4DJ3A

Unwinding the differences of the mammalian period clock proteins from crystal structure to cellular function
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
308
structure length
298
Chain Sequence
GRLEDVTVYSLEDLTALASEHTSKNTDTFAAVFSFLSGRLVHISEQAALILNSKRGFLKSVHFVDLLAPQDVRAFYAHTAPTQLPFWNCAPAKPFFCRICGGGDREKRHYSPFRILPYLVHVHSSAQPEPEPCCLTLVEKIHSGYEAPRIPVDKRIFTTTHTPGCVFLEVDERAVPLLGYLPQDLIGTSILTYLHPEDRPLMVAIHQKVLKYAGHPPFEHSPVRFCTQNGEYVILDSSWSSFVNPWSRKVSFIIGRHKVRTSPLNEDVFATRIKKAASNDKDIAELQEQIHKLLLQPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unwinding the differences of the mammalian PERIOD clock proteins from crystal structure to cellular function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Period circadian protein homolog 3
total genus 65
structure length 298
sequence length 308
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A01
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4dj3A02
3IBRA 4I3JA 5IS1A 1OTDA 1S1ZA 1Y28A 2PD8A 2W0NA 4HQAA 1ODVA 5I5LA 2B02A 3BY9A 4LRZE 4XT2B 3VOLA 1V9YA 4KUOA 1XJ4A 2P7JA 3C2WA 1F9IA 4K08A 5DJTA 5TBMB 5F6AA 3NOPC 1OTAA 3NOTC 3P7NA 2D01A 4KQDA 2QWSA 3PHYA 2W27A 4JGOA 2I9VA 4GHIB 2V0WA 2PHYA 3SW1A 1LSVA 3EEHA 4JGRA 4HOIA 4YWZA 4EEUA 1D06A 3E4QA 2J80A 4NXFA 5HD5A 3UB7A 3CWFA 2OWHA 3H82B 5IU1A 3LI8A 4H6JB 3F1OB 3RTYA 4LRXC 3UB9A 3MQQA 4BBUA 3HJKA 2VEAA 2PD7A 4NXEA 3BY8A 2V9AA 3OLOA 4HJ4A 2BASA 1GSXA 4GW9A 5HWTA 4I39A 5F5YA 3GDIA 4R38A 3G6OA 1LL8A 5HSQA 3MFXA 1DP9A 1OT9A 2GJ3A 4GCZA 4PKYG 1OJGA 3LIAA 1TS0A 2M1CA 1KOUA 2KX6A 2VV6A 3PYPA 3FG8A 3LIDA 3H7WA 4MN6A 4WUJA 5J3WA 3UE6A 1XJ2A 1TS8A 4WN5A 3T50A 4EESA 3EWKA 2WKPA 2Z6CA 4WF0A 4XT2A 5DJUA 5G4ZA 2OWJA 4DJ2A 1GSVA 5HDSA 3BWLA 4L9FA 1LT0A 1X0OA 3H7WB 4I3AA 4NXBA 4R70A 3VE4A 3UMDA 4F3LB 1XFQA 5AVEA 2EA9A 1DP6A 3HJIA 3CLOA 3F1NA 3LUQA 4EEPA 3MXQA 4EETB 2QJ5A 1P0ZA 1UGUA 3LICA 4RQ9A 4F3LA 2A24B 2ZBBA 2L4RA 5J4EA 1N9NA 1OJ5A 1GSWA 3LIEA 2HV1A 1DP8A 5KIZA 4L9GA 3UMEA 2A24A 3F1OA 2JN7A 3ICYA 4HJ3A 1WA9A 2K7SA 1MZUA 5G4YA 3RH8B 5HWWA 1T1CA 2VV8A 3LIBA 4GS9A 1UWPX 2PR6A 2QKPA 2ZOHA 2VLGA 3NOUC 4HNBA 5DKKA 4EXOA 3E4PA 1XJ3A 4EERA 2OOLA 2WKQA 3MQOA 4HIAA 1G28A 4KUKA 4BBVA 5EFWA 5AVFA 4HY8A 5HD3A 3F1PA 2H28A 1T1AA 4JGPA 1UWNX 5F68A 2PYPA 5HDCA 4E04A 3IS2A 4WL9A 2L0WA 1P97A 3MJQA 2V1BA 1OTBA 2YKHA 4NXGA 1S67L 2QHKA 2ZOIA 3CAXA 2Z6DA 4EQ1A 2L1MA 3FC7A 3KX0X 4HP9A 4HI4A 2V0UA 3UB8A 4BBTA 1F98A 1OTEA 3LI9A 5F69A 3MR0A 4LPZA 5J7EA 5A8BA 1DRMA 3A0SA 3A0RA 1T1BA 2PR5A 3B33A 4M4XA 3F1NB 4LLOB 1EW0A 3D72A 4HJ6A 5TBMA 5HZHA 3K3DA 2WKRA 5HDDA 4EW7A 1JNUA 3LYXA 3E4OA 4HHDA 4I3IA 1N9LA 4HH2A 3ZQ5A 1LSXA 4GHIA 5DKLA 3UB6A 2CMNA 3C8CA 4R6LA 1NWZA 3VE3A 4JGQA 4R3AA 1S66L 3K3CA 1T19A 2PDRA 1N9OA 3A0VA 2D02A 4GS9B 1XJ6A 2INWA 2YKFA 1D7EA 4I5SA 4B9OA 3H82A 1BYWA 2QJ7A 3GECA 4H6JA 4DJ3A 4LRYC 1S1YA 2KDKA 1S4SA 1OTIA 2PYRA 3NJAA 1LSWA 4HH3A 1V9ZA 2V1AA 3F1PB 1T18A 2JHEA 4L9EA 4WLAA 5HWVA 4MN5A 3H9WA 3LIFA 1VB6A 1XFNA 3IS2B 4HP4A 4I38A 2VV7A 2R78A 3NHQA 4PKYA 1OT6A 1S4RA 1TS6A 3ULFA 1TS7A
chains in the Genus database with same CATH superfamily
3P01A 1BTLA 4CLCE 4KQQA 4EBNA 2XH9A 1F2KA 1F9IA 1MWUA 1AXBA 5DF9A 2ZD8A 5CTMA 2WADA 4E6WA 4QY5A 5EVEA 3IH8A 3E4QA 2WGIA 4Z9QA 2HDSA 2KOIA 3RTYA 4LRXC 3UE1A 4B88A 1P9WA 4KZ7A 4R38A 1ONGA 3DW0A 3V5MA 2JKFA 3LIDA 4G3WA 1TS8A 4UEYA 5FI6A 2XQZA 4R70A 2VKSA 2XFTA 1BLHA 2XLNA 4JF6A 4MBHA 2R9WA 3BQ8A 1J9MA 1N9NA 3QP2A 1FSYA 2ZC4B 4GNUA 3IBJA 4L9GA 3RXWA 3BFDA 4EQIA 4KZ8A 2ZOHA 2VLGA 1S0WA 1XXMA 4HY8A 3IF6B 3DAVA 4N92A 3Q07A 4EQ1A 4HI4A 4CLCB 4KENB 4BL2A 3A0SA 4IJGA 1N9BA 3VSLA 4JPMA 4HBUA 3HUMA 1E4DA 2CMNA 3JYIA 2O9CA 4GZBA 2HP6A 2WK0A 3QHYA 2VZWA 3UDFA 1XFNA 3V3RA 5FQJA 3ULFA 3IBRA 4BD0A 1SHVA 1ZTUA 1DJCA 4LRZE 2Y4AA 3PR6A 5FDSA 3C7VA 3VV4A 4X69A 3WS4A 4WZ4A 3W2ZA 4DE1A 1LSVA 2EXAA 3G31A 2OLUA 3SOIA 2JKTI 1D06A 1ES2A 5KSCA 1L0FA 1ACFA 1P9RA 3EEAA 2FZ0A 5L07A 3NI9A 2E8JA 2DNSA 4LFUA 1KOUA 1MKMA 2PAVP 2ZLYA 4O8GA 1GSVA 5HAPA 2V8CA 3WRZA 5AVEA 3MXQA 2FFYA 4F3LA 4BENA 3OBFA 4P6ZS 2P74A 3Q81A 1EI5A 4JBFA 2IWBA 4DKIA 3Q7ZA 5HWWA 4P0MA 3N8RA 3GMWA 2V8FA 2Q0OA 3NOUC 2XSSA 4PHTA 5AQBA 4KUKA 1G28A 1PI5A 4JF5A 5HDCA 1FCMA 3O3VA 1K55C 2V1BA 1S67L 3RXXA 3MKFA 5EV0A 3S7NA 1KDWA 2V20A 3A3JA 5FI2A 4DE3A 1EW0A 3T1XA 2GZAA 1IKIA 4HHDA 3MBZA 4LENA 4JGQA 3VSKA 1N9OA 4OONA 1BYWA 3D4FA 1OTIA 3T1RA 5HAIA 2P08A 3H9WA 5DF7A 2W3DA 3CJMA 1MWTA 3HLEA 3NIAA 1GHIA 3KSFA 4ZBEA 1ODVA 3KYQA 1J3WA 2V1ZA 4P85A 5MC7A 3G34A 3C2WA 1CEFA 1PNEA 4EBLA 4N1HA 3PHYA 1SKFA 4WZ5A 4B93A 2V2FF 3M6BA 1HZOA 1NYMA 1MC0A 3BQAA 4EV4A 1L0GA 4OQGA 2Q9MA 1XA1A 4X1LA 4GW9A 5HSQA 1YKDA 1LLBA 4PKYG 1YLTA 3FKVA 3PYPA 4WUJA 4LGWA 2Y2GA 2LB9A 4DJ2A 3S7OA 1IKGA 1KGGA 4P6BA 3SS4A 3BYDA 2WGWA 1CF0A 3CZDA 2A24B 3V50A 3RH8B 2HPBA 4GS9A 2Y2JA 3UNWA 4DRTA 1OPXA 3EQUA 5AVFA 1FCNA 4X6TA 3DWKA 4H8RA 1W7FA 1P97A 5FASA 4X1MA 2ZOIA 2L1MA 4K0WA 1TF1A 4LV0A 3R4KA 3PBRA 4I3IA 3E4OA 4GDBA 4OOYA 4ZJ3A 4R6LA 4JXWA 4FD8A 3WRTA 1S66L 3HL9A 1Z09A 4U0XA 4GS9B 3JPUA 3HUNA 1KE0A 3T4SA 1T18A 4MN5A 3E98A 3FPVA 4E3JA 1KE4A 1K0KA 4IUHA 1MY8A 5IS1A 5CECA 