4DJ3A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
298
Chain Sequence
GRLEDVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNCAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Period circadian protein homolog 3
total genus 65
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A02
4KUOA 2PHYA 2V0UA 3EEHA 3H82B 5DKLA 3E4QA 1XFQA 3IS2A 3MFXA 4HJ3A 3UB9A 5G4YA 1G28A 1S66L 1UGUA 2WKQA 1D7EA 2PD7A 3F1OB 4MN5A 5J3WA 3UMDA 3A0VA 1P97A 4GW9A 1OTAA 3LI8A 3LYXA 2D01A 4EETB 2H28A 1T19A 4WN5A 4HHDA 1ODVA 3UB7A 1GSXA 3E4PA 2PYPA 3E4OA 2JN7A 2HV1A 4PKYA 5HD5A 3FG8A 4JGOA 4E04A 3VOLA 1D06A 1BYWA 1TS8A 2L0WA 1XFNA 2EA9A 4HP9A 4JGRA 2YKFA 3ICYA 3IS2B 1T1CA 4DJ3A 1DRMA 3T50A 3NOPC 2WKPA 4EEUA 5J7EA 3NHQA 2OWJA 4JGPA 1DP9A 3LIBA 5DKKA 4EW7A 1DP6A 3SW1A 3LIAA 4LPZA 3K3DA 4HJ4A 2QHKA 4EESA 4F3LA 1T1AA 1LSWA 3MXQA 4HNBA 3LI9A 3G6OA 3BWLA 1XJ3A 2KDKA 3F1NB 4HH2A 4LRXC 2OWHA 2D02A 4HJ6A 1VB6A 4HQAA 2QWSA 3NOTC 3LIDA 4XT2A 4I38A 4WLAA 1P0ZA 1OJ5A 1WA9A 3BY9A 4XT2B 2YKHA 4GHIB 3RH8B 2VEAA 4HIAA 4B9OA 1S4RA 2PYRA 2VV6A 4H6JB 4R6LA 3F1PB 3HJKA 1T1BA 1N9OA 4L9FA 3F1NA 1X0OA 2KX6A 3A0RA 4GCZA 1S1YA 2R78A 4F3LB 3LICA 2Z6CA 2QKPA 4KUKA 4HI4A 2A24A 5HWTA 4GS9B 4I3AA 4R38A 1OTDA 2V1AA 5F5YA 1OT9A 3H9WA 4WL9A 5AVEA 4HOIA 2PDRA 3C8CA 4K08A 3UB8A 4WUJA 3IBRA 4HP4A 1LSXA 4LRYC 2VLGA 4M4XA 1XJ6A 4HH3A 5HDCA 3VE3A 4EERA 4EQ1A 4I3IA 3FC7A 1S1ZA 1MZUA 5TBMB 2VV7A 2PR5A 4LRZE 2BASA 5I5LA 1XJ4A 3MQOA 2L4RA 3NOUC 5HDDA 1S4SA 2WKRA 3F1OA 4NXBA 3ZQ5A 1KOUA 4I39A 1UWPX 2B02A 2CMNA 3GDIA 3K3CA 4R3AA 4MN6A 4I3JA 4HY8A 4LLOB 5F6AA 3B33A 3PHYA 5TBMA 3VE4A 1DP8A 4PKYG 2J80A 3MR0A 1XJ2A 2OOLA 5IU1A 3UMEA 4NXEA 4BBUA 3H82A 1GSVA 2GJ3A 4R70A 4EEPA 4L9EA 4EXOA 2L1MA 1OTEA 1EW0A 4DJ2A 1TS6A 1V9YA 4YWZA 1OTIA 3KX0X 2P7JA 2ZOIA 5HD3A 3ULFA 1JNUA 1Y28A 1TS0A 4GS9A 5KIZA 2A24B 2JHEA 3LIFA 3P7NA 1F9IA 4H6JA 1LL8A 5A8BA 5J4EA 5HZHA 4GHIA 5HWVA 2W27A 3H7WA 2V1BA 1T18A 3C2WA 3F1PA 3OLOA 4I5SA 3LUQA 3CLOA 4NXGA 5HSQA 2ZOHA 1N9NA 1S67L 1TS7A 1UWNX 2INWA 2K7SA 2PD8A 2PR6A 3CWFA 1LT0A 5F68A 1OTBA 3H7WB 4WF0A 5DJTA 3UE6A 4BBVA 4KQDA 2I9VA 2M1CA 2V0WA 3D72A 2ZBBA 1F98A 2QJ7A 2V9AA 2W0NA 1N9LA 4L9GA 5EFWA 4BBTA 3EWKA 1V9ZA 3GECA 3HJIA 3NJAA 4JGQA 5G4ZA 5DJUA 5F69A 2VV8A 5IS1A 3MJQA 3MQQA 1LSVA 3LIEA 5AVFA 3PYPA 4RQ9A 5HDSA 3CAXA 3RTYA 1NWZA 3BY8A 5HWWA 2QJ5A 1GSWA 4NXFA 1OT6A 3A0SA 1OJGA 3UB6A 2Z6DA
chains in the Genus database with same CATH superfamily
1DJCA 1ES5A 5G4YA 3VP0A 4P6BA 5J3WA 2FFYA 1D7EA 4ARZA 4S2NC 4MMNA 3LI8A 4JXGA 3P98A 1EWZA 4G3WA 3E4PA 3V50A 2JN7A 3CITA 3ZG9B 5FEGA 1Z6FA 3HL9A 2XDMA 1DP6A 4LPZA 1IYOA 4MCWA 2XR0A 5KSHA 3LR3A 1LL5A 3W4OA 2KDKA 2EX2A 1HLUP 2J9PA 4N1XA 4KZ9A 3NC8A 1BULA 1NXYA 4E3OA 3OCNA 4NKPA 3BFDA 2VGJA 3PR6A 3W2ZA 4R38A 4RX2A 4A5RA 4K08A 4HP4A 3TJZC 3VP4A 1YLZA 4X56A 5M1AA 3L9KA 1I2WA 1YMXA 4OPRA 3I7JA 4KZ4A 4WBGA 3HUNA 2P7JA 1NZUA 1TEMA 4JKTA 2W27A 1K55A 2P04A 3LUQA 4NXGA 4JXSA 5CTNA 2K7SA 4OLGA 5LBRA 4GDNA 3ITBA 5F1GA 2VK3A 3PBNA 5CGXA 2VKSA 3RXWA 4KZBA 2Z6DA 1BLSA 3MFXA 4PPRA 3D4FA 4DKIA 3IHAA 2WAEA 4JGOA 5EM1A 4PM9A 5L8MA 1XPBA 4GKUA 1DRMA 1QMFA 1P9WA 4Y3IA 3G2ZA 4BMWA 5DKKA 1DJBA 2XD1A 4HNBA 3LI9A 1KE4A 1PZPA 1QMEA 2XA7S 2XH9A 4GD6A 3NOTC 4EU0A 1F2KA 2XQZA 2O9CA 4M3KA 1ZTUA 1PI4A 2YKHA 3GV9A 3HREA 1H5XA 4P85A 1RGYA 5HAIA 3DTIA 2ZLYA 5TR7A 1G68A 3IF6A 1W79A 3NI9A 2WKEA 4I3IA 1S1ZA 3K2NA 4Y2FA 1NLYA 3BEBA 3MQOA 3HLBA 1FCNA 1YLTA 1PWCA 3T4KA 1TS6A 3T1QB 4FCFA 4XUZA 1LL8A 4WMCD 3F1PA 2OV5A 3V67A 2XD5A 4LV3A 3ZFZA 1VM1A 1YM1A 1NZOA 2H0TA 2QJ7A 3MS6A 4MBFA 2QYBA 4R3JA 2JKTI 2VV8A 3V39A 4ZAMA 2EX9A 3UN7A 2BTFP 3L7HA 4LGWA 3HCYA 4DMZA 2HDSA 1BZAA 5DF9A 3C7VA 3IF5A 4QWOA 1RGZA 1T19A 1MC0A 2UWXA 3NOPC 4RVAA 1W5DA 1KGEA 2W3FA 1KVMA 2O9AA 3G31A 4UQIS 2IA2A 3V3SA 5U47A 1LSWA 3PBRA 3FZCA 4HH2A 2XA7M 1YMSA 4R1GA 1ES4A 3NULA 1CI8A 3KSIA 1OJ5A 4FOFA 4E3KA 3S1YA 5DF8A 4F3LB 3FPVA 2IWCA 1LSXA 4OONA 3RXXA 3QNBA 5FAOA 3WS5A 3FKWA 2C5WB 4OOYA 5I5LA 3LO7A 1IYPA 1MY8A 2G2UA 4UAAA 3S7NA 2Y2MA 4O0PA 4JF4A 4LLOB 2PU4A 3B33A 1FR1A 3JPUA 4PKYG 4XXRA 3QHYA 3D9YA 2IWDA 3MKEA 2V1BA 4OQIA 3IQAA 4IBXA 4PM5A 4BQMA 3SOIA 2M1CA 5EVIA 1F5MA 3EWKA 2PAVP 2Y2PA 3PBQA 3WWXA 3GRJA 2V2FF 3D3OA 2VJWA 5DKLA 3H82B 3F1OB 1KGGA 5GLDA 2WGWA 4OP5A 1PWGA 3SH9A 2PYPA 5MC7A 1FILA 3IXDA 2ZQ8A 2K31A 4EQIA 4HP9A 2JKFA 1BLHA 2OLUA 4E3MA 3M2KA 5FAQA 3EOIA 1W63M 1K55C 3HLCA 4GN2A 5DTKA 3LIDA 3KSGA 2Y91A 4H6JB 2O9BA 4WN5A 1MPLA 1T1BA 2DNSA 2Y2IA 3MBZA 5EV0A 1FCOA 1ZC2A 3EQUA 3N4IA 3LICA 2IWBA 1CEFA 4KZ7A 4GS9B 3OC2A 4OH0A 2J3TC 2Y55A 4R4SA 4UA7A 3MXSA 3NDGA 4UA6A 2BASA 3IF6C 1XJ4A 1PFLA 5I94A 3LY3A 2M7VA 4X6TA 1GHIA 4B88A 3M6HA 4GNUA 4MN6A 1K6SA 3TRCA 3HLFA 3VE4A 4JF5A 1O7EA 3ZHHA 4BBUA 4EEPA 3Q1FA 1L3LA 4IVKA 3MKFA 1OTIA 4Z1WA 1YPRA 4H6JA 5EOOA 4OQ0A 2G7UA 1HD8A 4FTXA 1M6KA 2Y2JA 1IFQA 4R4RA 1VQQA 5F68A 3NIAA 2A49A 3D72A 2V0WA 1F98A 4BLMA 5DJUA 5HX9A 5F82A 1OT6A 4X69A 3UB6A 1JWPA 4CLCB 3E4QA 1RP5A 1PWDA 1UGUA 3UMDA 2B18A 2A2LA 1BLPA 4JLFA 1CJFA 1SZVA 2DMWA 3PXPA 4ETZA 