4DJ5X

Proteinase k by langmuir-blodgett hanging drop method at 1.8a resolution for unique water distribution
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unique water distribution of Langmuir-Blodgett versus classical crystals.
pubmed doi rcsb
source organism Engyodontium album
molecule tags Hydrolase
molecule keywords Proteinase K
total genus 97
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2012-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4dj5X00
4H6WA 3EDYA 1S2NA 1SUEA 2Z2YA 4OMDA 4I0WB 2Z2XA 1GTL1 3AJ8A 1LW6E 3SICE 1GTJ1 1SCBA 1YJBA 2WV7A 1C9NA 3PTLA 1EGQA 4JP8A 2ZRQA 4LVNA 4CG0A 1GA1A 3DVQX 4FONA 1BFUA 1GA6A 1SPBS 1Y3BE 2Z56A 1R0RE 1YU6A 2Z57A 2SNIE 2E1PA 2SBTA 3BPSA 3DDZX 3DE3X 3GT4A 4OV6B 5ARDA 3GCXA 3CNQS 3Q40A 3QTLA 2Z2ZA 3WIUA 1SIOA 4DJ5X 1PTKA 3A3PA 1AF4A 2XRMA 1EA7A 5SICE 1AH2A 1SUPA 1PJ8A 2SICE 3A3NA 3DE5X 5ARCA 3LPAA 1ZVKA 1Y33E 1PEKE 3UNXA 2W2NA 4B5LA 1XF1A 1C9MA 1Q5PA 1SBCA 3DVSX 1DUIA 3F7MA 1WSDA 1KDZA 3AJ9A 2WUWE 1AVTA 1A2QA 3VV3A 3QFHA 3DE7X 1PFGA 1CNMA 1AU9A 1SUCA 2GKOA 2ST1A 1YJAA 2X8JB 1R6VA 1V6CA 3ZXXA 3L1KA 4ZOQI 2X8JA 5AVJA 1WVMA 4J94A 1Y4DE 5FAXA 3GT3A 2WUVA 5AQEA 4YN3A 3VTAA 4KG7A 4LVOA 1Y9ZA 1ZVJA 4CFYA 2ZWOA 3LPCA 1SBNE 1S02A 4H6XA 3WIVA 1HT3A 1WMFA 2DQKA 1T1GA 4HX2A 3TI7A 5JXGA 3DW3X 5CW1A 1UBNA 1SIBE 1BFKA 1ST2A 3A3OA 3CO0S 3DE1X 3I34X 2G4VA 2IXTA 2SECE 2ZWPA 1SUBA 5B1EA 3DE2X 5JXIA 3DVRX 3TECE 4NE9A 1BE8A 4MZDA 1GNSA 1MEEA 1TM7E 3WHIA 1AV7A 1SBHA 2XTJA 5JXJA 4KPGA 3VYVA 1JEAA 1SN7A 2PWAA 1TM5E 1KE1A 1Y1KE 1SUAA 1IC6A 1TM1E 2IY9A 3DE0X 4BWGA 2PKCA 1P8JA 1T1IA 1C9JA 3F7OA 3Q5GA 2W2PA 3DWEX 1GTG1 4HVLA 1TMGE 1Y3DE 5I9SA 1VSBA 2PMWB 3AFGA 4DZTA 1Y4AE 4DWWA 1TK2A 1OT5A 1TM3E 1YJCA 3I2YX 3QMPA 3DW1X 2W2MA 5FFNA 3OSZA 1GA4A 1S01A 5AVKA 2W2QA 4C3VA 1KDVA 1TO2E 3GCWA 1C3LA 2WWTA 4KB5A 3BX1A 3DYBA 3SQOA 2ID8A 3T41A 2TECE 1AQNA 1SUDA 3LPDA 4M1ZA 3WQBA 4CFZA 3VHQA 2DUJA 3D43A 3DE6X 3TI9A 2Z58A 1Y34E 1THMA 3LXUX 1WMDA 1KDYA 5JXHA 1MPTA 3BGOS 1SELA 2Z30A 4NE7A 1NDQA 4Z2AA 3DE4X 4WOBA 1R64A 1SBTA 1TO1E 3D9QX 1BE6A 1GCIA 5ARBA 1Y48E 1NDUA 1GT91 4ZARA 5JMOA 1CSEE 2P4EA 1AK9A 1TECE 1SIUA 5AMXA 1SVNA 3EE6A 1SBIA 3VV2A 2W2OA 1T1EA 4RYDA 1IAVA 1OYVA 1SCJA 5B1DA 4AKTA 2DP4E 3EIFA 1OYOA 1DBIA 1NLUA 1WMEA 2HD4A 2PWBA 3HJRA 4WOCA 4OMCA 5K7SA 2PYZA 4C3UA 3I37X 3ZXYA 1BH6A 4NMXB 1SCNE 1GNVA 2PRKA 3F49S 4K8RB 1KE2A 3P5BA 4GI3A 1ST3A 1Y3CE 2PQ2A 2B6NA 3H42B 5FBZA 3VSBA 1Y3FE 4AKSA 2V8BA 1SCAA 2HPZA 3I30X 4H6VA 2QTWB 1SCDA 3PRKE 2ID4A 1P7WA 1V5IA 1SH7A 1BJRE 1TM4E 1P7VA
chains in the Genus database with same CATH superfamily
1XHLA 2C59A 3B1YA 3P9PA 4GZ6A 4HGPA 5L3RA 3RS0A 3QVSA 1L5WA 4OK5A 4NABA 4C06A 2BDUA 2C8VA 1UMCB 4TLEA 3V7UA 1GNLA 3I5AA 1PP4A 2BYTA 1M2OA 3V8MA 1IVNA 2BGIA 3CONA 5AKKA 3MPOA 3UV7A 4A36A 3F3SA 1EWYA 1IULA 3ICWA 3CINA 1RXWA 1OIXA 1W4RA 1JXQA 2RKOA 2QLMA 3B9QA 121PA 3JRXA 3E1GA 4FE4A 1ESZA 1RDFA 3LCRA 4QPJC 5FEUA 1VBKA 1MV5A 2PZFA 3W6ZA 1WETA 4U7WA 2ISCA 3S7ZA 3P9YA 4PPNA 3QFSA 4MV3A 3ENQA 2J08A 1SD2A 2WUWE 3WMXA 5D2CA 2NPOA 2X4IA 4MYRA 1FTGA 3FSRA 3PC6A 4G4IA 4Z0PA 5BVGA 1A8IA 2NU7A 1ZL0A 5CLGA 4G5GA 3UA3A 3ADCA 1VIDA 1E94E 4UVHA 1VZ3A 2FVYA 4ZCPA 2G4LA 1IN4A 3ZIAD 2PH7A 2XZPA 1HL7A 3H8WA 4IJMA 1V3QE 3N6VA 5FORA 3LPCA 1TTQB 1AZLA 1EP9A 1GAEO 2W6JA 3SNKA 3ZNOA 5B36A 5JBIA 3PXAA 1SXJB 1Z5NA 3L5KA 3FYUA 4O4LB 1D2HA 3QVTA 2NUBA 3UV6A 1UIMA 1X86B 3LBHA 5JPDA 3WFJA 1N6IA 2XMPA 2ZROA 1XD9A 3CCFA 4D4JA 3OY7A 4DCPA 2QG6A 1NLFA 1P2TA 2P2GA 2WU8A 5KSWB 4E12A 3MUNA 5K3FA 1X80A 3A6EA 2A1TR 4EUFA 3J81k 3QUQA 4AP9A 3FAZA 2YJ6A 3ETNA 4FD2A 3Q11A 5A03A 5EMHA 3X43A 2OFFA 3UHOA 4YBRA 4X1KA 2BZ1A 5ICFA 5WRFA 4WD3A 2XWPA 3SS7X 4D4MA 3LLVA 3QW2A 3L92A 4GMDA 4IEFB 5LMNB 2FA9A 4B3FX 1TO2E 4EVIA 1VQ1A 3E7WA 3RTGA 1PX2A 1Q0HA 1RXCA 3M6LA 3NASA 4NBWA 2GGSA 2ZWVA 4I5DA 2ZRFA 5ALIA 1FDIA 1T6ZA 3NIDB 3V8QA 2DPGA 5AI0A 5EIXA 4ZZIA 1AOXA 2YUTA 4WOBA 5IW8A 5KWVA 4IMRA 2ZYTX 3GJ3A 2CBXA 4G8DA 4EFNA 3MJVA 1T3HA 3EFOB 2JGFA 1O1YA 4OYLA 3ZY6A 2FN8A 1XL1A 1K5PA 1O8CA 2BGJA 2CUTA 2IEIA 2H06A 2JLSA 2WU4A 3AUTA 3O5AA 5FR1A 3V4OA 2GCOB 5D8DA 3AESB 2A33A 2IYSA 5F4ZA 3AEZA 2YY6A 5GJVC 2PEZA 3T99A 1KI6A 1R0WA 5BN1A 1MNAA 1K88A 1HA3A 1I10A 1LSUA 1BH6A 2PL5A 3KPVA 2YHSA 3GLIB 1FNNA 3T0GA 4KOAA 4M54A 4X6LA 3BMOB 4BVKA 1LV8A 1IQUA 4OOEA 5AKGA 1HYQA 1QUEA 3FLMA 1W88A 1W73A 3BHJA 4KRFA 3I5XA 4DILA 2OV4A 4CWAA 2A3RA 2DULA 3IQFA 4ALLA 1W88B 2PFGA 2PL3A 5TX7A 3SJUA 5L51A 1UMBA 4RGQA 5KJFA 2UVQA 4TPKA 2HEGA 2XUGA 4X93A 4C30A 5HZKA 5BSKA 4K40A 2HXGA 2O50A 4MMXB 5FULA 3T0IA 2JI8A 2FG5A 1Z3CA 2Y9PB 3V2HA 1G41A 3VBEA 3EPRA 2FRDC 3SICE 3FOAA 3M6FA 2PU7A 4I3FA 1E2IA 1WBDA 4EYSA 3LKDA 5DHPA 3MTIA 4KX3A 4L7QA 4CDNA 1ZCJA 5K8VA 3I5YA 3ZD7A 4HQ0A 1EDDA 1KK0A 1G6HA 2FWRA 3TYXA 1THTA 3UYLA 3OF3A 3E3NA 4EF6A 4IIFA 4B7AA 2VATA 3LDAA 4EMUA 2Y0PA 3C4JA 3L7CA 2CDRA 1PJ8A 5HQTA 4LYAA 2ZIVB 2QL6A 2WLSA 1HFEL 1YQDA 1I6MA 2G09A 2JC3A 2X8WA 3KXPA 4IS3A 4WBNB 5ICEA 1T3LA 3FNBA 2X7HA 2I4TA 1Q50A 3F7MA 4P54A 3KXIA 3ZW8A 4HXYA 4AS3A 4NHOA 4BV2A 4MEBA 4N0MA 