3B3XA 3MQ0A 4UQIM 1XJ4A 1ES4A 3P7NA 3LEQA 3CPTA 4D60A 4XXRA 4HOIA 1BUEA 3NECA 3GQZA 5CEDA 1IEMA 4CLCC 2V9AA 2XF3A 3VFHA 1DP9A 1FIKA 4PM7A 3T50A 4UAAA 1JWZA 4XUXA 3VE4A 3T1QB 2WAEA 1Q2QA 1NLYA 1MWRA 4IBRA 2G7UA 3KSGA 1OJ5A 2EX2A 1ZG6A 2QMIA 3C7UA 5EVIB 4PM5A 3VP1A 3QNCA 3VP4A 4IBXA 2W3GA 2IA2A 5D3OA 4EERA 2OOLA 5DTSA 2Q9NA 3WWXA 5CXWA 3WS2A 4BBVA 4NK3A 1BLCA 3OPRA 3F1PA 1UWNX 3E2KA 5DFXA 4BWIA 5FI7A 2W1TA 3B33A 3QP6A 2PR5A 4EU0A 2A49A 3LY3A 4LLOB 4OPRA 3GRJA 4CLCA 1YT4A 3M6HA 2VA0A 1N9LA 2PU2A 4MNRA 3FYZA 2QYBA 4EWFA 2EXBA 2ZM2A 1T19A 3EOIA 4DE2A 3H82A 3MF0A 4H6JA 3Q1FA 2HDRA 4FOFA 3F1PB 1K6SA 3OC2A 3GV9A 2VV7A 2R78A 1NRJA 5EFWA 1S1ZA 5CTNA 2GX5A 2P9VB 4S2OA 2Y2OA 4P6ZM 5F6AA 3R7WB 3NOPC 3W4OA 4IUKA 1YLYA 5FQ9A 4XUZA 4Y0UA 4S2KA 5HPIA 4ARZA 1XPBA 4ESPA 4HESA 4Y15A 1WE4A 3IHBA 1OT9A 4NXGA 3T12B 5J3WA 1RGYA 1MPLA 4E3KA 2Z6CA 5E2GA 2ZQ8A 3GSGA 2PT7A 1FR1A 3T4TA 3HJIA 3UPPA 1AWIA 2JKGA 3G2YA 4OP5A 2WGWB 2GNXA 2ZL1B 1PZPA 2PRFA 4YNRA 2K7SA 4KZ9A 1SZVA 2Z2MB 4OH0A 5GLBA 1DY6A 5M19A 4DXCA 5CGSA 1CK3A 3IXGA 3UB8A 2EWVA 5HZHA 4HJ6A 3IT9A 4BL3A 1CI9A 2XFSA 4ETZA 2ZJ9A 1VEUB 4HEFA 2EFXA 3U4LP 1D7EA 1YLZA 1M40A 2KDKA 1SKOA 1K54C 1Y54A 2XDMA 3FWLA 1XA7A 2HP5A 4I3JA 4R1GA 2J3TC 3PTEA 4QJGA 3CHWP 4KQRA 4S2PA 1TVFA 4N9KA 3FV7A 3FZCA 2D01A 2QWSA 1PIOA 3IXBA 1IYPA 4DDYA 4LV3A 1CJFA 1EWZA 3UB7A 3VMAA 1GHPA 5FEFA 3F1OB 3NDEA 3ZNYA 2HJEA 2O99A 4ZDXA 2RL3A 1FSWA 3OLOA 3BFEA 1XGJA 1L3LA 3EQVA 4GCZA 1BT5A 1N4OA 3U2AA 1RP5A 3C30A 1YQSA 4OPYA 4OLDA 2OWJA 3C5AA 3BWLA 1LI0A 5FDHA 1TDLA 3LY4A 3CITA 4ZRRA 2WKHA 1MKIA 3VP2A 5EVLA 3UMEA 4Q8IA 4MLLA 1S6RA 4S2MA 1PYYA 1ONHA 1UWPX 2QKPA 4UA9A 4CPKA 2ZM0A 3CMZA 5F82A 1LHYA 5TGFA 3ISGA 4E04A 1H8ZA 2B18A 2H28A 4JGPA 1LL5A 5EM0A 4CQHA 2YKHA 4MBFA 1YAXA 5AJGA 4OVDA 3M2KA 4C75A 1DJBA 4KG6A 5BOHA 1W8YA 5HPFA 1M6KA 2QZ6A 1YLWA 1WYBA 1XKZA 3MZDA 1V9ZA 1FILA 3LIFA 3TW8A 3DTEA 2EX9A 4PAUA 3NC8A 3O87A 3BY9A 4QWOA 2EWWA 1W63Q 5I94A 3NOTC 3FPWA 4R4RA 4YOFA 4GHIB 3EEHA 4R4SA 2XGNA 4IVKA 3OPLA 2Y91A 2BASA 4P87A 4I39A 5HWTA 1LL8A 5GHZA 3Q7VB 2KX6A 2WAFA 1XJ2A 1PRQA 4Y5FA 3S22A 5G4ZA 3DWZA 5GLDA 3UMDA 2Y2IA 1PFLA 1ERQA 1CI8A 3MS6A 3LICA 1H8YA 3DBAA 5KIZA 1K4FA 1H5XA 4Q0HA 4Q0IA 1ZC2A 4CLCD 1NXYA 5GHXA 1OMEA 1H3QA 3BEBA 4NKPA 3CUEC 3NBLA 4X25A 3MJQA 1TEMA 2Y2PA 2MJ6A 2Z6DA 1ESIA 4X56A 4R3JA 4M4XA 3ZG0A 5TBMA 4KZAA 1K38A 3HLBA 5HDDA 4YFMA 3C8CA 4Y13A 3HLCA 3VP3A 4B9OA 1GHMA 2Y79A 4LRYC 1S4SA 4Y2FA 4KQOA 4BLMA 4JLFA 3UB5P 3VP0A 4DDSA 2ZC6B 1SKOB 5F83A 4KZ5A 1BLSA 4U0TA 1KDSA 5EOOA 1BULA 4KQDA 3ZG7B 3SW1A 1MWSA 2OAQ1 2J80A 2XA7M 1A0KA 2B95A 5A8BA 1SDEA 1L2SA 5CRFA 2UWXA 1IFQA 3NCKA 5F5YA 1U60A 3KSHA 3MFXA 2HF6A 2VV6A 2IWDA 4OPQA 1PWGA 3EWKA 4KZ4A 3SH7A 5HDSA 1X0OA 4DMZA 3LUQA 2Y8HA 2XD5A 3HCYA 4OP8A 1O07A 1K57A 1DP8A 4MDZA 3ICYA 4HJ3A 4KZ3A 1MZUA 5L10A 2J7VA 3HUOA 4MN7A 1T1AA 4GLQA 4NEED 2VGLS 5F68A 1OTBA 4R0QA 2XRNA 3LI9A 1DRMA 3D72A 3KSIA 2K31A 2FFFB 3ZQ5A 5HL1A 2OV5A 5CEBA 2O9BA 4X55A 2JKRI 2Y2KA 3BW6A 2G2WA 5E43A 2B5RA 2PYRA 3NJAA 1LSWA 3IWIA 2H0YA 3IS2B 3PBNA 1OT6A 1OTDA 3D9YA 4HQAA 1FR6A 2WYXA 2ACGA 1V9YA 5DJTA 2J8YA 1WYCA 4JGOA 2I9VA 3PXPA 3C4OA 4ZJ2A 4QY6A 5DFYA 3ZG5A 3LEZA 2W1RA 2QPNA 4PM6A 3G6OA 1TS0A 4B4ZA 1C3BA 5FL3A 3MSHA 3P98A 3HLDA 3HREA 3IH9A 1UGUA 3CUEA 2L4RA 4O01A 5J4EA 4OQHA 2A24A 3N4IA 5G4YA 1XX2A 2DCFA 1NZOA 2PR6A 5EUAA 5DTTA 3MQOA 3PBTA 4LV2A 2M7VA 3PBOA 3T4OA 4DF6A 3UDIA 5EOEA 4S2NC 4ETXA 2J3TD 1VHMA 1NY0A 3KX0X 5GLCA 2V0UA 3CG5A 3Q82A 3MXRA 3W4PA 2IWCA 4UHUA 4WMCA 4HH2A 5DKLA 2WKEA 4R3AA 3HLGA 2D02A 2WZZA 2G2UA 1G6OA 3V3SA 4Y3IA 5FSRA 4E3MA 4L9EA 4Q0JA 1H0MA 1DJAA 4QD4A 2ZC5B 3O5YA 3S1YA 4DXBA 1Y28A 2W0NA 2JCHA 4GB7A 4LV1A 2OLVA 4WZ5C 3W8KA 4MBKA 5L09A 2PHYA 4JGRA 3K2NA 4ZJ1A 4WELA 1JWPA 3PBSA 3SH9A 1YSPA 1E25A 4NXEA 3PBQA 3QP1A 3IX8A 3A3DA 4DN0A 3MKEA 3ZYTA 3IF5A 2VK3A 5C5KA 3ZNTA 2FH5A 4R3BA 5A90A 3ZVTA 3D3OA 3DTIA 4EESA 4XT2A 2W3HA 4X53A 4B4XA 2EFUA 5G18A 4PM8A 4X68A 1D1JA 1G68A 3T1SA 3S4XA 2X71A 2XROA 3LIEA 3T4JA 3A3IA 2BLSA 2HJ9C 5E2HA 3A3FA 5EVIA 2WKQA 5FQMA 2NUPC 5J8XA 2W3EA 2ZMAA 2DMWA 3ZGAB 3AGEA 2QHKA 3HVFA 3AGFA 1OTEA 5F69A 1W8QA 2WGVA 4LPZA 4WEKA 4N9LA 4II7A 4GHIA 4FH2A 3IXHA 1NWZA 5LBRA 3IHAA 2PBDP 4E6XA 3KO6A 2ZC3B 3BECA 1F5MA 4GDNA 2QJ7A 3IWQA 5FA7A 3B42A 3UE3A 2Y2QA 1O7EA 2A2LA 1VETB 4FTXA 4O7DA 2ZQAA 1OJGA 3NDGA 4BJPA 3WS1A 2Y2NA 3TOIA 3VOLA 1HLUP 1PI4A 5GL9A 4N1XA 4K08A 3O86A 3JVVA 2W27A 5TFQA 3E0YA 4S2IA 3ZG8B 4EEUA 4IHQA 1I5QA 3UB9A 3LI8A 1FQGA 3TE8A 4JXGA 1PW1A 3UN7A 2VGLM 3ITAA 5L2FA 3ZDJA 1VETA 5FQKA 3WS0A 3H7WA 3A3EA 1NLZA 3UPOA 4L9FA 1NRFA 2JKTM 5HX9A 5EVIC 5KZHA 3FKWA 3CI6A 5K5BA 1K4EA 2ZMFA 2Y55A 3BRMA 5U47A 1GSWA 1EROA 1YPRA 4LCLA 1T1CA 2VV8A 2OSUA 5AQ9A 1Y4OA 1YLPA 4S2NA 1JVJA 4M3KA 2VJWA 1IELA 2JC7A 1SCWA 5TJJA 2H5SA 2Y2HA 3CAXA 2ZQDA 4AFIA 1ALQA 4WYYA 2M7UA 2RCXA 4NG2A 2VGKA 3S7QA 3O88A 3LYXA 1XGIA 3AGDA 1IYOA 2PBYA 5FAPA 3WS5A 1ES5A 2OAP1 3T4KA 2LB5A 5IT5A 3V67A 3L7HA 2P9VA 3NHQA 1GCEA 4OKPA 5A91A 4QHCA 5I5LA 1SDNA 2B02A 3BFGA 1ZG4A 1G6AA 4IVIA 4JXVA 4NETA 5FAQA 3N6IA 3IQAA 2V0WA 2J9PA 4Y17A 1NYYA 4NXFA 3MZEA 5DF8A 3CWFA 