5F83A 5EUAA 3CG5A 2L0WA 1K4EA 1L2SA 3IS2B 3WS2A 4JGPA 1ZKJA 5GHXA 4O7DA 4KG2A 2QHKA 1T1AA 3UPNA 3UB5P 4O8GA 2J7VA 3LEZA 4UEYA 4ESPA 1BLCA 1SKFA 4R6LA 3MXRA 3R7WB 1ESIA 2ZM0A 3DTMA 2JKRI 1L0FA 1OTDA 2JKRM 3ISGA 1OT9A 4HOIA 4WUJA 4HH3A 1E3UD 2PR5A 2QZ6A 3OOVA 3SH8A 3QP6A 3MQ0A 3UE0A 5C5KA 5IHVA 4CLCA 4HY8A 2XLNA 3C4PA 2VZWA 4ARZB 2J80A 2OOLA 4ZJ2A 5M18A 4EWFA 1NY0A 4JBFA 1FQGA 4OOLA 3CLOA 4R23A 3GR2A 2FH5A 5CX7A 4OPQA 1DJAA 2OLVA 1Y54A 2GZAA 3LEQA 4NG2A 3E2LA 4X68A 1ZHHB 2R9WA 4X55A 3A0SA 4BJPA 4YOFA 3ZG7B 4MN5A 3A0VA 1OMEA 2LB9A 1GSXA 2B5RA 1KDSA 2WADA 5CERA 2BG1A 2EA9A 1E25A 3ZDJA 4PM8A 5FSRA 3OZHA 4QD4A 2V1ZA 3VOZA 3QP4A 3IT9A 4PHTA 2ZC7A 4ZDXA 3BFFA 1SCWA 2PYRA 2W3DA 1N9OA 3F1NA 1X0OA 3DBAA 4Y15A 3OCLA 3WS1A 2VX8A 3Q7ZA 2Y2GA 4HI4A 1FSWA 2PBYA 2Y2LA 1L0DA 5CXWA 3C8CA 3S4XA 3HUOA 2VLGA 3UY6A 5JYPA 1YLJA 2XF3A 3DWZA 1H8ZA 5DFYA 3B47A 4E3IA 2QMIA 4NK3A 1RCJA 3O87A 2CMNA 1XGJA 1DP8A 4ZTKA 5FASA 1PIOA 1EW0A 4QPRA 4EUVA 3MF0A 5F1FA 2PT7A 5E43A 3VP1A 4P6ZM 1T18A 2WKIA 1XA7A 1S0WA 3LFVA 4L9GA 4DE3A 2NUPC 5FDSA 5GHZA 4Y0UA 5A91A 4E6XA 5AQ9A 4ZJ3A 1ERMA 2P9VA 1G28A 3HUMA 1U60A 3UO9A 2HP9A 4KQQA 4NETA 4GB7A 3FG8A 3MZDA 5FA7A 5GHYA 3T1XA 4RA7A 3T50A 4EUZA 2Y8HA 4F3LA 4HJ4A 3BRMA 1YKDA 3NY4A 4UHUA 4JF6A 4ME4A 5EOEA 2XSSA 5A93A 3IX3A 4OQHA 5J7EA 4HBTA 5FQJA 5CECA 3R4KA 3H9WA 2JE5A 3IBRA 5TJJA 4IBRA 3IXHA 1VETB 3TSGA 1IELA 3V5MA 5F6AA 5TBMA 4BENA 3TE8A 2P9VB 5AQBA 5CHJA 4BL2A 1TDGA 2XFTA 4E6WA 5HPIA 2X02A 5HAPA 1K25A 3QP1A 5FQQA 3IWQA 1EI5A 4P6ZS 3OLOA 3BFGA 1I5QA 2ZOHA 1N9NA 1AXBA 1GA0A 2PD8A 5G18A 1N9LA 4K0WA 3GECA 3NJAA 3TOIA 1K38A 3CAXA 5HWWA 2HGVA 2B95A 3B42A 4KUOA 1YT4A 2ZMVA 3IX8A 4EV4A 1S66L 2H5SA 2H10A 3UNWA 4GW9A 3G35A 2ZMAA 3FKVA 3MSHA 4N1HA 2W3GA 3UPPA 4PKYA 5HD5A 4F94A 5AQ7A 1KVLA 4E3JA 4KQRA 4DF6A 2X71A 1SKOB 4UQIM 3WRZA 5BOHA 3MZEA 3SW1A 3LIAA 3VV4A 2LB5A 3IBJA 4YFMA 3F1NB 2GX5A 2OWHA 2D02A 2WGIA 2KOIA 4HJ6A 4HQAA 4LV2A 3RH8B 4B9OA 4C6YA 3AGFA 2VEAA 3WRTA 4CLCD 4R70A 3T4JA 4YWZA 1YSQA 4DRTA 4WZ5C 2HP5A 1TDLA 1S6RA 4DN0A 2HDQA 1K57A 3UE3A 2ZQDA 5J8XA 5KMWA 4WZ5A 5HAQA 4KZ3A 4GOGA 1UWPX 3K3CA 1K56D 1C3BA 1G5UA 3T4SA 4R3BA 3PHYA 4CJNA 2GDNA 3EEAA 1BTLA 4CLCC 1VHMA 3N8RA 4EXOA 3Q7VB 1PW1A 3E98A 1OTEA 4S2PA 2J9OA 3IXBA 1YLWA 4P87A 1TF1A 3Q82A 4X25A 2A24B 3S7PA 4RX3A 5HWVA 4O01A 1ONGA 1YAXA 2HP6A 3CWFA 1XP4A 4ZBEA 4KQDA 2ZBBA 3HJIA 3N8SA 1CK3A 3MQQA 3LIEA 3EGDC 1D1JA 4RQ9A 4Y17A 1ONHA 5E2EA 1WE4A 3HBRA 5JYOA 5A90A 1PYYA 2BLSA 4OKPA 2D01A 2QPNA 4EETB 3O88A 3OPRA 3UB7A 3SS4A 2HV1A 3OPLA 5CRFA 4GJ4A 1TS8A 5FQ9A 1BSGA 4KZAA 3AGEA 2W1RA 3NHQA 1DP9A 3CHWP 4L0LA 3QNCA 2Q9NA 3GVBA 3MXQA 3ZCZA 1GA9A 3IX4A 3S7QA 1SDNA 1XJ3A 5GL9A 3DWKA 3BQAA 2G2WA 1MKMA 1SDEA 2Y4AA 5DVAA 4B4ZA 4S2JA 4ZRRA 3VOYA 2QKPA 1XX2A 4Y0TA 4PAUA 3LR0A 3UMEA 3VE3A 2C6WB 1HZOA 3P09A 4N92A 5EE8A 3SZTA 3NOUC 4R3AA 4I3JA 5K5BA 1NYYA 1WYCA 3GSGA 3KSHA 3FV7A 2CC1A 4L9EA 3ZNYA 5KZHA 3BFEA 1V9YA 3PBSA 5A8BA 1F9IA 1K56A 4Y0OA 1L0EA 1K57C 4LENA 2Z2LB 4EERA 1OTBA 4WF0A 4MLLA 4KENB 3P01A 4OVDA 1H3QA 5FQMA 3T12B 2J8YA 5IS1A 1K54A 4HBUA 3Q7VA 1H8MA 3RTYA 2QJ5A 1GSWA 4PM7A 2MJ6A 2VGKA 3UB9A 4DXCA 5EVEA 3BLSA 2PRFA 3LR5A 1P97A 1Y4OA 2DRWA 3FPWA 3ZG5A 4IUKA 3CPTB 4N9KA 3JVVA 1JTGA 3PBTA 1ERQA 3ITAA 4LCMA 4E04A 4JGRA 4XUXA 4II7A 2J3TD 2XGNA 4JXWA 5DFXA 3T1SA 3BWLA 3ZVWA 3VP3A 5HL1A 4WM9A 5J4EA 3N6IA 2PU2A 3BFCA 3G34A 3CUEC 1IKIA 4S2MA 2RCXA 4KG6A 5AVEA 5FI7A 2ZQCA 4WZ4A 4EBPA 1LI0A 4EQ1A 1IYSA 1HVBA 4Y13A 3GQZA 4Z9QA 3OPPA 2ZL1A 4C75A 4E3NA 3O3VA 3H82A 1EROA 1LI9A 2O99A 2L1MA 4H8RA 3C30A 5DTSA 5E2HA 5AQAA 3ZNTA 2WZZA 2OSUA 1ALQA 1NJ4A 3PAEA 2Q9MA 2WZXA 1W8QA 5CEDA 3ZGAB 5EFWA 5KSCA 4Q0IA 2XFSA 3LCEA 4KZ6A 1JTDA 3BYDA 5AVFA 2EWWA 3IWOA 4NXFA 4KG5A 4QB8A 2PBDP 2PHYA 3IS2A 3A3IA 3CMZA 3G30A 1H0MA 1VEUA 5L10A 4QY5A 5EPHA 1T1CA 4DJ3A 4KZ5A 5FL3A 4C3QA 3T4OA 3UPOA 5EECA 1W63Q 1NYMA 2EXAA 3KO6A 1VB6A 4IUHA 3ZG8B 3PAGA 1FR6A 3TW8A 3CZDA 3IXGA 1IKGA 4L9FA 4S2KA 5FEFA 3IH8A 2R78A 1TD5A 4Q0HA 4PM6A 2NUTC 5F5YA 4WL9A 1XJ6A 2O0YA 2EWVA 1J3WA 2VGLS 2GNXA 2XROA 1KOUA 3GDIA 4WMCA 2VA0A 2VGLM 2ZC3B 1IYQA 4DJ2A 1PZOA 3R7WA 3BECA 4GS9A 2V8CA 5FATA 4GHIA 4S2LA 1XGIA 4HESA 3PBOA 2EFUA 3H7WB 3BLMA 5DJTA 4DDSA 2EX6A 3FWLA 1XKZA 3C7UA 5HW3A 1A0KA 5E2GA 5G4ZA 4JGQA 2Y2QA 4YINA 4FH4A 4X1LA 1ACFA 1LSVA 3PYPA 3BY8A 2ZM8A 1NRJA 1SHVA 1CI9A 3VFFA 3E2KA 2DCFA 1LLBA 3ZYTA 5HL6A 3LYXA 1IOUA 2H0YA 2V8FA 2WKHA 3E4OA 3LR4A 3W4PA 5FQIA 1MXOA 1XFNA 3HLEA 3ICYA 1FCMA 1K54C 4KQOA 1KE0A 2W1TB 3ZVTA 3T1RA 3O86A 4QJGA 1GHPA 1YLPA 3UE1A 5EVIB 3BW6A 3RFBA 1K0KA 4I38A 3WS0A 4CQHA 2ZC6B 4Y5FA 3HJKA 3CJMA 4LCLA 2KX6A 5CGSA 4DXBA 3MMHA 3IWIA 4GLQA 2XK1A 5HDDA 2WUQA 3ZQ5A 2XRNA 4MNRA 3N7WA 4AFIA 4KZ8A 1XXMA 2HJEA 1GSVA 2ZQ9A 3KX0X 4IHQA 1FOFA 5HD3A 5CHUA 3VMAA 2E8IA 1MKIA 2KLIA 4JXVA 1LT0A 3DTEA 1PRQA 1MBLA 5EM0A 4HEFA 4U0TA 2K2NA 3SS3A 3NECA 5GLCA 2JBFA 1YLYA 1BT5A 5CEBA 1G6AA 3G32A 3A3EA 4BWIA 2WGWB 4WEJA 3AGDA 2H28A 4U3TA 1ODVA 2FZ0A 3OBFA 3M2JA 4RYEA 4EEUA 2OWJA 3FYZA 5HARA 4B4XA 1ZG6A 1AWIA 