4DJ3A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
298
Chain Sequence
GRLEDVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNCAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Period circadian protein homolog 3
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 65
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A02
2QJ5A 5F68A 2D01A 4JGPA 3HJIA 2P7JA 4L9EA 2KDKA 4WN5A 4JGOA 1OTDA 1UWPX 2QKPA 5HZHA 1ODVA 4EESA 3CAXA 1TS6A 2W0NA 3PHYA 3BWLA 4GCZA 2VV7A 4WUJA 3KX0X 2OWJA 3LI9A 4I38A 2ZOHA 1F98A 3MJQA 1DP6A 3LIAA 1DP8A 2D02A 4DJ2A 1S1ZA 4NXBA 3EEHA 4MN6A 3F1NA 3FC7A 3MFXA 1T1BA 3F1OA 2VLGA 2OWHA 3K3CA 4MN5A 1OJGA 4L9GA 2ZBBA 1DP9A 2BASA 3LIEA 1EW0A 4NXGA 1XJ2A 3E4OA 3UB7A 2L1MA 4WL9A 4LPZA 2L0WA 2KX6A 3HJKA 1S67L 2V0WA 5HDDA 3LIBA 2CMNA 4WLAA 3LIDA 3IBRA 2M1CA 2YKHA 4HH2A 4HJ4A 4GS9A 4R38A 2WKPA 3G6OA 3BY9A 2K7SA 3H82A 2V0UA 3UB9A 1UGUA 3CLOA 4KQDA 5J4EA 4EXOA 3BY8A 3C2WA 3A0RA 2VV8A 5DJTA 2V1BA 3VE4A 3D72A 5HDSA 4HOIA 2A24A 2L4RA 3NOTC 2OOLA 4EEUA 5TBMB 3OLOA 1X0OA 2PYPA 3FG8A 2W27A 4EQ1A 3IS2A 3NOUC 4BBTA 5AVFA 1XFNA 4HI4A 5AVEA 5HDCA 3MQOA 4LLOB 4H6JA 2VEAA 1S1YA 1V9ZA 4I3AA 3MXQA 1OTIA 4HH3A 3H7WA 4EERA 4F3LB 4NXFA 1GSVA 2QHKA 2PR6A 2PR5A 3LUQA 1F9IA 3A0VA 1T19A 4I39A 1MZUA 1T18A 4R6LA 3UMDA 5KIZA 1D7EA 3LIFA 1NWZA 2PD7A 1S4RA 2R78A 5J7EA 4XT2A 5J3WA 2QJ7A 3B33A 2INWA 3H82B 1N9LA 4NXEA 5HWWA 4JGRA 3RH8B 5DKLA 1T1AA 2WKRA 2I9VA 2A24B 5DJUA 3RTYA 1OT9A 2GJ3A 4K08A 2PHYA 1N9NA 2PDRA 4R3AA 4LRYC 3E4PA 3GDIA 1N9OA 3IS2B 4HY8A 1GSXA 1LSVA 4LRXC 3UB6A 1OTBA 3H9WA 1WA9A 4KUKA 1XJ6A 3LI8A 3C8CA 4EEPA 1D06A 3K3DA 3ICYA 1LL8A 1T1CA 5G4YA 5HWVA 3ULFA 4PKYG 2V9AA 3VE3A 1JNUA 3F1NB 4YWZA 1LT0A 4EW7A 1TS7A 3NHQA 3F1OB 4HHDA 4GHIA 5EFWA 1P97A 1UWNX 1LSXA 3UMEA 1VB6A 4RQ9A 5HWTA 2PD8A 5F5YA 2Z6DA 1TS0A 3NJAA 5A8BA 5I5LA 4HP9A 1OJ5A 4L9FA 4I3IA 3GECA 2YKFA 4HP4A 3UB8A 2HV1A 4WF0A 1OTEA 2PYRA 3MR0A 1XJ3A 4LRZE 3PYPA 1Y28A 1BYWA 1LSWA 5HD3A 4E04A 4HQAA 4BBUA 1XFQA 4I5SA 4GS9B 3F1PA 1DRMA 3NOPC 2EA9A 3E4QA 5HSQA 3P7NA 5IS1A 5F69A 4HIAA 2ZOIA 1P0ZA 3MQQA 2B02A 4GHIB 4DJ3A 1OT6A 1S66L 1G28A 1GSWA 4KUOA 4BBVA 2H28A 4B9OA 5G4ZA 3CWFA 2JN7A 2Z6CA 2QWSA 4JGQA 5TBMA 4EETB 4GW9A 3LICA 4HNBA 5HD5A 1OTAA 4H6JB 2WKQA 5F6AA 3EWKA 4HJ3A 4I3JA 5IU1A 3H7WB 5DKKA 2VV6A 1S4SA 1TS8A 4HJ6A 3LYXA 4R70A 3T50A 4F3LA 3VOLA 1V9YA 4PKYA 3UE6A 4M4XA 2J80A 2JHEA 3A0SA 1XJ4A 3F1PB 4XT2B 3SW1A 1KOUA 2V1AA 3ZQ5A
chains in the Genus database with same CATH superfamily
5F68A 1H5XA 2QMIA 3MMHA 1PNEA 2WZXA 3T4SA 1KGGA 4L9EA 4Y0TA 4JF6A 3VOYA 1UWPX 2ZMAA 3DTEA 1RCJA 5E2HA 3V39A 3ZCZA 5KMWA 1GHMA 1ODVA 2ZJ9A 4K0WA 3VSKA 1CI8A 5DTTA 3IF6C 2W0NA 2ZQ7A 2P08A 1MBLA 3PHYA 3HREA 4Y17A 4LGWA 4GCZA 1FR1A 2OWJA 4IHQA 1A0KA 2PRFA 4WZ5C 1YLJA 1XA1A 3D4FA 1F98A 1TD5A 5FATA 2J8YA 1DP6A 3LIAA 1DP8A 3W8KA 3IQAA 2ZQCA 1IEMA 5DFXA 4DJ2A 3EEHA 1TEMA 2FFFB 3F1NA 1SDEA 1YLZA 1LLBA 1HVBA 2Y59A 1G5UA 1PI5A 2XA7S 4KZ6A 4GOGA 1ERQA 3HUNA 5E2GA 3MZDA 1YMXA 2OWHA 4YOFA 3DW0A 3QP4A 1CQAA 3RJUA 2ZBBA 1BZAA 3UB5P 1BT5A 1K55A 4JF4A 4JXWA 4HBTA 2ZQ8A 3IT9A 5AQ7A 1DP9A 3LIEA 1EW0A 1XJ2A 5FQQA 3E4OA 3IBJA 5TGFA 4LPZA 1YMSA 2L0WA 2KX6A 1S67L 2V0WA 4MCWA 3C4PA 4B4XA 1J3WA 1ALQA 3EQUA 1Q2PA 3N6IA 3DWZA 4ESPA 1ESIA 1ZHHB 2NUPC 2KOIA 2M1CA 2ZM2A 2YKHA 3VP0A 3KYEA 5CEDA 1J9MA 4PM7A 2K7SA 3R7WB 3V67A 2V0UA 3M2JA 3CLOA 4KQDA 3UB9A 4WZ5A 1KDWA 2ZD8A 2VGKA 2C5WB 3C2WA 5F1FA 4O0PA 1HZOA 5MC7A 4EUZA 5HDSA 3E2LA 2A24A 2Y2MA 1YLWA 3VP4A 5TBMB 1X0OA 2W27A 2P9VA 1WYBA 4UHUA 3CUEC 4WMCA 4KQOA 1KGFA 2ZC5B 2XK1A 3MQOA 3UNWA 4LLOB 4N9KA 2VEAA 1S1YA 1V9ZA 4JBFA 1H8YA 3PAGA 4HH3A 3T1QB 1YSPA 3G34A 4F3LB 1GSVA 4FSFA 4EU0A 1XP4A 3LUQA 2XROA 1F9IA 4Q0HA 4I39A 1K54C 1LL5A 5EOEA 3ITAA 4R6LA 4Y2FA 3ISGA 3WWXA 4AFIA 4BD1A 3GMWA 3LIFA 1L0GA 3T4KA 3RFBA 3IH8A 5J7EA 5KSCA 4HESA 1IYPA 1SDNA 4NXEA 5HWWA 3RH8B 1KE0A 1VETB 1MKIA 4OPRA 2EX6A 4WEJA 3UE3A 1MWTA 5DKLA 4WM9A 2I9VA 4DE2A 3D9YA 2PDRA 3VFFA 4R3AA 4S2MA 3SS3A 2DRWA 3IS2B 2GDNA 1MPLA 1GSXA 1WYCA 4KG5A 1CJFA 5HL1A 4OONA 1FOFA 1WA9A 5EVLA 2Q9MA 3B3XA 1PWCA 3MF0A 3FKVA 3BJNA 3GQZA 2OLVA 4E3NA 1I2WA 2PT7A 4ZBEA 4ETXA 3CPTA 1EWZA 3VE3A 2Z2MB 1C3BA 3CHWP 3LFVA 5F1GA 3F1NB 2XRNA 4KZAA 4S2NC 3Q1FA 1LT0A 1TS7A 1K4FA 4GHIA 1K54A 5CGXA 2P74A 4E6XA 2PD8A 5F5YA 3IWOA 1KE3A 5EECA 4HP9A 4L9FA 3S22A 5HAQA 2DCFA 5GL9A 3G35A 4GDBA 1XX2A 4HP4A 5L09A 4KQRA 4WF0A 1OTEA 3ZNYA 3AGFA 3CITA 4NG2A 1STZA 3MR0A 1M40A 3IWQA 5CHUA 4DF6A 1XJ3A 3P98A 3UPNA 4LRZE 1YSQA 4E6WA 5FAQA 4EQIA 3IF6B 1VM1A 2Y2LA 3NCKA 4DXBA 2PBDP 3AGDA 5E2FA 2EFXA 4PHTA 2EA9A 1Z09A 1ZG6A 4IUHA 2RCXA 4E3OA 1TF1A 1XXMA 3HLCA 3NY4A 3V50A 4R4RA 4K91A 5CERA 4C6YA 3IX8A 3KO6A 2WK0A 5FI2A 3O3VA 1P0ZA 1H0MA 4QU3A 2Y79A 4EWFA 1JTGA 2M7VA 3VMAA 2M7UA 1H8ZA 1CK3A 5FSRA 2Z6CA 3E0YA 3IWIA 4S2NA 1W8YA 4JGQA 4FH2A 5CXWA 3SH8A 2NUTC 4MDZA 3EWKA 4L0LA 2W1RA 1FCMA 5DKKA 3ZNTA 4O8GA 1E3UD 2HJEA 1ES4A 3T4OA 5HFOA 3T50A 3VOLA 1ZG4A 1SZVA 4OPQA 4QHCA 4EBPA 2HPBA 5CTNA 1K56A 4DE0A 3VFHA 1XJ4A 3F1PB 2WGWB 1KOUA 3ZQ5A 