2OWHA 3W4QA 4UA6A 4O0PA 2H10A 3G4PA 4QU3A 2W3FA 1GSXA 4KG5A 4A5RA 2BTFP 4WM9A 3KYEA 1YSQA 2M1CA 3FG8A 1LL9A 3TG9A 4I3AA 4F3LB 2EX8A 1NZUA 1XFQA 2O9AA 4OQ0A 1JTGA 4EEPA 2ZL1A 3BLMA 4MCWA 4KZ6A 3BLSA 2ZBBA 5GLAA 1ESUA 3S7PA 1W63M 2HV1A 3BFFA 4S2JA 4GN2A 2ZC7A 3IF6A 5TR7A 2BG1A 4BQMA 3P09A 3MFDA 2AVXA 4WBGA 5HD3A 2X02A 2PYPA 3IS2A 5FEGA 2L0WA 1ES3A 1QMFA 1K56A 4HP9A 1FOFA 2HGVA 3LGOA 5HAQA 1FCOA 4LCMA 2E8IA 1JNUA 5E2FA 1E3UA 3QP5A 4JF4A 1W79A 2J9OA 1IYSA 3VOYA 1XJ6A 3GECA 3MZFA 3LR0A 4ME4A 3KYZA 4C3QA 4G3KA 1VB6A 1PW8A 1IYQA 2R9XA 4FCFA 4S2LA 1MBLA 1TS6A 2P04A 2H0TA 3JVUA 4XT2B 3ZHHA 2P7JA 4OOMA 3OCLA 1OTAA 3RFBA 5CHUA 1G5UA 1KE3A 4GJ4A 3CPTB 1W5DA 5IU1A 4BBUA 5EPHA 4RX3A 3NULA 2VEAA 1JWVA 3QP8A 4HJ4A 5JYOA 4OLGA 2GJ3A 1PWDA 4MN6A 3IXDA 4FSFA 2WKPA 4E3NA 3Q7VA 3H7WB 5FAOA 1K54A 4OQIA 2WKIA 3CLOA 3F1NA 4UQIS 4RQ9A 4GOGA 1BZAA 5CX7A 3F1OA 3T4QA 1WA9A 2ZM8A 4RA7A 4G3VA 3LIBA 1KVMA 2XA7S 4HNBA 5DKKA 4EXOA 1K55A 4HIAA 1I2WA 4Y7PA 1BLPA 1H8MA 2Y2MA 4JXSA 2EX6A 3C4PA 4C6YA 3FC7A 3GR2A 4FH4A 4KG2A 3BJNA 2JBFA 3TSGA 4EW7A 2W1TB 3UB6A 2ZQ7A 4GD6A 5JYPA 3LCEA 3K3CA 4HBTA 2INWA 1JTDA 1NJ4A 1YMSA 2HZ5A 2DRWA 3IWOA 5HWVA 5EVID 3HLFA 3EGDC 5HFOA 2C5WB 3C38A 4PKYA 2HDQA 4Y0OA 1CEGA 2PD8A 2X01A 3QP4A 3T4LA 5DTKA 3ZG9B 4BD1A 3LO7A 3L9KA 3E2LA 3N8SA 5HD5A 3SS3A 4E3OA 3H82B 5HW3A 3HJKA 2PD7A 3UPNA 2HDUA 3UO9A 2VX8A 3OPHA 1YM1A 4EUZA 3GDIA 3GTCA 1BSGA 3UE6A 2XK1A 4ZTKA 4WN5A 1HVBA 4K91A 1Q2PA 3DTMA 3N8LA 4NXBA 2WZXA 3G35A 5M18A 2J3WA 1LI9A 3SZTA 4U3TA 4UA7A 4Z1WA 3TRCA 4ARZB 1RCJA 1QMEA 4WL9A 3PAGA 2HP9A 2UV0E 3OZHA 3ZVWA 5J7EA 5CHMA 1T1BA 3UE0A 1KGEA 3OPPA 4QPRA 3VE3A 4PMAA 3G2ZA 3BFCA 2YKFA 2NUTC 4DJ3A 2VGJA 3M2JA 2XD1A 2JHEA 1ZKJA 4HP4A 1S4RA 4RYEA 3R7WA 1PZOA 4GD8A 1STZA 5DVAA 5HARA 4KUOA 5TBMB 5HL6A 1VM1A 1TDGA 3RJUA 1VEUA 4K0XA 3HLWA 4YWZA 2JE5A 5AQ7A 1VQQA 1YLJA 1XP4A 4H6JB 4OOLA 5IHVA 3PAEA 3MQQA 4KZBA 1KGFA 4GKUA 2WUQA 3ITBA 4FUWA 3ZFZA 2XR0A 2K2NA 3LIAA 4JKTA 4WF0A 5L8MA 2Y59A 1K25A 2PU4A 1IOUA 1ERMA 3IX4A 1DP6A 2QJ5A 1P0ZA 4MEZA 5A93A 4YINA 1MXOA 4MMNA 2KLIA 3ZCZA 5A92A 5CGXA 1YMXA 4E3LA 3MXSA 1Z6FA 3TJZC 5FQIA 4PPRA 4EBPA 4D2OA 1GA9A 2JKRM 4PM9A 4ID4A 3A0RA 5EM1A 4EUVA 1K57C 3K3DA 1L0DA 3OCNA 4DE0A 1RGZA 3A0VA 5AQAA 4F94A 4I5SA 2ZMVA 2ZQ9A 5KMWA 4HH3A 4WLAA 3QNBA 4I38A 4WMCD 3OOVA 4IEDA 1KVLA 3VFFA 4ZAMA 5M1AA 3G30A 4L0LA 2C6WB 1K6RA 3N7WA 1I2SA 5EE8A 5EECA 3DTKA 3G32A 5FATA 3BY8A 4CJNA 5CHJA 3NY4A 3UDXA 4RVAA 5FQQA 3LR5A 3LR4A 1CQAA 3BM6A 3IX3A 5DJUA 3GVBA 3LFVA 1LT0A 5CERA 5KSHA 2A3UA 2EA9A 3SH8A 4EETB 3LR3A 1ZHHB 4WEJA 4R23A 1HTZA 5E2EA 1TD5A 5F1GA 2JN7A 1GA0A 4E3IA 3B47A 3VOZA 4QB8A 2ZQCA 3E4PA 1XJ3A 3MMHA 1L0EA 3IF6C 2O0YA 1HD8A 4BBTA 1F98A 1K56D 2I72A 3MR0A 5CGWA 3F1NB 2Z2LB 3SS5A 4OPZA 2WKRA 3HBRA 1PWCA 1LSXA 4BMWA 1E3UD 4RX2A 2CC1A 2XEPA 2PDRA 5F1FA 4Y0TA 1S1YA 2Y2LA 3EGXC 2V1AA 3I7JA 5GHYA 2GDNA 3UY6A 3V39A 1TS7A
chains in the Genus database with same CATH topology
2P04A 3P01A 1OTDA 1S1ZA 4CLCE 2GX5A 3JVUA 4HQAA 4XT2B 1V9YA 5DJTA 2P7JA 4OOMA 1F9IA 3OCLA 4P6ZM 5F6AA 3R7WB 3NOPC 5DF9A 1OTAA 4IUKA 3RFBA 4JGOA 2I9VA 3PXPA 4GJ4A 5HPIA 5DFYA 3E4QA 5IU1A 2KOIA 4BBUA 3RTYA 4LRXC 4ARZA 2W1RA 2VEAA 1P9WA 4HJ4A 4R38A 3G6OA 1OT9A 2GJ3A 1TS0A 4NXGA 5J3WA 3LIDA 4MN6A 4G3WA 1TS8A 4FSFA 5FL3A 4UEYA 2WKPA 2Z6CA 3H7WB 4R70A 2VKSA 2PT7A 3T4TA 3HJIA 3CLOA 3F1NA 4UQIS 1UGUA 4RQ9A 3CUEA 3BQ8A 2L4RA 4O01A 5CX7A 5J4EA 1N9NA 2GNXA 3IBJA 4L9GA 2A24A 3F1OA 5G4YA 3T4QA 4YNRA 1WA9A 2K7SA 4G3VA 3LIBA 2PR6A 2ZOHA 2VLGA 2XA7S 4HNBA 5DKKA 4EXOA 3MQOA 4HIAA 3PBTA 2M7VA 3T4OA 3PBOA 4HY8A 1H8MA 4ETXA 2J3TD 1VHMA 4EQ1A 3FC7A 3KX0X 3UB8A 4HI4A 2V0UA 4CLCB 2EWVA 3A0SA 5HZHA 4IJGA 4HJ6A 3BJNA 4EW7A 2W1TB 4HH2A 4ETZA 5DKLA 3UB6A 2CMNA 4R3AA 3K3CA 2D02A 2O9CA 2INWA 1D7EA 1G6OA 2KDKA 4Y3IA 2VZWA 5HWVA 4L9EA 4Q0JA 1XFNA 3EGDC 4PKYA 3C38A 3O5YA 3ULFA 3IBRA 4I3JA 1Y28A 2J3TC 2PD8A 2W0NA 1ZTUA 4LRZE 3PR6A 3T4LA 3VV4A 2D01A 2QWSA 3W2ZA 2PHYA 1LSVA 4JGRA 3K2NA 4WELA 2JKTI 1D06A 5HD5A 3UB7A 3PBSA 3H82B 3F1OB 1YSPA 3HJKA 4NXEA 2HJEA 2O99A 2PD7A 3OLOA 1P9RA 2VX8A 3EEAA 3PBQA 2FZ0A 4DN0A 3ZYTA 3GDIA 3EQVA 4GCZA 2FH5A 5C5KA 1KOUA 3UE6A 3D3OA 3U2AA 3C30A 4EESA 4WN5A 1MKMA 4XT2A 2W3HA 2OWJA 4O8GA 1GSVA 3BWLA 4NXBA 5AVEA 3CITA 4ZRRA 3MXQA 4F3LA 3OBFA 2J3WA 4P6ZS 2XROA 3LIEA 3UMEA 3T4JA 5HWWA 4Z1WA 3TRCA 4ARZB 2HJ9C 1UWPX 2QKPA 3NOUC 2XSSA 4PHTA 2WKQA 4KUKA 1G28A 2NUPC 4E04A 2B18A 2H28A 4JGPA 5HDCA 2W3EA 4CQHA 4WL9A 2DMWA 2V1BA 2YKHA 1S67L 2QHKA 3S7NA 1OTEA 5F69A 4LPZA 1YAXA 5AJGA 5J7EA 1T1BA 1EW0A 2GZAA 4WEKA 4HHDA 4II7A 4GHIA 1NWZA 5LBRA 5HPFA 4QPRA 3VE3A 4JGQA 3KO6A 1N9OA 1F5MA 2YKFA 1BYWA 2NUTC 2QJ7A 4DJ3A 3B42A 1OTIA 3UE3A 1V9ZA 2JHEA 2P08A 3H9WA 2A2LA 3LIFA 4HP4A 2W3DA 1S4RA 3TW8A 1OJGA 4BJPA 4PAUA 3R7WA 3KSFA 1STZA 1ODVA 3KYQA 3BY9A 5MC7A 3VOLA 4KUOA 2EWWA 3C2WA 1W63Q 4K08A 5TBMB 5HL6A 3NOTC 3FPWA 3JVVA 3PHYA 2W27A 4YOFA 4GHIB 3E0YA 3EEHA 4YWZA 4B93A 4EEUA 4IHQA 3UB9A 3LI8A 4H6JB 4OOLA 3MQQA 1MC0A 3BQAA 3TE8A 2VGLM 2BASA 4GW9A 5HWTA 4I39A 5HSQA 1LL8A 2K2NA 1YKDA 4PKYG 3LIAA 3PYPA 4WUJA 2KX6A 3H7WA 1XJ2A 2LB9A 1NLZA 4WF0A 