3GUHA 2CLIB 4LYYA 2X13A 1WB6A 4LMAA 4EEZA 1P6XA 1XKQA 2EFEB 3S2YA 3UHPA 4DY4A 2WZQA 3KYCA 3ZOKA 1T1JA 5JY6A 2C9DA 5IH7A 1T8WA 3MD0A 2OD9A 4AFNA 3A9RA 4O25A 5KVSA 1OOEA 1WP9A 1OXBB 3RB8A 1CVIA 1YZKA 4DIKA 3L7OA 4JDPA 4WY2A 4FPXA 5CAEB 2A14A 1HLFA 2X0KA 4ZEXA 3VR5D 5KMGA 3R3HA 4NMWA 2FU5C 3AB3A 3O26A 2GJAA 3ASVA 3RD5A 1YHNA 1SNYA 3QOFA 2AI2A 4L8VA 3WL7A 2VHEA 3PYLA 1ZH4A 1JA9A 4IG4A 1KOGA 2FZ4A 1NVDA 3FOBA 3H7AA 5TQ2B 5KWIA 1G3QA 3TGWA 1C9JA 1MO5A 2C4HA 3V6MA 1C80A 3B5IA 3DTVA 1GSOA 2CLFB 4L9WA 4WCFA 5IJ0A 3K72B 4KXMA 5GADl 1X87A 4INAA 5F35A 2VF2A 5FT9A 3SYMA 1JNXX 4NNPA 4HN4B 4TN1A 1GQOA 4J07A 3RREA 6PFKA 5GTDA 2VUTA 4IMIB 1V3TA 5EFOA 2ZB7A 3ZV5A 3KP1A 4XQEA 3HR8A 4D57A 4P82A 3JQAD 5CTJA 5JT1A 4CJXA 2QPTA 2ZZKA 2R68A 1GGMA 3DT6A 3ETCA 1OASA 3F5SA 4HQRA 16PKA 2XLCA 2J3KA 1L7BA 4IPTA 2I6QA 2VQDA 1RHJA 2IPMA 3G8BA 4BAUA 3A1TA 4KAXA 5BURA 5JCXA 4D5EA 1FQOA 2AWNA 1IY8A 2FEOA 3HHEA 1SBTA 2QLLA 3HYRA 4EHBA 1J2RA 3VOAA 2FFHA 4D3FA 7MDHA 3CX4A 3FPGA 4Z9FA 3M89A 4E0BA 1EFCA 3MS2A 1VE3A 1N1MA 4MLPA 3PC8A 4UDXX 5H81A 3S6JA 1XRLA 2IEYA 3LT1A 4D98A 1JN0A 3JQ9A 4CG3A 3TS1A 4DJJA 3HCRA 4ITUA 5ICSA 2OUKA 1O9BA 1JLLA 2GUWA 3QOXA 5LDHA 4BUJA 1T2FA 4FIZA 1RLUA 4NXNB 4J90A 4YDHB 3D0KA 4RLHA 2WSYB 2X42A 4ERNA 2A35A 2VYNA 1MAVA 2NO0A 2WAYA 4IEEA 3BMCA 2D06A 3KFVA 3QXHA 4IZIA 4K8RB 4ZYLA 5DYNA 1KXJA 5A04A 5KC9A 4IO1A 2B1GA 2ZSDA 4PG4A 2BWJA 1L5VA 3FLBA 3H3FA 2OV1A 2OP1A 2WNSA 4ITVA 1V1RB 4EYKA 2Q1WA 5D7NA 3R2JA 4FWBA 9ABPA 1C3LA 4J16C 2XQGA 4ZU6X 2B2XA 3IBGA 1WF3A 4FOPA 3JCZA 1MQSA 1LDYA 1NVWQ 4KLRA 1LZKA 1C9NA 2IDKA 1B15A 1L7DA 1U0HC 5EIBC 4E31A 1GA6A 1A27A 1X70A 3H0KA 4QWWA 2VH5R 4RPGA 4YJFA 3T5DA 1JHYA 1M6HA 2B61A 1N6RA 2G77B 1YQEA 4UC0A 3IDSA 2NPFA 2EW2A 1RKBA 2BJWA 1ODFA 1BS2A 1L6IA 1GFZA 3MAJA 4LEIA 5CH5A 1XVVA 3DZJA 3HVUA 1XNHA 3NJ8A 1DTSA 1DJQA 4AIRA 4PAGA 2OB2A 3N59A 3NNSA 1KOJA 1XV5A 1MX5A 2GD2A 5LZ4A 1SBCA 4NS4A 3FGZA 3AJ9A 3DBLA 5K4HA 1HBJA 3W3AD 5AUOB 3HB7A 3PJEA 1A5TA 2PQMA 3IMGA 4EVQA 1YOBA 3D6FA 1T5OA 5EP3A 1AG9A 4J7CA 5TARA 4EF5A 2JJYA 2PKQO 2QENA 3HLTA 4KGXA 1FZQA 5BWOA 2GFIA 4IRMA 4EH1A 4YN3A 1SXIA 4B9AA 5BN3A 2ZQZA 5LMCA 2J7PD 3PUJA 3UK2A 2P1ZA 4OU4A 4UPVA 1E0KA 5KNBD 1EKXA 2VG8A 4RTNA 1H1TA 4OY3A 4ZMBA 3DMDA 3WRXA 2A86A 3L93A 5A9SB 5AXCA 2WB2A 3IURA 1G7RA 1H0HA 1GPYA 4NFHA 4F4UA 1ML3A 3PI6A 1DPFA 4YJ3A 4KQXA 1SG6A 2WW8A 2ZANA 1SC4A 3ODGA 3D3KA 1JAYA 3N2KB 4ZA2A 3W1VA 5JRJA 4OJNA 1N1GA 2QLTA 5IK2A 3CISA 5C3UA 3OKAA 5FKJA 5ENVA 3R0ZA 2ZI9A 3W2TA 4Q9IA 2R79A 1DIHA 3B1VA 4AF7A 1SU4A 4M9SA 3RFXA 1GQFA 3P9ZA 1EE2A 3HJBA 4TSKA 4XB2A 4HTAA 2ZB4A 3KAQA 3G02A 4C9BA 1RQRA 2G1KA 2E5LB 1WUYA 4MUYA 2QG9A 3L1IA 4QUHA 1ORVA 3OZUA 4BLWA 1FLNA 3AEUB 2IP1A 3G5UA 2CEAA 3VBCA 1YT5A 1L4FA 2P40A 1J20A 1AN9A 1X7ZA 4LZAA 4MA5A 4PBRA 2X5XA 2CXRA 4XASA 5DM1A 1UK9A 5JI3E 5KDDA 4ROSA 3R3VA 1S2IA 3G6KA 2W2OA 3OQ1A 2IU0A 3VPSA 4CKCB 2FR1A 3OU2A 1DV2A 1KERA 5T4EA 3RAEC 2JGMA 2BGRA 5I01A 4KSYA 1I24A 4Q18A 4UU8A 1KIMA 1V95A 2PFKA 2Z2JA 3LO5A 4JEUA 1CIJA 2H54A 1VHTA 3L0DA 2WZCA 1VSVA 3OEWA 4E2FA 4MEAA 2XXBA 4OMFG 1HDYA 4HQKA 1H1DA 3SX0A 1C9YA 4F6RA 5IF3A 4FM9A 2IQIA 1I94B 2HM7A 3FVWA 1BDJA 1DFGA 1LRLA 2DE0X 4XVQA 4XDHA 4A26A 5CBPB 1N34B 3L77A 3O8QB 3QUBA 5FBZA 5G0UA 2IUSA 1H9CA 2YVKA 4MYUA 4OFXA 4PNZA 2C2YA 1M1UA 1SCDA 4DV7B 2MR6A 3CIOA 2ZKIA 1GRNA 3PGJA 3UB3A 3QX7A 1T8SA 5EWLB 1L6RA 5BPHA 2D0OB 1RLOA 1WV1A 3GL9A 5AKXA 4ZVLA 3JW8A 3SEQA 4CKEA 2VF7A 1NW5A 1B8NA 2ZULA 3HNPA 4S0XA 2GTPA 2MSCB 1D1SA 1Z34A 5T4FA 4N7MA 4QXPA 1NBHA 3WDLA 3T5MA 3EBPA 3NHBA 3OJLA 1M2OB 1X7WA 3UKDA 1SPXA 4LRYA 2HMWA 2VRBA 3E48A 3HSKA 3I5MA 4AU1A 5AW4A 3ZJVA 3Q87B 1Z9BA 3GFRA 2I22A 1C14A 3DHYA 2A5JA 3PFCA 3RU2A 3VISA 4OKSA 3RRYA 1NW8A 4NQRA 1R10A 3STTA 3H6GA 4TT3D 4R2KA 3V7YA 4ZT3A 1VKOA 1YQQA 4GLLA 2VP3A 1SVKA 3F6EX 3GEDA 3MT9A 4HAXA 5EESA 1N78A 3SKVA 1KKMA 4YP0A 2Y77A 3CRNA 1M34E 1EP1B 1FDOA 3FI9A 2ZUBA 5JMWA 3RU9A 5GONF 3T3MB 1FU7A 4N65A 3D2BA 1GFSA 4QOJA 1DEXA 3CMMA 2DHRA 5L7WA 1F2UB 1HDGO 1ZD2P 4I50B 4JB3A 5AT1A 4EHLA 4Z7NB 1CB0A 3ZCQA 3X1YA 1GN8A 1OREA 1YQXA 1I33A 1Z75A 4G1UC 3NBUA 4TXHA 4EDHA 3ET5A 3MWDB 2FN7A 3R6WA 2Z95A 3CTPA 2J3JA 4F4FA 2CJFA 1OH8A 1XZ8A 4PZ9A 3E4DA 3SBXA 3KQKA 2QZPA 3DHVA 4NEGA 4LZPA 5EINA 3U7QA 4M0DA 2JGJA 4RK0A 4RMJA 4D3SA 3HM2A 1T5DX 4LHSA 2OHGA 3EVFA 2DZDA 1NBAA 3KKOA 4H7IA 2FWNA 3WGGA 3FFTA 2Q6VA 4US1R 1L7OA 2QN7A 4HAVA 4TTTS 1STOA 5EWJA 3U60B 1WZ2A 1YB4A 3SKYA 1T9GS 3GOHA 5JNWA 4NCBA 1GQ2A 1N2EA 1UCFA 4B85A 1XFDA 3VJRA 3GBSA 3LDFA 1P2GA 1GGNA 4ZP1A 5E1OA 1F8UA 4GOJA 3STWA 5ESDA 2GERA 2WQ7A 1GSAA 2VYND 1OILA 2XCQA 1ZH2A 1HL3A 5CUQA 1R5NA 4I6EA 2M6LA 3RBXA 3ZC3A 4BMXA 5INTA 2KI5A 4DRXA 2FCRA 3N8IA 4D4IA 3WIBA 3KU1A 1J2UA 1WXDA 1PVOA 3WWYA 3IT1A 3IX7A 4E5PA 1A9XA 4FHGA 5CJJA 4CKBA 1YS6A 2C2OA 3BAFA 4G81A 3IQGX 5LM3A 3ABIA 3Q9UA 4AJPA 1DKPA 4KQFA 4YUZA 1ZHFA 3X1XA 4L5AA 4ZYWA 3CEPB 3HFSA 4WHMA 1XDUA 4L57A 4A6PA 2O8NA 4IIDA 1Z6XA 4TWJA 1SOMA 2GEFA 1EX7A 3S1LA 2QV7A 1FTQA 3HVIA 1K06A 3KTDA 4ILKA 4MV8A 2NVWA 3RFTA 2ZIXB 5A71A 2GZMA 3IT3A 1JPVA 1PS8A 1TRKA 3Q2IA 