3MXSA 1RGYA 2J9OA 5CX7A 2KDKA 4JGOA 2OAP1 5LBRA 2DMWA 1LI9A 2JBFA 3OPLA 1IYSA 4Y7PA 2JKTM 5FASA 4P0MA 4GJ4A 4CJNA 4DRTA 3NDGA 3T4JA 3DTKA 1NLZA 1S0WA 4Z9QA 3UDFA 2XA7M 5FA7A 2BTFP 3O86A 4OPZA 2HP5A 2ZOHA 1NXYA 3QP5A 1BULA 4IVIA 3MJQA 3LEQA 3CPTB 2GZAA 3UPOA 3A3IA 2Q9NA 4FOFA 3O87A 3R7WA 4XUXA 1DY6A 2G7UA 4R3BA 1MC0A 4QD4A 2X71A 1W63Q 2WZZA 4OP5A 3FC7A 2Q0OA 3MFXA 3RXXA 1XGIA 2IA2A 3OZHA 3WRZA 5FQIA 2HDSA 2B95A 3QP2A 3CI6A 1KGEA 4QY6A 4CLCE 1DJAA 3ZVTA 3LR5A 2E8IA 2HF6A 1ZKJA 2BASA 4NXGA 5K5BA 5EVEA 2L1MA 4U0XA 4OP8A 4CQHA 3HBRA 1GCEA 4U3TA 3CJMA 4A5RA 4WLAA 3LIDA 5CGSA 3WS5A 2H0YA 1FCOA 1BTLA 3VV4A 3IBRA 3V3RA 5U47A 2Y2QA 1LL9A 1M6KA 3FV7A 4HH2A 5IHVA 3N8RA 4X1LA 2WKPA 3BY9A 4DDYA 1CI9A 3AGEA 3BY8A 1JTDA 2LB5A 3ZG7B 1ES5A 4R4SA 4OQHA 4OLDA 1IYQA 1AXBA 1VETA 4OPYA 1G6AA 2XD5A 1QMFA 1DJBA 1PYYA 2VGLS 3VP1A 4QY5A 2L4RA 3N8LA 4YINA 1FILA 2JKRM 3KSHA 2EX9A 1G6OA 2PYPA 4EQ1A 3IS2A 1YT4A 3B42A 3SS5A 2ZMFA 4WEKA 5AVEA 5HDCA 2ZQAA 4I3AA 1E25A 4S2PA 3MXQA 3LCEA 4EV4A 4MN7A 3H7WA 3MS6A 2JE5A 2QHKA 3BFFA 2PR6A 4N9LA 2PR5A 3KSIA 4ZJ3A 2EXBA 3N7WA 4ZTKA 3GV9A 4ME4A 3BFEA 4MLLA 1Q2QA 3NDEA 2PD7A 3GR2A 2INWA 1N9LA 2ZC6B 3H82B 5TFQA 3V3SA 5E2EA 3EEAA 4ID4A 4JPMA 5A90A 1VEUB 2VK3A 4JGRA 2O99A 2ZM8A 3LEZA 3MZFA 4UA7A 1BLCA 2Y2GA 4X25A 2BG1A 2OSUA 3W2ZA 3MQ0A 5DJUA 2GJ3A 3OPPA 1PRQA 2WUQA 1TDGA 4LRYC 1N9OA 4HY8A 1MWUA 1LSVA 2H0TA 2AVXA 4BLMA 3M6HA 1K56D 3SS4A 3DAVA 1OTBA 3H9WA 2Y91A 4E3KA 3C5AA 4Q0JA 2G2WA 5JYOA 1D06A 3K3DA 3IF6A 2ZLYA 1K57C 2ZMVA 4NEED 1LL8A 4R3JA 2HZ5A 3ULFA 4PKYG 3DTMA 2V9AA 5JYPA 3E2KA 1E3UA 1JNUA 1K6RA 2WAEA 4IEDA 1DJCA 2Y2HA 5TR7A 4EW7A 3LR0A 3PXPA 1LHYA 5EFWA 4X1MA 1P97A 3QHYA 2W1TA 1NZOA 5HWTA 3BEBA 2ZQDA 2Z6DA 1TS0A 3EGXC 5A8BA 4ZJ2A 4LCLA 1ES2A 1SHVA 4KZ7A 4JXVA 3WRTA 1NLYA 3HLEA 4P87A 2YKFA 1JWPA 3C7VA 3UB8A 4YFMA 2ZC4B 5FAOA 2PYRA 3ITBA 1MWRA 4E3JA 4F94A 4E3LA 3CMZA 3U4LP 4WBGA 3DBAA 4O01A 4NKPA 3PR6A 5FDSA 1OPXA 4KZ5A 4E04A 4HQAA 1XFQA 3ZYTA 3QP8A 3Q81A 2J3TC 2J3WA 3F1PA 4RX2A 1G68A 2WGWA 4OQIA 3I7JA 2Z2LB 1K4EA 3IXBA 5HSQA 4HBUA 4Y3IA 5IS1A 1BLPA 3IF5A 5L2FA 2X01A 1K57A 3DTIA 2HDRA 3N4IA 2G2UA 3ZGAB 3Q07A 1QMEA 5HPFA 1IFQA 4DJ3A 3MZEA 1OT6A 3T1SA 2QPNA 3TE8A 3NIAA 2Y8HA 1GSWA 1ERMA 4KUOA 1RGZA 1IOUA 5DTSA 4D2OA 3TRCA 2LB9A 4GW9A 5F83A 5HD5A 1OTAA 1PWGA 1EROA 4BL3A 3MSHA 4GLQA 4FTXA 3H7WB 1N9BA 3LY4A 4OKPA 3CUEA 3IXHA 4HJ6A 2PU2A 3IXGA 3UE6A 2PU4A 4BD0A 4RYEA 5HARA 1ACFA 5EM0A 2JHEA 3SH7A 4ZAMA 4IVKA 4KENB 3VOZA 2V8FA 4II7A 4Y13A 3ZG9B 5FQ9A 4QWOA 1PZPA 2QJ5A 3HUOA 1LI0A 1GA9A 2ZC7A 4PM9A 1I5QA 4CLCC 2VGJA 4EBNA 3HJIA 3FPVA 4WN5A 4S2OA 1OTDA 3T12B 3BQAA 3HLBA 4QJGA 5HZHA 2JCHA 1K6SA 4EESA 5HPIA 3OC2A 3C30A 3CAXA 5FI6A 1S6RA 4S2JA 2OAQ1 4KZ4A 2VV7A 4WUJA 4LCMA 3LI9A 3M6BA 4I38A 3K2NA 2K31A 5FEFA 2HP6A 4GKUA 2WGIA 2D02A 3ZVWA 4JXGA 4OVDA 3EGDC 2Y55A 2GNXA 2Y2NA 3KYQA 4NXBA 4MN6A 4GB7A 2IWDA 3TOIA 1AWIA 2JKFA 5FDHA 5AQ9A 3BLMA 3PAEA 1T1BA 4UA6A 3F1OA 3W4QA 2W1TB 5J8XA 2WKIA 3HUMA 2VLGA 2QYBA 2XD1A 2HP9A 1P9WA 5EV0A 3S1YA 2UV0E 3K3CA 4MN5A 1OJGA 4L9GA 2O9CA 1NRJA 3C38A 5EVIC 1PW8A 1OMEA 3MFDA 1WE4A 1PIOA 4X56A 4RX3A 3PBRA 3UB7A 4WL9A 5DTKA 1IYOA 5L10A 4CLCA 3PBOA 2XLNA 4Y5FA 3T4QA 1BSGA 2CC1A 3HJKA 4U0TA 5HDDA 3WS4A 3LIBA 4RVAA 5TJJA 3M2KA 2VGLM 2CMNA 3UPPA 4K0XA 1YLYA 1YPRA 4KQQA 5GLAA 1W8QA 5FQKA 3TSGA 2OV5A 1FSWA 4R38A 4GS9A 3G6OA 3H82A 2WYXA 1UGUA 5J4EA 4EXOA 4Y0UA 1VEUA 1W5DA 2VV8A 2H5SA 4H8RA 5I94A 4B93A 2HJ9C 1KVLA 3VE4A 5AQAA 1PWDA 3B47A 4QB8A 1NZUA 2V20A 3D72A 3FYZA 4FCFA 5AJGA 4HOIA 3NOTC 2OOLA 5GHZA 3BFDA 2B18A 1PW1A 3A3EA 4OOLA 4BBTA 5DVAA 2B5RA 1XFNA 4HI4A 5FI7A 5GHYA 3PBQA 4ZJ1A 2W3HA 4H6JA 4ZRRA 4EBLA 3IX3A 2EWWA 2ZC3B 4BJPA 4JF5A 1IKIA 3FKWA 1ONGA 4NXFA 2PAVP 1W7FA 4QPRA 3S7PA 3VSLA 5EVIA 3W4PA 3DWKA 1D7EA 4DE1A 2WADA 2WKHA 1S4RA 2R78A 3EQVA 2BLSA 3QP1A 2QJ7A 5GHXA 5J3WA 3B33A 4N92A 1JWVA 4LV3A 3UDXA 1SKOB 3GSGA 3NC8A 1T1AA 1XPBA 1H3QA 2IWCA 4P6ZS 2PHYA 5F82A 3IHAA 3GDIA 3T1RA 4X68A 1YAXA 2XH9A 3G2ZA 4LRXC 3UB6A 1ES3A 3ZFZA 3ZDJA 1XJ6A 5FQMA 3OCLA 3LI8A 4HEFA 3HLDA 3KYZA 4JXSA 3W4OA 1ESUA 1ONHA 2K2NA 5C5KA 5FAPA 2J3TD 4RA7A 5A91A 3GTCA 4FUWA 5KZHA 4OH0A 5M19A 1FR6A 3F1OB 3IXDA 1BLSA 4NK3A 4LV1A 3OOVA 3SOIA 4X69A 3GRJA 3FWLA 1LSXA 5EPHA 1VB6A 4RQ9A 4S2IA 1W63M 2VA0A 1MY8A 5CHJA 1YLPA 5I5LA 1OJ5A 4DE3A 3T4LA 4CLCB 4OLGA 4I3IA 3GECA 2HGVA 1Y4OA 5IT5A 1O07A 2HV1A 5CEBA 2J9PA 2QZ6A 4DXCA 1NYMA 4GNUA 1FQGA 4UAAA 3PYPA 3NULA 1CEFA 1LSWA 1K38A 4UEYA 5HD3A 4BBUA 4I5SA 5DF9A 4UA9A 4GS9B 4OOYA 5CECA 2V1ZA 4ETZA 3IHBA 3P7NA 3ZG0A 4IBRA 4G3WA 3UE0A 2XEPA 4HIAA 1O7EA 2P04A 3P09A 3CG5A 3QNBA 4CLCD 2FZ0A 1YM1A 5CRFA 5DF8A 4NETA 4MBKA 3MBZA 2FFYA 3LO7A 4UQIS 4BBVA 2FH5A 3G31A 4R23A 2JN7A 2QWSA 4LV0A 3R4KA 3Q7VA 4DDSA 3TJZC 4H6JB 4HJ3A 4I3JA 1VHMA 4FD8A 2I72A 4G3VA 3L7HA 3WS0A 1TS8A 5EVIB 4R70A 4PM8A 1P9RA 2W3FA 2XDMA 3LR4A 4KG2A 3A0SA 3UE1A 3S4XA 2V1AA 2PBYA 4XUZA 3BFGA 2D01A 1L0EA 4C75A 4JGPA 1SKFA 4JKTA 5BOHA 2P7JA 1K0KA 4PMAA 4WELA 4LV2A 4S2LA 5E43A 3SZTA 4P6BA 3UDIA 2UWXA 2QKPA 4OQGA 3BFCA 