4Y5FA 5L8MA 4DJ2A 5G4ZA 3S7OA 4L9FA 2JKTM 3UMDA 1IOUA 1DP6A 2QJ5A 1P0ZA 3LICA 2A24B 3CI6A 5K5BA 2ZMFA 1GSWA 3DBAA 5KIZA 4MMNA 4Q0HA 3RH8B 2KLIA 1T1CA 2VV8A 4Q0IA 4GS9A 4CLCD 1OPXA 3EQUA 5EFWA 5AVFA 2VJWA 1H3QA 3TJZC 4NKPA 3CUEC 3MJQA 1P97A 2JKRM 5TJJA 2ZOIA 3CAXA 2MJ6A 2Z6DA 2L1MA 1TF1A 4AFIA 2M7UA 3A0RA 4M4XA 5TBMA 4EUVA 3S7QA 3K3DA 3R4KA 5HDDA 3PBRA 3OCNA 3LYXA 3E4OA 4I3IA 3C8CA 4R6LA 1S66L 3A0VA 4GS9B 4I5SA 4B9OA 2Y79A 2ZMVA 4LRYC 1S4SA 4Y2FA 2OAP1 4KQOA 4HH3A 4WLAA 3T4KA 3T4SA 1T18A 2LB5A 4MN5A 3E98A 5IT5A 4I38A 3V67A 3FPVA 3NHQA 3OOVA 4IUHA 5IS1A 3MQ0A 5I5LA 2B02A 4UQIM 1XJ4A 3P7NA 4L0LA 4KQDA 2V0WA 3SW1A 4HOIA 2OAQ1 4NXFA 2J80A 2XA7M 3CWFA 2OWHA 5A8BA 4O0PA 4CLCC 3BY8A 2V9AA 1IFQA 1GSXA 2W3FA 5F5YA 3LR5A 3LR4A 3KSHA 3MFXA 1DP9A 2HF6A 1YSQA 2M1CA 2VV6A 3FG8A 3T50A 3EWKA 5DJUA 5HDSA 3LFVA 1LT0A 1X0OA 4I3AA 3VE4A 4F3LB 5KSHA 1XFQA 4DMZA 2EA9A 2O9AA 4EEPA 3LUQA 2Y8HA 4EETB 3LR3A 1NLYA 1ZHHB 4MCWA 4WEJA 2G7UA 2ZBBA 3HCYA 3KSGA 3S7PA 1W63M 1TD5A 1OJ5A 2HV1A 1DP8A 4MDZA 2JN7A 3ICYA 4HJ3A 1MZUA 3B47A 2W3GA 2IA2A 3E4PA 1XJ3A 4EERA 2OOLA 4BBVA 3MMHA 5HD3A 3F1PA 4MN7A 1T1AA 4GLQA 1UWNX 2VGLS 2PYPA 4NEED 5F68A 3IS2A 2L0WA 5DFXA 1OTBA 4BWIA 2O0YA 4HP9A 2HGVA 2XRNA 4BBTA 1F98A 2W1TA 3LI9A 3MR0A 1DRMA 3B33A 4EU0A 2PR5A 3F1NB 4LLOB 3D72A 3KSIA 2K31A 2WKRA 4CLCA 1JNUA 3ZQ5A 2VA0A 1N9LA 1LSXA 4BMWA 2QYBA 2O9BA 1T19A 2PDRA 3EOIA 1XJ6A 3H82A 3MF0A 3GECA 4H6JA 2JKRI 3BW6A 1S1YA 3LR0A 4ME4A 3KYZA 4FOFA 3NJAA 2PYRA 3EGXC 1LSWA 2V1AA 3F1PB 4G3KA 3OC2A 1VB6A 3IS2B 2VV7A 3PBNA 2R78A 1OT6A 1TS6A 1NRJA 1TS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IBR A;  4I3J A;  5IS1 A;  1OTD A;  1S1Z A;  1Y28 A;  2PD8 A;  2W0N A;  4HQA A;  1ODV A;  5I5L A;  2B02 A;  3BY9 A;  4LRZ E;  4XT2 B;  3VOL A;  1V9Y A;  4KUO A;  1XJ4 A;  2P7J A;  3C2W A;  1F9I A;  4K08 A;  5DJT A;  5TBM B;  5F6A A;  3NOP C;  1OTA A;  3NOT C;  3P7N A;  2D01 A;  4KQD A;  2QWS A;  3PHY A;  2W27 A;  4JGO A;  2I9V A;  4GHI B;  2V0W A;  2PHY A;  3SW1 A;  1LSV A;  3EEH A;  4JGR A;  4HOI A;  4YWZ A;  4EEU A;  1D06 A;  3E4Q A;  2J80 A;  4NXF A;  5HD5 A;  3UB7 A;  3CWF A;  2OWH A;  3H82 B;  5IU1 A;  3LI8 A;  4H6J B;  3F1O B;  3RTY A;  4LRX C;  3UB9 A;  3MQQ A;  4BBU A;  3HJK A;  2VEA A;  2PD7 A;  4NXE A;  3BY8 A;  2V9A A;  3OLO A;  4HJ4 A;  2BAS A;  1GSX A;  4GW9 A;  5HWT A;  4I39 A;  5F5Y A;  3GDI A;  4R38 A;  3G6O A;  1LL8 A;  5HSQ A;  3MFX A;  1DP9 A;  1OT9 A;  2GJ3 A;  4GCZ A;  4PKY G;  1OJG A;  3LIA A;  1TS0 A;  2M1C A;  1KOU A;  2KX6 A;  2VV6 A;  3PYP A;  3FG8 A;  3LID A;  3H7W A;  4MN6 A;  4WUJ A;  5J3W A;  3UE6 A;  1XJ2 A;  1TS8 A;  4WN5 A;  3T50 A;  4EES A;  3EWK A;  2WKP A;  2Z6C A;  4WF0 A;  4XT2 A;  5DJU A;  5G4Z A;  2OWJ A;  4DJ2 A;  1GSV A;  5HDS A;  3BWL A;  4L9F A;  1LT0 A;  1X0O A;  3H7W B;  4I3A A;  4NXB A;  4R70 A;  3VE4 A;  3UMD A;  4F3L B;  1XFQ A;  5AVE A;  2EA9 A;  1DP6 A;  3HJI A;  3CLO A;  3F1N A;  3LUQ A;  4EEP A;  3MXQ A;  4EET B;  2QJ5 A;  1P0Z A;  1UGU A;  3LIC A;  4RQ9 A;  4F3L A;  2A24 B;  2ZBB A;  2L4R A;  5J4E A;  1N9N A;  1OJ5 A;  1GSW A;  3LIE A;  2HV1 A;  1DP8 A;  5KIZ A;  4L9G A;  3UME A;  2A24 A;  3F1O A;  2JN7 A;  3ICY A;  4HJ3 A;  1WA9 A;  2K7S A;  1MZU A;  5G4Y A;  3RH8 B;  5HWW A;  1T1C A;  2VV8 A;  3LIB A;  4GS9 A;  1UWP X;  2PR6 A;  2QKP A;  2ZOH A;  2VLG A;  3NOU C;  4HNB A;  5DKK A;  4EXO A;  3E4P A;  1XJ3 A;  4EER A;  2OOL A;  2WKQ A;  3MQO A;  4HIA A;  1G28 A;  4KUK A;  4BBV A;  5EFW A;  5AVF A;  4HY8 A;  5HD3 A;  3F1P A;  2H28 A;  1T1A A;  4JGP A;  1UWN X;  5F68 A;  2PYP A;  5HDC A;  4E04 A;  3IS2 A;  4WL9 A;  2L0W A;  1P97 A;  3MJQ A;  2V1B A;  1OTB A;  2YKH A;  4NXG A;  1S67 L;  2QHK A;  2ZOI A;  3CAX A;  2Z6D A;  4EQ1 A;  2L1M A;  3FC7 A;  3KX0 X;  4HP9 A;  4HI4 A;  2V0U A;  3UB8 A;  4BBT A;  1F98 A;  1OTE A;  3LI9 A;  5F69 A;  3MR0 A;  4LPZ A;  5J7E A;  5A8B A;  1DRM A;  3A0S A;  3A0R A;  1T1B A;  2PR5 A;  3B33 A;  4M4X A;  3F1N B;  4LLO B;  1EW0 A;  3D72 A;  4HJ6 A;  5TBM A;  5HZH A;  3K3D A;  2WKR A;  5HDD A;  4EW7 A;  1JNU A;  3LYX A;  3E4O A;  4HHD A;  4I3I A;  1N9L A;  4HH2 A;  3ZQ5 A;  1LSX A;  4GHI A;  5DKL A;  3UB6 A;  2CMN A;  3C8C A;  4R6L A;  1NWZ A;  3VE3 A;  4JGQ A;  4R3A A;  1S66 L;  3K3C A;  1T19 A;  2PDR A;  1N9O A;  3A0V A;  2D02 A;  4GS9 B;  1XJ6 A;  2INW A;  2YKF A;  1D7E A;  4I5S A;  4B9O A;  3H82 A;  1BYW A;  2QJ7 A;  3GEC A;  4H6J A;  4DJ3 A;  4LRY C;  1S1Y A;  2KDK A;  1S4S A;  1OTI A;  2PYR A;  3NJA A;  1LSW A;  4HH3 A;  1V9Z A;  2V1A A;  3F1P B;  1T18 A;  2JHE A;  4L9E A;  4WLA A;  5HWV A;  4MN5 A;  3H9W A;  3LIF A;  1VB6 A;  1XFN A;  3IS2 B;  4HP4 A;  4I38 A;  2VV7 A;  2R78 A;  3NHQ A;  4PKY A;  1OT6 A;  1S4R A;  1TS6 A;  3ULF A;  1TS7 A; 
#chains in the Genus database with same CATH topology