3ZDFA 3E82A 1EVEA 3R0QA 4CTJA 3SMQA 4OI0A 1M8KA 4MQUA 2F1IA 3E53A 4LHWA 1PGNA 4UQOA 3JPYA 3LK7A 1YIAA 1HG0A 4FI3F 1BEEA 2W2KA 2ZI6A 4HN9A 3BGIA 4ZDJA 2GPJA 4RWEA 1SJ9A 4BP9A 2V65A 1SY7A 4ZGGA 1SC3A 1EGQA 1X9HA 2ID7A 4PVDA 1D2EA 1MU0A 3W6OA 3PT5A 2ZJAA 3ZE8A 3GEIA 3PCXA 1DWQA 2IX9A 2Z09A 2V55B 4B3SB 2ZT7A 1QIDA 4TMZA 2Z2ZA 3N07A 3QVWA 4B6SA 3H5IA 4OQFA 1CS0A 1LBQA 1QG0A 3PCRB 3SHQA 4BWYA 4IGFA 2AZXA 4NVRA 2W0MA 3OQ6A 5AHXA 2V6BA 3BOSA 4WXPA 5FEMA 5C0OE 1K7CA 1TAQA 2A0KA 2ZRMA 4P5EA 4XGRA 1WPQA 4P7FA 1CNFA 4L1KA 4G0PA 4PHTA 2GWRA 2V9PA 4MYTA 2OV3A 4R1SA 4CM8B 3U2QA 4EY8A 2UUBB 1QLJA 2H2AA 2X0NA 4HNUA 1F38A 3F9IA 4QTTB 1GCGA 1FP2A 1RAAA 1NX6A 7YASA 4MLCA 1V47A 1X14A 1BEZA 4KGDA 2D7JA 3EQ7A 1CUVA 4KMSA 4M36A 1E7MA 3T12A 3HV2A 4TYYA 1V7QA 5D5PA 2FNAA 4BV9A 5BORA 1YDMA 2F3QA 2O5VA 3HADA 3TQCA 4DREA 5CDUA 3W2GA 2K6GA 1S8FA 3CBGA 1VXOA 1J5XA 3UCXA 4OXNA 1YRQA 2HWWA 6REQB 3NT2A 4MWSA 4RHTA 1JJFA 2FSFA 2D3TA 1HNNA 3DE2X 3ROGA 1Z83A 2QX6A 4AZVA 1I6WA 3L04A 5C1PA 3MA0A 1HDEA 3O4GA 4ZAXA 1PZGA 5BNFA 4GDFA 1J07A 3RS3A 3JARB 3D8UA 1U0TA 2A30A 1LJUA 2HO4A 4ZT2A 1R6UA 5CB6A 3W34A 1T2DA 1F8YA 5AFSA 4HFMA 3KYBA 1U2GC 1HYBA 1RAEA 4RU1A 4U2FA 3QH4A 2J32A 4HDMA 1Z0JA 4QDJA 1NPTO 2C31A 2VNAA 4LC0A 5HIMA 3WRWA 2O8BB 2H51A 2OCBA 3CB2A 3T7TA 2GHQA 3VX4A 8AT1A 1VP3A 3FOFC 1G20B 3LOQA 4P7BA 3RLFA 3V9AA 3G2PA 3MWEB 1N75A 1WHTB 4RMNA 2YWEA 1NJ5A 1ATZA 1TTHA 1VZ2A 1Z4IA 1OTXA 1E2NA 2BZ0A 3HB9A 5DJ5A 4D8TA 4DCOA 3NGMA 3A32A 1Z6YA 3RF6A 4ZDKA 721PA 3A6KA 2F6RA 1YZ3A 3V7NA 4DMCA 4MUJA 1T9ZA 2Z8YM 3OT1A 4K9OA 3BG5A 1UQUA 1FP6A 1ZM2A 3GV0A 4DCUA 4EW2A 3OT1B 3MOGA 4M37A 1D9XA 3TQTA 4CM6A 3ZIUA 3C8DA 1NC1A 4WK6A 3GLKA 1ONPA 1NL3A 3UUGA 2GRAA 5BXYA 3KYIB 3O31A 1DIBA 1HLDA 3BWXA 5JC1A 1GG2A 3BDVA 3I0NA 4NU6A 2Q4DA 4W5HA 3INNA 1ZKDA 3C3WA 3GUUA 4FSXA 3IEPA 5ESWA 5FL7D 2DJIA 4FN4A 2HT1A 1U3CA 4TV8F 1H5QA 4DTCA 2PJRA 3KJGA 4G2NA 1G3RA 3ITKA 4QPZA 4F4JA 4MAMA 1RKVA 3IUPA 2EJWA 5FTLA 1OA0A 1ZKMA 1IEWA 3GD7A 3IBSA 1RYMA 4EGSA 2HWUA 3OTIA 4GT1A 2F3TA 5JNSA 2LTAA 1E7WA 2BTQA 2Y0DA 5ALDA 1JFRA 1R8SA 5E8JA 2F8MA 3UG7A 5BMVF 1IZ0A 1RJFA 1V4NA 1LQUA 4QOHA 3R41A 1PSWA 1E1KA 3AUFA 1O08A 1ZH6A 3HKCA 3M82A 3MTQA 5JR3A 3WK6A 3SE7A 1JI3A 2QS9A 1GTMA 5ARCA 3WHPA 2JFBA 1P4JA 1TCAA 1TIKA 1JLKA 2IQ5A 5FUBA 4OM8A 4X3CA 1YB7A 2IBMA 5JNRA 4QYMA 1IPHA 3EG5A 5H5JA 1GZ7A 3ELYA 3U4HA 2QR5A 3PUXA 4PNPA 1Q7TA 2W42A 4LF6B 1IY9A 1F2TA 3FCYA 5EJ4A 2JI6A 1KMNA 5BT9A 3ZDDA 4KCGA 1YA8A 1G5RA 3CSSA 1TNDA 1E8MA 2NWQA 3KHKA 1OFIA 1YBHA 4U3JB 5M3BA 3WBBA 4EB8A 4FFBB 4XLTA 3TQRA 9MHTA 2IA5A 2YXEA 2DAPA 1XI2A 3Q3VA 5B53A 5KSYA 1YRWA 1J0BA 2D2XA 2I66A 1Q22A 2DWOA 1MG0A 4HPJB 3U13A 2ZYAA 1NW4A 1OC4A 2VCEA 3LA8A 3OOJA 1QNFA 1N32B 5C4MA 1TCBA 2KBEA 5AJZA 1GTRA 4CM9D 4L8WB 3UENA 5J4VA 4BPBA 2V6MA 4KE9A 2XGSA 1ELOA 2JGEA 4D3XA 1ZISA 1Q1ZA 1JU9A 2B98A 2UUCB 1U0NA 4L4XA 1KQNA 3HEMA 3ZU5A 4X8OA 4FT4A 2IOHA 4TKVB 4W9NC 3UJDA 2J09A 1NAIA 5LJIA 1Y0BA 3IAXA 4WNIA 5EXPA 1VYUA 1KZYC 3U9TA 4GG1A 5C81A 1YJCA 1YR2A 2D4AA 2CMDA 1QHHA 1XXLA 3ZCSA 5EJEA 2F3SA 3W5SA 1NVBA 3ICQB 2C5FA 4IMPA 5GJBA 4TXMA 1CZRA 5LZ8A 3G9QA 4RTOA 2BGLA 3AMVA 3AF4A 2AJCA 2VPWA 1NG9A 1JTVA 5EJ6A 1KSFX 4N8SA 4U9UA 3KFXA 4B0OA 5FNZA 1P5ZB 1T5TA 2REXB 5AOCA 2ACVA 2BW0A 3PE3A 3ROMA 2R4UA 5KWSA 1E9AA 1KVQA 1VYHA 4G4SO 2PL9A 1Q92A 2CJYA 1JDUA 2X7XA 2J9YB 5ITZB 4DV6B 3NXKA 2GNAA 3RU7A 3V8RA 1OKKD 3GCDA 4RSRA 3RC7A 4LF4B 2HY7A 4FB4A 3RT9A 2BFCA 5IXJA 2XB6A 3I8XA 3F9RA 3WGZA 4JEIA 3SG0A 1EU1A 1OYOA 3FBWA 4Y6OA 3U4CA 2DFLA 1G7SA 2FWIA 5JD5A 3GQVA 1F0KA 4OGLA 1BKSB 1Q14A 2Q2QA 3EVNA 4LKRA 2GYVA 4X7RA 1COZA 2ZJ1A 1GIAA 4H3SA 1A7UA 1A9PA 1SHZA 2J67A 2FSSA 3KPYA 4CLDA 5KNCD 4B4VA 2PZLA 3IVGA 3WL4A 2FR8C 2FW7A 1B8UA 2G0NA 3P27A 3QI2A 4B8YA 2R8RA 4X95A 1CR0A 2ZYIA 3O8QA 3Q3IA 4KK3A 3UIEA 2ZSKA 2W6MA 3LVQE 4XGNA 2ORED 1UKAA 3GA0A 4GR5A 1QBGA 2BFBB 3Q98A 4M9CA 4D82A 1I4OA 1K0UA 4YRNA 1VI6A 3CZAA 1MZVA 3B78A 3C5WP 1TADA 3R5XA 4Q1CA 2HRCA 5TPWA 2X3UA 1XTIA 3UWKA 5H59A 5FIUA 1SCBA 5BSMA 3RKUA 2XOKD 1ZWKA 3IAAA 4OK6A 3CF4A 3TQOA 5JH7A 3FZNA 3O7WA 4QARA 1F3LA 3HZOA 1M74A 1L1FA 3KSMA 4AQYB 1R0YA 3IDOA 3QVJA 1NMZA 3PFFA 1WIWA 4YJHB 2K7FA 1EA7A 3L6UA 3M7IA 2AUTA 1RQGA 3DD1A 1RBZA 4H27A 4EHFA 1RWWA 1RKUA 3FUVA 5ERYA 3RFFA 3D8RA 4I9UA 5F52A 3KJZA 2ZS7A 5DRTA 3U6KA 2XRFA 4A6XA 3T5TA 4AMYA 4IGAA 4WN9A 2QRJA 2W5UA 1KEPA 2IPXA 2EZ8A 4NC9A 2BGGA 4DJAA 2GDZA 5KPDA 1NG1A 5DYTA 4DQ0A 1QNLA 4B84A 1R8QA 1M0EA 4OMUA 3C14C 3NT4A 2A5FA 3GIDA 3P97A 1W5SA 3TIIA 2QZSA 1U6IA 3GC6A 1JEYA 4GMHA 2CVPA 1L3CA 3DDOA 5BUCA 2R7LA 3FCAA 2CLKB 4FMDF 3HKDA 2WMNB 3Q1LA 4HOYA 2SCUB 3LW7A 4MRPA 1GLNA 1ZOLA 2YVAA 3M6WA 1GV1A 1E3EA 1PFKA 4N39A 1NWCA 4F3RA 1UZLA 3GARA 3PE4A 3LIPA 4IHKA 3WRYC 3NTVA 4KKVA 3R0JA 2OCLA 1VKRA 2DUUA 2PT6A 4XTCS 5ERGB 4G1BA 4RFSB 2VH2A 4C14A 4DIDA 4DKXA 1OT3A 4IOMA 1OLUB 1SN7A 1E4YA 2IZ1A 3AKZA 2QP9X 2MSLA 1DNPA 1JW9B 2D8MA 2WMOB 4HHEA 1JI0A 5T57A 4DSTA 3MXTA 3ZD8A 2AC7A 2Q46A 1MENA 4XTRA 1VG9B 5BW8A 5JAZA 3RJMA 1UPXA 5BV8A 3KB8A 4BKMA 4ARSA 2H08A 4MPDA 2D4HA 3ZXIA 2GZSA 5FQOA 