4BQMA 2HDUA 2ZQ9A 5EVID 1TS6A 2JC7A 3ZG8B 1N4OA 1HLUP 1YLTA 3SH9A 2XSSA 3BWLA 5DFYA 3G4PA 1U60A 2EX2A 3N8SA 2ZL1A 2W3GA 3KX0X 1NY0A 4Q0IA 3A3JA 4Y0OA 3S7OA 3WS1A 2R9XA 2XF3A 5G18A 4ARZA 1W79A 1GA0A 2JKTI 1XGJA 2XGNA 3OPHA 1Y54A 4LENA 2ACGA 2IWBA 3BLSA 1CEGA 1S1ZA 4MBFA 2Y2KA 4KZ3A 3HL9A 4PM6A 2E8JA 3TW8A 3WS2A 4B4ZA 5D3OA 1H8MA 2KLIA 3P01A 1VQQA 3ZG5A 3JVUA 3PTEA 5FEGA 4PM5A 1PI4A 2XFTA 3BW6A 5EOOA 4YNRA 1D1JA 3HLGA 1NJ4A 4X53A 4B88A 3HLFA 1KVMA 1HTZA 3KSFA 5HX9A 4OQ0A 3FZCA 3RXWA 3MKFA 5HAIA 3T4TA 4X55A 1FIKA 3HCYA 4ZDXA 2C6WB 3NI9A 5DF7A 4GN2A 5M1AA 4GD6A 4MEZA 1I2SA 4HJ4A 3VP2A 3GVBA 3JPUA 4LFUA 2EFUA 1RP5A 1YKDA 3A0RA 5DJTA 1SKOA 2V1BA 3S7NA 3LR3A 1MKMA 1GHIA 4M3KA 4E3MA 4S2KA 2ZM0A 3VP3A 3A3DA 4EEUA 3LY3A 3OLOA 1MWSA 3FG8A 1L3LA 4E3IA 3UO9A 4R0QA 3NOUC 3Q7VB 2A2LA 3QNCA 4N1XA 5AVFA 5CHMA 3U2AA 5FL3A 5EUAA 3HVFA 5KSHA 2MJ6A 2X02A 2Y2OA 4Q8IA 4GZBA 1PFLA 1OTIA 2RL3A 3NBLA 5CTMA 4EERA 5EM1A 5GLBA 4IBXA 2JKRI 3O88A 3A0VA 1T19A 1MZUA 4P6ZM 1CF0A 1T18A 3UMDA 4BENA 4C3QA 5KIZA 4DKIA 3S7QA 1XKZA 4PAUA 4BMWA 2O9BA 1NWZA 3QP6A 4XT2A 4X6TA 4P85A 4MBHA 5CGWA 3A3FA 2EWVA 3CZDA 3Q7ZA 4BL2A 1XA7A 3JVVA 3PBSA 4BWIA 3V5MA 2WKRA 2A24B 3RTYA 3PBNA 4DMZA 1OT9A 1Z6FA 4K08A 4D60A 4GD8A 1N9NA 1NRFA 4KZBA 1BLHA 2EXAA 2WKEA 1E4DA 3E4PA 2P9VB 5HAPA 4G3KA 1JVJA 3E98A 3L9KA 2OLUA 2ZL1B 2VJWA 3BYDA 2GX5A 2XQZA 4KUKA 3C8CA 4ARZB 4EEPA 5A92A 5HL6A 1L0FA 3ICYA 1FSYA 1KDSA 1L0DA 1T1CA 4GDNA 5G4YA 5HWVA 3MXRA 2W3DA 1JWZA 2HDQA 3HLWA 3C4OA 4PPRA 4WZ4A 1NYYA 1PZOA 3OCNA 1ZC2A 1ZTUA 4YWZA 4KZ9A 3UY6A 2JKGA 3NHQA 1GHPA 4HHDA 2O9AA 4Y15A 1KE4A 2V2FF 4WMCD 1K25A 4XXRA 1UWNX 4JLFA 3UMEA 3D3OA 3IX4A 3G30A 3ZHHA 3BECA 5AQBA 2XFSA 3MKEA 3NJAA 4FH4A 2W3EA 2A49A 3LGOA 3JYIA 3BM6A 5L07A 4OOMA 3T1XA 2H10A 3UN7A 1FCNA 1TDLA 2EX8A 1TVFA 3G2YA 3BRMA 5FQJA 2VX8A 4UQIM 4MMNA 1Y28A 1BYWA 2R9WA 5M18A 3EOIA 4KG6A 4KZ8A 5L8MA 1DRMA 2O0YA 3NOPC 5GLCA 1L2SA 2A3UA 3BQ8A 2Y2IA 4R1GA 2VKSA 1YQSA 2V8CA 3E4QA 2WAFA 4WYYA 3OBFA 4MNRA 1HD8A 1EI5A 2XR0A 5F69A 1MXOA 4DN0A 3FPWA 2ZOIA 2J7VA 4IJGA 3MQQA 2B02A 3KSGA 4GHIB 1S66L 1G28A 4EUVA 2H28A 4B9OA 1F2KA 5A93A 5G4ZA 3CWFA 5TBMA 1BUEA 4EETB 1IELA 3LICA 1IKGA 4CPKA 4HNBA 2WKQA 1F5MA 5F6AA 2WGVA 5GLDA 4IUKA 4N1HA 3G32A 5IU1A 2DNSA 1SCWA 5EE8A 2VV6A 1S4SA 3OPRA 3IH9A 3LYXA 2Y4AA 5HW3A 4F3LA 4O7DA 3C7UA 1V9YA 4PKYA 4M4XA 2Y2PA 3O5YA 2Y2JA 2J80A 3TG9A 3NECA 4XT2B 4Z1WA 3SW1A 3Q82A 1K55C 3PBTA 2VZWA
chains in the Genus database with same CATH topology
2QJ5A 5F68A 2D01A 4JGPA 5CX7A 4CLCC 3MMHA 3T4SA 3HJIA 2P7JA 4L9EA 3FPVA 2KDKA 4WELA 4WN5A 4JGOA 2OAP1 5LBRA 1OTDA 2DMWA 1UWPX 3BQAA 2QKPA 5HZHA 1ODVA 4EESA 2JKTM 5HPIA 3OC2A 3C30A 4GJ4A 3T4JA 3CAXA 1TS6A 2W0NA 1NLZA 2P08A 3PHYA 2XSSA 3BWLA 5DFYA 2OAQ1 2XA7M 4GCZA 2VV7A 4WUJA 2W3GA 3KX0X 2OWJA 3LI9A 4IHQA 4Q0IA 3S7OA 4I38A 3K2NA 2ZOHA 1F98A 1TD5A 4ARZA 2K31A 3MJQA 1DP6A 2JKTI 3LIAA 1DP8A 2GZAA 2D02A 3EGDC 4FOFA 2GNXA 3R7WA 5DFXA 4DJ2A 1S1ZA 3KYQA 4NXBA 3EEHA 2G7UA 4MN6A 1MC0A 1W63Q 3F1NA 3TW8A 3FC7A 3MFXA 2IA2A 2XA7S 1H8MA 2KLIA 3P01A 1T1BA 3F1OA 2W1TB 3JVUA 3CI6A 2VLGA 4CLCE 2OWHA 2QYBA 4YOFA 1P9WA 3LR5A 3K3CA 4MN5A 1OJGA 4L9GA 2ZBBA 2O9CA 2HF6A 1NRJA 3BW6A 3C38A 1DP9A 2BASA 4YNRA 3LIEA 1EW0A 4NXGA 5K5BA 1XJ2A 3PBRA 3E4OA 3IBJA 2L1MA 4WL9A 3UB7A 4LPZA 4CLCA 3PBOA 4CQHA 4Y5FA 3T4QA 2L0WA 2KX6A 3HJKA 1S67L 2V0WA 5HDDA 3KSFA 4MCWA 3LIBA 3EQUA 5TJJA 3T4TA 2VGLM 2CMNA 3HCYA 4WLAA 3LIDA 1ZHHB 2NUPC 3VV4A 3IBRA 2KOIA 2M1CA 2YKHA 4HH2A 4HJ4A 4GS9A 4R38A 2WKPA 3G6OA 3BY9A 2K7SA 3H82A 3R7WB 3V67A 2V0UA 3UB9A 1UGUA 3CLOA 4KQDA 5J4EA 4EXOA 3BY8A 3C2WA 2LB5A 1YKDA 3A0RA 2VV8A 5DJTA 4B93A 2V1BA 2HJ9C 3S7NA 4O0PA 3VE4A 3LR3A 1MKMA 3B47A 5MC7A 3D72A 5HDSA 2VGLS 5AJGA 4HOIA 2A24A 2L4RA 3NOTC 2JKRM 3KSHA 2OOLA 4EEUA 5TBMB 3OLOA 1X0OA 1G6OA 2PYPA 3FG8A 2W27A 4EQ1A 3IS2A 2B18A 3CUEC 3B42A 3NOUC 2A2LA 4KQOA 4OOLA 4BBTA 5AVFA 1XFNA 3U2AA 5FL3A 2ZMFA 4HI4A 4WEKA 5AVEA 5KSHA 3PBQA 5HDCA 3MQOA 2W3HA 4LLOB 4H6JA 2VEAA 1S1YA 1V9ZA 2MJ6A 4I3AA 4ZRRA 2EWWA 3MXQA 4BJPA 1OTIA 4HH3A 4MN7A 3H7WA 1YSPA 4EERA 4F3LB 4NXFA 1GSVA 4FSFA 2JKRI 2QHKA 2PR6A 4QPRA 4EU0A 3S7PA 2PR5A 3LUQA 2XROA 3KSIA 1F9IA 3A0VA 4Q0HA 1T19A 4I39A 1MZUA 4P6ZM 1T18A 4R6LA 4Y2FA 3UMDA 5KIZA 4ME4A 4AFIA 3S7QA 1D7EA 4PAUA 4BMWA 3LIFA 2O9BA 1NWZA 3T4KA 3RFBA 2PD7A 1S4RA 2R78A 5J7EA 4XT2A 3EQVA 5J3WA 2QJ7A 3B33A 2INWA 3H82B 1N9LA 4NXEA 3EEAA 5HWWA 4JGRA 2EWVA 3RH8B 2O99A 4WEJA 3JVVA 3UE3A 3PBSA 5DKLA 1T1AA 4BWIA 2WKRA 3W2ZA 1H3QA 2I9VA 3MQ0A 2A24B 5DJUA 3RTYA 3PBNA 4DMZA 1OT9A 2GJ3A 4K08A 4P6ZS 2PHYA 1N9NA 2PDRA 4R3AA 4LRYC 3E4PA 3GDIA 4G3KA 1N9OA 3IS2B 4HY8A 1YAXA 1GSXA 1LSVA 4LRXC 3E98A 3UB6A 2VJWA 1OTBA 3H9WA 1WA9A 2GX5A 4KUKA 1XJ6A 4Q0JA 3OCLA 3LI8A 3C8CA 4ARZB 4EEPA 3MF0A 1D06A 3K3DA 3BJNA 5HL6A 3ICYA 3KYZA 2ZMVA 4NEED 1LL8A 1T1CA 2PT7A 2K2NA 5G4YA 4ETXA 5HWVA 2W3DA 3ULFA 4PKYG 5C5KA 2V9AA 2J3TD 3VE3A 3LFVA 1JNUA 3F1NB 2XRNA 3OCNA 1ZTUA 4YWZA 1LT0A 4EW7A 3LR0A 1TS7A 3NHQA 3PXPA 3F1OB 4HHDA 4GHIA 2O9AA 5EFWA 3OOVA 1P97A 1UWNX 2W1TA 