 3P01 A;  1BTL A;  4CLC E;  4KQQ A;  4EBN A;  2XH9 A;  1F2K A;  1F9I A;  1MWU A;  1AXB A;  5DF9 A;  2ZD8 A;  5CTM A;  2WAD A;  4E6W A;  4QY5 A;  5EVE A;  3IH8 A;  3E4Q A;  2WGI A;  4Z9Q A;  2HDS A;  2KOI A;  3RTY A;  4LRX C;  3UE1 A;  4B88 A;  1P9W A;  4KZ7 A;  4R38 A;  1ONG A;  3DW0 A;  3V5M A;  2JKF A;  3LID A;  4G3W A;  1TS8 A;  4UEY A;  5FI6 A;  2XQZ A;  4R70 A;  2VKS A;  2XFT A;  1BLH A;  2XLN A;  4JF6 A;  4MBH A;  2R9W A;  3BQ8 A;  1J9M A;  1N9N A;  3QP2 A;  1FSY A;  2ZC4 B;  4GNU A;  3IBJ A;  4L9G A;  3RXW A;  3BFD A;  4EQI A;  4KZ8 A;  2ZOH A;  2VLG A;  1S0W A;  1XXM A;  4HY8 A;  3IF6 B;  3DAV A;  4N92 A;  3Q07 A;  4EQ1 A;  4HI4 A;  4CLC B;  4KEN B;  4BL2 A;  3A0S A;  4IJG A;  1N9B A;  3VSL A;  4JPM A;  4HBU A;  3HUM A;  1E4D A;  2CMN A;  3JYI A;  2O9C A;  4GZB A;  2HP6 A;  2WK0 A;  3QHY A;  2VZW A;  3UDF A;  1XFN A;  3V3R A;  5FQJ A;  3ULF A;  3IBR A;  4BD0 A;  1SHV A;  1ZTU A;  1DJC A;  4LRZ E;  2Y4A A;  3PR6 A;  5FDS A;  3C7V A;  3VV4 A;  4X69 A;  3WS4 A;  4WZ4 A;  3W2Z A;  4DE1 A;  1LSV A;  2EXA A;  3G31 A;  2OLU A;  3SOI A;  2JKT I;  1D06 A;  1ES2 A;  5KSC A;  1L0F A;  1ACF A;  1P9R A;  3EEA A;  2FZ0 A;  5L07 A;  3NI9 A;  2E8J A;  2DNS A;  4LFU A;  1KOU A;  1MKM A;  2PAV P;  2ZLY A;  4O8G A;  1GSV A;  5HAP A;  2V8C A;  3WRZ A;  5AVE A;  3MXQ A;  2FFY A;  4F3L A;  4BEN A;  3OBF A;  4P6Z S;  2P74 A;  3Q81 A;  1EI5 A;  4JBF A;  2IWB A;  4DKI A;  3Q7Z A;  5HWW A;  4P0M A;  3N8R A;  3GMW A;  2V8F A;  2Q0O A;  3NOU C;  2XSS A;  4PHT A;  5AQB A;  4KUK A;  1G28 A;  1PI5 A;  4JF5 A;  5HDC A;  1FCM A;  3O3V A;  1K55 C;  2V1B A;  1S67 L;  3RXX A;  3MKF A;  5EV0 A;  3S7N A;  1KDW A;  2V20 A;  3A3J A;  5FI2 A;  4DE3 A;  1EW0 A;  3T1X A;  2GZA A;  1IKI A;  4HHD A;  3MBZ A;  4LEN A;  4JGQ A;  3VSK A;  1N9O A;  4OON A;  1BYW A;  3D4F A;  1OTI A;  3T1R A;  5HAI A;  2P08 A;  3H9W A;  5DF7 A;  2W3D A;  3CJM A;  1MWT A;  3HLE A;  3NIA A;  1GHI A;  3KSF A;  4ZBE A;  1ODV A;  3KYQ A;  1J3W A;  2V1Z A;  4P85 A;  5MC7 A;  3G34 A;  3C2W A;  1CEF A;  1PNE A;  4EBL A;  4N1H A;  3PHY A;  1SKF A;  4WZ5 A;  4B93 A;  2V2F F;  3M6B A;  1HZO A;  1NYM A;  1MC0 A;  3BQA A;  4EV4 A;  1L0G A;  4OQG A;  2Q9M A;  1XA1 A;  4X1L A;  4GW9 A;  5HSQ A;  1YKD A;  1LLB A;  4PKY G;  1YLT A;  3FKV A;  3PYP A;  4WUJ A;  4LGW A;  2Y2G A;  2LB9 A;  4DJ2 A;  3S7O A;  1IKG A;  1KGG A;  4P6B A;  3SS4 A;  3BYD A;  2WGW A;  1CF0 A;  3CZD A;  2A24 B;  3V50 A;  3RH8 B;  2HPB A;  4GS9 A;  2Y2J A;  3UNW A;  4DRT A;  1OPX A;  3EQU A;  5AVF A;  1FCN A;  4X6T A;  3DWK A;  4H8R A;  1W7F A;  1P97 A;  5FAS A;  4X1M A;  2ZOI A;  2L1M A;  4K0W A;  1TF1 A;  4LV0 A;  3R4K A;  3PBR A;  4I3I A;  3E4O A;  4GDB A;  4OOY A;  4ZJ3 A;  4R6L A;  4JXW A;  4FD8 A;  3WRT A;  1S66 L;  3HL9 A;  1Z09 A;  4U0X A;  4GS9 B;  3JPU A;  3HUN A;  1KE0 A;  3T4S A;  1T18 A;  4MN5 A;  3E98 A;  3FPV A;  4E3J A;  1KE4 A;  1K0K A;  4IUH A;  1MY8 A;  5IS1 A;  5CEC A;  3B3X A;  3MQ0 A;  4UQI M;  1XJ4 A;  1ES4 A;  3P7N A;  3LEQ A;  3CPT A;  4D60 A;  4XXR A;  4HOI A;  1BUE A;  3NEC A;  3GQZ A;  5CED A;  1IEM A;  4CLC C;  2V9A A;  2XF3 A;  3VFH A;  1DP9 A;  1FIK A;  4PM7 A;  3T50 A;  4UAA A;  1JWZ A;  4XUX A;  3VE4 A;  3T1Q B;  2WAE A;  1Q2Q A;  1NLY A;  1MWR A;  4IBR A;  2G7U A;  3KSG A;  1OJ5 A;  2EX2 A;  1ZG6 A;  2QMI A;  3C7U A;  5EVI B;  4PM5 A;  3VP1 A;  3QNC A;  3VP4 A;  4IBX A;  2W3G A;  2IA2 A;  5D3O A;  4EER A;  2OOL A;  5DTS A;  2Q9N A;  3WWX A;  5CXW A;  3WS2 A;  4BBV A;  4NK3 A;  1BLC A;  3OPR A;  3F1P A;  1UWN X;  3E2K A;  5DFX A;  4BWI A;  5FI7 A;  2W1T A;  3B33 A;  3QP6 A;  2PR5 A;  4EU0 A;  2A49 A;  3LY3 A;  4LLO B;  4OPR A;  3GRJ A;  4CLC A;  1YT4 A;  3M6H A;  2VA0 A;  1N9L A;  2PU2 A;  4MNR A;  3FYZ A;  2QYB A;  4EWF A;  2EXB A;  2ZM2 A;  1T19 A;  3EOI A;  4DE2 A;  3H82 A;  3MF0 A;  4H6J A;  3Q1F A;  2HDR A;  4FOF A;  3F1P B;  1K6S A;  3OC2 A;  3GV9 A;  2VV7 A;  2R78 A;  1NRJ A;  5EFW A;  1S1Z A;  5CTN A;  2GX5 A;  2P9V B;  4S2O A;  2Y2O A;  4P6Z M;  5F6A A;  3R7W B;  3NOP C;  3W4O A;  4IUK A;  1YLY A;  5FQ9 A;  4XUZ A;  4Y0U A;  4S2K A;  5HPI A;  4ARZ A;  1XPB A;  4ESP A;  4HES A;  4Y15 A;  1WE4 A;  3IHB A;  1OT9 A;  4NXG A;  3T12 B;  5J3W A;  1RGY A;  1MPL A;  4E3K A;  2Z6C A;  5E2G A;  2ZQ8 A;  3GSG A;  2PT7 A;  1FR1 A;  3T4T A;  3HJI A;  3UPP A;  1AWI A;  2JKG A;  3G2Y A;  4OP5 A;  2WGW B;  2GNX A;  2ZL1 B;  1PZP A;  2PRF A;  4YNR A;  2K7S A;  4KZ9 A;  1SZV A;  2Z2M B;  4OH0 A;  5GLB A;  1DY6 A;  5M19 A;  4DXC A;  5CGS A;  1CK3 A;  3IXG A;  3UB8 A;  2EWV A;  5HZH A;  4HJ6 A;  3IT9 A;  4BL3 A;  1CI9 A;  2XFS A;  4ETZ A;  2ZJ9 A;  1VEU B;  4HEF A;  2EFX A;  3U4L P;  1D7E A;  1YLZ A;  1M40 A;  2KDK A;  1SKO A;  1K54 C;  1Y54 A;  2XDM A;  3FWL A;  1XA7 A;  2HP5 A;  4I3J A;  4R1G A;  2J3T C;  3PTE A;  4QJG A;  3CHW P;  4KQR A;  4S2P A;  1TVF A;  4N9K A;  3FV7 A;  3FZC A;  2D01 A;  2QWS A;  1PIO A;  3IXB A;  1IYP A;  4DDY A;  4LV3 A;  1CJF A;  1EWZ A;  3UB7 A;  3VMA A;  1GHP A;  5FEF A;  3F1O B;  3NDE A;  3ZNY A;  2HJE A;  2O99 A;  4ZDX A;  2RL3 A;  1FSW A;  3OLO A;  3BFE A;  1XGJ A;  1L3L A;  3EQV A;  4GCZ A;  1BT5 A;  1N4O A;  3U2A A;  1RP5 A;  3C30 A;  1YQS A;  4OPY A;  4OLD A;  2OWJ A;  3C5A A;  3BWL A;  1LI0 A;  5FDH A;  1TDL A;  3LY4 A;  3CIT A;  4ZRR A;  2WKH A;  1MKI A;  3VP2 A;  5EVL A;  3UME