4GZBA 4IJGA 5HFOA 1ES2A 5DTTA 2ZJ9A 3BY9A 1I2SA 4GHIB 4S2IA 4HIAA 2JKTM 1E3UA 3F1PB 1STZA 2Y2KA 2Z2MB 3VP2A 3DAVA 4OPZA 2Y2HA 2XEPA 4I3AA 1KE3A 2V1AA 2PDRA 1CF0A 3V3RA 4B93A 1MWSA 3UDFA 1GHMA 3LY4A 3U2AA 2L4RA 4LV0A 5L2FA 5FDHA 4GD8A 2B02A 5AJGA 3SS5A 2J3WA 1H8YA 4R0QA 3A3JA 4OOMA 1WYBA 3MR0A 5IU1A 1MWTA 3T4TA 3KYQA 3EGXC 1YSPA 3IF6B 1JNUA 2HDRA 1OPXA 3BJNA 5KIZA 2Y2OA 5TFQA 5HSQA 3B3XA 1TS7A 2PR6A 1K6RA 4BBVA 3CUEA 4DE0A 2W0NA 3BM6A 5F69A 1PNEA 3MZFA 5CGWA 5IT5A 1VEUB 4YNRA 3EEHA 1M40A 4K91A 3UDIA 2ZM2A 4HJ3A 2PD7A 2HPBA 3LGOA 2ZC5B 1LHYA 3VOLA 1D06A 5FQKA 5CTMA 4WYYA 2YKFA 1DY6A 2WKPA 5M19A 4EW7A 5EVIC 4EESA 1TVFA 4DDYA 4N9LA 3DW0A 4LRXC 4Q8IA 1NRFA 5D3OA 2QWSA 4BL3A 4MDZA 4XT2A 4D2OA 4X1MA 1KDWA 3A0RA 5L07A 4QU3A 2W1TA 5FI2A 3UB8A 3NDEA 2ZD8A 2X01A 5EVID 2Y79A 3SH7A 1CQAA 5E2FA 2EXBA 2JCHA 4K0XA 1FSYA 1CEGA 3F1OA 2JKGA 4WEKA 1KGFA 1W7FA 4MN7A 1Z09A 3WS4A 1XA1A 3A3DA 2JHEA 2JC7A 5HZHA 3MFDA 3U4LP 3JYIA 3H7WA 4I5SA 2FFFB 5TGFA 2HF6A 4LV1A 4PMAA 3HVFA 3O5YA 2V9AA 4GDBA 1IEMA 1MWRA 3OPHA 3MJQA 3VFHA 4EBLA 1NWZA 2UV0E 1OJGA 3T4QA 4IEDA 3W8KA 2HZ5A 4QHCA 1HTZA 2A3UA 2I72A 2RL3A 3CPTA 3NCKA 1OTAA 1GCEA 1JVJA 2ZQAA 3ZG0A 1PW8A 5FI6A 3IHBA 1NLZA 4DE2A 3S7OA 3K3DA 3NBLA 2ZC4B 3DTKA 4Q0JA 3KYEA 4LFUA 3E0YA 1O07A 5A92A 1JWVA 1P0ZA 3N8LA 4BD0A 4ETXA 1WA9A 1ES3A 2EFXA 1S4RA 2VV6A 1N9BA 1S1YA 2A24A 5HWTA 3PTEA 3GMWA 4ID4A 4OQGA 4M4XA 4FH2A 4LRYC 4OPYA 3W4QA 3Q81A 3KSFA 4MBKA 4QY6A 4P0MA 3FC7A 1MZUA 2VV7A 4LRZE 4UA9A 3HLGA 4G3VA 4NXBA 3JVUA 4OP8A 2WYXA 2OAQ1 2R9XA 2WK0A 4G3KA 2ZOIA 1ESUA 3ULFA 1TS0A 2ACGA 3GTCA 3P7NA 2Y59A 3QP8A 3BQ8A 2AVXA 4FSFA 5HPFA 1L0GA 4Y7PA 5DF7A 3T4LA 3UE6A 2W3HA 5L09A 1V9ZA 1Q2PA 3Q07A 2HDUA 3QP2A 5HDSA 4S2NA 2P74A 4JPMA 4DE1A 1SKOA 1N4OA 2V0UA 4EBNA 4NEED 1BUEA 1XFQA 2ZL1B 4U0XA 3CI6A 2WKQA 3RJUA 3QP5A 5GLAA 4HHDA 3C4OA 1PI5A 4OLDA 3KYZA 1BYWA 3HLWA 1Q2QA 4MEZA 4X53A 3G4PA 2P08A 2Q0OA 3LIBA 2V20A 3C38A 4CLCE 2Y2NA 4IVIA 1G6OA 4ZJ1A 3G6OA 4CPKA 3IH9A 3VSKA 3UDXA 2OAP1 3C5AA 3S22A 4WLAA 3TG9A 1MWUA 4XT2B 2W3EA 4GCZA 1YQSA 1W8YA 2Z6CA 4KUKA 3VSLA 3EQVA 2WAFA 3G2YA 4S2OA 5HDCA 4FD8A 4D60A 5TBMB 3HLDA 1S4SA 2WKRA 5FAPA 4I39A 2WGVA 1VETA 4BD1A 1XJ2A 4NXEA 2GJ3A 1ZG4A 1K4FA 1LL9A 5EVLA 2E8JA 3M6BA 2M7UA 1Y28A 5CHMA 3LIFA 5GLBA 1P9RA 2HJ9C 2ZMFA 3C2WA 1JWZA 1S67L 2INWA 1UWNX 2EX8A 4E3LA 4WELA 1J9MA 2I9VA 4FUWA 2ZQ7A 4BBTA 1FIKA 1E4DA 3A3FA 4MBHA
chains in the Genus database with same CATH topology
4CLCB 3E4QA 5G4YA 1UGUA 5J3WA 1D7EA 4ARZA 3UMDA 2B18A 2A2LA 4BWIA 4WEJA 4MMNA 2DMWA 3LI8A 3PXPA 2D01A 4EETB 4ETZA 2H28A 4G3WA 1ODVA 3UB7A 2FZ0A 3E4PA 2JN7A 2HV1A 3CITA 4GJ4A 3OBFA 1TS8A 2L0WA 3IS2B 4EEUA 2W1RA 3NHQA 2OWJA 4JGPA 1DP9A 4L0LA 1DP6A 4LPZA 2QHKA 4MCWA 1T1AA 3MXQA 5KSHA 3S7QA 3LR3A 1XJ3A 2KDKA 4IJGA 4O8GA 3BQAA 1MKMA 3BY9A 4UEYA 4GHIB 3OCNA 4NKPA 4HIAA 2JKTM 4R6LA 3F1PB 1STZA 4ZRRA 3R7WB 3PR6A 2QKPA 2JKRI 4I3AA 3LR0A 4PAUA 1OTDA 2JKRM 2V1AA 4R38A 1OT9A 3W2ZA 4HOIA 2PDRA 4K08A 3UMEA 4WUJA 4HP4A 3VE3A 4B93A 4HH3A 3TJZC 2PR5A 3OOVA 3U2AA 3MQ0A 2L4RA 3NOUC 5C5KA 5AJGA 2B02A 4R3AA 2J3WA 4I3JA 4CLCA 4HY8A 5K5BA 2VZWA 4OOMA 4ARZB 2J80A 3MR0A 2OOLA 3KSHA 5IU1A 3T4TA 3KYQA 3EGXC 4L9EA 1YSPA 1V9YA 2P7JA 1JNUA 3BJNA 1OPXA 3PBSA 5KIZA 5A8BA 1F9IA 4OOLA 2W27A 2P04A 3LUQA 3CLOA 4NXGA 5HSQA 1TS7A 2K7SA 2PR6A 2FH5A 4EERA 1OTBA 4WF0A 5CX7A 4BBVA 3CUEA 5LBRA 3P01A 2W0NA 1H3QA 2GZAA 3PBNA 5F69A 2VKSA 5IS1A 1ZHHB 1H8MA 3RTYA 2QJ5A 1GSWA 3A0SA 2Z6DA 5IT5A 2MJ6A 4YNRA 3EEHA 4YOFA 4BJPA 3MFXA 4HJ3A 3UB9A 2PD7A 4MN5A 3A0VA 3LR5A 1P97A 3FPWA 4IUKA 2LB9A 3JVVA 1GSXA 3PBTA 4JGOA 4E04A 3VOLA 1D06A 4JGRA 2EA9A 5L8MA 4II7A 2YKFA 2J3TD 1DRMA 1P9WA 2WKPA 4Y3IA 4BMWA 4EW7A 5DKKA 4EESA 5DFXA 4HNBA 3LI9A 3BWLA 2XA7S 4LRXC 2QWSA 3NOTC 4PHTA 4MDZA 4XT2A 4EU0A 2O9CA 1ZTUA 2YKHA 2PYRA 2W3DA 5J4EA 1N9OA 3F1NA 1X0OA 3A0RA 3DBAA 3OCLA 2VX8A 4HI4A 3CUEC 2W1TA 5AVEA 3UB8A 3C8CA 2VLGA 2Y79A 4EQ1A 4I3IA 1S1ZA 5DFYA 3K2NA 4Y2FA 1NLYA 3B47A 3MQOA 3F1OA 4WEKA 2CMNA 4MN7A 1DP8A 3H82A 2O99A 2L1MA 1EW0A 3T4KA 1TS6A 4QPRA 4EUVA 3MF0A 3C30A 2PT7A 2JHEA 1LL8A 5HZHA 4P6ZM 3H7WA 4I5SA 1T18A 3F1PA 3V67A 2HF6A 3O5YA 3LFVA 2QJ7A 2V9AA 4L9GA 4Q0IA 5EFWA 2NUPC 2QYBA 2JKTI 2VV8A 3MJQA 5AVFA 2EWWA 1NWZA 4NXFA 1OJGA 2PHYA 3T4QA 3HCYA 3IS2A 4DMZA 1G28A 5DF9A 1OTAA 1T19A 1MC0A 3FG8A 1T1CA 4DJ3A 3T50A 3NOPC 1NLZA 2W3FA 2O9AA 4UQIS 2Y8HA 2IA2A 3S7OA 3K3DA 4HJ4A 4F3LA 5FL3A 1LSWA 3T4OA 1YKDA 4Q0JA 3PBRA 4HH2A 3E0YA 2XA7M 1W63Q 3KO6A 1VB6A 4IUHA 4ME4A 2XSSA 3KSIA 1P0ZA 4ETXA 1OJ5A 1WA9A 3TW8A 4FOFA 1S4RA 2VV6A 4L9FA 5J7EA 4F3LB 1S1YA 2R78A 1TD5A 4Q0HA 3FPVA 2A24A 5HWTA 2NUTC 3R4KA 5F5YA 3H9WA 4WL9A 3IBRA 4M4XA 1LSXA 4LRYC 1XJ6A 2O0YA 5TJJA 3KSFA 3FC7A 1MZUA 2VV7A 4LRZE 2EWVA 5I5LA 3S7NA 2VGLS 4G3VA 4NXBA 2GNXA 2XROA 1KOUA 4O0PA 3GDIA 3JVUA 2VA0A 4LLOB 5F6AA 3B33A 5TBMA 4PKYG 2OAQ1 3TE8A 2VGLM 4G3KA 5HPIA 4DJ2A 3R7WA 2ZOIA 3ULFA 1TS0A 4GS9A 3P7NA 4GHIA 3BQ8A 2V1BA 4P6ZS 3OLOA 4FSFA 5HPFA 3PBOA 2ZOHA 1N9NA 2PD8A 3T4LA 3UE6A 3H7WB 5DJTA 2W3HA 2M1CA 1N9LA 1F5MA 