1LSXA 3UMEA 3D3OA 1VB6A 4RQ9A 5HWTA 1W63M 2PD8A 5F5YA 2Z6DA 1TS0A 2VA0A 3EGXC 3NJAA 5A8BA 5I5LA 2W3EA 4HP9A 1OJ5A 4L9FA 3T4LA 4CLCB 4I3IA 3GECA 1NLYA 2YKFA 4HP4A 4OOMA 3UB8A 2HGVA 5IT5A 2HV1A 4WF0A 1OTEA 2PYRA 3CITA 1STZA 3MR0A 2VX8A 1XJ3A 4LRZE 1YSQA 4UQIM 3DBAA 4MMNA 3PYPA 4O01A 4NKPA 1Y28A 1BYWA 1LSWA 3PR6A 4UEYA 1OPXA 5HD3A 4E04A 4HQAA 4BBUA 3EOIA 1XFQA 4I5SA 5DF9A 3ZYTA 2J3TC 4GS9B 2J3WA 5L8MA 3F1PA 1DRMA 2O0YA 3NOPC 4PHTA 2EA9A 4IUHA 4ETZA 3BQ8A 2VKSA 3E4QA 5HSQA 3P7NA 1TF1A 4Y3IA 5IS1A 4G3WA 3OBFA 5F69A 4HIAA 3FPWA 2P04A 4DN0A 2ZOIA 3KO6A 4IJGA 1P0ZA 4CLCD 3MQQA 2B02A 2FZ0A 3KSGA 2Y79A 5HPFA 1IFQA 4GHIB 4DJ3A 1OT6A 1S66L 2M7VA 3TE8A 1G28A 2M7UA 2Y8HA 1GSWA 4EUVA 4KUOA 4UQIS 4BBVA 2H28A 4B9OA 2FH5A 1IOUA 5G4ZA 3CWFA 2JN7A 2Z6CA 3E0YA 2QWSA 3TRCA 4JGQA 5TBMA 2LB9A 4EETB 4GW9A 3LICA 3R4KA 4HNBA 2NUTC 4MDZA 1OTAA 5HD5A 3TJZC 4H6JB 2WKQA 1F5MA 5F6AA 3EWKA 4L0LA 4HJ3A 4GLQA 4IUKA 4I3JA 1VHMA 5IU1A 2W1RA 3H7WB 4G3VA 5DKKA 2VV6A 3CUEA 4O8GA 1S4SA 1TS8A 2HJEA 4HJ6A 3LYXA 4R70A 3T4OA 3T50A 4F3LA 3VOLA 1P9RA 1V9YA 4PKYA 2W3FA 3UE6A 4M4XA 3O5YA 2J80A 3LR4A 2JHEA 3A0SA 1XJ4A 3F1PB 4XT2B 4Z1WA 3SW1A 4II7A 1KOUA 2V1AA 3ZQ5A 3PBTA 2VZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ5 A;  5F68 A;  2D01 A;  4JGP A;  3HJI A;  2P7J A;  4L9E A;  2KDK A;  4WN5 A;  4JGO A;  1OTD A;  1UWP X;  2QKP A;  5HZH A;  1ODV A;  4EES A;  3CAX A;  1TS6 A;  2W0N A;  3PHY A;  3BWL A;  4GCZ A;  2VV7 A;  4WUJ A;  3KX0 X;  2OWJ A;  3LI9 A;  4I38 A;  2ZOH A;  1F98 A;  3MJQ A;  1DP6 A;  3LIA A;  1DP8 A;  2D02 A;  4DJ2 A;  1S1Z A;  4NXB A;  3EEH A;  4MN6 A;  3F1N A;  3FC7 A;  3MFX A;  1T1B A;  3F1O A;  2VLG A;  2OWH A;  3K3C A;  4MN5 A;  1OJG A;  4L9G A;  2ZBB A;  1DP9 A;  2BAS A;  3LIE A;  1EW0 A;  4NXG A;  1XJ2 A;  3E4O A;  3UB7 A;  2L1M A;  4WL9 A;  4LPZ A;  2L0W A;  2KX6 A;  3HJK A;  1S67 L;  2V0W A;  5HDD A;  3LIB A;  2CMN A;  4WLA A;  3LID A;  3IBR A;  2M1C A;  2YKH A;  4HH2 A;  4HJ4 A;  4GS9 A;  4R38 A;  2WKP A;  3G6O A;  3BY9 A;  2K7S A;  3H82 A;  2V0U A;  3UB9 A;  1UGU A;  3CLO A;  4KQD A;  5J4E A;  4EXO A;  3BY8 A;  3C2W A;  3A0R A;  2VV8 A;  5DJT A;  2V1B A;  3VE4 A;  3D72 A;  5HDS A;  4HOI A;  2A24 A;  2L4R A;  3NOT C;  2OOL A;  4EEU A;  5TBM B;  3OLO A;  1X0O A;  2PYP A;  3FG8 A;  2W27 A;  4EQ1 A;  3IS2 A;  3NOU C;  4BBT A;  5AVF A;  1XFN A;  4HI4 A;  5AVE A;  5HDC A;  3MQO A;  4LLO B;  4H6J A;  2VEA A;  1S1Y A;  1V9Z A;  4I3A A;  3MXQ A;  1OTI A;  4HH3 A;  3H7W A;  4EER A;  4F3L B;  4NXF A;  1GSV A;  2QHK A;  2PR6 A;  2PR5 A;  3LUQ A;  1F9I A;  3A0V A;  1T19 A;  4I39 A;  1MZU A;  1T18 A;  4R6L A;  3UMD A;  5KIZ A;  1D7E A;  3LIF A;  1NWZ A;  2PD7 A;  1S4R A;  2R78 A;  5J7E A;  4XT2 A;  5J3W A;  2QJ7 A;  3B33 A;  2INW A;  3H82 B;  1N9L A;  4NXE A;  5HWW A;  4JGR A;  3RH8 B;  5DKL A;  1T1A A;  2WKR A;  2I9V A;  2A24 B;  5DJU A;  3RTY A;  1OT9 A;  2GJ3 A;  4K08 A;  2PHY A;  1N9N A;  2PDR A;  4R3A A;  4LRY C;  3E4P A;  3GDI A;  1N9O A;  3IS2 B;  4HY8 A;  1GSX A;  1LSV A;  4LRX C;  3UB6 A;  1OTB A;  3H9W A;  1WA9 A;  4KUK A;  1XJ6 A;  3LI8 A;  3C8C A;  4EEP A;  1D06 A;  3K3D A;  3ICY A;  1LL8 A;  1T1C A;  5G4Y A;  5HWV A;  3ULF A;  4PKY G;  2V9A A;  3VE3 A;  1JNU A;  3F1N B;  4YWZ A;  1LT0 A;  4EW7 A;  1TS7 A;  3NHQ A;  3F1O B;  4HHD A;  4GHI A;  5EFW A;  1P97 A;  1UWN X;  1LSX A;  3UME A;  1VB6 A;  4RQ9 A;  5HWT A;  2PD8 A;  5F5Y A;  2Z6D A;  1TS0 A;  3NJA A;  5A8B A;  5I5L A;  4HP9 A;  1OJ5 A;  4L9F A;  4I3I A;  3GEC A;  2YKF A;  4HP4 A;  3UB8 A;  2HV1 A;  4WF0 A;  1OTE A;  2PYR A;  3MR0 A;  1XJ3 A;  4LRZ E;  3PYP A;  1Y28 A;  1BYW A;  1LSW A;  5HD3 A;  4E04 A;  4HQA A;  4BBU A;  1XFQ A;  4I5S A;  4GS9 B;  3F1P A;  1DRM A;  3NOP C;  2EA9 A;  3E4Q A;  5HSQ A;  3P7N A;  5IS1 A;  5F69 A;  4HIA A;  2ZOI A;  1P0Z A;  3MQQ A;  2B02 A;  4GHI B;  4DJ3 A;  1OT6 A;  1S66 L;  1G28 A;  1GSW A;  4KUO A;  4BBV A;  2H28 A;  4B9O A;  5G4Z A;  3CWF A;  2JN7 A;  2Z6C A;  2QWS A;  4JGQ A;  5TBM A;  4EET B;  4GW9 A;  3LIC A;  4HNB A;  5HD5 A;  1OTA A;  4H6J B;  2WKQ A;  5F6A A;  3EWK A;  4HJ3 A;  4I3J A;  5IU1 A;  3H7W B;  5DKK A;  2VV6 A;  1S4S A;  1TS8 A;  4HJ6 A;  3LYX A;  4R70 A;  3T50 A;  4F3L A;  3VOL A;  1V9Y A;  4PKY A;  3UE6 A;  4M4X A;  2J80 A;  2JHE A;  3A0S A;  1XJ4 A;  3F1P B;  4XT2 B;  3SW1 A;  1KOU A;  2V1A A;  3ZQ5 A; 
#chains in the Genus database with same CATH topology
