FFF B;  4GW9 A;  1PZP A;  4JXG A;  4OP8 A;  2GZA A;  3BFC A;  1A0K A;  4LGW A;  3SOI A;  3GR2 A;  3LIF A;  3RH8 B;  3WS2 A;  5CGS A;  1I2S A;  1BZA A;  1XJ3 A;  2PBD P;  1O7E A;  3UE1 A;  3C5A A;  4ZDX A;  1LL5 A;  1HZO A;  1TVF A;  1K0K A;  3KSG A;  2LB5 A;  3NOU C;  2HPB A;  3A0R A;  3T4Q A;  1YKD A;  2VV8 A;  3ZYT A;  4NK3 A;  5DTS A;  4QY6 A;  2WZX A;  3UB9 A;  4JGQ A;  4EQI A;  2GDN A;  4LEN A;  5FAP A;  3NBL A;  4HOI A;  1Y28 A;  3LY3 A;  2ZQC A;  4U0T A;  3UB8 A;  1LI9 A;  1NWZ A;  3BFE A;  3FPW A;  4Z1W A;  2WAF A;  3KSI A;  2VV6 A;  4E3M A;  2YKH A;  5E2H A;  4L9G A;  1FQG A;  5EEC A;  2ZM2 A;  1MKI A;  3T1X A;  4DE1 A;  2VGJ A;  4ARZ A;  3IX3 A;  1L0F A;  2BG1 A;  2UWX A;  5AQA A;  2HF6 A;  3TE8 A;  4NXG A;  3CZD A;  4N92 A;  4CQH A;  5HD5 A;  2JKG A;  3ZG7 B;  4JKT A;  4UQI M;  4KG5 A;  3BLS A;  2G2W A;  3VV4 A;  4MBH A;  1KE0 A;  1KDS A;  5DF9 A;  1D7E A;  5E43 A;  3HLW A;  4XUZ A;  4RVA A;  1XPB A;  5F5Y A;  5CHU A;  4CLC E;  3LYX A;  2A2L A;  3MQQ A;  4WL9 A;  1KGE A;  4KG6 A;  3LCE A;  5FQJ A;  3EWK A;  3EGX C;  2WZZ A;  5DVA A;  1OME A;  3T1R A;  2Y2J A;  5U47 A;  1TS6 A;  3NUL A;  2I72 A;  3H9W A;  2NUP C;  3ULF A;  1PI5 A;  4QU3 A;  2JKT I;  3KO6 A;  4FH2 A;  2K31 A;  3KYQ A;  4X1L A;  5DFX A;  3BY8 A;  3M6H A;  4Y7P A;  3QHY A;  1Y4O A;  4EQ1 A;  2Q0O A;  2MJ6 A;  1W7F A;  3ZGA B;  2GJ3 A;  3F1N B;  3V50 A;  1K25 A;  4OPR A;  3QP2 A;  5IT5 A;  3IXH A;  3VP3 A;  2WGW A;  2M7U A;  4ZTK A;  3M2J A;  5HL6 A;  3C4O A;  4C3Q A;  3V3S A;  3QNB A;  4WLA A;  1T19 A;  3D4F A;  2X71 A;  2JE5 A;  2OV5 A;  4EBP A;  4KQR A;  1FR1 A;  5AVE A;  4RX2 A;  1HLU P;  4OQH A;  2P08 A;  1YLY A;  2QWS A;  3OPP A;  4PM7 A;  3IF6 A;  3E4P A;  5G18 A;  3KX0 X;  2WKP A;  1F98 A;  4MMN A;  3HLE A;  4DE3 A;  4Y15 A;  4LRZ E;  2ACG A;  2G2U A;  4KZ7 A;  3T4L A;  1VM1 A;  3VOY A;  5FQQ A;  3IF5 A;  3UE0 A;  3F1P A;  3Q1F A;  2VV7 A;  3IF6 C;  1MWR A;  5GHY A;  1WYC A;  2PU2 A;  3QP8 A;  4K0W A;  3VP4 A;  1G28 A;  3FPV A;  2QHK A;  3UDX A;  1SHV A;  