3EWKA 1V9ZA 3GECA 5G4ZA 3NJAA 4JGQA 1LSVA 3PBQA 3PYPA 5HDSA 3CAXA 5HWWA 2HGVA 3BY8A 1NRJA 3D3OA 2VJWA 2V0UA 3B42A 2ZMVA 3H82B 4KUOA 4NEED 5DKLA 1XFQA 3CI6A 1S66L 2WKQA 3F1OB 3ZYTA 4GW9A 5HL6A 3LYXA 1IOUA 4HHDA 2PYPA 2W3GA 3E4OA 4PKYA 3LR4A 5HD5A 5MC7A 2K31A 3KYZA 1BYWA 4HP9A 1XFNA 3ICYA 4KQOA 2W1TB 4UQIM 2P08A 3LIBA 3SW1A 3LIAA 3VV4A 3C38A 2LB5A 4CLCE 1G6OA 3G6OA 3EOIA 1W63M 3IBJA 3F1NB 2GX5A 2OWHA 2D02A 3BW6A 2KOIA 4HJ6A 4HQAA 2OAP1 3RFBA 3LIDA 4I38A 4WLAA 4CQHA 3KSGA 4XT2B 3RH8B 4B9OA 2VEAA 4H6JB 2O9BA 2W3EA 4R70A 4CLCD 3T4JA 3HJKA 1T1BA 1YSQA 4WN5A 4Y5FA 4YWZA 2KX6A 4GCZA 3EQUA 3LICA 2Z6CA 4KUKA 4GS9B 3OC2A 2J3TC 3EQVA 3MMHA 5HDCA 4DN0A 3UE3A 5TBMB 2BASA 4GLQA 1XJ4A 2M7VA 5HDDA 1S4SA 2WKRA 3ZQ5A 4I39A 1UWPX 2XRNA 3K3CA 4MN6A 3TRCA 3T4SA 3PHYA 3VE4A 3EEAA 4AFIA 4CLCC 1XJ2A 1VHMA 4NXEA 2HJEA 4BBUA 1GSVA 2GJ3A 4EEPA 4EXOA 3E98A 1OTEA 1OTIA 3KX0X 4IHQA 5HD3A 1Y28A 1TF1A 2M7UA 2A24B 3LIFA 4Z1WA 4H6JA 1P9RA 2HJ9C 2ZMFA 3S7PA 5HWVA 4O01A 3C2WA 2G7UA 2KLIA 1IFQA 1S67L 1YAXA 1UWNX 2INWA 3CWFA 5F68A 1LT0A 4WELA 4KQDA 2I9VA 2V0WA 3D72A 2ZBBA 1F98A 4BBTA 3HJIA 5DJUA 3MQQA 3LIEA 2K2NA 3EGDC 4RQ9A 1OT6A 3UB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUO A;  2PHY A;  2V0U A;  3EEH A;  3H82 B;  5DKL A;  3E4Q A;  1XFQ A;  3IS2 A;  3MFX A;  4HJ3 A;  3UB9 A;  5G4Y A;  1G28 A;  1S66 L;  1UGU A;  2WKQ A;  1D7E A;  2PD7 A;  3F1O B;  4MN5 A;  5J3W A;  3UMD A;  3A0V A;  1P97 A;  4GW9 A;  1OTA A;  3LI8 A;  3LYX A;  2D01 A;  4EET B;  2H28 A;  1T19 A;  4WN5 A;  4HHD A;  1ODV A;  3UB7 A;  1GSX A;  3E4P A;  2PYP A;  3E4O A;  2JN7 A;  2HV1 A;  4PKY A;  5HD5 A;  3FG8 A;  4JGO A;  4E04 A;  3VOL A;  1D06 A;  1BYW A;  1TS8 A;  2L0W A;  1XFN A;  2EA9 A;  4HP9 A;  4JGR A;  2YKF A;  3ICY A;  3IS2 B;  1T1C A;  4DJ3 A;  1DRM A;  3T50 A;  3NOP C;  2WKP A;  4EEU A;  5J7E A;  3NHQ A;  2OWJ A;  4JGP A;  1DP9 A;  3LIB A;  5DKK A;  4EW7 A;  1DP6 A;  3SW1 A;  3LIA A;  4LPZ A;  3K3D A;  4HJ4 A;  2QHK A;  4EES A;  4F3L A;  1T1A A;  1LSW A;  3MXQ A;  4HNB A;  3LI9 A;  3G6O A;  3BWL A;  1XJ3 A;  2KDK A;  3F1N B;  4HH2 A;  4LRX C;  2OWH A;  2D02 A;  4HJ6 A;  1VB6 A;  4HQA A;  2QWS A;  3NOT C;  3LID A;  4XT2 A;  4I38 A;  4WLA A;  1P0Z A;  1OJ5 A;  1WA9 A;  3BY9 A;  4XT2 B;  2YKH A;  4GHI B;  3RH8 B;  2VEA A;  4HIA A;  4B9O A;  1S4R A;  2PYR A;  2VV6 A;  4H6J B;  4R6L A;  3F1P B;  3HJK A;  1T1B A;  1N9O A;  4L9F A;  3F1N A;  1X0O A;  2KX6 A;  3A0R A;  4GCZ A;  1S1Y A;  2R78 A;  4F3L B;  3LIC A;  2Z6C A;  2QKP A;  4KUK A;  4HI4 A;  2A24 A;  5HWT A;  4GS9 B;  4I3A A;  4R38 A;  1OTD A;  2V1A A;  5F5Y A;  1OT9 A;  3H9W A;  4WL9 A;  5AVE A;  4HOI A;  2PDR A;  3C8C A;  4K08 A;  3UB8 A;  4WUJ A;  3IBR A;  4HP4 A;  1LSX A;  4LRY C;  2VLG A;  4M4X A;  1XJ6 A;  4HH3 A;  5HDC A;  3VE3 A;  4EER A;  4EQ1 A;  4I3I A;  3FC7 A;  1S1Z A;  1MZU A;  5TBM B;  2VV7 A;  2PR5 A;  4LRZ E;  2BAS A;  5I5L A;  1XJ4 A;  3MQO A;  2L4R A;  3NOU C;  5HDD A;  1S4S A;  2WKR A;  3F1O A;  4NXB A;  3ZQ5 A;  1KOU A;  4I39 A;  1UWP X;  2B02 A;  2CMN A;  3GDI A;  3K3C A;  4R3A A;  4MN6 A;  4I3J A;  4HY8 A;  4LLO B;  5F6A A;  3B33 A;  3PHY A;  5TBM A;  3VE4 A;  1DP8 A;  4PKY G;  2J80 A;  3MR0 A;  1XJ2 A;  2OOL A;  5IU1 A;  3UME A;  4NXE A;  4BBU A;  3H82 A;  1GSV A;  2GJ3 A;  4R70 A;  4EEP A;  4L9E A;  4EXO A;  2L1M A;  1OTE A;  1EW0 A;  4DJ2 A;  1TS6 A;  1V9Y A;  4YWZ A;  1OTI A;  3KX0 X;  2P7J A;  2ZOI A;  5HD3 A;  3ULF A;  1JNU A;  1Y28 A;  1TS0 A;  4GS9 A;  5KIZ A;  2A24 B;  2JHE A;  3LIF A;  3P7N A;  1F9I A;  4H6J A;  1LL8 A;  5A8B A;  5J4E A;  5HZH A;  4GHI A;  5HWV A;  2W27 A;  3H7W A;  2V1B A;  1T18 A;  3C2W A;  3F1P A;  3OLO A;  4I5S A;  3LUQ A;  3CLO A;  4NXG A;  5HSQ A;  2ZOH A;  1N9N A;  1S67 L;  1TS7 A;  1UWN X;  2INW A;  2K7S A;  2PD8 A;  2PR6 A;  3CWF A;  1LT0 A;  5F68 A;  1OTB A;  3H7W B;  4WF0 A;  5DJT A;  3UE6 A;  4BBV A;  4KQD A;  2I9V A;  2M1C A;  2V0W A;  3D72 A;  2ZBB A;  1F98 A;  2QJ7 A;  2V9A A;  2W0N A;  1N9L A;  4L9G A;  5EFW A;  4BBT A;  3EWK A;  1V9Z A;  3GEC A;  3HJI A;  3NJA A;  4JGQ A;  5G4Z A;  5DJU A;  5F69 A;  2VV8 A;  5IS1 A;  3MJQ A;  3MQQ A;  1LSV A;  3LIE A;  5AVF A;  3PYP A;  4RQ9 A;  5HDS A;  3CAX A;  3RTY A;  1NWZ A;  3BY8 A;  5HWW A;  2QJ5 A;  1GSW A;  4NXF A;  1OT6 A;  3A0S A;  1OJG A;  3UB6 A;  2Z6D A; 
#chains in the Genus database with same CATH topology