 5F68 A;  1H5X A;  2QMI A;  3MMH A;  1PNE A;  2WZX A;  3T4S A;  1KGG A;  4L9E A;  4Y0T A;  4JF6 A;  3VOY A;  1UWP X;  2ZMA A;  3DTE A;  1RCJ A;  5E2H A;  3V39 A;  3ZCZ A;  5KMW A;  1GHM A;  1ODV A;  2ZJ9 A;  4K0W A;  3VSK A;  1CI8 A;  5DTT A;  3IF6 C;  2W0N A;  2ZQ7 A;  2P08 A;  1MBL A;  3PHY A;  3HRE A;  4Y17 A;  4LGW A;  4GCZ A;  1FR1 A;  2OWJ A;  4IHQ A;  1A0K A;  2PRF A;  4WZ5 C;  1YLJ A;  1XA1 A;  3D4F A;  1F98 A;  1TD5 A;  5FAT A;  2J8Y A;  1DP6 A;  3LIA A;  1DP8 A;  3W8K A;  3IQA A;  2ZQC A;  1IEM A;  5DFX A;  4DJ2 A;  3EEH A;  1TEM A;  2FFF B;  3F1N A;  1SDE A;  1YLZ A;  1LLB A;  1HVB A;  2Y59 A;  1G5U A;  1PI5 A;  2XA7 S;  4KZ6 A;  4GOG A;  1ERQ A;  3HUN A;  5E2G A;  3MZD A;  1YMX A;  2OWH A;  4YOF A;  3DW0 A;  3QP4 A;  1CQA A;  3RJU A;  2ZBB A;  1BZA A;  3UB5 P;  1BT5 A;  1K55 A;  4JF4 A;  4JXW A;  4HBT A;  2ZQ8 A;  3IT9 A;  5AQ7 A;  1DP9 A;  3LIE A;  1EW0 A;  1XJ2 A;  5FQQ A;  3E4O A;  3IBJ A;  5TGF A;  4LPZ A;  1YMS A;  2L0W A;  2KX6 A;  1S67 L;  2V0W A;  4MCW A;  3C4P A;  4B4X A;  1J3W A;  1ALQ A;  3EQU A;  1Q2P A;  3N6I A;  3DWZ A;  4ESP A;  1ESI A;  1ZHH B;  2NUP C;  2KOI A;  2M1C A;  2ZM2 A;  2YKH A;  3VP0 A;  3KYE A;  5CED A;  1J9M A;  4PM7 A;  2K7S A;  3R7W B;  3V67 A;  2V0U A;  3M2J A;  3CLO A;  4KQD A;  3UB9 A;  4WZ5 A;  1KDW A;  2ZD8 A;  2VGK A;  2C5W B;  3C2W A;  5F1F A;  4O0P A;  1HZO A;  5MC7 A;  4EUZ A;  5HDS A;  3E2L A;  2A24 A;  2Y2M A;  1YLW A;  3VP4 A;  5TBM B;  1X0O A;  2W27 A;  2P9V A;  1WYB A;  4UHU A;  3CUE C;  4WMC A;  4KQO A;  1KGF A;  2ZC5 B;  2XK1 A;  3MQO A;  3UNW A;  4LLO B;  4N9K A;  2VEA A;  1S1Y A;  1V9Z A;  4JBF A;  1H8Y A;  3PAG A;  4HH3 A;  3T1Q B;  1YSP A;  3G34 A;  4F3L B;  1GSV A;  4FSF A;  4EU0 A;  1XP4 A;  3LUQ A;  2XRO A;  1F9I A;  4Q0H A;  4I39 A;  1K54 C;  1LL5 A;  5EOE A;  3ITA A;  4R6L A;  4Y2F A;  3ISG A;  3WWX A;  4AFI A;  4BD1 A;  3GMW A;  3LIF A;  1L0G A;  3T4K A;  3RFB A;  3IH8 A;  5J7E A;  5KSC A;  4HES A;  1IYP A;  1SDN A;  4NXE A;  5HWW A;  3RH8 B;  1KE0 A;  1VET B;  1MKI A;  4OPR A;  2EX6 A;  4WEJ A;  3UE3 A;  1MWT A;  5DKL A;  4WM9 A;  2I9V A;  4DE2 A;  3D9Y A;  2PDR A;  3VFF A;  4R3A A;  4S2M A;  3SS3 A;  2DRW A;  3IS2 B;  2GDN A;  1MPL A;  1GSX A;  1WYC A;  4KG5 A;  1CJF A;  5HL1 A;  4OON A;  1FOF A;  1WA9 A;  5EVL A;  2Q9M A;  3B3X A;  1PWC A;  3MF0 A;  3FKV A;  3BJN A;  3GQZ A;  2OLV A;  4E3N A;  1I2W A;  2PT7 A;  4ZBE A;  4ETX A;  3CPT A;  1EWZ A;  3VE3 A;  2Z2M B;  1C3B A;  3CHW P;  3LFV A;  5F1G A;  3F1N B;  2XRN A;  4KZA A;  4S2N C;  3Q1F A;  1LT0 A;  1TS7 A;  1K4F A;  4GHI A;  1K54 A;  5CGX A;  2P74 A;  4E6X A;  2PD8 A;  5F5Y A;  3IWO A;  1KE3 A;  5EEC A;  4HP9 A;  4L9F A;  3S22 A;  5HAQ A;  2DCF A;  5GL9 A;  3G35 A;  4GDB A;  1XX2 A;  4HP4 A;  5L09 A;  4KQR A;  4WF0 A;  1OTE A;  3ZNY A;  3AGF A;  3CIT A;  4NG2 A;  1STZ A;  3MR0 A;  1M40 A;  3IWQ A;  5CHU A;  4DF6 A;  1XJ3 A;  3P98 A;  3UPN A;  4LRZ E;  1YSQ A;  4E6W A;  5FAQ A;  4EQI A;  3IF6 B;  1VM1 A;  2Y2L A;  3NCK A;  4DXB A;  2PBD P;  3AGD A;  5E2F A;  2EFX A;  4PHT A;  2EA9 A;  1Z09 A;  1ZG6 A;  4IUH A;  2RCX A;  4E3O A;  1TF1 A;  1XXM A;  3HLC A;  3NY4 A;  3V50 A;  4R4R A;  4K91 A;  5CER A;  4C6Y A;  3IX8 A;  3KO6 A;  2WK0 A;  5FI2 A;  3O3V A;  1P0Z A;  1H0M A;  4QU3 A;  2Y79 A;  4EWF A;  1JTG A;  2M7V A;  3VMA A;  2M7U A;  1H8Z A;  1CK3 A;  5FSR A;  2Z6C A;  3E0Y A;  3IWI A;  4S2N A;  1W8Y A;  4JGQ A;  4FH2 A;  5CXW A;  3SH8 A;  2NUT C;  4MDZ A;  3EWK A;  4L0L A;  2W1R A;  1FCM A;  5DKK A;  3ZNT A;  4O8G A;  1E3U D;  2HJE A;  1ES4 A;  3T4O A;  5HFO A;  3T50 A;  3VOL A;  1ZG4 A;  1SZV A;  4OPQ A;  4QHC A;  4EBP A;  2HPB A;  5CTN A;  1K56 A;  4DE0 A;  3VFH A;  1XJ4 A;  3F1P B;  2WGW B;  1KOU A;  3ZQ5 A;  3MXS A;  1RGY A;  2J9O A;  5CX7 A;  2KDK A;  4JGO A;  2OAP 1;  5LBR A;  2DMW A;  1LI9 A;  2JBF A;  3OPL A;  1IYS A;  4Y7P A;  2JKT M;  5FAS A;  4P0M A;  4GJ4 A;  4CJN A;  4DRT A;  3NDG A;  3T4J A;  3DTK A;  1NLZ A;  1S0W A;  4Z9Q A;  3UDF A;  2XA7 M;  5FA7 A;  2BTF P;  3O86 A;  4OPZ A;  2HP5 A;  2ZOH A;  1NXY A;  3QP5 A;  1BUL A;  4IVI A;  3MJQ A;  3LEQ A;  3CPT B;  2GZA A;  3UPO A;  3A3I A;  2Q9N A;  4FOF A;  3O87 A;  3R7W A;  4XUX A;  1DY6 A;  2G7U A;  4R3B A;  1MC0 A;  4QD4 A;  2X71 A;  1W63 Q;  2WZZ A;  4OP5 A;  3FC7 A;  2Q0O A;  3MFX A;  3RXX A;  1XGI A;  2IA2 A;  3OZH A;  3WRZ A;  5FQI A;  2HDS A;  2B95 A;  3QP2 A;  3CI6 A;  1KGE A;  4QY6 A;  4CLC E;  1DJA A;  3ZVT A;  3LR5 A;  2E8I A;  2HF6 A;  1ZKJ A;  2BAS A;  4NXG A;  5K5B A;  5EVE A;  2L1M A;  4U0X A;  4OP8 A;  4CQH A;  3HBR A;  1GCE A;  4U3T A;  3CJM A;  4A5R A;  4WLA A;  3LID A;  5CGS A;  3WS5 A;  2H0Y A;  1FCO A;  1BTL A;  3VV4 A;  3IBR A;  3V3R A;  5U47 A;  2Y2Q A;  1LL9 A;  1M6K A;  3FV7 A;  4HH2 A;  5IHV A;  3N8R A;  4X1L A;  2WKP A;  3BY9 A;  4DDY A;  1CI9 A;  3AGE A;  3BY8 A;  1JTD A;  2LB5 A;  3ZG7 B;  1ES5 A;  4R4S A;  4OQH A;  4OLD A;  1IYQ A;  1AXB A;  1VET A;  4OPY A;  1G6A A;  2XD5 A;  1QMF A;  1DJB A;  1PYY A;  2VGL S;  3VP1 A;  4QY5 A;  2L4R A;  3N8L A;  4YIN A;  1FIL A;  2JKR M;  3KSH A;  2EX9 A;  1G6O A;  2PYP A;  4EQ1 A;  3IS2 A;  1YT4 A;  3B42 A;  3SS5 A;  2ZMF A;  4WEK A;  5AVE A;  5HDC A;  2ZQA A;  4I3A A;  1E25 A;  4S2P A;  3MXQ A;  3LCE A;  4EV4 A;  4MN7 A;  3H7W A;  3MS6 A;  2JE5 A;  2QHK A;  3BFF A;  2PR6 A;  4N9L A;  2PR5 A;  3KSI A;  4ZJ3 A;  2EXB A;  3N7W A;  4ZTK A;  3GV9 A;  4ME4 A;  3BFE A;  4MLL A;  1Q2Q A;  3NDE A;  2PD7 A;  3GR2 A;  2INW A;  1N9L A;  2ZC6 B;  3H82 B;  5TFQ A;  3V3S A;  5E2E A;  3EEA A;  4ID4 A;  4JPM A;  