A;  4Q8I A;  4MLL A;  1S6R A;  4S2M A;  1PYY A;  1ONH A;  1UWP X;  2QKP A;  4UA9 A;  4CPK A;  2ZM0 A;  3CMZ A;  5F82 A;  1LHY A;  5TGF A;  3ISG A;  4E04 A;  1H8Z A;  2B18 A;  2H28 A;  4JGP A;  1LL5 A;  5EM0 A;  4CQH A;  2YKH A;  4MBF A;  1YAX A;  5AJG A;  4OVD A;  3M2K A;  4C75 A;  1DJB A;  4KG6 A;  5BOH A;  1W8Y A;  5HPF A;  1M6K A;  2QZ6 A;  1YLW A;  1WYB A;  1XKZ A;  3MZD A;  1V9Z A;  1FIL A;  3LIF A;  3TW8 A;  3DTE A;  2EX9 A;  4PAU A;  3NC8 A;  3O87 A;  3BY9 A;  4QWO A;  2EWW A;  1W63 Q;  5I94 A;  3NOT C;  3FPW A;  4R4R A;  4YOF A;  4GHI B;  3EEH A;  4R4S A;  2XGN A;  4IVK A;  3OPL A;  2Y91 A;  2BAS A;  4P87 A;  4I39 A;  5HWT A;  1LL8 A;  5GHZ A;  3Q7V B;  2KX6 A;  2WAF A;  1XJ2 A;  1PRQ A;  4Y5F A;  3S22 A;  5G4Z A;  3DWZ A;  5GLD A;  3UMD A;  2Y2I A;  1PFL A;  1ERQ A;  1CI8 A;  3MS6 A;  3LIC A;  1H8Y A;  3DBA A;  5KIZ A;  1K4F A;  1H5X A;  4Q0H A;  4Q0I A;  1ZC2 A;  4CLC D;  1NXY A;  5GHX A;  1OME A;  1H3Q A;  3BEB A;  4NKP A;  3CUE C;  3NBL A;  4X25 A;  3MJQ A;  1TEM A;  2Y2P A;  2MJ6 A;  2Z6D A;  1ESI A;  4X56 A;  4R3J A;  4M4X A;  3ZG0 A;  5TBM A;  4KZA A;  1K38 A;  3HLB A;  5HDD A;  4YFM A;  3C8C A;  4Y13 A;  3HLC A;  3VP3 A;  4B9O A;  1GHM A;  2Y79 A;  4LRY C;  1S4S A;  4Y2F A;  4KQO A;  4BLM A;  4JLF A;  3UB5 P;  3VP0 A;  4DDS A;  2ZC6 B;  1SKO B;  5F83 A;  4KZ5 A;  1BLS A;  4U0T A;  1KDS A;  5EOO A;  1BUL A;  4KQD A;  3ZG7 B;  3SW1 A;  1MWS A;  2OAQ 1;  2J80 A;  2XA7 M;  1A0K A;  2B95 A;  5A8B A;  1SDE A;  1L2S A;  5CRF A;  2UWX A;  1IFQ A;  3NCK A;  5F5Y A;  1U60 A;  3KSH A;  3MFX A;  2HF6 A;  2VV6 A;  2IWD A;  4OPQ A;  1PWG A;  3EWK A;  4KZ4 A;  3SH7 A;  5HDS A;  1X0O A;  4DMZ A;  3LUQ A;  2Y8H A;  2XD5 A;  3HCY A;  4OP8 A;  1O07 A;  1K57 A;  1DP8 A;  4MDZ A;  3ICY A;  4HJ3 A;  4KZ3 A;  1MZU A;  5L10 A;  2J7V A;  3HUO A;  4MN7 A;  1T1A A;  4GLQ A;  4NEE D;  2VGL S;  5F68 A;  1OTB A;  4R0Q A;  2XRN A;  3LI9 A;  1DRM A;  3D72 A;  3KSI A;  2K31 A;  2FFF B;  3ZQ5 A;  5HL1 A;  2OV5 A;  5CEB A;  2O9B A;  4X55 A;  2JKR I;  2Y2K A;  3BW6 A;  2G2W A;  5E43 A;  2B5R A;  2PYR A;  3NJA A;  1LSW A;  3IWI A;  2H0Y A;  3IS2 B;  3PBN A;  1OT6 A;  1OTD A;  3D9Y A;  4HQA A;  1FR6 A;  2WYX A;  2ACG A;  1V9Y A;  5DJT A;  2J8Y A;  1WYC A;  4JGO A;  2I9V A;  3PXP A;  3C4O A;  4ZJ2 A;  4QY6 A;  5DFY A;  3ZG5 A;  3LEZ A;  2W1R A;  2QPN A;  4PM6 A;  3G6O A;  1TS0 A;  4B4Z A;  1C3B A;  5FL3 A;  3MSH A;  3P98 A;  3HLD A;  3HRE A;  3IH9 A;  1UGU A;  3CUE A;  2L4R A;  4O01 A;  5J4E A;  4OQH A;  2A24 A;  3N4I A;  5G4Y A;  1XX2 A;  2DCF A;  1NZO A;  2PR6 A;  5EUA A;  5DTT A;  3MQO A;  3PBT A;  4LV2 A;  2M7V A;  3PBO A;  3T4O A;  4DF6 A;  3UDI A;  5EOE A;  4S2N C;  4ETX A;  2J3T D;  1VHM A;  1NY0 A;  3KX0 X;  5GLC A;  2V0U A;  3CG5 A;  3Q82 A;  3MXR A;  3W4P A;  2IWC A;  4UHU A;  4WMC A;  4HH2 A;  5DKL A;  2WKE A;  4R3A A;  3HLG A;  2D02 A;  2WZZ A;  2G2U A;  1G6O A;  3V3S A;  4Y3I A;  5FSR A;  4E3M A;  4L9E A;  4Q0J A;  1H0M A;  1DJA A;  4QD4 A;  2ZC5 B;  3O5Y A;  3S1Y A;  4DXB A;  1Y28 A;  2W0N A;  2JCH A;  4GB7 A;  4LV1 A;  2OLV A;  4WZ5 C;  3W8K A;  4MBK A;  5L09 A;  2PHY A;  4JGR A;  3K2N A;  4ZJ1 A;  4WEL A;  1JWP A;  3PBS A;  3SH9 A;  1YSP A;  1E25 A;  4NXE A;  3PBQ A;  3QP1 A;  3IX8 A;  3A3D A;  4DN0 A;  3MKE A;  3ZYT A;  3IF5 A;  2VK3 A;  5C5K A;  3ZNT A;  2FH5 A;  4R3B A;  5A90 A;  3ZVT A;  3D3O A;  3DTI A;  4EES A;  4XT2 A;  2W3H A;  4X53 A;  4B4X A;  2EFU A;  5G18 A;  4PM8 A;  4X68 A;  1D1J A;  1G68 A;  3T1S A;  3S4X A;  2X71 A;  2XRO A;  3LIE A;  3T4J A;  3A3I A;  2BLS A;  2HJ9 C;  5E2H A;  3A3F A;  5EVI A;  2WKQ A;  5FQM A;  2NUP C;  5J8X A;  2W3E A;  2ZMA A;  2DMW A;  3ZGA B;  3AGE A;  2QHK A;  3HVF A;  3AGF A;  1OTE A;  5F69 A;  1W8Q A;  2WGV A;  4LPZ A;  4WEK A;  4N9L A;  4II7 A;  4GHI A;  4FH2 A;  3IXH A;  1NWZ A;  5LBR A;  3IHA A;  2PBD P;  4E6X A;  3KO6 A;  2ZC3 B;  3BEC A;  1F5M A;  4GDN A;  2QJ7 A;  3IWQ A;  5FA7 A;  3B42 A;  3UE3 A;  2Y2Q A;  1O7E A;  2A2L A;  1VET B;  4FTX A;  4O7D A;  2ZQA A;  1OJG A;  3NDG A;  4BJP A;  3WS1 A;  2Y2N A;  3TOI A;  3VOL A;  1HLU P;  1PI4 A;  5GL9 A;  4N1X A;  4K08 A;  3O86 A;  3JVV A;  2W27 A;  5TFQ A;  3E0Y A;  4S2I A;  3ZG8 B;  4EEU A;  4IHQ A;  1I5Q A;  3UB9 A;  3LI8 A;  1FQG A;  3TE8 A;  4JXG A;  1PW1 A;  3UN7 A;  2VGL M;  3ITA A;  5L2F A;  3ZDJ A;  1VET A;  5FQK A;  3WS0 A;  3H7W A;  3A3E A;  1NLZ A;  3UPO A;  4L9F A;  1NRF A;  2JKT M;  5HX9 A;  5EVI C;  5KZH A;  3FKW A;  3CI6 A;  5K5B A;  1K4E A;  2ZMF A;  2Y55 A;  3BRM A;  5U47 A;  1GSW A;  1ERO A;  1YPR A;  4LCL A;  1T1C A;  2VV8 A;  2OSU A;  5AQ9 A;  1Y4O A;  1YLP A;  4S2N A;  1JVJ A;  4M3K A;  2VJW A;  1IEL A;  2JC7 A;  1SCW A;  5TJJ A;  2H5S A;  2Y2H A;  3CAX A;  2ZQD A;  4AFI A;  1ALQ A;  4WYY A;  2M7U A;  2RCX A;  4NG2 A;  2VGK A;  3S7Q A;  3O88 A;  3LYX A;  1XGI A;  3AGD A;  1IYO A;  2PBY A;  5FAP A;  3WS5 A;  1ES5 A;  2OAP 1;  3T4K A;  2LB5 A;  5IT5 A;  3V67 A;  3L7H A;  2P9V A;  3NHQ A;  1GCE A;  4OKP A;  5A91 A;  4QHC A;  5I5L A;  1SDN A;  2B02 A;  3BFG A;  1ZG4 