3IQEA 1TEZA 3GQBA 5CD9A 1KJYA 3AEKA 2LCQA 1N7HA 2I91A 1KPGA 4HAOA 4QE3A 1D8AA 3F78A 1KOFA 1EQAA 3KFLA 3GJXC 5BNIA 4UOQA 5EJMA 1IFXA 2GCIA 1AA9A 1ZQ1A 1LX6A 2DX7A 4P3YA 4KKXB 4PGAA 2ZAOA 2AD5A 3T8YA 4YQYA 1TT5B 1VXRA 3H9BA 4RNDB 4Y9RA 1U9JA 4TWAA 2PGIA 4EHDA 1T2VA 1S2OA 3E3MA 4EW6A 1L7QA 1C41A 2BHRA 3MTAA 1BQ4A 3N2IA 5LNK1 2ET6A 1BYUA 2FPKA 3VKVA 3MMZA 3ORRA 2YZGA 1THGA 4PRZA 4AJ2A 2H18A 4KLCA 3UJ9A 1QAQA 1RXEA 2ECFA 1A5AB 3PUVA 4KH1A 3C7KA 3IVRA 1UM9B 1CW2B 4GLBA 1TA0A 4IL5A 4ENSA 4XCXA 4P22A 2ZDGA 1K97A 1OX6A 2BGUA 2G0AA 4MW0A 1L5HA 3AGQA 4A2WA 1QRTA 2QUIA 3AJ8A 4GMFA 2EIHA 3D3WA 3KZXA 5BVHB 1FRQA 2JFHA 2CMHA 4L28A 5AQ1A 1IPFA 1RMQA 3CMCO 4IIJA 1QV7A 4ZRMA 3ZVNA 4LY3A 2UUPA 2PRJA 3A70A 2JHCA 5GV7A 2R86A 3M6IA 2EC5A 4I3HA 4D97A 1DRUA 1SURA 3G2JA 1Z18A 5J9FA 2JCGA 3VJMA 4B33A 3EB9A 1LBEA 1L4NA 3I2JA 3I9FA 3UJHA 3ZEAA 3R5TA 1SB8A 4YASA 4CCAA 4L76A 4EB3A 4LOAA 4DAOA 1NVAA 1QHYA 1CNMA 1AU9A 3TR0A 5DNUA 2R2GA 4JJAA 1TYEB 1V6CA 4ZVKA 1PE0A 3DDHA 4Q3LA 1V7ZA 3ZHSA 1I2BA 1ZYUA 1P0FA 3ZE7A 3PDIA 2PCJA 3NBKA 5BNTA 3A1WA 3OZGA 2GF9A 4KYTA 4R8VA 2OCAA 3OLYA 3TSZA 3REGA 4ES6A 2PUBA 5BQXA 4JR0A 1AQYA 1E79A 3OM1A 3ISVA 1JHQA 1NW3A 2HA7A 3FHLA 4JUBA 1EFHA 2ZJBA 5FRDA 4QTYA 1FDVA 1E6UA 2G9VA 1GNTA 3AB8A 5B6IA 1MA3A 1MIOB 1B26A 1W1WA 5B1EA 1LS6A 1W52X 2P9ZA 2IYUA 3NTRA 4OH7A 3K9QO 1CV2A 3LT0A 1LPAB 4RVUA 4F71A 1M1YA 4GKBA 5C4GB 1P7PA 3IELA 4BMVA 5EJ8A 3QLUC 5F1KA 1V1RA 3Q88A 2PKCA 1N0WA 1CLEA 2ISQA 2OXCA 4N8EA 5CLQA 3CZ9A 3WLOA 1BE1A 3DTNA 4KWCA 3I05A 4EAAA 2JHPA 3NBZC 4M7WA 4ZQEA 3RC3A 4XIFA 3QBVA 2I4MA 3NDBB 4KREA 3WWDA 2V4MA 4D8VA 3HBAA 5G1PA 4DCTA 2VJPA 4N49A 2GLUA 2WJWA 1Y89A 3GLHA 4JLMA 3HY4A 2G88A 4UPEA 1US8A 3QTTA 3TCXB 4DIFA 1KDPA 3NOVA 1A8HA 3WDSA 4FWIB 4BNMA 5AVSA 3LDGA 4BXOA 4PN3A 3KNZA 4P0PB 3FCUB 3LO8A 4NR0A 3ELBA 3W9BA 1HZZA 4KR0A 4EJSC 1YRHA 1GZ6A 1CSEE 3CVOA 3O0TA 2OCYC 2O8FA 1ZEJA 1V5WA 1RQNA 1F6DA 4O5OA 3V46A 3I8SA 1SZDA 1UEIA 3PNKA 1PEDA 5LQAA 2EHDA 1ORWA 1EFUA 1U4OA 3RBZA 4LFAB 1JUDA 4RZUA 4ETIA 2AR0A 2L2QA 1XEXA 2OV8A 1CJSA 3KUCA 4PSVA 5FQNA 3REQA 4ARIA 2ZM5A 2GEVA 3PI7A 4CIVA 5LXTF 2CN1A 4AYXA 2R8XA 1EXWA 3NWOA 1UPFA 4JLJA 3HBNA 4PF1A 4JX9A 5FB3A 4O4IB 4A0QA 3F4LA 2HCBA 2JGDA 4IWNA 1XJQA 2YS7A 3N9IA 4LNUB 1QQTA 5EZYA 4JI3B 4YCSA 2ASEA 1CR1A 3FDFA 2AXEA 3GIWA 4DR4B 3LGSA 4MNTA 4HMPA 3QA9A 2R48A 1W4ZA 3TIVA 1Q0TA 1PWHA 2JLVA 2F55A 5T3UA 4K6CA 2CVZA 2JBWA 3NR2A 4B17A 4V1CA 2Z08A 3O8DA 1ZN9A 4OYHA 1ZR4A 5B58C 1R0RE 2EKBA 3TW8A 1CUGA 1XCGB 3M4NA 1S0UA 3Q0IA 3GP3A 1NJFA 3QTLA 4L50A 3VR4H 1FSPA 5COQA 3TLKA 5EFZA 4FKZA 4ALJA 2JJQA 1SXGA 3ADOA 1XZBA 1FMCA 3WO0A 1C4OA 4WTOA 1P17A 5DHSA 5FOSA 3HY6A 4DL9A 3KVNA 2JZOA 1EFLA 4DG5A 3QG5A 1T0BA 1XLTA 4A2CA 1ZH0A 1WCIB 5AJHA 2XZDA 4M6WB 5ALPA 4P4NA 1HF3A 3PR1A 1JEEA 2JK1A 4LQLA 4D4LA 4DA8A 5K0TA 5P21A 2ZJFA 1C30A 3CY6A 3GDFA 3G0DA 4R68A 4YLYA 4ABTA 1LW7A 3PEEA 4IFEA 4IJKA 2JAUA 1EZ4A 2AMYA 4NDAA 2WUVA 4OBEA 5F1YA 5HG0A 4BE7B 3DP9A 2HH9A 4OSOA 4TTRA 1P4AA 1TZMA 3L46A 1L4YA 2BR5A 1PK8A 2CYCA 3P2YA 1H3NA 3PXUA 3QGMA 2PMEA 3E1KA 4BV3A 1T6BY 1JMKC 1AD2A 3ZG6A 3BGSA 4YJ2F 4LZZA 5GV8A 2VRNA 3DB1A 3BJMA 1KVSA 4C22A 4DLTA 3H65A 1MAWA 4ITRC 2I9PA 5T41A 2OTCA 2GMWA 1W2WB 3IYLW 4IJ6A 3LUPA 1IOZA 4MPRA 2GWHA 3EXEA 4J0FA 1ACLA 2QMYA 3C39A 3MGCA 3P19A 4UUPA 4JJ4A 1KI2A 3CX7A 2ZAIA 5BV2P 3JAWA 2DTXA 4P31A 1VCMA 3QELA 1FJGB 1GTG1 3WMGA 1IXYA 2O2EA 2NYVA 3ZNNA 5G0TA 5DNYB 1Z6ZA 3S27A 3W8EA 1H8ED 4UBLA 3HUDA 5FJIA 2C7QA 5DGTA 1WL8A 3PPVA 4AP6A 2R62A 3EGEA 4JL5A 2EFJA 2H9IA 5HMLA 1Z22A 2GM3A 3UMCA 4L4YA 3N0RA 1MVNA 2AVDA 2H0QA 3A2KA 3B6IA 4WESA 6GPBA 5EHXA 1I6KA 2OGZA 3G9UA 3WKCA 4JFRA 1KBOA 1NVXQ 3AWDA 4N47A 3QX3A 1B16A 3W5IA 1GT91 2WJZB 1E5XA 3T1VA 4RESA 4PQYA 5KNDH 2GOYA 4IP0A 4TL8A 1XROA 2BFCB 2CLHB 3DMTA 4E22A 2VBIA 1K4MA 1KZHA 4ML3A 3RFUA 1E9VA 1AXEA 3WHLA 1DWPA 3E2MA 3X1MA 2R5WA 2NSJA 3TW0A 1U2QA 2IWRA 2CVOA 2PT7A 2YOGA 2C4VA 3WL3A 2WU3A 4E1BA 3WISA 4F9GA 5JQWA 2OBBA 4TMYA 1TU3A 1KE2A 4C7VA 4Z4QA 1RKQA 2HZ7A 4ESHA 4ZPJA 1QZUA 3HDGA 3PT9A 4BQSA 4CLRB 4U7HA 3G0IA 3GOQA 3AR8A 2YJTD 4RORA 2QTWB 3ORFA 5BPFA 3LCUA 1NT4A 3MZ0A 1U2DA 1P7VA 1KAMA 2VAMA 1KY4A 3EZNA 3P32A 3I28A 3PQ2A 4X54A 1OB2A 3ZHRA 2DR3A 4Q7JB 3E9DA 4D0SA 3UGQA 2W2LA 4BNKA 1REQB 1CTQA 4JROA 2HSDA 4RIEA 1LRKA 1PBTA 2COUA 2WD7A 3MB5A 2EP5A 5D3KA 3BCRA 2FMIA 2SNIE 1OLSA 1OXXK 1YS1X 2ZSHA 3GFSA 3IQDB 2PJUA 4M9UA 1C4KA 4WDQA 4X44A 4FHEA 4ZEWA 2O19A 3PGVA 3KVOA 3ZHQA 4YPFA 4ND2A 1H2WA 4LISA 3VDXA 4MKIA 4E2ZA 3S44A 3KETA 1ULUA 3KQTA 1U0SY 1TF2A 2D2EA 1IN6A 3O2SB 4LCJA 2OXRA 2EIXA 4O2AF 3HVRA 1XR3A 3KKKA 3FOZA 2WHRA 1Y3IA 4DXAA 1Z08A 5JNLA 2R7AA 1KZ7B 4BRSA 1XPRA 5HKKA 4O5AA 1JL3A 2H4JA 4A5SA 4BB5A 1KMIY 1B41A 2AFIB 2QM7A 3EY9A 1ODSA 2RHHA 1F0YA 2AFHA 2PK3A 1G59A 1ZK3A 3G0CA 1XPUA 5DRYA 3FKSA 2B2CA 3VI4B 3GEHA 4X5OA 3U49A 5EIWA 1COWD 2DYKA 1XZIA 3PITA 3AV3A 3D31A 3GBPA 3PD7A 2IU6A 4JZYA 3UMGA 4AULA 1BMTA 3W8DA 5FAKA 3DUFB 2P9BA 2WT9A 4OQQA 2GKSA 2ZBPA 1EB8A 1OXVA 2ODNA 1QORA 2M6SA 1Q83A 2PM8A 4KL8S 2P3SA 3WYEA 2RGBA 3A11A 1YV9A 1FFXA 3BXPA 3ESBA 