 1DJC A;  1ES5 A;  5G4Y A;  3VP0 A;  4P6B A;  5J3W A;  2FFY A;  1D7E A;  4ARZ A;  4S2N C;  4MMN A;  3LI8 A;  4JXG A;  3P98 A;  1EWZ A;  4G3W A;  3E4P A;  3V50 A;  2JN7 A;  3CIT A;  3ZG9 B;  5FEG A;  1Z6F A;  3HL9 A;  2XDM A;  1DP6 A;  4LPZ A;  1IYO A;  4MCW A;  2XR0 A;  5KSH A;  3LR3 A;  1LL5 A;  3W4O A;  2KDK A;  2EX2 A;  1HLU P;  2J9P A;  4N1X A;  4KZ9 A;  3NC8 A;  1BUL A;  1NXY A;  4E3O A;  3OCN A;  4NKP A;  3BFD A;  2VGJ A;  3PR6 A;  3W2Z A;  4R38 A;  4RX2 A;  4A5R A;  4K08 A;  4HP4 A;  3TJZ C;  3VP4 A;  1YLZ A;  4X56 A;  5M1A A;  3L9K A;  1I2W A;  1YMX A;  4OPR A;  3I7J A;  4KZ4 A;  4WBG A;  3HUN A;  2P7J A;  1NZU A;  1TEM A;  4JKT A;  2W27 A;  1K55 A;  2P04 A;  3LUQ A;  4NXG A;  4JXS A;  5CTN A;  2K7S A;  4OLG A;  5LBR A;  4GDN A;  3ITB A;  5F1G A;  2VK3 A;  3PBN A;  5CGX A;  2VKS A;  3RXW A;  4KZB A;  2Z6D A;  1BLS A;  3MFX A;  4PPR A;  3D4F A;  4DKI A;  3IHA A;  2WAE A;  4JGO A;  5EM1 A;  4PM9 A;  5L8M A;  1XPB A;  4GKU A;  1DRM A;  1QMF A;  1P9W A;  4Y3I A;  3G2Z A;  4BMW A;  5DKK A;  1DJB A;  2XD1 A;  4HNB A;  3LI9 A;  1KE4 A;  1PZP A;  1QME A;  2XA7 S;  2XH9 A;  4GD6 A;  3NOT C;  4EU0 A;  1F2K A;  2XQZ A;  2O9C A;  4M3K A;  1ZTU A;  1PI4 A;  2YKH A;  3GV9 A;  3HRE A;  1H5X A;  4P85 A;  1RGY A;  5HAI A;  3DTI A;  2ZLY A;  5TR7 A;  1G68 A;  3IF6 A;  1W79 A;  3NI9 A;  2WKE A;  4I3I A;  1S1Z A;  3K2N A;  4Y2F A;  1NLY A;  3BEB A;  3MQO A;  3HLB A;  1FCN A;  1YLT A;  1PWC A;  3T4K A;  1TS6 A;  3T1Q B;  4FCF A;  4XUZ A;  1LL8 A;  4WMC D;  3F1P A;  2OV5 A;  3V67 A;  2XD5 A;  4LV3 A;  3ZFZ A;  1VM1 A;  1YM1 A;  1NZO A;  2H0T A;  2QJ7 A;  3MS6 A;  4MBF A;  2QYB A;  4R3J A;  2JKT I;  2VV8 A;  3V39 A;  4ZAM A;  2EX9 A;  3UN7 A;  2BTF P;  3L7H A;  4LGW A;  3HCY A;  4DMZ A;  2HDS A;  1BZA A;  5DF9 A;  3C7V A;  3IF5 A;  4QWO A;  1RGZ A;  1T19 A;  1MC0 A;  2UWX A;  3NOP C;  4RVA A;  1W5D A;  1KGE A;  2W3F A;  1KVM A;  2O9A A;  3G31 A;  4UQI S;  2IA2 A;  3V3S A;  5U47 A;  1LSW A;  3PBR A;  3FZC A;  4HH2 A;  2XA7 M;  1YMS A;  4R1G A;  1ES4 A;  3NUL A;  1CI8 A;  3KSI A;  1OJ5 A;  4FOF A;  4E3K A;  3S1Y A;  5DF8 A;  4F3L B;  3FPV A;  2IWC A;  1LSX A;  4OON A;  3RXX A;  3QNB A;  5FAO A;  3WS5 A;  3FKW A;  2C5W B;  4OOY A;  5I5L A;  3LO7 A;  1IYP A;  1MY8 A;  2G2U A;  4UAA A;  3S7N A;  2Y2M A;  4O0P A;  4JF4 A;  4LLO B;  2PU4 A;  3B33 A;  1FR1 A;  3JPU A;  4PKY G;  4XXR A;  3QHY A;  3D9Y A;  2IWD A;  3MKE A;  2V1B A;  4OQI A;  3IQA A;  4IBX A;  4PM5 A;  4BQM A;  3SOI A;  2M1C A;  5EVI A;  1F5M A;  3EWK A;  2PAV P;  2Y2P A;  3PBQ A;  3WWX A;  3GRJ A;  2V2F F;  3D3O A;  2VJW A;  5DKL A;  3H82 B;  3F1O B;  1KGG A;  5GLD A;  2WGW A;  4OP5 A;  1PWG A;  3SH9 A;  2PYP A;  5MC7 A;  1FIL A;  3IXD A;  2ZQ8 A;  2K31 A;  4EQI A;  4HP9 A;  2JKF A;  1BLH A;  2OLU A;  4E3M A;  3M2K A;  5FAQ A;  3EOI A;  1W63 M;  1K55 C;  3HLC A;  4GN2 A;  5DTK A;  3LID A;  3KSG A;  2Y91 A;  4H6J B;  2O9B A;  4WN5 A;  1MPL A;  1T1B A;  2DNS A;  2Y2I A;  3MBZ A;  5EV0 A;  1FCO A;  1ZC2 A;  3EQU A;  3N4I A;  3LIC A;  2IWB A;  1CEF A;  4KZ7 A;  4GS9 B;  3OC2 A;  4OH0 A;  2J3T C;  2Y55 A;  4R4S A;  4UA7 A;  3MXS A;  3NDG A;  4UA6 A;  2BAS A;  3IF6 C;  1XJ4 A;  1PFL A;  5I94 A;  3LY3 A;  2M7V A;  4X6T A;  1GHI A;  4B88 A;  3M6H A;  4GNU A;  4MN6 A;  1K6S A;  3TRC A;  3HLF A;  3VE4 A;  4JF5 A;  1O7E A;  3ZHH A;  4BBU A;  4EEP A;  3Q1F A;  1L3L A;  4IVK A;  3MKF A;  1OTI A;  4Z1W A;  1YPR A;  4H6J A;  5EOO A;  4OQ0 A;  2G7U A;  1HD8 A;  4FTX A;  1M6K A;  2Y2J A;  1IFQ A;  4R4R A;  1VQQ A;  5F68 A;  3NIA A;  2A49 A;  3D72 A;  2V0W A;  1F98 A;  4BLM A;  5DJU A;  5HX9 A;  5F82 A;  1OT6 A;  4X69 A;  3UB6 A;  1JWP A;  4CLC B;  3E4Q A;  1RP5 A;  1PWD A;  1UGU A;  3UMD A;  2B18 A;  2A2L A;  1BLP A;  4JLF A;  1CJF A;  1SZV A;  2DMW A;  3PXP A;  4ETZ A;  5F83 A;  5EUA A;  3CG5 A;  2L0W A;  1K4E A;  1L2S A;  3IS2 B;  3WS2 A;  4JGP A;  1ZKJ A;  5GHX A;  4O7D A;  4KG2 A;  2QHK A;  1T1A A;  3UPN A;  3UB5 P;  4O8G A;  2J7V A;  3LEZ A;  4UEY A;  4ESP A;  1BLC A;  1SKF A;  4R6L A;  3MXR A;  3R7W B;  1ESI A;  2ZM0 A;  3DTM A;  2JKR I;  1L0F A;  1OTD A;  2JKR M;  3ISG A;  1OT9 A;  4HOI A;  4WUJ A;  4HH3 A;  1E3U D;  2PR5 A;  2QZ6 A;  3OOV A;  3SH8 A;  3QP6 A;  3MQ0 A;  3UE0 A;  5C5K A;  5IHV A;  4CLC A;  4HY8 A;  2XLN A;  3C4P A;  2VZW A;  4ARZ B;  2J80 A;  2OOL A;  4ZJ2 A;  5M18 A;  4EWF A;  1NY0 A;  4JBF A;  1FQG A;  4OOL A;  3CLO A;  4R23 A;  3GR2 A;  2FH5 A;  5CX7 A;  4OPQ A;  1DJA A;  2OLV A;  1Y54 A;  2GZA A;  3LEQ A;  4NG2 A;  3E2L A;  4X68 A;  1ZHH B;  2R9W A;  4X55 A;  3A0S A;  4BJP A;  4YOF A;  3ZG7 B;  4MN5 A;  3A0V A;  1OME A;  2LB9 A;  1GSX A;  2B5R A;  1KDS A;  2WAD A;  5CER A;  2BG1 A;  2EA9 A;  1E25 A;  3ZDJ A;  4PM8 A;  5FSR A;  3OZH A;  4QD4 A;  2V1Z A;  3VOZ A;  3QP4 A;  3IT9 A;  4PHT A;  2ZC7 A;  4ZDX A;  3BFF A;  1SCW A;  2PYR A;  2W3D A;  1N9O A;  3F1N A;  1X0O A;  3DBA A;  4Y15 A;  3OCL A;  3WS1 A;  2VX8 A;  3Q7Z A;  2Y2G A;  4HI4 A;  1FSW A;  2PBY A;  2Y2L A;  1L0D A;  5CXW A;  3C8C A;  3S4X A;  3HUO A;  2VLG A;  3UY6 A;  5JYP A;  1YLJ A;  2XF3 A;  3DWZ A;  1H8Z A;  5DFY A;  3B47 A;  4E3I A;  2QMI A;  4NK3 A;  1RCJ A;  3O87 A;  2CMN A;  1XGJ A;  1DP8 A;  4ZTK A;  5FAS A;  1PIO A;  1EW0 A;  4QPR A;  4EUV A;  3MF0 A;  5F1F A;  2PT7 A;  5E43 A;  3VP1 A;  4P6Z M;  1T18 A;  2WKI A;  1XA7 A;  1S0W A;  3LFV A;  4L9G A;  4DE3 A;  2NUP C;  5FDS A;  5GHZ A;  4Y0U A;  5A91 A;  4E6X A;  5AQ9 A;  4ZJ3 A;  1ERM A;  2P9V A;  1G28 A;  3HUM A;  1U60 A;  3UO9 A;  2HP9 A;  4KQQ A;  4NET A;  4GB7 A;  3FG8 A;  3MZD A;  5FA7 A;  