1UGU A;  2HDU A;  3NDG A;  2ZQD A;  2WKQ A;  4I3I A;  4UQI S;  1H0M A;  2ZD8 A;  3Q07 A;  1PIO A;  4MLL A;  3T50 A;  3SZT A;  2OOL A;  3OC2 A;  2OWJ A;  1JTG A;  2XQZ A;  3Q7V B;  2HP9 A;  1G6O A;  4YFM A;  1PRQ A;  4KUO A;  1J3W A;  4ZJ3 A;  2XD1 A;  1TS0 A;  3NI9 A;  2EXA A;  3ZVT A;  1XA7 A;  1LSW A;  2IWD A;  1T18 A;  2AVX A;  2J7V A;  4LV3 A;  2C5W B;  1SDN A;  1E3U D;  2Y2I A;  4MN5 A;  4XXR A;  1YLT A;  3FZC A;  1LLB A;  2BAS A;  5HWV A;  4F3L B;  5HPI A;  1ALQ A;  3O86 A;  4UEY A;  4E3I A;  3EEH A;  2O0Y A;  3ZFZ A;  3ITA A;  1L0E A;  1BLP A;  2V0W A;  3GDI A;  4ZJ2 A;  2DCF A;  4IVI A;  4L0L A;  1S4S A;  4ZAM A;  1MBL A;  3AGF A;  4Y0U A;  2JC7 A;  1ES3 A;  1FSY A;  3C7V A;  4G3K A;  5CX7 A;  1M40 A;  5FSR A;  1V9Y A;  4GJ4 A;  3UME A;  1CQA A;  2XH9 A;  2EFX A;  2W1R A;  5A93 A;  3BFD A;  5FAO A;  5FQK A;  4CLC C;  1TS7 A;  1RGZ A;  1W79 A;  1YLP A;  3H82 A;  4KZA A;  2EWW A;  4X25 A;  4WBG A;  2V20 A;  1VEU A;  1IYO A;  1YPR A;  1DP6 A;  3IWQ A;  1JTD A;  1PWD A;  1PZO A;  1S0W A;  2QKP A;  2V1B A;  1X0O A;  3DTI A;  5CEC A;  3UE3 A;  4BL3 A;  1PFL A;  4KZ3 A;  2HV1 A;  4OPY A;  3U2A A;  2Q9N A;  3SS3 A;  1ES2 A;  5KSH A;  1I5Q A;  4Q0H A;  2R78 A;  2PAV P;  1QME A;  1ZG4 A;  3CLO A;  3PYP A;  1H8Z A;  2IA2 A;  4E6W A;  1S66 L;  4XT2 B;  5EVI A;  2ZQA A;  3RXX A;  4A5R A;  1GSW A;  2X01 A;  3LID A;  2OLV A;  5J4E A;  3NOP C;  4DN0 A;  3T1S A;  5FEG A;  2HDR A;  4OPQ A;  3RTY A;  4E04 A;  4MEZ A;  4UA6 A;  4R38 A;  5FI6 A;  1EI5 A;  1N9N A;  5EUA A;  3E2L A;  4DXC A;  4KQO A;  1OJ5 A;  4DMZ A;  2JKR I;  5GLD A;  4HH2 A;  3H7W B;  2Y2K A;  1MC0 A;  3OLO A;  3A3I A;  3L7H A;  1LL9 A;  1P97 A;  4QJG A;  4MBF A;  2W3E A;  4LCM A;  2QZ6 A;  2Y2G A;  3G2Y A;  4E3L A;  1HD8 A;  4GLQ A;  3SS4 A;  4OOY A;  2Z2M B;  3DWK A;  4JF4 A;  2Y2H A;  2XRO A;  4L9F A;  3N7W A;  1IKI A;  3ZG9 B;  1NZU A;  3CMZ A;  5HAI A;  1RCJ A;  3WS0 A;  3C7U A;  3G2Z A;  3HVF A;  2J9O A;  3CG5 A;  4WMC D;  3MXQ A;  1BT5 A;  1L0G A;  1OT6 A;  5IHV A;  3C2W A;  1KGG