5A90 A;  1VEU B;  2VK3 A;  4JGR A;  2O99 A;  2ZM8 A;  3LEZ A;  3MZF A;  4UA7 A;  1BLC A;  2Y2G A;  4X25 A;  2BG1 A;  2OSU A;  3W2Z A;  3MQ0 A;  5DJU A;  2GJ3 A;  3OPP A;  1PRQ A;  2WUQ A;  1TDG A;  4LRY C;  1N9O A;  4HY8 A;  1MWU A;  1LSV A;  2H0T A;  2AVX A;  4BLM A;  3M6H A;  1K56 D;  3SS4 A;  3DAV A;  1OTB A;  3H9W A;  2Y91 A;  4E3K A;  3C5A A;  4Q0J A;  2G2W A;  5JYO A;  1D06 A;  3K3D A;  3IF6 A;  2ZLY A;  1K57 C;  2ZMV A;  4NEE D;  1LL8 A;  4R3J A;  2HZ5 A;  3ULF A;  4PKY G;  3DTM A;  2V9A A;  5JYP A;  3E2K A;  1E3U A;  1JNU A;  1K6R A;  2WAE A;  4IED A;  1DJC A;  2Y2H A;  5TR7 A;  4EW7 A;  3LR0 A;  3PXP A;  1LHY A;  5EFW A;  4X1M A;  1P97 A;  3QHY A;  2W1T A;  1NZO A;  5HWT A;  3BEB A;  2ZQD A;  2Z6D A;  1TS0 A;  3EGX C;  5A8B A;  4ZJ2 A;  4LCL A;  1ES2 A;  1SHV A;  4KZ7 A;  4JXV A;  3WRT A;  1NLY A;  3HLE A;  4P87 A;  2YKF A;  1JWP A;  3C7V A;  3UB8 A;  4YFM A;  2ZC4 B;  5FAO A;  2PYR A;  3ITB A;  1MWR A;  4E3J A;  4F94 A;  4E3L A;  3CMZ A;  3U4L P;  4WBG A;  3DBA A;  4O01 A;  4NKP A;  3PR6 A;  5FDS A;  1OPX A;  4KZ5 A;  4E04 A;  4HQA A;  1XFQ A;  3ZYT A;  3QP8 A;  3Q81 A;  2J3T C;  2J3W A;  3F1P A;  4RX2 A;  1G68 A;  2WGW A;  4OQI A;  3I7J A;  2Z2L B;  1K4E A;  3IXB A;  5HSQ A;  4HBU A;  4Y3I A;  5IS1 A;  1BLP A;  3IF5 A;  5L2F A;  2X01 A;  1K57 A;  3DTI A;  2HDR A;  3N4I A;  2G2U A;  3ZGA B;  3Q07 A;  1QME A;  5HPF A;  1IFQ A;  4DJ3 A;  3MZE A;  1OT6 A;  3T1S A;  2QPN A;  3TE8 A;  3NIA A;  2Y8H A;  1GSW A;  1ERM A;  4KUO A;  1RGZ A;  1IOU A;  5DTS A;  4D2O A;  3TRC A;  2LB9 A;  4GW9 A;  5F83 A;  5HD5 A;  1OTA A;  1PWG A;  1ERO A;  4BL3 A;  3MSH A;  4GLQ A;  4FTX A;  3H7W B;  1N9B A;  3LY4 A;  4OKP A;  3CUE A;  3IXH A;  4HJ6 A;  2PU2 A;  3IXG A;  3UE6 A;  2PU4 A;  4BD0 A;  4RYE A;  5HAR A;  1ACF A;  5EM0 A;  2JHE A;  3SH7 A;  4ZAM A;  4IVK A;  4KEN B;  3VOZ A;  2V8F A;  4II7 A;  4Y13 A;  3ZG9 B;  5FQ9 A;  4QWO A;  1PZP A;  2QJ5 A;  3HUO A;  1LI0 A;  1GA9 A;  2ZC7 A;  4PM9 A;  1I5Q A;  4CLC C;  2VGJ A;  4EBN A;  3HJI A;  3FPV A;  4WN5 A;  4S2O A;  1OTD A;  3T12 B;  3BQA A;  3HLB A;  4QJG A;  5HZH A;  2JCH A;  1K6S A;  4EES A;  5HPI A;  3OC2 A;  3C30 A;  3CAX A;  5FI6 A;  1S6R A;  4S2J A;  2OAQ 1;  4KZ4 A;  2VV7 A;  4WUJ A;  4LCM A;  3LI9 A;  3M6B A;  4I38 A;  3K2N A;  2K31 A;  5FEF A;  2HP6 A;  4GKU A;  2WGI A;  2D02 A;  3ZVW A;  4JXG A;  4OVD A;  3EGD C;  2Y55 A;  2GNX A;  2Y2N A;  3KYQ A;  4NXB A;  4MN6 A;  4GB7 A;  2IWD A;  3TOI A;  1AWI A;  2JKF A;  5FDH A;  5AQ9 A;  3BLM A;  3PAE A;  1T1B A;  4UA6 A;  3F1O A;  3W4Q A;  2W1T B;  5J8X A;  2WKI A;  3HUM A;  2VLG A;  2QYB A;  2XD1 A;  2HP9 A;  1P9W A;  5EV0 A;  3S1Y A;  2UV0 E;  3K3C A;  4MN5 A;  1OJG A;  4L9G A;  2O9C A;  1NRJ A;  3C38 A;  5EVI C;  1PW8 A;  1OME A;  3MFD A;  1WE4 A;  1PIO A;  4X56 A;  4RX3 A;  3PBR A;  3UB7 A;  4WL9 A;  5DTK A;  1IYO A;  5L10 A;  4CLC A;  3PBO A;  2XLN A;  4Y5F A;  3T4Q A;  1BSG A;  2CC1 A;  3HJK A;  4U0T A;  5HDD A;  3WS4 A;  3LIB A;  4RVA A;  5TJJ A;  3M2K A;  2VGL M;  2CMN A;  3UPP A;  4K0X A;  1YLY A;  1YPR A;  4KQQ A;  5GLA A;  1W8Q A;  5FQK A;  3TSG A;  2OV5 A;  1FSW A;  4R38 A;  4GS9 A;  3G6O A;  3H82 A;  2WYX A;  1UGU A;  5J4E A;  4EXO A;  4Y0U A;  1VEU A;  1W5D A;  2VV8 A;  2H5S A;  4H8R A;  5I94 A;  4B93 A;  2HJ9 C;  1KVL A;  3VE4 A;  5AQA A;  1PWD A;  3B47 A;  4QB8 A;  1NZU A;  2V20 A;  3D72 A;  3FYZ A;  4FCF A;  5AJG A;  4HOI A;  3NOT C;  2OOL A;  5GHZ A;  3BFD A;  2B18 A;  1PW1 A;  3A3E A;  4OOL A;  4BBT A;  5DVA A;  2B5R A;  1XFN A;  4HI4 A;  5FI7 A;  5GHY A;  3PBQ A;  4ZJ1 A;  2W3H A;  4H6J A;  4ZRR A;  4EBL A;  3IX3 A;  2EWW A;  2ZC3 B;  4BJP A;  4JF5 A;  1IKI A;  3FKW A;  1ONG A;  4NXF A;  2PAV P;  1W7F A;  4QPR A;  3S7P A;  3VSL A;  5EVI A;  3W4P A;  3DWK A;  1D7E A;  4DE1 A;  2WAD A;  2WKH A;  1S4R A;  2R78 A;  3EQV A;  2BLS A;  3QP1 A;  2QJ7 A;  5GHX A;  5J3W A;  3B33 A;  4N92 A;  1JWV A;  4LV3 A;  3UDX A;  1SKO B;  3GSG A;  3NC8 A;  1T1A A;  1XPB A;  1H3Q A;  2IWC A;  4P6Z S;  2PHY A;  5F82 A;  3IHA A;  3GDI A;  3T1R A;  4X68 A;  1YAX A;  2XH9 A;  3G2Z A;  4LRX C;  3UB6 A;  1ES3 A;  3ZFZ A;  3ZDJ A;  1XJ6 A;  5FQM A;  3OCL A;  3LI8 A;  4HEF A;  3HLD A;  3KYZ A;  4JXS A;  3W4O A;  1ESU A;  1ONH A;  2K2N A;  5C5K A;  5FAP A;  2J3T D;  4RA7 A;  5A91 A;  3GTC A;  4FUW A;  5KZH A;  4OH0 A;  5M19 A;  1FR6 A;  3F1O B;  3IXD A;  1BLS A;  4NK3 A;  4LV1 A;  3OOV A;  3SOI A;  4X69 A;  3GRJ A;  3FWL A;  1LSX A;  5EPH A;  1VB6 A;  4RQ9 A;  4S2I A;  1W63 M;  2VA0 A;  1MY8 A;  5CHJ A;  1YLP A;  5I5L A;  1OJ5 A;  4DE3 A;  3T4L A;  4CLC B;  4OLG A;  4I3I A;  3GEC A;  2HGV A;  1Y4O A;  5IT5 A;  1O07 A;  2HV1 A;  5CEB A;  2J9P A;  2QZ6 A;  4DXC A;  1NYM A;  4GNU A;  1FQG A;  4UAA A;  3PYP A;  3NUL A;  1CEF A;  1LSW A;  1K38 A;  4UEY A;  5HD3 A;  4BBU A;  4I5S A;  5DF9 A;  4UA9 A;  4GS9 B;  4OOY A;  5CEC A;  2V1Z A;  4ETZ A;  3IHB A;  3P7N A;  3ZG0 A;  4IBR A;  4G3W A;  3UE0 A;  2XEP A;  4HIA A;  1O7E A;  