5GHY A;  3T1X A;  4RA7 A;  3T50 A;  4EUZ A;  2Y8H A;  4F3L A;  4HJ4 A;  3BRM A;  1YKD A;  3NY4 A;  4UHU A;  4JF6 A;  4ME4 A;  5EOE A;  2XSS A;  5A93 A;  3IX3 A;  4OQH A;  5J7E A;  4HBT A;  5FQJ A;  5CEC A;  3R4K A;  3H9W A;  2JE5 A;  3IBR A;  5TJJ A;  4IBR A;  3IXH A;  1VET B;  3TSG A;  1IEL A;  3V5M A;  5F6A A;  5TBM A;  4BEN A;  3TE8 A;  2P9V B;  5AQB A;  5CHJ A;  4BL2 A;  1TDG A;  2XFT A;  4E6W A;  5HPI A;  2X02 A;  5HAP A;  1K25 A;  3QP1 A;  5FQQ A;  3IWQ A;  1EI5 A;  4P6Z S;  3OLO A;  3BFG A;  1I5Q A;  2ZOH A;  1N9N A;  1AXB A;  1GA0 A;  2PD8 A;  5G18 A;  1N9L A;  4K0W A;  3GEC A;  3NJA A;  3TOI A;  1K38 A;  3CAX A;  5HWW A;  2HGV A;  2B95 A;  3B42 A;  4KUO A;  1YT4 A;  2ZMV A;  3IX8 A;  4EV4 A;  1S66 L;  2H5S A;  2H10 A;  3UNW A;  4GW9 A;  3G35 A;  2ZMA A;  3FKV A;  3MSH A;  4N1H A;  2W3G A;  3UPP A;  4PKY A;  5HD5 A;  4F94 A;  5AQ7 A;  1KVL A;  4E3J A;  4KQR A;  4DF6 A;  2X71 A;  1SKO B;  4UQI M;  3WRZ A;  5BOH A;  3MZE A;  3SW1 A;  3LIA A;  3VV4 A;  2LB5 A;  3IBJ A;  4YFM A;  3F1N B;  2GX5 A;  2OWH A;  2D02 A;  2WGI A;  2KOI A;  4HJ6 A;  4HQA A;  4LV2 A;  3RH8 B;  4B9O A;  4C6Y A;  3AGF A;  2VEA A;  3WRT A;  4CLC D;  4R70 A;  3T4J A;  4YWZ A;  1YSQ A;  4DRT A;  4WZ5 C;  2HP5 A;  1TDL A;  1S6R A;  4DN0 A;  2HDQ A;  1K57 A;  3UE3 A;  2ZQD A;  5J8X A;  5KMW A;  4WZ5 A;  5HAQ A;  4KZ3 A;  4GOG A;  1UWP X;  3K3C A;  1K56 D;  1C3B A;  1G5U A;  3T4S A;  4R3B A;  3PHY A;  4CJN A;  2GDN A;  3EEA A;  1BTL A;  4CLC C;  1VHM A;  3N8R A;  4EXO A;  3Q7V B;  1PW1 A;  3E98 A;  1OTE A;  4S2P A;  2J9O A;  3IXB A;  1YLW A;  4P87 A;  1TF1 A;  3Q82 A;  4X25 A;  2A24 B;  3S7P A;  4RX3 A;  5HWV A;  4O01 A;  1ONG A;  1YAX A;  2HP6 A;  3CWF A;  1XP4 A;  4ZBE A;  4KQD A;  2ZBB A;  3HJI A;  3N8S A;  1CK3 A;  3MQQ A;  3LIE A;  3EGD C;  1D1J A;  4RQ9 A;  4Y17 A;  1ONH A;  5E2E A;  1WE4 A;  3HBR A;  5JYO A;  5A90 A;  1PYY A;  2BLS A;  4OKP A;  2D01 A;  2QPN A;  4EET B;  3O88 A;  3OPR A;  3UB7 A;  3SS4 A;  2HV1 A;  3OPL A;  5CRF A;  4GJ4 A;  1TS8 A;  5FQ9 A;  1BSG A;  4KZA A;  3AGE A;  2W1R A;  3NHQ A;  1DP9 A;  3CHW P;  4L0L A;  3QNC A;  2Q9N A;  3GVB A;  3MXQ A;  3ZCZ A;  1GA9 A;  3IX4 A;  3S7Q A;  1SDN A;  1XJ3 A;  5GL9 A;  3DWK A;  3BQA A;  2G2W A;  1MKM A;  1SDE A;  2Y4A A;  5DVA A;  4B4Z A;  4S2J A;  4ZRR A;  3VOY A;  2QKP A;  1XX2 A;  4Y0T A;  4PAU A;  3LR0 A;  3UME A;  3VE3 A;  2C6W B;  1HZO A;  3P09 A;  4N92 A;  5EE8 A;  3SZT A;  3NOU C;  4R3A A;  4I3J A;  5K5B A;  1NYY A;  1WYC A;  3GSG A;  3KSH A;  3FV7 A;  2CC1 A;  4L9E A;  3ZNY A;  5KZH A;  3BFE A;  1V9Y A;  3PBS A;  5A8B A;  1F9I A;  1K56 A;  4Y0O A;  1L0E A;  1K57 C;  4LEN A;  2Z2L B;  4EER A;  1OTB A;  4WF0 A;  4MLL A;  4KEN B;  3P01 A;  4OVD A;  1H3Q A;  5FQM A;  3T12 B;  2J8Y A;  5IS1 A;  1K54 A;  4HBU A;  3Q7V A;  1H8M A;  3RTY A;  2QJ5 A;  1GSW A;  4PM7 A;  2MJ6 A;  2VGK A;  3UB9 A;  4DXC A;  5EVE A;  3BLS A;  2PRF A;  3LR5 A;  1P97 A;  1Y4O A;  2DRW A;  3FPW A;  3ZG5 A;  4IUK A;  3CPT B;  4N9K A;  3JVV A;  1JTG A;  3PBT A;  1ERQ A;  3ITA A;  4LCM A;  4E04 A;  4JGR A;  4XUX A;  4II7 A;  2J3T D;  2XGN A;  4JXW A;  5DFX A;  3T1S A;  3BWL A;  3ZVW A;  3VP3 A;  5HL1 A;  4WM9 A;  5J4E A;  3N6I A;  2PU2 A;  3BFC A;  3G34 A;  3CUE C;  1IKI A;  4S2M A;  2RCX A;  4KG6 A;  5AVE A;  5FI7 A;  2ZQC A;  4WZ4 A;  4EBP A;  1LI0 A;  4EQ1 A;  1IYS A;  1HVB A;  4Y13 A;  3GQZ A;  4Z9Q A;  3OPP A;  2ZL1 A;  4C75 A;  4E3N A;  3O3V A;  3H82 A;  1ERO A;  1LI9 A;  2O99 A;  2L1M A;  4H8R A;  3C30 A;  5DTS A;  5E2H A;  5AQA A;  3ZNT A;  2WZZ A;  2OSU A;  1ALQ A;  1NJ4 A;  3PAE A;  2Q9M A;  2WZX A;  1W8Q A;  5CED A;  3ZGA B;  5EFW A;  5KSC A;  4Q0I A;  2XFS A;  3LCE A;  4KZ6 A;  1JTD A;  3BYD A;  5AVF A;  2EWW A;  3IWO A;  4NXF A;  4KG5 A;  4QB8 A;  2PBD P;  2PHY A;  3IS2 A;  3A3I A;  3CMZ A;  3G30 A;  1H0M A;  1VEU A;  5L10 A;  4QY5 A;  5EPH A;  1T1C A;  4DJ3 A;  4KZ5 A;  5FL3 A;  4C3Q A;  3T4O A;  3UPO A;  5EEC A;  1W63 Q;  1NYM A;  2EXA A;  3KO6 A;  1VB6 A;  4IUH A;  3ZG8 B;  3PAG A;  1FR6 A;  3TW8 A;  3CZD A;  3IXG A;  1IKG A;  4L9F A;  4S2K A;  5FEF A;  3IH8 A;  2R78 A;  1TD5 A;  4Q0H A;  4PM6 A;  2NUT C;  5F5Y A;  4WL9 A;  1XJ6 A;  2O0Y A;  2EWV A;  1J3W A;  2VGL S;  2GNX A;  2XRO A;  1KOU A;  3GDI A;  4WMC A;  2VA0 A;  2VGL M;  2ZC3 B;  1IYQ A;  4DJ2 A;  1PZO A;  3R7W A;  3BEC A;  4GS9 A;  2V8C A;  5FAT A;  4GHI A;  4S2L A;  1XGI A;  4HES A;  3PBO A;  2EFU A;  3H7W B;  3BLM A;  5DJT A;  4DDS A;  2EX6 A;  3FWL A;  1XKZ A;  3C7U A;  5HW3 A;  1A0K A;  5E2G A;  5G4Z A;  4JGQ A;  2Y2Q A;  4YIN A;  4FH4 A;  4X1L A;  1ACF A;  1LSV A;  3PYP A;  3BY8 A;  2ZM8 A;  1NRJ A;  1SHV A;  1CI9 A;  3VFF A;  3E2K A;  2DCF A;  1LLB A;  3ZYT A;  5HL6 A;  3LYX A;  1IOU A;  2H0Y A;  2V8F A;  2WKH A;  3E4O A;  3LR4 A;  3W4P A;  5FQI A;  1MXO A;  1XFN A;  3HLE A;  3ICY A;  1FCM A;  1K54 C;  4KQO A;  1KE0 A;  2W1T B;  3ZVT A;  3T1R A;  3O86 A;  4QJG A;  1GHP A;  1YLP A;  3UE1 A;  5EVI B;  