A;  3S7Q A;  2ZJ9 A;  2Y2M A;  5D3O A;  2W1T A;  4KZ5 A;  3HCY A;  4EV4 A;  1ESI A;  4HES A;  1FR6 A;  5JYP A;  2O99 A;  2ZQ8 A;  4JF6 A;  3W4Q A;  1Q2Q A;  3OCN A;  2J9P A;  1VET A;  1BUE A;  1YM1 A;  4LRX C;  2INW A;  4OP5 A;  2ZC5 B;  2VA0 A;  5HW3 A;  2XSS A;  4JGP A;  4RYE A;  1YLW A;  3S22 A;  2PD7 A;  2P04 A;  5L10 A;  2NUT C;  2PYR A;  3HJI A;  3T4J A;  3ZVW A;  4S2P A;  4G3W A;  3VP2 A;  3LI8 A;  3NC8 A;  2XA7 S;  3DTK A;  4Z9Q A;  2QJ5 A;  1OPX A;  4KQQ A;  2IWB A;  2W3F A;  2C6W B;  4MN7 A;  5J7E A;  3VSL A;  4ZJ1 A;  1YLJ A;  4C75 A;  2Y8H A;  4IUK A;  1YSQ A;  1WE4 A;  4K91 A;  5FA7 A;  5CER A;  1ZG6 A;  2W3G A;  3P01 A;  5KZH A;  2ZOI A;  3W4P A;  5A8B A;  5FAS A;  3B33 A;  4FD8 A;  4S2L A;  1NRF A;  2EX8 A;  3AGE A;  2Y2N A;  1OTA A;  3PBQ A;  3VMA A;  4M4X A;  5GLC A;  4ESP A;  2PR5 A;  3DBA A;  4KZ4 A;  3CUE A;  4CPK A;  2LB9 A;  3HBR A;  1NYY A;  3CHW P;  4DE0 A;  4B9O A;  3UB6 A;  3N8R A;  1XJ2 A;  3Q7V A;  4N1H A;  3UN7 A;  4Y3I A;  2O9B A;  3QP5 A;  3W4O A;  4OOM A;  5L07 A;  3VE4 A;  3MR0 A;  3MJQ A;  1J9M A;  2EX6 A;  4X68 A;  4Y2F A;  2QJ7 A;  2V0U A;  2XF3 A;  3MBZ A;  4DE2 A;  4N1X A;  1GHM A;  3EEA A;  1KDW A;  4HI4 A;  3MS6 A;  5EM1 A;  5KSC A;  4NXB A;  4C6Y A;  5KIZ A;  3PXP A;  5HX9 A;  3FV7 A;  2FH5 A;  3IBR A;  4Y5F A;  4EBL A;  3WS5 A;  3ZG0 A;  5EFW A;  5GHX A;  2PU4 A;  3AGD A;  5A91 A;  3WS4 A;  3TRC A;  3L9K A;  2D02 A;  1K57 C;  3VP0 A;  3IWO A;  2PRF A;  4GHI B;  3GTC A;  4I38 A;  2W0N A;  4B88 A;  1O07 A;  4IBR A;  5M19 A;  4GZB A;  5L2F A;  3TJZ C;  4Q0J A;  1FIL A;  5AQB A;  1XFN A;  4GD6 A;  1L3L A;  4K0X A;  3T1Q B;  5CTM A;  5EVL A;  4D2O A;  4WEJ A;  3BWL A;  3LUQ A;  1RP5 A;  2XFT A;  4OOL A;  5EPH A;  1E3U A;  5GLA A;  2V8F A;  4YIN A;  5TR7 A;  5TJJ A;  5CTN A;  5HPF A;  1NYM A;  3LY4 A;  1KE4 A;  3QP4 A;  3D72 A;  1W5D A;  4P87 A;  3IBJ A;  3GQZ A;  4S2O A;  3NDE A;  3O3V A;  1U60 A;  3ZHH A;  1S1Z A;  4LPZ A;  4H6J A;  4R70 A;  4PMA A;  1TF1 A;  4CJN A;  2Y2L A;  1MY8 A;  4EET B;  4NXE