5DGXA 2BVNA 4TQUS 1IB6A 2WTEA 1VHWA 4I9NA 3LPNA 3OX4A 4BZPA 3PA6A 2QKYA 2HPHA 4IH1A 3D4IA 3FF1A 1TKBA 4RVNA 1CE8A 3IP8A 5JNTA 1GG9A 1JV2B 1EVKA 3I2YX 2J5BA 3DGFC 4AN1A 3ESCA 3T1NA 3OTGA 4YFYA 4R16A 4XLLA 3TTUA 3VDQA 4ENWA 1U8UA 5AHRA 3EEQA 3K05A 2FLWA 3R4CA 4RKRA 1T8TA 3PSAA 1XJWA 1D03A 2R8YA 5LB2A 1YE5A 3AEQA 2O8EB 5JCPA 5JSZB 2BJHA 5TGZA 5IVDA 3CX3A 2UZ3A 3A9VA 1Z0ZA 4EUSA 1GCIA 2EDCA 1V8DA 3PQ5A 4MR8B 4ROTA 4OXYA 1JFFB 4CCYB 2BY4A 3ESAA 3OPVA 2FJUA 3HFGA 4UEQA 3S2EA 2ZSAA 1ZNWA 4MS4B 4TMXA 5AHKA 5EP1A 4NAHA 2H2FA 2NU6B 2J5XA 5HQ3B 1TJ5A 4H7PA 3RTDA 3C85A 1B43A 5CK4A 1LUAA 2QW0X 1B76A 3P9RA 1IYZA 1B7GO 5CNMA 2Q4RA 3EQ2A 4TVOA 4TV9F 1G8AA 3A6FA 4LXUA 5ALSA 5EZYF 3UK0A 3OJFA 1O58A 3OLXA 4PO9A 1FTWA 3ORHA 4V03A 1RFLA 3RSFA 4REMA 1VSQA 2VOEA 3K2EA 4UREA 1JJIA 3BVPA 3AR6A 3TLCA 2F43A 1VCNA 3ZPXA 5AVXA 3ESZA 1FP1D 4XWYA 2HWXA 3TRJA 4O63O 1NSYA 3TRKA 3QSYA 2OLKA 3RI3A 3SOZA 2FQWA 1GTL1 1R7RA 1LPSA 1T6YA 2ETXA 2GETA 3NHJA 4PZZA 4AZ3B 5K3OA 3MTJA 1KDOA 5F51A 4U7JA 2QRQA 4I5FA 1B3BA 2WU0A 1MAHA 4UUMA 5GONB 3L79A 2GK7A 4LOIA 1NN0A 5HILA 4HVCA 2BEVA 3C7TA 3N86A 1QX3A 4CU5A 4NYMR 5JBNA 3RUAA 3ANMA 3DQQA 5AW6A 1RZRA 1PJTA 1E9EA 2WIJA 4KE7A 4C0BA 1OAAA 2QNRA 3FR7A 4LXIA 1OIWA 2EX0A 3ZK8A 8MHTA 2H31A 1A2QA 2AE1A 2J3IA 4HDNB 2O9JA 4HAZA 1A8PA 3ZWAA 1WEHA 3C3CA 4IHJB 1R8XA 5K3AA 1VFNA 2HU8A 2QN9A 1I9GA 1Q7RA 3ZW9A 5LQNA 5KOIA 4CGYA 1GHTA 3AZPA 3CW2A 3FSEA 1J0AA 1O94D 2VJBA 1SULA 4JL8A 3W7AA 5L53A 2X5JO 4OQYA 2KSQA 2DTEA 2PZAA 3S2IA 3TAXA 3WNDA 3S1SA 1MGPA 1S8NA 1X77A 4D26A 4PBSA 4TUYF 4RZXA 4YT8A 3K96A 2F3RA 2QTBA 1OFUX 3B1ZA 3K0CC 3AYXB 1OYYA 1UPAA 3ZHOA 1OTHA 4HQLA 1CJBA 1RWMA 1SIWA 2A0YA 5FL3A 2HA4A 1Q20A 2ZR9A 2W2XA 2XKAA 4O4IA 5DW3A 2HNAA 2OBNA 1EX1A 3K2QA 1XKLA 3LV8A 3CN9A 3CHYA 4DEXA 5CDSA 5A9TA 2Z5LA 3SM9A 1DIGA 1RQPA 2GH1A 2YHBA 3HRKA 1YIDA 5JZMA 5KTYA 2G9RA 1E2MA 1QB8A 2BM1A 2GNPA 3A0RB 5IJXA 3NAZA 4MPPA 2VSYA 3MQ4A 2HF9A 4K8OA 4ISCA 3DW1X 3N2NA 4H9GA 4L6IA 4JIMA 3K0FA 1G8HA 1UAGA 4QD3A 4RPKA 5CYFA 4EB6A 4CEIA 4B3GA 4HAUA 4DR1B 1EGMB 2KLHA 3T9CA 4FX5A 4RLSA 2AMLA 2GD1O 1EWQA 2ORIA 4IUBS 3WI7A 1GNQA 4JD5A 3EXG2 4I4LA 1FQJA 2P78A 3X0DA 1UBJS 3DBRA 1P3JA 4CHGA 1XRPA 2XI4A 4OQ4A 5EXSA 4OI4A 7REQA 1TO1E 4AKEA 4KI7A 1CZKA 3C16C 2OENG 4C0AC 3F6YA 3ZI0A 4YV7A 4ETNA 2YXLA 1C1XB 2B8EA 4ID3A 3KR0A 2NU6A 5JHGB 1O0BA 5DNAA 1SBIA 5EAIA 1SC6A 2ZIEA 4K03A 2F1RA 1CC1S 1NM5A 3M1LA 3IBFA 3EUWA 1I4DD 3CXUA 2VZ9A 4PXSA 4ZYYA 2QRMA 3O1HB 3WMWA 3CEAA 4Z53A 3F46A 2Q5CA 3W8FA 4HFRA 3U44A 2FOIA 2PKEA 4ANFA 3PS9A 5LP6A 5HKBA 4NOMA 3EGXB 2HUNA 3I83A 4PX3A 2C9YA 2YWJA 4BNXA 4FMPA 1PW5A 1FBTA 2LW7A 3AR4A 2ZDQA 3GGSA 3JASA 3KYDA 4OXIA 5AJXA 4Y7CA 1S3FA 3P7MA 1QPBA 1CEQA 1E3SA 1XQ9A 5HF9A 1JAZA 2QORA 4RA6A 2XUZA 4J3NA 1XXHE 5EHIA 4C3ZA 4PGGA 1YGYA 3JQCA 3AOEA 4UAUA 4KXNA 3KLPX 1ZC3A 2FDRA 2I03A 1SC9A 2BMVA 4RIGA 1SD1A 4HDMB 4YAWA 2AFVA 2H1CA 3ZDEA 4ZVQA 2W6NA 4BGVA 3VOBA 4HEA6 4UATA 3I9OA 4MVJP 2J3HA 1EVIA 4I50F 4UE3S 4CKEB 1KTVA 3AHJA 3IJEB 3QK7A 1Q3KA 4ECEA 3CV3A 4IO0A 3G13A 1O6GA 1QYVA 1RM3A 2H2IA 3DMPA 4P8RA 3TD9A 3PX3A 4BECA 3FYSA 3SM3A 4GH5A 1TCCA 4A1FA 1UOOA 1T3SA 3AI2A 4IKPA 5KYUA 4DPKA 3L4BC 2D62A 1V2HE 3VHXA 4QTZA 1GZ4A 2HCTA 4XPZA 3HGMA 1PEKE 2P6PA 2QAJA 2WIKA 3A2NA 4MUFA 4O4LF 1T26A 4TTAA 4CCSA 1WQ3A 1DC6A 5KWEA 3TZKA 2CV2A 4FFMA 3SLKA 3LC0A 4FFOA 4JT4A 1M67A 4WE3A 2GHIA 5HCIA 4BMNA 3L02A 2FR8A 1C8VB 4RQAA 2X0DA 4RE6A 4X1YB 1HMYA 4BCBA 3I9JA 4V0KA 1M66A 1MUUA 3O4HA 5K0CA 1ABEA 1CETA 4LHVA 3IHLA 1TYCA 3MJRA 4Q93A 3OZDA 1AKVA 1L4HA 3F1KA 1Z2DA 4IGEA 3VR4A 3IE2A 4ND6A 3TOCA 1ISFA 1ECCA 1UBNA 5TRTA 5IT5A 5DXJA 2G4VA 1U7OA 1Y1LA 1RIFA 3BMOA 2F4NA 3L0IB 3M9WA 4O1HA 4PPFA 4L07A 5FWYB 3U26A 3A28A 4BLUA 2JNWA 3K92A 2ZSIA 1U80A 3LOPA 4S0ZA 3VYTB 5JNUA 5L4NA 2CEKA 4PSAA 1DKRA 3X3HA 3EXEB 2Q4OA 3LZDA 1RRCA 3D1LA 2N1BA 3S81A 3MT7A 3UANA 4Q24A 2XUHA 3MQ2A 3QU9A 4GGMX 3O2JA 1F14A 3U7IA 1DADA 2IEZA 2CDAA 2QUJA 2OXIA 2IP2A 3RNOA 1ZSYA 4GKVA 3WGQA 3HN2A 3HR4A 3PNOA 1FIUA 2FDCA 4YO7A 2EWMA 1MB3A 5IVKA 2Z3ZA 2OFPA 4N3CA 1ORDA 5B2EA 4IF6A 1ZMOA 5K9ZA 5KOJA 1X7HA 3H1BA 4ZOLA 1UDBA 1RXVA 2Z2KA 5KTRA 5F33A 3SI7A 3H97A 1YH3A 4I1PA 3AVXA 3I0ZA 3HJUA 3TXAA 4DVGA 1NDUA 1A2BA 5LBIA 3W2HA 1F06A 4C7XA 2H8GA 2D2IA 2AJBA 1QKKA 3TTWA 2JCBA 3W06A 3Q7RA 4J0KA 1KETA 1FYVA 1Y9DA 4R7GA 4C29A 3SZRA 1I0IA 3MXOA 1NXPA 4JJFA 3WTCA 1ECBA 3B12A 3M6AA 1Q15A 2JAXA 3CLRD 4TV9A 4GMGA 1XCMA 5ALGA 5EKXA 5TE9A 4AJ1A 2MYPA 2XF8A 1DOZA 1RZRD 1N5RA 1PJAA 5FHRA 4XWAA 2CVFA 4E5VA 1CHNA 3IEMA 1F20A 3NPAA 4MVJG 2PRKA 2F8TA 2I7DA 2IYPA 4LZJA 4GVPA 4UM5A 4DLNA 3N5CA 4A8JA 1PJBA 4GU5A 1WQ1R 4LSZA 4Y1GA 2GEDA 4I4TB 3ZK9A 1YNSA 4D9HA 2X22A 1CB7A 2GO1A 3LDHA 3KVYA 1T8UA 1SHLA 3NRJA 4H6VA 4HWSA 4J1NA 4J7AA 1DRVA 1DV1A 1YS2X 3AP3A 5I7SA 2OBYA 1KYTA 2C4WA 3I09A 4JLSA 4WRRA 1P5HA 3P4YA 1GOTA 2QQ5A 2ZRNA 1EDOA 3CZQA 4OAOA 4PINA 1OWOA 3JSXA 2NXWA 1PDVA 1MJGM 2YRWA 4OMDA 5CIQA 3TVTA 5E7QA 1NXXA 4CM5A 4G1EB 4D4HA 1ORIA 1W5FA 1PAUA 1E3WB 4JZKA 4HPXB 3V1UA 3SSMA 1J49A 4Q1FA 3FFAA 3A0UA 4C4OA 1K9SA 1KJIA 1PQPA 1J24A 4PX5A 