3BW6 A;  3RFB A;  1K0K A;  4I38 A;  3WS0 A;  4CQH A;  2ZC6 B;  4Y5F A;  3HJK A;  3CJM A;  4LCL A;  2KX6 A;  5CGS A;  4DXB A;  3MMH A;  3IWI A;  4GLQ A;  2XK1 A;  5HDD A;  2WUQ A;  3ZQ5 A;  2XRN A;  4MNR A;  3N7W A;  4AFI A;  4KZ8 A;  1XXM A;  2HJE A;  1GSV A;  2ZQ9 A;  3KX0 X;  4IHQ A;  1FOF A;  5HD3 A;  5CHU A;  3VMA A;  2E8I A;  1MKI A;  2KLI A;  4JXV A;  1LT0 A;  3DTE A;  1PRQ A;  1MBL A;  5EM0 A;  4HEF A;  4U0T A;  2K2N A;  3SS3 A;  3NEC A;  5GLC A;  2JBF A;  1YLY A;  1BT5 A;  5CEB A;  1G6A A;  3G32 A;  3A3E A;  4BWI A;  2WGW B;  4WEJ A;  3AGD A;  2H28 A;  4U3T A;  1ODV A;  2FZ0 A;  3OBF A;  3M2J A;  4RYE A;  4EEU A;  2OWJ A;  3FYZ A;  5HAR A;  4B4X A;  1ZG6 A;  1AWI A;  4GZB A;  4IJG A;  5HFO A;  1ES2 A;  5DTT A;  2ZJ9 A;  3BY9 A;  1I2S A;  4GHI B;  4S2I A;  4HIA A;  2JKT M;  1E3U A;  3F1P B;  1STZ A;  2Y2K A;  2Z2M B;  3VP2 A;  3DAV A;  4OPZ A;  2Y2H A;  2XEP A;  4I3A A;  1KE3 A;  2V1A A;  2PDR A;  1CF0 A;  3V3R A;  4B93 A;  1MWS A;  3UDF A;  1GHM A;  3LY4 A;  3U2A A;  2L4R A;  4LV0 A;  5L2F A;  5FDH A;  4GD8 A;  2B02 A;  5AJG A;  3SS5 A;  2J3W A;  1H8Y A;  4R0Q A;  3A3J A;  4OOM A;  1WYB A;  3MR0 A;  5IU1 A;  1MWT A;  3T4T A;  3KYQ A;  3EGX C;  1YSP A;  3IF6 B;  1JNU A;  2HDR A;  1OPX A;  3BJN A;  5KIZ A;  2Y2O A;  5TFQ A;  5HSQ A;  3B3X A;  1TS7 A;  2PR6 A;  1K6R A;  4BBV A;  3CUE A;  4DE0 A;  2W0N A;  3BM6 A;  5F69 A;  1PNE A;  3MZF A;  5CGW A;  5IT5 A;  1VEU B;  4YNR A;  3EEH A;  1M40 A;  4K91 A;  3UDI A;  2ZM2 A;  4HJ3 A;  2PD7 A;  2HPB A;  3LGO A;  2ZC5 B;  1LHY A;  3VOL A;  1D06 A;  5FQK A;  5CTM A;  4WYY A;  2YKF A;  1DY6 A;  2WKP A;  5M19 A;  4EW7 A;  5EVI C;  4EES A;  1TVF A;  4DDY A;  4N9L A;  3DW0 A;  4LRX C;  4Q8I A;  1NRF A;  5D3O A;  2QWS A;  4BL3 A;  4MDZ A;  4XT2 A;  4D2O A;  4X1M A;  1KDW A;  3A0R A;  5L07 A;  4QU3 A;  2W1T A;  5FI2 A;  3UB8 A;  3NDE A;  2ZD8 A;  2X01 A;  5EVI D;  2Y79 A;  3SH7 A;  1CQA A;  5E2F A;  2EXB A;  2JCH A;  4K0X A;  1FSY A;  1CEG A;  3F1O A;  2JKG A;  4WEK A;  1KGF A;  1W7F A;  4MN7 A;  1Z09 A;  3WS4 A;  1XA1 A;  3A3D A;  2JHE A;  2JC7 A;  5HZH A;  3MFD A;  3U4L P;  3JYI A;  3H7W A;  4I5S A;  2FFF B;  5TGF A;  2HF6 A;  4LV1 A;  4PMA A;  3HVF A;  3O5Y A;  2V9A A;  4GDB A;  1IEM A;  1MWR A;  3OPH A;  3MJQ A;  3VFH A;  4EBL A;  1NWZ A;  2UV0 E;  1OJG A;  3T4Q A;  4IED A;  3W8K A;  2HZ5 A;  4QHC A;  1HTZ A;  2A3U A;  2I72 A;  2RL3 A;  3CPT A;  3NCK A;  1OTA A;  1GCE A;  1JVJ A;  2ZQA A;  3ZG0 A;  1PW8 A;  5FI6 A;  3IHB A;  1NLZ A;  4DE2 A;  3S7O A;  3K3D A;  3NBL A;  2ZC4 B;  3DTK A;  4Q0J A;  3KYE A;  4LFU A;  3E0Y A;  1O07 A;  5A92 A;  1JWV A;  1P0Z A;  3N8L A;  4BD0 A;  4ETX A;  1WA9 A;  1ES3 A;  2EFX A;  1S4R A;  2VV6 A;  1N9B A;  1S1Y A;  2A24 A;  5HWT A;  3PTE A;  3GMW A;  4ID4 A;  4OQG A;  4M4X A;  4FH2 A;  4LRY C;  4OPY A;  3W4Q A;  3Q81 A;  3KSF A;  4MBK A;  4QY6 A;  4P0M A;  3FC7 A;  1MZU A;  2VV7 A;  4LRZ E;  4UA9 A;  3HLG A;  4G3V A;  4NXB A;  3JVU A;  4OP8 A;  2WYX A;  2OAQ 1;  2R9X A;  2WK0 A;  4G3K A;  2ZOI A;  1ESU A;  3ULF A;  1TS0 A;  2ACG A;  3GTC A;  3P7N A;  2Y59 A;  3QP8 A;  3BQ8 A;  2AVX A;  4FSF A;  5HPF A;  1L0G A;  4Y7P A;  5DF7 A;  3T4L A;  3UE6 A;  2W3H A;  5L09 A;  1V9Z A;  1Q2P A;  3Q07 A;  2HDU A;  3QP2 A;  5HDS A;  4S2N A;  2P74 A;  4JPM A;  4DE1 A;  1SKO A;  1N4O A;  2V0U A;  4EBN A;  4NEE D;  1BUE A;  1XFQ A;  2ZL1 B;  4U0X A;  3CI6 A;  2WKQ A;  3RJU A;  3QP5 A;  5GLA A;  4HHD A;  3C4O A;  1PI5 A;  4OLD A;  3KYZ A;  1BYW A;  3HLW A;  1Q2Q A;  4MEZ A;  4X53 A;  3G4P A;  2P08 A;  2Q0O A;  3LIB A;  2V20 A;  3C38 A;  4CLC E;  2Y2N A;  4IVI A;  1G6O A;  4ZJ1 A;  3G6O A;  4CPK A;  3IH9 A;  3VSK A;  3UDX A;  2OAP 1;  3C5A A;  3S22 A;  4WLA A;  3TG9 A;  1MWU A;  4XT2 B;  2W3E A;  4GCZ A;  1YQS A;  1W8Y A;  2Z6C A;  4KUK A;  3VSL A;  3EQV A;  2WAF A;  3G2Y A;  4S2O A;  5HDC A;  4FD8 A;  4D60 A;  5TBM B;  3HLD A;  1S4S A;  2WKR A;  5FAP A;  4I39 A;  2WGV A;  1VET A;  4BD1 A;  1XJ2 A;  4NXE A;  2GJ3 A;  1ZG4 A;  1K4F A;  1LL9 A;  5EVL A;  2E8J A;  3M6B A;  2M7U A;  1Y28 A;  5CHM A;  3LIF A;  5GLB A;  1P9R A;  2HJ9 C;  2ZMF A;  3C2W A;  1JWZ A;  1S67 L;  2INW A;  1UWN X;  2EX8 A;  4E3L A;  4WEL A;  1J9M A;  2I9V A;  4FUW A;  2ZQ7 A;  4BBT A;  1FIK A;  1E4D A;  3A3F A;  4MBH A; 
#chains in the Genus database with same CATH homology