A;  1JWV A;  4R4S A;  4KZ8 A;  3PBS A;  1SZV A;  1KOU A;  2WKE A;  2HZ5 A;  3DTM A;  4I3A A;  1RGY A;  4ID4 A;  3K3C A;  2WYX A;  2VZW A;  2Z6C A;  1W8Q A;  3VOZ A;  4EBN A;  3E4Q A;  4BLM A;  5F1F A;  4OKP A;  3HL9 A;  3BM6 A;  5HDC A;  3MKF A;  4BJP A;  2PHY A;  3C30 A;  2PBY A;  4R3A A;  5DKL A;  3P7N A;  1IFQ A;  3FYZ A;  1SKO B;  3PHY A;  3HJK A;  3LEZ A;  1FIK A;  2PYP A;  2ZQ7 A;  2XD5 A;  1N9O A;  3EQV A;  4X53 A;  4I5S A;  4OPZ A;  1W8Y A;  3NIA A;  4WEL A; 
#chains in the Genus database with same CATH homology
 1DP9 A;  1DP6 A;  2XA7 M;  2QKP A;  5F69 A;  2V1B A;  3UB7 A;  4P6Z M;  4WEK A;  3IS2 B;  1X0O A;  4H6J B;  1OTB A;  4WN5 A;  3LIE A;  3PBT A;  5DJT A;  3UE3 A;  4EXO A;  1OTD A;  2J3T D;  2XRN A;  2HV1 A;  3U2A A;  1DRM A;  2ZBB A;  4CLC B;  1TD5 A;  2O9C A;  2L4R A;  4PKY G;  5KSH A;  4Q0H A;  1S4R A;  2HJ9 C;  2R78 A;  4HH3 A;  1GSV A;  1S1Y A;  2VX8 A;  3EGD C;  3CLO A;  3PYP A;  1UWP X;  2IA2 A;  5IU1 A;  3F1O B;  1S66 L;  2KLI A;  4XT2 B;  4XT2 A;  1LSV A;  2FZ0 A;  3E0Y A;  1ZTU A;  1ODV A;  3V67 A;  4L9E A;  1GSW A;  4ZRR A;  4EES A;  3LID A;  5J4E A;  3NOP C;  4DN0 A;  5C5K A;  2GX5 A;  3B47 A;  3OCL A;  3S7N A;  3RTY A;  4NKP A;  4E04 A;  4GW9 A;  4EEP A;  4R38 A;  2J80 A;  2VKS A;  5K5B A;  1N9N A;  2GZA A;  2B18 A;  4KQO A;  3RFB A;  4GHI A;  1OJ5 A;  3MQO A;  3LIF A;  4DMZ A;  2JKR I;  5HDD A;  4HH2 A;  3RH8 B;  1JNU A;  3H7W B;  3NOT C;  3R7W B;  4I3J A;  4IHQ A;  1MC0 A;  1XJ3 A;  4K08 A;  3CWF A;  3OLO A;  1P97 A;  2W3E A;  3OBF A;  3NJA A;  4BBU A;  3KSG A;  4GLQ A;  3LIC A;  2LB5 A;  3B42 A;  3NOU C;  4DJ3 A;  3A0R A;  3T4Q A;  2OAP 1;  4YOF A;  2XRO A;  4L9F A;  1YKD A;  2VV8 A;  3ZYT A;  3K2N A;  2EA9 A;  1WA9 A;  3UB9 A;  2A24 A;  4JGQ A;  2VJW A;  2W3D A;  3NHQ A;  4ETZ A;  3JVU A;  2D01 A;  4HOI A;  1Y28 A;  3CUE C;  1MKM A;  2JKT M;  3BY9 A;  4EEU A;  1ZHH B;  3F1O A;  3MXQ A;  1LT0 A;  2ZOH A;  1OT6 A;  2M1C A;  3UB8 A;  3C2W A;  1NWZ A;  3S7Q A;  2W1T B;  4HQA A;  3FPW A;  4Z1W A;  4NEE D;  3KSI