1Z73A 2P9FA 3FZQA 1RRVA 1S9HA 2OWEA 4BL5A 5C1IA 3U17A 4Z3KA 1ADJA 3T38A 1OI7A 5JZOA 2WWIA 2CLLB 5E6RA 3UC5A 4AJOA 2IVZA 1XO1A 1XRMA 4W9MC 5E6RB 4I46A 3FHCB 4HB0A 5C53B 4Z9XA 1PR1A 1NSFA 1D4ZA 3KDSE 1CR2A 1ZCAA 5F1PA 5FF9A 4QEDA 5ICCA 7AT1A 1PWEA 4EITA 1Y4UA 2A1TS 3AILA 4Z4GA 5MGNA 1JQKA 4LECA 3QKSA 1KJ8A 4OXKA 1KAHA 4OCZA 4TRRA 2HBRA 3T54A 4B3CA 3T3HA 1CG6A 1JEQA 3P9QA 3VTAA 2ZT6A 2OR3A 2WNHA 3BD6A 4EPWA 4MQLA 4X63A 1JSCA 1R16A 3TL2A 1ZGBA 5JXGA 1HI9A 2SECE 1ZZEA 1JIQA 3VU3A 3A6PC 4JYMA 1QJCA 3TLZA 1KYZA 1X1QA 2AHOA 2ZE6A 1BHJA 2O8EA 1E9BA 3I42A 3N8DA 4A0GA 1FFHA 1CUDA 2OQRA 2NYRA 2QP4A 4G5YA 4NG5A 2UYCA 4DV0B 3OX3A 3UBMA 1XDWA 1BDIA 1GQRA 2BFAA 2QQEA 3CEMA 1PV2A 3RSGA 5A4FS 2MTBA 1GYRA 1PR3A 2CK3D 4QIHA 1QQ7A 4QRHA 3I92A 3MINA 2REQB 5EE1A 5HBGA 5JQGB 3JATB 3R1IA 5BRAA 3DTVB 2C99A 5EWJB 2RGYA 3IUJA 5AI8A 4EQ6B 4ARUA 2AOTB 1VKHA 3OSZA 1GA4A 1X1RA 3FPEA 3OD5A 3L06A 4UZSA 2GEUA 3DG9A 4RK5A 5F7ZA 3E4CA 4OJYA 5TNXA 4CW7A 1NZJA 2DPYA 2QUBA 3GFVA 4LKOA 4NZYA 5H68A 1LS1A 4DM3A 3OPYI 4IIJB 4C0JA 1HEYA 1RP1A 4BMDA 1YFJA 2WJ3A 2GBPA 5JTUA 3W1WA 1BD3A 2X8LA 4LZOA 4RZIA 3H1PA 1BHO1 1MPTA 1OWNA 3AR3A 4DLRA 3FFBA 5KYWB 1I13A 4JJ6A 1YQTA 5HUHA 3OIUA 5TLSA 3H17A 2V0GA 1A3CA 3PNPA 5DLDA 5DTQA 2VSOA 5DIFA 3PQCA 1Z62A 3FMOB 3SFTA 4AT1A 4MDFA 4E70A 4TLAA 4EY6A 2LIVA 1QZTA 5TMDA 1EX6A 1FFCA 3BFJA 3DKVA 1HSOA 4M83A 3F5DA 2HU2A 2G7ZA 3QJ5A 3CUYA 2NAFA 1H0KA 2FV8A 2RI6A 2VBCA 3MCWA 4ZT6A 5BSFA 5JZ9A 5BR7A 5LD2B 4A73A 1HE2A 3PEYA 2RJNA 4Y0NA 4FDTA 5DXAA 5EKSA 2CUZA 4PZEA 4E30A 4OX9B 1J23A 4QBFA 2PEYA 3AFNA 4MDEA 1UBSB 2YIJA 4KXWA 1L7PA 4M89A 1F4LA 4G3XA 3THRA 1A5BB 3L7KA 4W1SA 1OGIA 1U9CA 1WAMA 1X1CA 3QHPA 2PU5A 3AHHA 4RS3A 3TDNA 1BJRE 1HLGA 3ICVA 5C4IA 4LHXA 4AP5A 1Z0DA 3UAOA 4XVUA 2FF5A 3IP6A 3NM5A 3R7WA 2VDJA 1DS6A 2P6UA 4J1QA 1LW6E 1ZIPA 2R6JA 2XQJA 3INYA 5TS2A 1ZIDA 3VFDA 4CV1A 1N6LA 2X6RA 2ZXUA 4B2PA 1UXJA 2IYYA 4F1JA 1W85A 1YMQA 3I6ZA 3CVVA 3HKCB 1P0MA 4HZUA 4PLCA 3FCSB 4Q3NA 4AO6A 2XYRA 2XGGA 3KZCA 4NYIQ 2ZIAA 1SWWA 3VVMA 1ZRNA 5ALYA 2O3TA 1NJ6A 3GNSA 3TO5A 1ODTC 4Q82A 4CNQA 1BOOA 2WJHA 3N3BC 2VSXA 1DUIA 3N5KA 4MYCA 1GPBA 1ECFA 4BY9E 4CF5A 4EG3A 5ENZA 4B73A 1GUYA 3LP6A 2VCYA 1C0LA 1NVEA 1UMKA 3E2PA 3RVPA 3DF9A 1PNVA 1QGUA 5A5GA 1OVGA 4P32A 2X5OA 4JT9A 5JPCA 1P1IA 3N39C 2XDQA 3ZX5A 3UJ8A 4DWVA 5BW4A 3LDUA 3GDWA 1N0VC 1NNLA 2NQTA 5IHPA 4RIIA 2Z1MA 4AI6A 3K31A 4MTCA 1JKJA 5HKLA 3RYFA 3G8AA 2CL0X 3BWMA 1EZZA 3RC1A 1XCOA 3IUMA 3PDCA 3A4YA 3R6LA 4BNVA 2E4XA 2XADA 4D0RA 3I4LA 1UFRA 4WQMA 1J0XO 3FZEA 2AFHE 3MTBA 4MVJF 3GWGA 4L27A 3LT2A 4Z6KA 1J8FA 1G20E 2ZXFA 3JWPA 1RC0A 5TXGA 3O47A 1TLTA 3RYIB 2UVPB 5LWQA 3V42A 3DVAB 3ILSA 1M0TA 4CIDA 1NULA 1I2DA 4IUYA 2OM2A 1XALA 2I8CA 4BN0A 4MAFA 3RV3A 1WZIA 2ZRHA 1ZJYA 2IEBA 4NY1A 3RABA 4N5LA 4MLZA 5AVVA 5DHUA 2O1WA 3HXTA 4FZVA 3WL8A 2FZGA 3O73A 4ZU1X 1WBJB 3T7AA 5E9AA 2I2AA 4CODB 4FP9A 2OAP1 4U63A 1NONA 1Y1PA 4FW9A 4KFTA 2VI5A 4TZKA 3S2SA 5D3MB 1BXRB 2IHNA 3KPJA 4BPRA 3M5CA 2Q4BA 2RI1A 3OUUA 3ME5A 4WXMA 3OTOB 1IBRA 1AS0A 1GNPA 2R47A 4JELA 2AXNA 3GI1A 2Z3VA 1PQUA 3HPRA 1WOYA 1TA9A 4D42A 2BUAA 2QNIA 1NQTA 1PJCA 4LY9A 1W87A 2R44A 4PPQA 2YNMD 2VJMB 2CKDA 3DKIA 4QPCA 4DVJA 1ZK0A 4CF3A 2QTTA 3EVGA 1Y1RA 5ELLA 3ZYCA 1LLUA 1PNRA 4OBXA 4NU8X 2YWXA 3PNVA 2V5UA 1GZUA 2DC1A 4PHCA 4BB0A 5A5EA 4BZZA 4NCJA 3CUEF 2F1OA 4LVUA 4NNJA 3WBKA 4RTRA 3PJFA 1T0HB 4Z4HA 1P44A 2CNLA 2P6OA 5B57C 5BOSB 3FDZA 3NW9A 3T1YB 3FA2A 2H52A 2Q3EA 3FUWA 4M0UA 1HQDA 1AO0A 4ESVA 2O07A 5IBQA 1V1MA 2NXNA 3IJ5A 4M53A 1MBZA 4H7JA 2Q7DA 5JLAA 2XVZA 2AZTA 2VJDA 3B52X 3F6BX 4ZMSA 2GEKA 3EN0A 1HE4A 1JEJA 4ER6A 4HH3C 1R5OA 3G9XA 3HQ4O 1JB1A 2QNBA 4QGBA 4ACBA 2FW1A 2YMPA 3DE3X 4HZUB 4UBJA 3ZZ0A 1YMVA 5EZQA 4EUKA 2QDXA 1DELA 2EARA 1B1CA 1L7RA 1SIOA 2YMLA 4XJXA 2O2JA 1TU4A 2UXDB 1PGJA 2AXQA 4GPTA 3SR3A 5BXQC 4GP9A 1FP4B 2RC6A 3HJTA 3LLUA 4GYKA 4N0EA 1J90A 1FMLA 1MABA 2XNKA 1OUMA 3H4VA 4QJ5A 3WIEA 3ZWCA 2J9RA 3AL0C 1GD1O 4GKJB 5D87A 1GLGA 4N6OA 4V0MA 2PQ6A 4CN8A 1K75A 3VVCA 3IDZA 5BQOA 4PYMA 1UOEA 4L3WA 1ZLXA 4X6UA 5DYGA 3K20A 2HIMA 1KY3A 4REQB 3ZXXA 3VNAA 2XCSB 1Z63A 2JW5A 2JHGA 5YASA 3EMKA 1V8ZA 2C98A 2ZI4A 3MQFA 1ZD4A 4KTVE 4UQPA 3U4MA 3V8EA 4YDSA 4MGZR 4UHKA 2IH5A 1YKSA 3MHPA 4YALA 5EJIA 1D09A 3ZTWA 5IT9A 4TKUB 5CH8A 4JI5B 2OXEA 5B1YA 1Z4NA 3MN1A 2NXJA 5M34A 3GAZA 1MEJA 1OAOA 1RCUA 2DY0A 2FZKA 4ALIA 5IVPA 4GEKA 4K0KB 1ZXLA 3L9XA 2CV1A 1KEWA 3LBAA 3BD8A 4UXJA 2QW8A 3SKXA 1TM5E 1YD7A 3QU7A 5J2UB 1TJ4A 1VRWA 1XNJA 4BVBA 1JIVA 1P8JA 3PUYA 3TLXA 1X9IA 3FI0A 4NH0A 4C21A 4DB4A 3EVCA 2O7VA 2RI0A 4AO7A 4C03A 5I6DA 4IEIA 4O1IA 1P9NA 4V0RA 4DGSA 5ES4B 3L4BA 1JJ7A 3DO5A 1E3WA 2QPAA 4CM3A 2GJ9A 2JH9A 4FT2A 5F7JA 4AS1A 3PLRA 4RAOA 3VQTA 1TXGA 4O2BB 5HCUA 4A0FA 5C80A 5FYQA 4JOCA 4UEJA 4I1YA 3QF7A 5ER6A 1LVGA 4M87A 2FJPA 4M1OA 4H3VA 2VDNB 3U3ZA 3QPUA 2TMYA 4WJLA 5LL6P 1GPDG 2B82A 3DF7A 5AUQA 5A06A 4QU5A 3B3GA 1X7ZB 3BXGA 3BXEA 1FQKA 1OAKA 4NE7A 4R7ZA 3L9WA 3N7UA 1E2FA 3P9NA 4PYIA 3NTUA 2WSBA 4MWCA 1B8VA 2HDWA 3S55A 1PNQA 4O0LA 1GN9A 3QZUA 2OM6A 3K0KA 4WKBA 1I14A 4F93B 