A;  1G6A A;  4IVI A;  4JXV A;  4NET A;  5FAQ A;  3N6I A;  3IQA A;  2V0W A;  2J9P A;  4Y17 A;  1NYY A;  4NXF A;  3MZE A;  5DF8 A;  3CWF A;  2OWH A;  3W4Q A;  4UA6 A;  4O0P A;  2H10 A;  3G4P A;  4QU3 A;  2W3F A;  1GSX A;  4KG5 A;  4A5R A;  2BTF P;  4WM9 A;  3KYE A;  1YSQ A;  2M1C A;  3FG8 A;  1LL9 A;  3TG9 A;  4I3A A;  4F3L B;  2EX8 A;  1NZU A;  1XFQ A;  2O9A A;  4OQ0 A;  1JTG A;  4EEP A;  2ZL1 A;  3BLM A;  4MCW A;  4KZ6 A;  3BLS A;  2ZBB A;  5GLA A;  1ESU A;  3S7P A;  1W63 M;  2HV1 A;  3BFF A;  4S2J A;  4GN2 A;  2ZC7 A;  3IF6 A;  5TR7 A;  2BG1 A;  4BQM A;  3P09 A;  3MFD A;  2AVX A;  4WBG A;  5HD3 A;  2X02 A;  2PYP A;  3IS2 A;  5FEG A;  2L0W A;  1ES3 A;  1QMF A;  1K56 A;  4HP9 A;  1FOF A;  2HGV A;  3LGO A;  5HAQ A;  1FCO A;  4LCM A;  2E8I A;  1JNU A;  5E2F A;  1E3U A;  3QP5 A;  4JF4 A;  1W79 A;  2J9O A;  1IYS A;  3VOY A;  1XJ6 A;  3GEC A;  3MZF A;  3LR0 A;  4ME4 A;  3KYZ A;  4C3Q A;  4G3K A;  1VB6 A;  1PW8 A;  1IYQ A;  2R9X A;  4FCF A;  4S2L A;  1MBL A;  1TS6 A;  2P04 A;  2H0T A;  3JVU A;  4XT2 B;  3ZHH A;  2P7J A;  4OOM A;  3OCL A;  1OTA A;  3RFB A;  5CHU A;  1G5U A;  1KE3 A;  4GJ4 A;  3CPT B;  1W5D A;  5IU1 A;  4BBU A;  5EPH A;  4RX3 A;  3NUL A;  2VEA A;  1JWV A;  3QP8 A;  4HJ4 A;  5JYO A;  4OLG A;  2GJ3 A;  1PWD A;  4MN6 A;  3IXD A;  4FSF A;  2WKP A;  4E3N A;  3Q7V A;  3H7W B;  5FAO A;  1K54 A;  4OQI A;  2WKI A;  3CLO A;  3F1N A;  4UQI S;  4RQ9 A;  4GOG A;  1BZA A;  5CX7 A;  3F1O A;  3T4Q A;  1WA9 A;  2ZM8 A;  4RA7 A;  4G3V A;  3LIB A;  1KVM A;  2XA7 S;  4HNB A;  5DKK A;  4EXO A;  1K55 A;  4HIA A;  1I2W A;  4Y7P A;  1BLP A;  1H8M A;  2Y2M A;  4JXS A;  2EX6 A;  3C4P A;  4C6Y A;  3FC7 A;  3GR2 A;  4FH4 A;  4KG2 A;  3BJN A;  2JBF A;  3TSG A;  4EW7 A;  2W1T B;  3UB6 A;  2ZQ7 A;  4GD6 A;  5JYP A;  3LCE A;  3K3C A;  4HBT A;  2INW A;  1JTD A;  1NJ4 A;  1YMS A;  2HZ5 A;  2DRW A;  3IWO A;  5HWV A;  5EVI D;  3HLF A;  3EGD C;  5HFO A;  2C5W B;  3C38 A;  4PKY A;  2HDQ A;  4Y0O A;  1CEG A;  2PD8 A;  2X01 A;  3QP4 A;  3T4L A;  5DTK A;  3ZG9 B;  4BD1 A;  3LO7 A;  3L9K A;  3E2L A;  3N8S A;  5HD5 A;  3SS3 A;  4E3O A;  3H82 B;  5HW3 A;  3HJK A;  2PD7 A;  3UPN A;  2HDU A;  3UO9 A;  2VX8 A;  3OPH A;  1YM1 A;  4EUZ A;  3GDI A;  3GTC A;  1BSG A;  3UE6 A;  2XK1 A;  4ZTK A;  4WN5 A;  1HVB A;  4K91 A;  1Q2P A;  3DTM A;  3N8L A;  4NXB A;  2WZX A;  3G35 A;  5M18 A;  2J3W A;  1LI9 A;  3SZT A;  4U3T A;  4UA7 A;  4Z1W A;  3TRC A;  4ARZ B;  1RCJ A;  1QME A;  4WL9 A;  3PAG A;  2HP9 A;  2UV0 E;  3OZH A;  3ZVW A;  5J7E A;  5CHM A;  1T1B A;  3UE0 A;  1KGE A;  3OPP A;  4QPR A;  3VE3 A;  4PMA A;  3G2Z A;  3BFC A;  2YKF A;  2NUT C;  4DJ3 A;  2VGJ A;  3M2J A;  2XD1 A;  2JHE A;  1ZKJ A;  4HP4 A;  1S4R A;  4RYE A;  3R7W A;  1PZO A;  4GD8 A;  1STZ A;  5DVA A;  5HAR A;  4KUO A;  5TBM B;  5HL6 A;  1VM1 A;  1TDG A;  3RJU A;  1VEU A;  4K0X A;  3HLW A;  4YWZ A;  2JE5 A;  5AQ7 A;  1VQQ A;  1YLJ A;  1XP4 A;  4H6J B;  4OOL A;  5IHV A;  3PAE A;  3MQQ A;  4KZB A;  1KGF A;  4GKU A;  2WUQ A;  3ITB A;  4FUW A;  3ZFZ A;  2XR0 A;  2K2N A;  3LIA A;  4JKT A;  4WF0 A;  5L8M A;  2Y59 A;  1K25 A;  2PU4 A;  1IOU A;  1ERM A;  3IX4 A;  1DP6 A;  2QJ5 A;  1P0Z A;  4MEZ A;  5A93 A;  4YIN A;  1MXO A;  4MMN A;  2KLI A;  3ZCZ A;  5A92 A;  5CGX A;  1YMX A;  4E3L A;  3MXS A;  1Z6F A;  3TJZ C;  5FQI A;  4PPR A;  4EBP A;  4D2O A;  1GA9 A;  2JKR M;  4PM9 A;  4ID4 A;  3A0R A;  5EM1 A;  4EUV A;  1K57 C;  3K3D A;  1L0D A;  3OCN A;  4DE0 A;  1RGZ A;  3A0V A;  5AQA A;  4F94 A;  4I5S A;  2ZMV A;  2ZQ9 A;  5KMW A;  4HH3 A;  4WLA A;  3QNB A;  4I38 A;  4WMC D;  3OOV A;  4IED A;  1KVL A;  3VFF A;  4ZAM A;  5M1A A;  3G30 A;  4L0L A;  2C6W B;  1K6R A;  3N7W A;  1I2S A;  5EE8 A;  5EEC A;  3DTK A;  3G32 A;  5FAT A;  3BY8 A;  4CJN A;  5CHJ A;  3NY4 A;  3UDX A;  4RVA A;  5FQQ A;  3LR5 A;  3LR4 A;  1CQA A;  3BM6 A;  3IX3 A;  5DJU A;  3GVB A;  3LFV A;  1LT0 A;  5CER A;  5KSH A;  2A3U A;  2EA9 A;  3SH8 A;  4EET B;  3LR3 A;  1ZHH B;  4WEJ A;  4R23 A;  1HTZ A;  5E2E A;  1TD5 A;  5F1G A;  2JN7 A;  1GA0 A;  4E3I A;  3B47 A;  3VOZ A;  4QB8 A;  2ZQC A;  3E4P A;  1XJ3 A;  3MMH A;  1L0E A;  3IF6 C;  2O0Y A;  1HD8 A;  4BBT A;  1F98 A;  1K56 D;  2I72 A;  3MR0 A;  5CGW A;  3F1N B;  2Z2L B;  3SS5 A;  4OPZ A;  2WKR A;  3HBR A;  1PWC A;  1LSX A;  4BMW A;  1E3U D;  4RX2 A;  2CC1 A;  2XEP A;  2PDR A;  5F1F A;  4Y0T A;  1S1Y A;  2Y2L A;  3EGX C;  2V1A A;  3I7J A;  5GHY A;  2GDN A;  3UY6 A;  3V39 A;  1TS7 A; 
#chains in the Genus database with same CATH homology