A;  1P0Z A;  2W1T A;  3HCY A;  2VV6 A;  2YKH A;  4L9G A;  2B02 A;  4PHT A;  2VLG A;  3O5Y A;  4BMW A;  1W63 Q;  1NLY A;  4ARZ A;  4KUK A;  5I5L A;  4Q0I A;  2DMW A;  3UE6 A;  4WUJ A;  2O99 A;  2ZMV A;  2HF6 A;  3TE8 A;  3R7W A;  4NXG A;  4O01 A;  3LR5 A;  4WF0 A;  4CQH A;  3MF0 A;  5HD5 A;  3H82 B;  4UQI M;  4MCW A;  3OCN A;  3MMH A;  3VV4 A;  5DF9 A;  1D7E A;  4LRX C;  2J3W A;  3PBO A;  2INW A;  3E4O A;  4WEL A;  2VA0 A;  2XSS A;  1YAX A;  2QYB A;  4JGP A;  2L1M A;  5F5Y A;  4CLC E;  5DJU A;  3LFV A;  3LYX A;  2A2L A;  2PD7 A;  3MQQ A;  4WL9 A;  5FL3 A;  2KDK A;  1T1C A;  3EWK A;  2P04 A;  3PBR A;  3EGX C;  3MFX A;  3T4O A;  4QPR A;  3FG8 A;  4CLC A;  3T4K A;  1GSX A;  1V9Z A;  4MDZ A;  1S67 L;  1TS6 A;  2NUT C;  2PYR A;  1DP8 A;  3HJI A;  5J3W A;  3T4J A;  1TS8 A;  4GS9 B;  5HWT A;  2V1A A;  2YKF A;  3K3D A;  4G3W A;  5G4Z A;  1P9W A;  3H9W A;  2NUP C;  3EOI A;  3ULF A;  1F5M A;  2VGL M;  3LI8 A;  3PBN A;  2XA7 S;  2JKT I;  2QJ5 A;  1OPX A;  3BW6 A;  2W3F A;  3KO6 A;  3A0V A;  4MN7 A;  2K31 A;  3KYQ A;  3VE3 A;  4EER A;  2K2N A;  5J7E A;  5DFX A;  1T1B A;  2Y8H A;  4IUK A;  1YSQ A;  2OAQ 1;  3BJN A;  4AFI A;  2HGV A;  3BY8 A;  4LLO B;  2PR6 A;  3S7P A;  5MC7 A;  4JGR A;  4CLC D;  3CI6 A;  2W3G A;  4EQ1 A;  3P01 A;  4PKY A;  2GNX A;  2ZOI A;  4HJ3 A;  5A8B A;  2HJE A;  2MJ6 A;  3B33 A;  2GJ3 A;  2I9V A;  4ME4 A;  5AJG A;  3F1N B;  4B93 A;  5IT5 A;  1F9I A;  3F1N A;  3MQ0 A;  1OTA A;  2M7U A;  3PBQ A;  3W2Z A;  4HP9 A;  5HL6 A;  4M4X A;  2PR5 A;  4O0P A;  3DBA A;  3CUE A;  2LB9 A;  4EU0 A;  4WLA A;  4B9O A;  4HIA A;  4BBT A;  4BBV A;  5HSQ A;  1T19 A;  3UB6 A;  4GCZ A;  3A0S A;  1XJ2 A;  3EQU A;  2W3H A;  3ICY A;  5DFY A;  3LIB A;  3G6O A;  3UMD A;  2JKR M;  4Y3I A;  2O9B A;  5AVE A;  4HY8 A;  2PD8 A;  4OOM A;  1W63 M;  2A24 B;  2P08 A;  3SW1 A;  2PT7 A;  3OOV A;  2QWS A;  2W27 A;  3VE4 A;  3E4P A;  3MR0 A;  5HD3 A;  4I39 A;  3MJQ A;  5TBM A;  4FOF A;  3KX0 X;  2K7S A;  2WKP A;  2VGL S;  3T4S A;  1VB6 A;  1F98 A;  4MMN A;  5L8M A;  4Y2F