 4CLC B;  3E4Q A;  5G4Y A;  1UGU A;  5J3W A;  1D7E A;  4ARZ A;  3UMD A;  2B18 A;  2A2L A;  4BWI A;  4WEJ A;  4MMN A;  2DMW A;  3LI8 A;  3PXP A;  2D01 A;  4EET B;  4ETZ A;  2H28 A;  4G3W A;  1ODV A;  3UB7 A;  2FZ0 A;  3E4P A;  2JN7 A;  2HV1 A;  3CIT A;  4GJ4 A;  3OBF A;  1TS8 A;  2L0W A;  3IS2 B;  4EEU A;  2W1R A;  3NHQ A;  2OWJ A;  4JGP A;  1DP9 A;  4L0L A;  1DP6 A;  4LPZ A;  2QHK A;  4MCW A;  1T1A A;  3MXQ A;  5KSH A;  3S7Q A;  3LR3 A;  1XJ3 A;  2KDK A;  4IJG A;  4O8G A;  3BQA A;  1MKM A;  3BY9 A;  4UEY A;  4GHI B;  3OCN A;  4NKP A;  4HIA A;  2JKT M;  4R6L A;  3F1P B;  1STZ A;  4ZRR A;  3R7W B;  3PR6 A;  2QKP A;  2JKR I;  4I3A A;  3LR0 A;  4PAU A;  1OTD A;  2JKR M;  2V1A A;  4R38 A;  1OT9 A;  3W2Z A;  4HOI A;  2PDR A;  4K08 A;  3UME A;  4WUJ A;  4HP4 A;  3VE3 A;  4B93 A;  4HH3 A;  3TJZ C;  2PR5 A;  3OOV A;  3U2A A;  3MQ0 A;  2L4R A;  3NOU C;  5C5K A;  5AJG A;  2B02 A;  4R3A A;  2J3W A;  4I3J A;  4CLC A;  4HY8 A;  5K5B A;  2VZW A;  4OOM A;  4ARZ B;  2J80 A;  3MR0 A;  2OOL A;  3KSH A;  5IU1 A;  3T4T A;  3KYQ A;  3EGX C;  4L9E A;  1YSP A;  1V9Y A;  2P7J A;  1JNU A;  3BJN A;  1OPX A;  3PBS A;  5KIZ A;  5A8B A;  1F9I A;  4OOL A;  2W27 A;  2P04 A;  3LUQ A;  3CLO A;  4NXG A;  5HSQ A;  1TS7 A;  2K7S A;  2PR6 A;  2FH5 A;  4EER A;  1OTB A;  4WF0 A;  5CX7 A;  4BBV A;  3CUE A;  5LBR A;  3P01 A;  2W0N A;  1H3Q A;  2GZA A;  3PBN A;  5F69 A;  2VKS A;  5IS1 A;  1ZHH B;  1H8M A;  3RTY A;  2QJ5 A;  1GSW A;  3A0S A;  2Z6D A;  5IT5 A;  2MJ6 A;  4YNR A;  3EEH A;  4YOF A;  4BJP A;  3MFX A;  4HJ3 A;  3UB9 A;  2PD7 A;  4MN5 A;  3A0V A;  3LR5 A;  1P97 A;  3FPW A;  4IUK A;  2LB9 A;  3JVV A;  1GSX A;  3PBT A;  4JGO A;  4E04 A;  3VOL A;  1D06 A;  4JGR A;  2EA9 A;  5L8M A;  4II7 A;  2YKF A;  2J3T D;  1DRM A;  1P9W A;  2WKP A;  4Y3I A;  4BMW A;  4EW7 A;  5DKK A;  4EES A;  5DFX A;  4HNB A;  3LI9 A;  3BWL A;  2XA7 S;  4LRX C;  2QWS A;  3NOT C;  4PHT A;  4MDZ A;  4XT2 A;  4EU0 A;  2O9C A;  1ZTU A;  2YKH A;  2PYR A;  2W3D A;  5J4E A;  1N9O A;  3F1N A;  1X0O A;  3A0R A;  3DBA A;  3OCL A;  2VX8 A;  4HI4 A;  3CUE C;  2W1T A;  5AVE A;  3UB8 A;  3C8C A;  2VLG A;  2Y79 A;  4EQ1 A;  4I3I A;  1S1Z A;  5DFY A;  3K2N A;  4Y2F A;  1NLY A;  3B47 A;  3MQO A;  3F1O A;  4WEK A;  2CMN A;  4MN7 A;  1DP8 A;  3H82 A;  2O99 A;  2L1M A;  1EW0 A;  3T4K A;  1TS6 A;  4QPR A;  4EUV A;  3MF0 A;  3C30 A;  2PT7 A;  2JHE A;  1LL8 A;  5HZH A;  4P6Z M;  3H7W A;  4I5S A;  1T18 A;  3F1P A;  3V67 A;  2HF6 A;  3O5Y A;  3LFV A;  2QJ7 A;  2V9A A;  4L9G A;  4Q0I A;  5EFW A;  2NUP C;  2QYB A;  2JKT I;  2VV8 A;  3MJQ A;  5AVF A;  2EWW A;  1NWZ A;  4NXF A;  1OJG A;  2PHY A;  3T4Q A;  3HCY A;  3IS2 A;  4DMZ A;  1G28 A;  5DF9 A;  1OTA A;  1T19 A;  1MC0 A;  3FG8 A;  1T1C A;  4DJ3 A;  3T50 A;  3NOP C;  1NLZ A;  2W3F A;  2O9A A;  4UQI S;  2Y8H A;  2IA2 A;  3S7O A;  3K3D A;  4HJ4 A;  4F3L A;  5FL3 A;  1LSW A;  3T4O A;  1YKD A;  4Q0J A;  3PBR A;  4HH2 A;  3E0Y A;  2XA7 M;  1W63 Q;  3KO6 A;  1VB6 A;  4IUH A;  4ME4 A;  2XSS A;  3KSI A;  1P0Z A;  4ETX A;  1OJ5 A;  1WA9 A;  3TW8 A;  4FOF A;  1S4R A;  2VV6 A;  4L9F A;  5J7E A;  4F3L B;  1S1Y A;  2R78 A;  1TD5 A;  4Q0H A;  3FPV A;  2A24 A;  5HWT A;  2NUT C;  3R4K A;  5F5Y A;  3H9W A;  4WL9 A;  3IBR A;  4M4X A;  1LSX A;  4LRY C;  1XJ6 A;  2O0Y A;  5TJJ A;  3KSF A;  3FC7 A;  1MZU A;  2VV7 A;  4LRZ E;  2EWV A;  5I5L A;  3S7N A;  2VGL S;  4G3V A;  4NXB A;  2GNX A;  2XRO A;  1KOU A;  4O0P A;  3GDI A;  3JVU A;  2VA0 A;  4LLO B;  5F6A A;  3B33 A;  5TBM A;  4PKY G;  2OAQ 1;  3TE8 A;  2VGL M;  4G3K A;  5HPI A;  4DJ2 A;  3R7W A;  2ZOI A;  3ULF A;  1TS0 A;  4GS9 A;  3P7N A;  4GHI A;  3BQ8 A;  2V1B A;  4P6Z S;  3OLO A;  4FSF A;  5HPF A;  3PBO A;  2ZOH A;  1N9N A;  2PD8 A;  3T4L A;  3UE6 A;  3H7W B;  5DJT A;  2W3H A;  2M1C A;  1N9L A;  1F5M A;  3EWK A;  1V9Z A;  3GEC A;  5G4Z A;  3NJA A;  4JGQ A;  1LSV A;  3PBQ A;  3PYP A;  5HDS A;  3CAX A;  5HWW A;  2HGV A;  3BY8 A;  1NRJ A;  3D3O A;  2VJW A;  2V0U A;  3B42 A;  2ZMV A;  3H82 B;  4KUO A;  4NEE D;  5DKL A;  1XFQ A;  3CI6 A;  1S66 L;  2WKQ A;  3F1O B;  3ZYT A;  4GW9 A;  5HL6 A;  3LYX A;  1IOU A;  4HHD A;  2PYP A;  2W3G A;  3E4O A;  4PKY A;  3LR4 A;  5HD5 A;  5MC7 A;  2K31 A;  3KYZ A;  1BYW A;  4HP9 A;  1XFN A;  3ICY A;  4KQO A;  2W1T B;  4UQI M;  2P08 A;  3LIB A;  3SW1 A;  3LIA A;  3VV4 A;  3C38 A;  2LB5 A;  4CLC E;  1G6O A;  3G6O A;  3EOI A;  1W63 M;  3IBJ A;  3F1N B;  2GX5 A;  2OWH A;  2D02 A;  3BW6 A;  2KOI A;  4HJ6 A;  4HQA A;  2OAP 1;  3RFB A;  3LID A;  4I38 A;  4WLA A;  4CQH A;  3KSG A;  4XT2 B;  3RH8 B;  4B9O A;  2VEA A;  4H6J B;  2O9B A;  2W3E A;  4R70 A;  4CLC D;  3T4J A;  3HJK A;  1T1B A;  1YSQ A;  4WN5 A;  4Y5F A;  4YWZ A;  2KX6 A;  4GCZ A;  3EQU A;  3LIC A;  2Z6C A;  4KUK A;  4GS9 B;  3OC2 A;  2J3T C;  3EQV A;  3MMH A;  5HDC A;  4DN0 A;  3UE3 A;  5TBM B;  2BAS A;  4GLQ A;  1XJ4 A;  2M7V A;  5HDD A;  1S4S A;  2WKR A;  3ZQ5 A;  4I39 A;  1UWP X;  2XRN A;  3K3C A;  4MN6 A;  3TRC A;  3T4S A;  3PHY A;  3VE4 A;  3EEA A;  4AFI A;  4CLC C;  1XJ2 A;  1VHM A;  4NXE A;  2HJE A;  4BBU A;  1GSV A;  2GJ3 A;  4EEP A;  4EXO A;  3E98 A;  1OTE A;  1OTI A;  3KX0 X;  4IHQ A;  5HD3 A;  1Y28 A;  1TF1 A;  2M7U A;  2A24 B;  3LIF A;  4Z1W A;  4H6J A;  1P9R A;  2HJ9 C;  2ZMF A;  3S7P A;  5HWV A;  4O01 A;  3C2W A;  2G7U A;  2KLI A;  1IFQ A;  1S67 L;  1YAX A;  1UWN X;  2INW A;  3CWF A;  5F68 A;  1LT0 A;  4WEL A;  4KQD A;  2I9V A;  2V0W A;  3D72 A;  2ZBB A;  1F98 A;  4BBT A;  3HJI A;  5DJU A;  3MQQ A;  3LIE A;  2K2N A;  3EGD C;  4RQ9 A;  1OT6 A;  3UB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...