 2P04 A;  3P01 A;  1OTD A;  1S1Z A;  4CLC E;  2GX5 A;  3JVU A;  4HQA A;  4XT2 B;  1V9Y A;  5DJT A;  2P7J A;  4OOM A;  1F9I A;  3OCL A;  4P6Z M;  5F6A A;  3R7W B;  3NOP C;  5DF9 A;  1OTA A;  4IUK A;  3RFB A;  4JGO A;  2I9V A;  3PXP A;  4GJ4 A;  5HPI A;  5DFY A;  3E4Q A;  5IU1 A;  2KOI A;  4BBU A;  3RTY A;  4LRX C;  4ARZ A;  2W1R A;  2VEA A;  1P9W A;  4HJ4 A;  4R38 A;  3G6O A;  1OT9 A;  2GJ3 A;  1TS0 A;  4NXG A;  5J3W A;  3LID A;  4MN6 A;  4G3W A;  1TS8 A;  4FSF A;  5FL3 A;  4UEY A;  2WKP A;  2Z6C A;  3H7W B;  4R70 A;  2VKS A;  2PT7 A;  3T4T A;  3HJI A;  3CLO A;  3F1N A;  4UQI S;  1UGU A;  4RQ9 A;  3CUE A;  3BQ8 A;  2L4R A;  4O01 A;  5CX7 A;  5J4E A;  1N9N A;  2GNX A;  3IBJ A;  4L9G A;  2A24 A;  3F1O A;  5G4Y A;  3T4Q A;  4YNR A;  1WA9 A;  2K7S A;  4G3V A;  3LIB A;  2PR6 A;  2ZOH A;  2VLG A;  2XA7 S;  4HNB A;  5DKK A;  4EXO A;  3MQO A;  4HIA A;  3PBT A;  2M7V A;  3T4O A;  3PBO A;  4HY8 A;  1H8M A;  4ETX A;  2J3T D;  1VHM A;  4EQ1 A;  3FC7 A;  3KX0 X;  3UB8 A;  4HI4 A;  2V0U A;  4CLC B;  2EWV A;  3A0S A;  5HZH A;  4IJG A;  4HJ6 A;  3BJN A;  4EW7 A;  2W1T B;  4HH2 A;  4ETZ A;  5DKL A;  3UB6 A;  2CMN A;  4R3A A;  3K3C A;  2D02 A;  2O9C A;  2INW A;  1D7E A;  1G6O A;  2KDK A;  4Y3I A;  2VZW A;  5HWV A;  4L9E A;  4Q0J A;  1XFN A;  3EGD C;  4PKY A;  3C38 A;  3O5Y A;  3ULF A;  3IBR A;  4I3J A;  1Y28 A;  2J3T C;  2PD8 A;  2W0N A;  1ZTU A;  4LRZ E;  3PR6 A;  3T4L A;  3VV4 A;  2D01 A;  2QWS A;  3W2Z A;  2PHY A;  1LSV A;  4JGR A;  3K2N A;  4WEL A;  2JKT I;  1D06 A;  5HD5 A;  3UB7 A;  3PBS A;  3H82 B;  3F1O B;  1YSP A;  3HJK A;  4NXE A;  2HJE A;  2O99 A;  2PD7 A;  3OLO A;  1P9R A;  2VX8 A;  3EEA A;  3PBQ A;  2FZ0 A;  4DN0 A;  3ZYT A;  3GDI A;  3EQV A;  4GCZ A;  2FH5 A;  5C5K A;  1KOU A;  3UE6 A;  3D3O A;  3U2A A;  3C30 A;  4EES A;  4WN5 A;  1MKM A;  4XT2 A;  2W3H A;  2OWJ A;  4O8G A;  1GSV A;  3BWL A;  4NXB A;  5AVE A;  3CIT A;  4ZRR A;  3MXQ A;  4F3L A;  3OBF A;  2J3W A;  4P6Z S;  2XRO A;  3LIE A;  3UME A;  3T4J A;  5HWW A;  4Z1W A;  3TRC A;  4ARZ B;  2HJ9 C;  1UWP X;  2QKP A;  3NOU C;  2XSS A;  4PHT A;  2WKQ A;  4KUK A;  1G28 A;  2NUP C;  4E04 A;  2B18 A;  2H28 A;  4JGP A;  5HDC A;  2W3E A;  4CQH A;  4WL9 A;  2DMW A;  2V1B A;  2YKH A;  1S67 L;  2QHK A;  3S7N A;  1OTE A;  5F69 A;  4LPZ A;  1YAX A;  5AJG A;  5J7E A;  1T1B A;  1EW0 A;  2GZA A;  4WEK A;  4HHD A;  4II7 A;  4GHI A;  1NWZ A;  5LBR A;  5HPF A;  4QPR A;  3VE3 A;  4JGQ A;  3KO6 A;  1N9O A;  1F5M A;  2YKF A;  1BYW A;  2NUT C;  2QJ7 A;  4DJ3 A;  3B42 A;  1OTI A;  3UE3 A;  1V9Z A;  2JHE A;  2P08 A;  3H9W A;  2A2L A;  3LIF A;  4HP4 A;  2W3D A;  1S4R A;  3TW8 A;  1OJG A;  4BJP A;  4PAU A;  3R7W A;  3KSF A;  1STZ A;  1ODV A;  3KYQ A;  3BY9 A;  5MC7 A;  3VOL A;  4KUO A;  2EWW A;  3C2W A;  1W63 Q;  4K08 A;  5TBM B;  5HL6 A;  3NOT C;  3FPW A;  3JVV A;  3PHY A;  2W27 A;  4YOF A;  4GHI B;  3E0Y A;  3EEH A;  4YWZ A;  4B93 A;  4EEU A;  4IHQ A;  3UB9 A;  3LI8 A;  4H6J B;  4OOL A;  3MQQ A;  1MC0 A;  3BQA A;  3TE8 A;  2VGL M;  2BAS A;  4GW9 A;  5HWT A;  4I39 A;  5HSQ A;  1LL8 A;  2K2N A;  1YKD A;  4PKY G;  3LIA A;  3PYP A;  4WUJ A;  2KX6 A;  3H7W A;  1XJ2 A;  2LB9 A;  1NLZ A;  4WF0 A;  4Y5F A;  5L8M A;  4DJ2 A;  5G4Z A;  3S7O A;  4L9F A;  2JKT M;  3UMD A;  1IOU A;  1DP6 A;  2QJ5 A;  1P0Z A;  3LIC A;  2A24 B;  3CI6 A;  5K5B A;  2ZMF A;  1GSW A;  3DBA A;  5KIZ A;  4MMN A;  4Q0H A;  3RH8 B;  2KLI A;  1T1C A;  2VV8 A;  4Q0I A;  4GS9 A;  4CLC D;  1OPX A;  3EQU A;  5EFW A;  5AVF A;  2VJW A;  1H3Q A;  3TJZ C;  4NKP A;  3CUE C;  3MJQ A;  1P97 A;  2JKR M;  5TJJ A;  2ZOI A;  3CAX A;  2MJ6 A;  2Z6D A;  2L1M A;  1TF1 A;  4AFI A;  2M7U A;  3A0R A;  4M4X A;  5TBM A;  4EUV A;  3S7Q A;  3K3D A;  3R4K A;  5HDD A;  3PBR A;  3OCN A;  3LYX A;  3E4O A;  4I3I A;  3C8C A;  4R6L A;  1S66 L;  3A0V A;  4GS9 B;  4I5S A;  4B9O A;  2Y79 A;  2ZMV A;  4LRY C;  1S4S A;  4Y2F A;  2OAP 1;  4KQO A;  4HH3 A;  4WLA A;  3T4K A;  3T4S A;  1T18 A;  2LB5 A;  4MN5 A;  3E98 A;  5IT5 A;  4I38 A;  3V67 A;  3FPV A;  3NHQ A;  3OOV A;  4IUH A;  5IS1 A;  3MQ0 A;  5I5L A;  2B02 A;  4UQI M;  1XJ4 A;  3P7N A;  4L0L A;  4KQD A;  2V0W A;  3SW1 A;  4HOI A;  2OAQ 1;  4NXF A;  2J80 A;  2XA7 M;  3CWF A;  2OWH A;  5A8B A;  4O0P A;  4CLC C;  3BY8 A;  2V9A A;  1IFQ A;  1GSX A;  2W3F A;  5F5Y A;  3LR5 A;  3LR4 A;  3KSH A;  3MFX A;  1DP9 A;  2HF6 A;  1YSQ A;  2M1C A;  2VV6 A;  3FG8 A;  3T50 A;  3EWK A;  5DJU A;  5HDS A;  3LFV A;  1LT0 A;  1X0O A;  4I3A A;  3VE4 A;  4F3L B;  5KSH A;  1XFQ A;  4DMZ A;  2EA9 A;  2O9A A;  4EEP A;  3LUQ A;  2Y8H A;  4EET B;  3LR3 A;  1NLY A;  1ZHH B;  4MCW A;  4WEJ A;  2G7U A;  2ZBB A;  3HCY A;  3KSG A;  3S7P A;  1W63 M;  1TD5 A;  1OJ5 A;  2HV1 A;  1DP8 A;  4MDZ A;  2JN7 A;  3ICY A;  4HJ3 A;  1MZU A;  3B47 A;  2W3G A;  2IA2 A;  3E4P A;  1XJ3 A;  4EER A;  2OOL A;  4BBV A;  3MMH A;  5HD3 A;  3F1P A;  4MN7 A;  1T1A A;  4GLQ A;  1UWN X;  2VGL S;  2PYP A;  4NEE D;  5F68 A;  3IS2 A;  2L0W A;  5DFX A;  1OTB A;  4BWI A;  2O0Y A;  4HP9 A;  2HGV A;  2XRN A;  4BBT A;  1F98 A;  2W1T A;  3LI9 A;  3MR0 A;  1DRM A;  3B33 A;  4EU0 A;  2PR5 A;  3F1N B;  4LLO B;  3D72 A;  3KSI A;  2K31 A;  2WKR A;  4CLC A;  1JNU A;  3ZQ5 A;  2VA0 A;  1N9L A;  1LSX A;  4BMW A;  2QYB A;  2O9B A;  1T19 A;  2PDR A;  3EOI A;  1XJ6 A;  3H82 A;  3MF0 A;  3GEC A;  4H6J A;  2JKR I;  3BW6 A;  1S1Y A;  3LR0 A;  4ME4 A;  3KYZ A;  4FOF A;  3NJA A;  2PYR A;  3EGX C;  1LSW A;  2V1A A;  3F1P B;  4G3K A;  3OC2 A;  1VB6 A;  3IS2 B;  2VV7 A;  3PBN A;  2R78 A;  1OT6 A;  1TS6 A;  1NRJ A;  1TS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...