2P04 A;  3P09 A;  3CG5 A;  3QNB A;  4CLC D;  2FZ0 A;  1YM1 A;  5CRF A;  5DF8 A;  4NET A;  4MBK A;  3MBZ A;  2FFY A;  3LO7 A;  4UQI S;  4BBV A;  2FH5 A;  3G31 A;  4R23 A;  2JN7 A;  2QWS A;  4LV0 A;  3R4K A;  3Q7V A;  4DDS A;  3TJZ C;  4H6J B;  4HJ3 A;  4I3J A;  1VHM A;  4FD8 A;  2I72 A;  4G3V A;  3L7H A;  3WS0 A;  1TS8 A;  5EVI B;  4R70 A;  4PM8 A;  1P9R A;  2W3F A;  2XDM A;  3LR4 A;  4KG2 A;  3A0S A;  3UE1 A;  3S4X A;  2V1A A;  2PBY A;  4XUZ A;  3BFG A;  2D01 A;  1L0E A;  4C75 A;  4JGP A;  1SKF A;  4JKT A;  5BOH A;  2P7J A;  1K0K A;  4PMA A;  4WEL A;  4LV2 A;  4S2L A;  5E43 A;  3SZT A;  4P6B A;  3UDI A;  2UWX A;  2QKP A;  4OQG A;  3BFC A;  4BQM A;  2HDU A;  2ZQ9 A;  5EVI D;  1TS6 A;  2JC7 A;  3ZG8 B;  1N4O A;  1HLU P;  1YLT A;  3SH9 A;  2XSS A;  3BWL A;  5DFY A;  3G4P A;  1U60 A;  2EX2 A;  3N8S A;  2ZL1 A;  2W3G A;  3KX0 X;  1NY0 A;  4Q0I A;  3A3J A;  4Y0O A;  3S7O A;  3WS1 A;  2R9X A;  2XF3 A;  5G18 A;  4ARZ A;  1W79 A;  1GA0 A;  2JKT I;  1XGJ A;  2XGN A;  3OPH A;  1Y54 A;  4LEN A;  2ACG A;  2IWB A;  3BLS A;  1CEG A;  1S1Z A;  4MBF A;  2Y2K A;  4KZ3 A;  3HL9 A;  4PM6 A;  2E8J A;  3TW8 A;  3WS2 A;  4B4Z A;  5D3O A;  1H8M A;  2KLI A;  3P01 A;  1VQQ A;  3ZG5 A;  3JVU A;  3PTE A;  5FEG A;  4PM5 A;  1PI4 A;  2XFT A;  3BW6 A;  5EOO A;  4YNR A;  1D1J A;  3HLG A;  1NJ4 A;  4X53 A;  4B88 A;  3HLF A;  1KVM A;  1HTZ A;  3KSF A;  5HX9 A;  4OQ0 A;  3FZC A;  3RXW A;  3MKF A;  5HAI A;  3T4T A;  4X55 A;  1FIK A;  3HCY A;  4ZDX A;  2C6W B;  3NI9 A;  5DF7 A;  4GN2 A;  5M1A A;  4GD6 A;  4MEZ A;  1I2S A;  4HJ4 A;  3VP2 A;  3GVB A;  3JPU A;  4LFU A;  2EFU A;  1RP5 A;  1YKD A;  3A0R A;  5DJT A;  1SKO A;  2V1B A;  3S7N A;  3LR3 A;  1MKM A;  1GHI A;  4M3K A;  4E3M A;  4S2K A;  2ZM0 A;  3VP3 A;  3A3D A;  4EEU A;  3LY3 A;  3OLO A;  1MWS A;  3FG8 A;  1L3L A;  4E3I A;  3UO9 A;  4R0Q A;  3NOU C;  3Q7V B;  2A2L A;  3QNC A;  4N1X A;  5AVF A;  5CHM A;  3U2A A;  5FL3 A;  5EUA A;  3HVF A;  5KSH A;  2MJ6 A;  2X02 A;  2Y2O A;  4Q8I A;  4GZB A;  1PFL A;  1OTI A;  2RL3 A;  3NBL A;  5CTM A;  4EER A;  5EM1 A;  5GLB A;  4IBX A;  2JKR I;  3O88 A;  3A0V A;  1T19 A;  1MZU A;  4P6Z M;  1CF0 A;  1T18 A;  3UMD A;  4BEN A;  4C3Q A;  5KIZ A;  4DKI A;  3S7Q A;  1XKZ A;  4PAU A;  4BMW A;  2O9B A;  1NWZ A;  3QP6 A;  4XT2 A;  4X6T A;  4P85 A;  4MBH A;  5CGW A;  3A3F A;  2EWV A;  3CZD A;  3Q7Z A;  4BL2 A;  1XA7 A;  3JVV A;  3PBS A;  4BWI A;  3V5M A;  2WKR A;  2A24 B;  3RTY A;  3PBN A;  4DMZ A;  1OT9 A;  1Z6F A;  4K08 A;  4D60 A;  4GD8 A;  1N9N A;  1NRF A;  4KZB A;  1BLH A;  2EXA A;  2WKE A;  1E4D A;  3E4P A;  2P9V B;  5HAP A;  4G3K A;  1JVJ A;  3E98 A;  3L9K A;  2OLU A;  2ZL1 B;  2VJW A;  3BYD A;  2GX5 A;  2XQZ A;  4KUK A;  3C8C A;  4ARZ B;  4EEP A;  5A92 A;  5HL6 A;  1L0F A;  3ICY A;  1FSY A;  1KDS A;  1L0D A;  1T1C A;  4GDN A;  5G4Y A;  5HWV A;  3MXR A;  2W3D A;  1JWZ A;  2HDQ A;  3HLW A;  3C4O A;  4PPR A;  4WZ4 A;  1NYY A;  1PZO A;  3OCN A;  1ZC2 A;  1ZTU A;  4YWZ A;  4KZ9 A;  3UY6 A;  2JKG A;  3NHQ A;  1GHP A;  4HHD A;  2O9A A;  4Y15 A;  1KE4 A;  2V2F F;  4WMC D;  1K25 A;  4XXR A;  1UWN X;  4JLF A;  3UME A;  3D3O A;  3IX4 A;  3G30 A;  3ZHH A;  3BEC A;  5AQB A;  2XFS A;  3MKE A;  3NJA A;  4FH4 A;  2W3E A;  2A49 A;  3LGO A;  3JYI A;  3BM6 A;  5L07 A;  4OOM A;  3T1X A;  2H10 A;  3UN7 A;  1FCN A;  1TDL A;  2EX8 A;  1TVF A;  3G2Y A;  3BRM A;  5FQJ A;  2VX8 A;  4UQI M;  4MMN A;  1Y28 A;  1BYW A;  2R9W A;  5M18 A;  3EOI A;  4KG6 A;  4KZ8 A;  5L8M A;  1DRM A;  2O0Y A;  3NOP C;  5GLC A;  1L2S A;  2A3U A;  3BQ8 A;  2Y2I A;  4R1G A;  2VKS A;  1YQS A;  2V8C A;  3E4Q A;  2WAF A;  4WYY A;  3OBF A;  4MNR A;  1HD8 A;  1EI5 A;  2XR0 A;  5F69 A;  1MXO A;  4DN0 A;  3FPW A;  2ZOI A;  2J7V A;  4IJG A;  3MQQ A;  2B02 A;  3KSG A;  4GHI B;  1S66 L;  1G28 A;  4EUV A;  2H28 A;  4B9O A;  1F2K A;  5A93 A;  5G4Z A;  3CWF A;  5TBM A;  1BUE A;  4EET B;  1IEL A;  3LIC A;  1IKG A;  4CPK A;  4HNB A;  2WKQ A;  1F5M A;  5F6A A;  2WGV A;  5GLD A;  4IUK A;  4N1H A;  3G32 A;  5IU1 A;  2DNS A;  1SCW A;  5EE8 A;  2VV6 A;  1S4S A;  3OPR A;  3IH9 A;  3LYX A;  2Y4A A;  5HW3 A;  4F3L A;  4O7D A;  3C7U A;  1V9Y A;  4PKY A;  4M4X A;  2Y2P A;  3O5Y A;  2Y2J A;  2J80 A;  3TG9 A;  3NEC A;  4XT2 B;  4Z1W A;  3SW1 A;  3Q82 A;  1K55 C;  3PBT A;  2VZW A; 
#chains in the Genus database with same CATH homology