A;  1STZ A;  4HNB A;  2QJ7 A;  2H28 A;  2V0U A;  1N9L A;  1XJ6 A;  4LRZ E;  5F68 A;  3EEA A;  1NLZ A;  4HI4 A;  1VHM A;  2KX6 A;  3BQA A;  3T4L A;  4NXB A;  3BQ8 A;  5AVF A;  4EUV A;  5KIZ A;  3LR0 A;  3PXP A;  2VEA A;  2FH5 A;  3IBR A;  4Y5F A;  3F1P A;  3VOL A;  3PR6 A;  2VV7 A;  3F1P B;  5EFW A;  4YWZ A;  2OWH A;  2WKR A;  3TRC A;  2D02 A;  3KSF A;  2Y79 A;  1G28 A;  4I38 A;  4GHI B;  3C38 A;  3FPV A;  4IJG A;  2QHK A;  2KOI A;  2PDR A;  2W0N A;  1H8M A;  4R6L A;  1UGU A;  4UQI S;  2WKQ A;  4I3I A;  3LR4 A;  3KSH A;  4NXF A;  1NRJ A;  3TJZ C;  4EW7 A;  4II7 A;  4Q0J A;  1XFN A;  4RQ9 A;  1OTE A;  4G3V A;  2OOL A;  3T50 A;  3OC2 A;  2OWJ A;  1G6O A;  4WEJ A;  3BWL A;  5HDS A;  4ARZ B;  4KQD A;  3LUQ A;  4KUO A;  4OOL A;  1P9R A;  1MZU A;  1OTI A;  1OT9 A;  2EWV A;  4LRY C;  3R4K A;  2J3T C;  5TJJ A;  1XFQ A;  3D3O A;  5HPF A;  1LSX A;  1TS0 A;  3H7W A;  5TBM B;  3LIA A;  3D72 A;  1OJG A;  1YSP A;  1LSW A;  4P6Z S;  2P7J A;  2O9A A;  4YNR A;  1T18 A;  3IBJ A;  2JN7 A;  3LI9 A;  3CAX A;  1S1Z A;  4LPZ A;  4MN5 A;  3KYZ A;  5DKK A;  5HWW A;  3IS2 A;  4H6J A;  4R70 A;  4F3L A;  2BAS A;  1TF1 A;  5HWV A;  4F3L B;  5HPI A;  1H3Q A;  4UEY A;  1T1A A;  2L0W A;  2Z6D A;  3EEH A;  4O8G A;  4EET B;  4HP4 A;  2O0Y A;  4NXE A;  2ZMF A;  1UWN X;  2V0W A;  4GS9 A;  3PBS A;  3GDI A;  2V9A A;  1KOU A;  4L0L A;  3ZQ5 A;  1S4S A;  1XJ4 A;  2CMN A;  4I3A A;  4PAU A;  3E98 A;  1D06 A;  3K3C A;  3T4T A;  3TW8 A;  3CIT A;  2VZW A;  2Z6C A;  5HZH A;  3C8C A;  4G3K A;  5CX7 A;  4JGO A;  3E4Q A;  5F6A A;  2G7U A;  1V9Y A;  4GJ4 A;  3UME A;  1EW0 A;  1IOU A;  2M7V A;  3GEC A;  4FSF A;  4IUH A;  4HJ4 A;  5HDC A;  2W1R A;  4BJP A;  3LR3 A;  2PHY A;  3JVV A;  3C30 A;  5DKL A;  4R3A A;  3FC7 A;  3P7N A;  5LBR A;  4CLC C;  1TS7 A;  1IFQ A;  1BYW A;  5IS1 A;  3PHY A;  3HJK A;  4DJ2 A;  5G4Y A;  3H82 A;  4BWI A;  1LL8 A;  2PYP A;  4MN6 A;  4ETX A;  2EWW A;  1N9O A;  4HHD A;  4I5S A;  3S7O A;  3EQV A;  2JHE A;  4HJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...