1K92A 5DNCA 1MRSA 3MELA 1CY6A 4MCIA 4P81A 3AZQA 2QL9A 5CFNA 3K0AB 3LZCA 4UEOA 5KVVA 4J2TA 1JR3D 4MMYB 1NLYA 1QGOA 4WLOA 4XUCA 3WAKA 3U7FB 5EY5B 5E3HA 1BN6A 1N36B 2R3SA 1DJPA 4D6PA 5CU7A 1W36D 2OFWA 3GMDA 4LYEA 1QHIA 1F2VA 4W63A 1OR8A 3CX8A 3KHUA 5AUPB 5U9CA 3V00A 1M2EA 5G41A 1AKRA 2LKDA 3QWHA 1ISSA 2F2TA 4MUXA 3HMKA 4QDUA 5F3DA 1O97C 1E1YA 1JTFA 1IDN1 2P11A 4TRNA 1T0JB 3KOUA 3T9AA 1TRHA 1IRXA 3U3OA 5JARA 4FEEA 1Q7EA 2ZQYA 3IESA 1ST2A 1V1MB 4X3OA 1T9HA 1VB5A 4U0JA 4HGRA 5F2NA 4OIFA 1R0CA 3STVA 1XT6A 1UKZA 3EVAA 2EJCA 1KDTA 2C5HA 2ZRDA 2DKFA 2QXYA 4YYEA 5C1OA 2ZYHA 1CRWG 4LNHA 4AUKA 1RZVA 2G72A 1O9GA 1E8DA 2I65A 2E4VA 2XUAA 2Q0XA 3RR2A 4XQGA 4G0ZA 3LF1A 1NE7A 4FNAA 4HEQA 1XF9A 4ZOLF 1VLHA 2CMKA 1OBHA 4KX5A 1FXWF 5FOXA 2E4WA 3IA2A 3RIXA 3BFXA 5I4BA 2CT8A 4IJWA 4CR8A 1HKUA 2HREA 1Q3HA 3G0BA 1GZ3A 4QYWA 4IR7A 2C0PA 2RK3A 3AINA 1N3LA 2ONYA 4L3OA 4QFDA 4XD2A 3L6EA 3QBDA 4ZO4A 2YV4A 1F0NA 2H6EA 4FTWA 4YAEA 1KDZA 3V80A 4XPIB 4R1MA 3I2GA 4DDUA 2I1WA 3BQ9A 4DLKA 3PU6A 5D5HA 4NYJR 2I87A 3SLRA 1NBOA 2VJAA 3HJGA 1SC1A 2P75A 3DSRA 3P9CA 4LY6A 4CTKA 5A5VA 2GD0A 1N2SA 2GK6A 3EEFA 2ZT8A 3PQDA 1KVRA 2PWYA 3AJDA 3B2EA 1TUEA 1Y9ZA 2ANCA 2EZUA 2HFKA 3KL4A 1LDEA 4HUQB 4LXHA 5J40A 3V1MA 4CFYA 4AJHA 5L9AA 3R9IA 1L8AA 3DEIA 3I2IA 1TQDA 3SWWA 1LTKA 1PDWA 1SUBA 4R6XA 1NQXA 3H2SA 2NOAA 5AP9A 3WSWA 1AA6A 2VR1A 5ALOA 1V48A 1NC3A 2WF6A 3G2IA 1YZYA 3JALA 3O94A 2X19A 2XAAA 2YWCA 3HH8A 4JSRA 3VUFA 1NBMA 3HG7A 4I08A 2RDMA 4Q6WA 4X84A 2WHYA 4DQVA 1QXSA 4EOGA 2XT6A 2PIDA 1QRRA 3KSRA 4NP6A 4PN7A 1NR1A 3BHIA 1UM8A 4EG1A 3UMRA 1OT5A 3JAKB 3AIMA 4RKEA 3UWMA 4F2WA 4BFTA 1QVRA 3VGJA 3I1JA 2O8BA 4JUIA 2E21A 5A1TA 2WUDA 4MGYR 3VU1A 1IEQA 1UJ6A 3E84A 1G6Q1 2HTFA 4OL9A 2ZRGA 3RRJA 3MCTA 5B58T 3ZGXA 1OLXA 1LLFA 4ZYXA 4I4TF 3BIXA 3VH4A 1TVMA 1SKUA 2D13A 2DUJA 4B7ZA 1R0KA 3M0EA 4IFIA 1H2YA 4G1VA 3ZH2A 1JB9A 4S1TA 5H7XA 3R3ZA 3ZWWA 3GN1A 1E7RA 4YT5A 1FPQA 1PLKA 4R2WA 4GNRA 1FRVA 5HE9A 4LUCA 4YWJA 3FBTA 5KDLA 3SLGA 4YMLA 1Q1NA 1TKRA 2R9VA 3OP1A 4DBVO 4PRLA 4DMMA 2QGFA 2W4QA 1UPTA 3KG2A 4O0MA 1DBPA 2AYXA 1Y8CA 4E33A 1R9GA 1PU2A 3QE0A 5JSYA 2GN9A 3EIFA 1QTRA 5CGQB 2FR0A 3BWDD 3PIIA 4RGBA 3TQIA 2XHZA 3LT5A 1DAGA 4A16A 1WDLA 4MQFB 4NAUA 5HS6A 4J9VA 4IY1A 4XYEA 2C97A 5IZCA 4ZVPA 2NO5A 2FDXA 4G0WA 2R87A 5IWAB 3A31A 3OPXA 2I6FA 2C5BA 2QQ0A 3R8FA 3B60A 3HTXA 1BEUB 5LUBA 3UC9A 4E4RA 1OI2A 1EWKA 2NO4A 1S89A 2QRVB 2QV0A 1A9QA 1PQ4A 1R9JA 2WK1A 1J8QA 4XYLA 5I4KA 5IJ9A 1NXTA 2AOVA 3SBDA 3U4GA 1WU7A 3ZN2A 2YV5A 1M1YE 1VE1A 1PT9A 2P4HX 2YH2A 3JRNA 3ZDQA 4P4SA 1K5HA 5IAGA 3RYIA 2RH5A 4D0GA 1ZITA 3I9LA 3GA5A 3L3BA 2QT9A 3QVGB 4QUGA 4TMTA 4UAGA 1WZEA 5EP4A 5BO5A 2AXPA 3C24A 4HWPA 4HBGA 3HCBA 1FSGA 4XR4A 1RWNA 3H1TA 3KQQA 4GQIA 3GP8A 3QTBA 2B1IA 1E1RA 3DDNA 4GOND 1P1RA 4JQOA 5MFZA 3C15C 3ZE0B 2R1UA 5LQUA 4I6JA 2OBLA 1WXGA 3TRFA 5AI4A 4U4AA 1T3GA 5J3JA 2FP3A 2GXUA 2V59A 5DTJA 1G63A 1NMEA 5I7RA 2AC4A 3L1KA 2YZMA 2R84A 1K7FB 1BG6A 4D8UA 1EAYA 1K3UB 5KCZA 3HXOA 3OFVA 1NRXA 5L6MB 2I3ZA 4IXMA 2I6GA 2OOSA 2XEXA 3WZMA 5AK6A 4TKMA 3CH5A 1AX9A 5TEVA 1DQRA 1TVKB 2KQUA 2LWIA 2P9CA 2GCGA 4OK3A 4PFQA 2BTOA 3DMYA 3TOVA 2J5KA 4UM9D 4MUAA 5GPBA 3G59A 2KHZA 3NIGB 2CFTA 3Q8WA 1TM1E 2JFQA 2HDNB 3NFYA 4J6FA 4UXIA 4XQCA 4CE6A 3GMSA 3FTCA 5F23A 4B6JA 4QSMA 4P4UA 3K8QA 1RW4A 1D9ZA 5L8VA 4QLOA 1U7WA 2OESA 4PQFA 4UVGA 1FRNA 4UZFA 3V9PA 4C2AA 7GPBA 1XMIA 3F96A 4H0CA 5ALTA 1SCQA 3AVOA 3GLUA 1UOPA 2JANA 3HDYA 5T7BA 1YASA 1P0CA 1NX9A 1X7WB 2J1LA 1VIAA 4MWZA 4QX6A 5A3JA 2H17A 4LJ7A 3DEKA 2IYXA 1FYDA 3PUHA 2XWSA 4JJ8A 3Q8KA 4PX9A 4Q4HB 4WA8A 5IAOA 3OJCA 1FDUA 1L8OA 1RZ3A 3AK4A 3OSUA 3ZJYA 3FCCA 4BRWA 2HK7A 2VT3A 3BFVA 3X2EA 4DMUB 4ZTZB 2PMDA 1E9RA 4QJ4A 3RRXA 4ZI3A 2XKKA 1JAXA 4CMHA 5FD8A 2DBZA 2AJ8A 5JWOA 2JK0A 1D6JA 2Z1NA 1EK5A 3LE8A 1LNZA 1ECLA 4W5WA 4F5EA 3AVQA 1YTUA 4H1HA 1SA0A 2HMVA 1HDZA 3CRZA 2QSYA 3RWOA 5CFZA 1BTOA 2PVSA 2CLMB 4C3UA 3F1LA 1GEGA 2VKQA 2WAOA 3D3NA 3OIDA 4NI5A 5JLJA 4RKFA 2CDCA 5IEJA 2H3HA 4JEHA 1CY1A 5AR1A 4C7OB 4LNUA 4MWTA 1WUIS 3MVEA 3UMMA 2RIRA 1MG5A 1A7AA 2QZ9A 2VDLB 2EDAA 4GXQA 4OGFA 3OZVA 3G8DA 1P7WA 2PKXA 5JDCC 1L4MA 3AF5A 1TEVA 2BTQB 2UZ1B 4YUXA 4PHGA 5FV7A 1LBTA 1JHAA 4JLKA 3GR6A 3JTMA 1VIYA 3A25A 1V4BA 3IKTA 2F9FA 1A71A 3R75A 4KBYA 1M33A 1OFVA 4H0NA 1KK3A 3QWAA 1N3IA 1CDDA 2C8KA 4FONA 3TW8B 1U9ZA 3QKRA 1KJJA 2X1LA 5HRUA 3B20A 1KC1A 3QKRB 1D1TA 1JJAA 1R6XA 3ITDA 3K1AA 3ROFA 1M1ZA 1SVSA 1CDEA 1U8FO 3W5HA 1XYGA 4JLDA 5LWHA 2HJSA 3FMPB 4S2UA 4JX8A 5G0SA 1AQIA 5A4AA 2YY7A 4XSHA 1Q95A 4R54A 2XMZA 5BR8B 2GCNA 1ARZA 2BFFB 2O6LA 3KR9A 3HCCA 4YMTA 3MBOA 4UTNA 4JIGA 1D6NA 1Z4LA 2OORA 3OIWA 2FB9A 4FR0A 1AB5A 5AXBA 4UJ5A 2E82A 2WE7A 1ONBA 3MYYA 4KIGA 1Z7WA 1TOAA 4BGIA 5C8YA 4DIEA 5JADA 3VNUA 2OXFA 3E8MA 4ZC1A 3GUCA 3DFMA 2C7VA 3GEBA 4H1TA 3G5AA 3URMA 4B74A 3MBKA 3NWEA 3AM1A 2I62A 2KS6A 1G8YA 1DBRA 3D5QA 3JQGB 2D6FA 2V7QD 4OQXA 3R5KA 4DJFC 3THYA 4EKGA 4GBED 4NMHA 4DLVA 1VJ5A 2XA1A 3KAPA 3UCEA 5JXIA 4OF4A 1EK6A 1G7CA 1UMDB 4TSFA 4KXUA 4H6PA 4ACAA 5CM9C 4KPUB 1VKZA 1XN1A 5KC8A 4KV7A 3D6NB 3DOUA 5DN9A 4EBFA 