 2QJ5 A;  5F68 A;  2D01 A;  4JGP A;  5CX7 A;  4CLC C;  3MMH A;  3T4S A;  3HJI A;  2P7J A;  4L9E A;  3FPV A;  2KDK A;  4WEL A;  4WN5 A;  4JGO A;  2OAP 1;  5LBR A;  1OTD A;  2DMW A;  1UWP X;  3BQA A;  2QKP A;  5HZH A;  1ODV A;  4EES A;  2JKT M;  5HPI A;  3OC2 A;  3C30 A;  4GJ4 A;  3T4J A;  3CAX A;  1TS6 A;  2W0N A;  1NLZ A;  2P08 A;  3PHY A;  2XSS A;  3BWL A;  5DFY A;  2OAQ 1;  2XA7 M;  4GCZ A;  2VV7 A;  4WUJ A;  2W3G A;  3KX0 X;  2OWJ A;  3LI9 A;  4IHQ A;  4Q0I A;  3S7O A;  4I38 A;  3K2N A;  2ZOH A;  1F98 A;  1TD5 A;  4ARZ A;  2K31 A;  3MJQ A;  1DP6 A;  2JKT I;  3LIA A;  1DP8 A;  2GZA A;  2D02 A;  3EGD C;  4FOF A;  2GNX A;  3R7W A;  5DFX A;  4DJ2 A;  1S1Z A;  3KYQ A;  4NXB A;  3EEH A;  2G7U A;  4MN6 A;  1MC0 A;  1W63 Q;  3F1N A;  3TW8 A;  3FC7 A;  3MFX A;  2IA2 A;  2XA7 S;  1H8M A;  2KLI A;  3P01 A;  1T1B A;  3F1O A;  2W1T B;  3JVU A;  3CI6 A;  2VLG A;  4CLC E;  2OWH A;  2QYB A;  4YOF A;  1P9W A;  3LR5 A;  3K3C A;  4MN5 A;  1OJG A;  4L9G A;  2ZBB A;  2O9C A;  2HF6 A;  1NRJ A;  3BW6 A;  3C38 A;  1DP9 A;  2BAS A;  4YNR A;  3LIE A;  1EW0 A;  4NXG A;  5K5B A;  1XJ2 A;  3PBR A;  3E4O A;  3IBJ A;  2L1M A;  4WL9 A;  3UB7 A;  4LPZ A;  4CLC A;  3PBO A;  4CQH A;  4Y5F A;  3T4Q A;  2L0W A;  2KX6 A;  3HJK A;  1S67 L;  2V0W A;  5HDD A;  3KSF A;  4MCW A;  3LIB A;  3EQU A;  5TJJ A;  3T4T A;  2VGL M;  2CMN A;  3HCY A;  4WLA A;  3LID A;  1ZHH B;  2NUP C;  3VV4 A;  3IBR A;  2KOI A;  2M1C A;  2YKH A;  4HH2 A;  4HJ4 A;  4GS9 A;  4R38 A;  2WKP A;  3G6O A;  3BY9 A;  2K7S A;  3H82 A;  3R7W B;  3V67 A;  2V0U A;  3UB9 A;  1UGU A;  3CLO A;  4KQD A;  5J4E A;  4EXO A;  3BY8 A;  3C2W A;  2LB5 A;  1YKD A;  3A0R A;  2VV8 A;  5DJT A;  4B93 A;  2V1B A;  2HJ9 C;  3S7N A;  4O0P A;  3VE4 A;  3LR3 A;  1MKM A;  3B47 A;  5MC7 A;  3D72 A;  5HDS A;  2VGL S;  5AJG A;  4HOI A;  2A24 A;  2L4R A;  3NOT C;  2JKR M;  3KSH A;  2OOL A;  4EEU A;  5TBM B;  3OLO A;  1X0O A;  1G6O A;  2PYP A;  3FG8 A;  2W27 A;  4EQ1 A;  3IS2 A;  2B18 A;  3CUE C;  3B42 A;  3NOU C;  2A2L A;  4KQO A;  4OOL A;  4BBT A;  5AVF A;  1XFN A;  3U2A A;  5FL3 A;  2ZMF A;  4HI4 A;  4WEK A;  5AVE A;  5KSH A;  3PBQ A;  5HDC A;  3MQO A;  2W3H A;  4LLO B;  4H6J A;  2VEA A;  1S1Y A;  1V9Z A;  2MJ6 A;  4I3A A;  4ZRR A;  2EWW A;  3MXQ A;  4BJP A;  1OTI A;  4HH3 A;  4MN7 A;  3H7W A;  1YSP A;  4EER A;  4F3L B;  4NXF A;  1GSV A;  4FSF A;  2JKR I;  2QHK A;  2PR6 A;  4QPR A;  4EU0 A;  3S7P A;  2PR5 A;  3LUQ A;  2XRO A;  3KSI A;  1F9I A;  3A0V A;  4Q0H A;  1T19 A;  4I39 A;  1MZU A;  4P6Z M;  1T18 A;  4R6L A;  4Y2F A;  3UMD A;  5KIZ A;  4ME4 A;  4AFI A;  3S7Q A;  1D7E A;  4PAU A;  4BMW A;  3LIF A;  2O9B A;  1NWZ A;  3T4K A;  3RFB A;  2PD7 A;  1S4R A;  2R78 A;  5J7E A;  4XT2 A;  3EQV A;  5J3W A;  2QJ7 A;  3B33 A;  2INW A;  3H82 B;  1N9L A;  4NXE A;  3EEA A;  5HWW A;  4JGR A;  2EWV A;  3RH8 B;  2O99 A;  4WEJ A;  3JVV A;  3UE3 A;  3PBS A;  5DKL A;  1T1A A;  4BWI A;  2WKR A;  3W2Z A;  1H3Q A;  2I9V A;  3MQ0 A;  2A24 B;  5DJU A;  3RTY A;  3PBN A;  4DMZ A;  1OT9 A;  2GJ3 A;  4K08 A;  4P6Z S;  2PHY A;  1N9N A;  2PDR A;  4R3A A;  4LRY C;  3E4P A;  3GDI A;  4G3K A;  1N9O A;  3IS2 B;  4HY8 A;  1YAX A;  1GSX A;  1LSV A;  4LRX C;  3E98 A;  3UB6 A;  2VJW A;  1OTB A;  3H9W A;  1WA9 A;  2GX5 A;  4KUK A;  1XJ6 A;  4Q0J A;  3OCL A;  3LI8 A;  3C8C A;  4ARZ B;  4EEP A;  3MF0 A;  1D06 A;  3K3D A;  3BJN A;  5HL6 A;  3ICY A;  3KYZ A;  2ZMV A;  4NEE D;  1LL8 A;  1T1C A;  2PT7 A;  2K2N A;  5G4Y A;  4ETX A;  5HWV A;  2W3D A;  3ULF A;  4PKY G;  5C5K A;  2V9A A;  2J3T D;  3VE3 A;  3LFV A;  1JNU A;  3F1N B;  2XRN A;  3OCN A;  1ZTU A;  4YWZ A;  1LT0 A;  4EW7 A;  3LR0 A;  1TS7 A;  3NHQ A;  3PXP A;  3F1O B;  4HHD A;  4GHI A;  2O9A A;  5EFW A;  3OOV A;  1P97 A;  1UWN X;  2W1T A;  1LSX A;  3UME A;  3D3O A;  1VB6 A;  4RQ9 A;  5HWT A;  1W63 M;  2PD8 A;  5F5Y A;  2Z6D A;  1TS0 A;  2VA0 A;  3EGX C;  3NJA A;  5A8B A;  5I5L A;  2W3E A;  4HP9 A;  1OJ5 A;  4L9F A;  3T4L A;  4CLC B;  4I3I A;  3GEC A;  1NLY A;  2YKF A;  4HP4 A;  4OOM A;  3UB8 A;  2HGV A;  5IT5 A;  2HV1 A;  4WF0 A;  1OTE A;  2PYR A;  3CIT A;  1STZ A;  3MR0 A;  2VX8 A;  1XJ3 A;  4LRZ E;  1YSQ A;  4UQI M;  3DBA A;  4MMN A;  3PYP A;  4O01 A;  4NKP A;  1Y28 A;  1BYW A;  1LSW A;  3PR6 A;  4UEY A;  1OPX A;  5HD3 A;  4E04 A;  4HQA A;  4BBU A;  3EOI A;  1XFQ A;  4I5S A;  5DF9 A;  3ZYT A;  2J3T C;  4GS9 B;  2J3W A;  5L8M A;  3F1P A;  1DRM A;  2O0Y A;  3NOP C;  4PHT A;  2EA9 A;  4IUH A;  4ETZ A;  3BQ8 A;  2VKS A;  3E4Q A;  5HSQ A;  3P7N A;  1TF1 A;  4Y3I A;  5IS1 A;  4G3W A;  3OBF A;  5F69 A;  4HIA A;  3FPW A;  2P04 A;  4DN0 A;  2ZOI A;  3KO6 A;  4IJG A;  1P0Z A;  4CLC D;  3MQQ A;  2B02 A;  2FZ0 A;  3KSG A;  2Y79 A;  5HPF A;  1IFQ A;  4GHI B;  4DJ3 A;  1OT6 A;  1S66 L;  2M7V A;  3TE8 A;  1G28 A;  2M7U A;  2Y8H A;  1GSW A;  4EUV A;  4KUO A;  4UQI S;  4BBV A;  2H28 A;  4B9O A;  2FH5 A;  1IOU A;  5G4Z A;  3CWF A;  2JN7 A;  2Z6C A;  3E0Y A;  2QWS A;  3TRC A;  4JGQ A;  5TBM A;  2LB9 A;  4EET B;  4GW9 A;  3LIC A;  3R4K A;  4HNB A;  2NUT C;  4MDZ A;  1OTA A;  5HD5 A;  3TJZ C;  4H6J B;  2WKQ A;  1F5M A;  5F6A A;  3EWK A;  4L0L A;  4HJ3 A;  4GLQ A;  4IUK A;  4I3J A;  1VHM A;  5IU1 A;  2W1R A;  3H7W B;  4G3V A;  5DKK A;  2VV6 A;  3CUE A;  4O8G A;  1S4S A;  1TS8 A;  2HJE A;  4HJ6 A;  3LYX A;  4R70 A;  3T4O A;  3T50 A;  4F3L A;  3VOL A;  1P9R A;  1V9Y A;  4PKY A;  2W3F A;  3UE6 A;  4M4X A;  3O5Y A;  2J80 A;  3LR4 A;  2JHE A;  3A0S A;  1XJ4 A;  3F1P B;  4XT2 B;  4Z1W A;  3SW1 A;  4II7 A;  1KOU A;  2V1A A;  3ZQ5 A;  3PBT A;  2VZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...