4RTSA 4RZHA 1MO6A 2C94A 3FPAA 1RHRA 3HJCA 5JECA 2W58A 3RODA 3JZAA 1DG1G 1DQNA 1J8YF 4UTXA 5DNWA 4AN4A 2XVXA 1A8UA 2XF2A 4YV1A 4KP7A 1JQBA 1CFJA 2XE6A 1OBFO 1U7ZA 3L8GA 3GLSA 4NBUA 4C3VA 1IHYA 3GMIA 1Y8QA 4D4GA 1K0FA 1I7NA 3B5EA 1U0GA 3ETEA 4M1ZA 4XYMA 5EKTA 2AFRA 4CFZA 5HZHA 4KR6A 1T3ZA 4YAGA 4YNBA 4W8HA 3ZLJA 1RZUA 2IEAA 3R9KA 2P9GA 1QH8A 1MFPA 5JJKA 2JARA 3ND8A 2VSFA 3WZLA 1MOSA 1YAJA 1SG0A 4LJLA 2Q07A 4Y2GA 3NHSA 1E3DA 1D0IA 2JIOA 5L3QA 1QM5A 4HNRA 5JTTA 4XRGA 1XZKA 1XTQA 4PU0A 4Y2XA 3OUZA 4DR2B 2JFNA 3PFNA 4UHJA 1PR4A 1WLYA 2XEDA 3F67A 2FMHA 2P5UA 2WJYA 4UTOA 1HH4A 3VU8A 1PFQA 1UDAA 2G1JA 1ZUNB 2BM8A 2VK2A 4YCLA 1TQHA 3PDIB 4FHZA 2PYZA 4J0QA 3PV0A 2GM5A 2HGZA 1RWQA 5I7VA 1GNVA 2AA3A 3QKIA 4WOJA 3WJ1A 4AJJA 3ZK7A 2DTDA 5I9TA 2AIRA 1M0WA 1TK3A 4PO3X 4GOMD 4BJ3A 4L0DA 5E9WA 2RAPA 4HK4A 1B6SA 2RGGA 2I7TA 2BLLA 3DMNA 1E6KA 2UZ1A 4R81A 3JQPA 4CQJA 1IWBB 3MIZA 4R69A 1YVRA 2C3PA 2J07A 1XZMA 3OLVA 1XUOA 1P2DA 3QY9A 1MJFA 5JCOA 4FFLA 3D5EA 2ARKA 2E4ZA 4RX1A 2DWCA 1X0VA 1YZNA 4L4RA 2DFVA 2R11A 3BQMB 4R3WA 2P2LA 4WFKA 4MIEA 3I30X 4JJKA 3GGDA 1XDSA 3WAGA 4EY3A 4I1UA 4L9SA 3R5HA 1RIIA 2CXXA 3KTFA 4MRSA 2PZMA 5B1HA 5SICE 4QDOA 2AB0A 3G7SA 4X7PA 1IUOA 4ZT4A 3W1EA 1QS0B 3ZHTA 1AUOA 4LDPA 5LZ2A 3RFVA 4M38A 1O96A 1GCUA 3BMQA 1J25A 5ADVA 1A1VA 3AVYA 2X5NA 3VMMA 4LCBA 3T4EA 4W4TA 3AL2A 2I2WA 1JPUA 4MQ6A 3PLAE 1DXOA 1IMOA 4OQPA 5LLDA 4Z51A 1R6VA 4R8MA 1UFQA 2O8DB 2ADOA 1GAWA 1NHWA 3E5MA 2HYIC 3GT0A 1ZESA 5IKMA 1QIFA 3TX6A 4LTDA 4NV0A 5G40A 1XHFA 1PJLA 2FMFA 4NHEA 3H8SA 3IS3A 1Z12A 2JFWA 4N5NA 4UDOA 5K01A 3KXDA 5I7UA 4J91A 3TNFA 4JI4B 1VG0B 4JDUA 4CMKA 1Z5OA 5TF4A 2QN3A 4GIBA 2YHAA 1P4HA 3SFZA 3ZCXA 1LPOA 1W96A 1YCDA 2E3JA 2NU8B 1P9WA 3GFOA 4ZVSA 3QMWA 3R3WA 2Y4OA 1XA0A 1Y7LA 2BONA 1G1AA 4TTVA 3P9KA 5FUWA 1LBIA 2HF2A 5JC8A 2RFLA 3EQ6A 1JG2A 3ZWVA 5TJ9A 3ESQA 4P2BA 1AN0A 1U28A 4C0SA 2V9CA 3SCZA 3ZVKA 4WLEA 4NX2A 2PX4A 4UTRA 3TDMA 4Y7DA 1IIRA 3AY6A 5J47A 2OB1A 1U7PA 4X94A 4CYMA 5KQLA 1ZI9A 2OKGA 4YJ2B 5CMLA 3TLGB 3GVPA 4N9QA 2O0MA 1M5UA 4AWXA 4UCQA 5DX8A 2R65A 2DWPA 5C51B 1LSJA 1Z28A 1YSCA 4B7UA 2WFZA 2D54A 2PV0A 4MRAA 3PL5A 4V02A 2Q8NA 4DCVA 3O4IA 4RH3A 4CF7A 2R00C 5L3QB 1NNEA 3I0MA 3ED5A 2JIZA 3KQYA 4KW7A 1KEEB 3K71B 4IDFA 4JKOA 1YCFA 1R64A 1RAFA 4DDHA 1I01A 2RHOA 4WKGA 3QU2A 2WG0A 1GQSA 2P9QA 5A62A 1XRNA 3L0YA 4Y1RA 1WB4A 4FWTA 1SUWA 4K6KA 1F7UA 3T9DA 4WFIA 1SHTX 5GJCA 5TV2A 3AETB 1KO4A 2PQ0A 4ZAFA 5E4YA 2HSGA 2VQEB 1PEYA 2YWRA 1V8OA 4HWOA 1NOKA 2G1UA 3KYCB 3NVKI 4OB8A 1Y9EA 2X9VA 1CVLA 4NJOA 2ISSD 1T4BA 1OZ0A 2PLWA 3VR6H 5JI2E 4JLOA 1JH9A 4MCAA 1LQTA 1X1DA 2O0JA 4U02A 3OZSA 3RSCA 2II6A 1LSSA 3QVOA 2CHUA 2OBXA 2VP5A 1I32A 2ZBEA 3F0TA 4O4HB 4WBXC 3DUWA 2DPMA 4FKMA 4WLUA 2CJWA 3HA2A 4LRSB 4E15A 5C46F 4OHXA 4X45A 2DKOA 1A82A 1T4DA 2QT0A 4IDAA 5HX7A 1ZZGA 2FHSA 1LVUA 1RBYA 3A1VA 1PT6A 1ID1A 5HK8A 5U4XA 5EL0A 1I7LA 3RS5A 1AGRA 3FMIA 2ZK7A 4AZWA 1W9MA 4DMLA 1E4OA 2B36A 5JSHA 1T2EA 3HDJA 1MH1A 4R1LA 2EG5A 2G6TA 3G3EA 3HU3A 4OHWA 2Q5EA 4OHFA 1BRTA 1RYDA 2QUZA 1N7IA 3ELDA 4KDEA 3K70C 2W8ZA 3RDPA 1UBKS 2YWBA 2ODAA 4N40A 3UFXB 1VI2A 3NTLA 4Q4DA 2B8JA 3Q12A 4H3HB 4MVJH 4MHSA 4UFOA 3EFOA 1WOMA 2WKSA 5FBRB 4BE9A 4PGMA 1UK6A 4R3NA 1VMEA 1XN4A 3LPLA 4WLVA 4W1PA 1NF8A 4L0MA 4KSBA 1BXGA 4N5DA 1OCEA 3WGTA 2P0EA 2ZYGA 3FSGA 3PHIA 4E1AA 1BMFA 1T4MA 2E9SA 1Z13A 4BQNA 4XCVA 4ND7A 5THQA 5CA0B 3EWSA 2E85A 4IVRA 3FDIA 4QJ3A 4K5QA 1BGWA 4WERA 2C54A 1NR7A 2NM0A 4IIXA 4LHZA 3RG8A 4DR6B 3NYIA 3LHKA 4BASA 4ZO9A 1P9LA 2QVYX 3F6CA 1EE1A 2GASA 3OOSA 1RYYA 4V0LA 4F92B 1YFLA 2Z04A 4ETMA 2UUAB 3RO7A 1GNSA 4EUNA 1T6XA 3U5ZB 1UPCA 1K8RA 3NFRA 6YASA 3AEXA 3M6VA 2NU9B 2YRFA 1S8OA 4OSEA 4KRXA 4YT2A 4WNAB 4MV7A 1BCSA 3AR2A 1ITZA 1PFUA 1J56A 3FVTA 4X8LA 4PWZA 2FZCA 4ZV9A 2XD4A 5ALHA 5HM6A 3H83A 4KNYA 4YP6A 5KOYA 1MC4A 1Z0SA 2YIVX 3KOZA 3EXIB 4HAIA 4O59O 3ZHZA 5D7BA 2R00A 3VKHA 2H11A 1E63A 1WSAA 3GROA 3FWHA 1E62A 2QSJA 3MWFA 1ZVQA 3T5CA 1Q44A 1SUDA 1GUFA 1RYEA 1UWVA 4O6VA 3UT5A 4QDKA 4A5OA 1B0AA 4BYGA 1N2ZA 4FQ5A 2VHXA 1NYQA 3NHPA 3NCTA 1D2NA 5ETJA 521PA 2RHDA 5AJYA 1QGED 2V4UA 3RTAA 2O59A 3S8YA 3UW1A 4OI2A 5EP2A 4EG6A 5TPZA 1W5AA 1SQ6A 3NB0A 4YROA 1OIVA 4NKRA 1XBTA 3L1VA 1HTTA 3Q9LA 4KQGA 3EVZA 2VT2A 3SC2B 5J4YA 1YRLA 5K2MA 2A84A 1OX5A 4QUJA 3T95A 3NDJA 1Z45A 3WHKA 1ZM3A 3PWSA 2HDHA 4PNEA 1IMJA 1J39A 2RB4A 2RAVA 2VDMB 4BNDB 1XTVA 2PZJA 4N6NA 3E22B 3OBIA 4Q4JB 4ZKEA 2XX3A 4D4KA 4EATA 1N0IA 1XD8A 2A94A 4FSHA 3JQGA 5EGNA 5LZ5A 4MKFA 1OFUA 1V3VA 2JPDA 1SHJA 1UPUA 1W5TA 2ZBVA 1H69A 1POWA 2WY2D 3NVDA 4M1WA 5AM1A 1YO6A 4B4DA 4KBFA 4PCAA 4WMLA 3LBNA 5AIBA 5DGHA 1KHHA 1XOIA 4DC1A 4G84A 4PV7A 2HRBA 3OG9A 1NLMA 2FW6A 1N4DA 3EXFA 3QP9A 4BKRA 4J1TC 4YACA 4EW1A 2Y2VA 2HQBA 1FXSA 4BX2A 5KHLB 5LA6B 1NKTA 4LCEA 1GGJA 3DWIA 2QYOA 3DULA 4RTJA 4YY3B 1Q0SA 5E1DA 4AF8A 3ZWKA 1R6TA 5E1BA 2O20A 4MJXA 5C3MA 3AEKB 3V7FA 2BEJA 1DAKA 5KYXB 1O95D 1UT6A 4LC1A 3INRA 1NOIA 5FP0A 2VJYA 1CBUA 3TE7A 1K9VF 1D4OA 4HQ6A 5EPUA 2H8KA 4I55F 3DLHA 3I45A 5EXXA 1OJLA 3BXFA 4XEHA 4B3BA 3VH1A 5C2JB 4HFJA 4CIYA 3IUNA 3ZE1B 3KAJA