4DJZB

Catalytic fragment of masp-1 in complex with its specific inhibitor developed by directed evolution on sgci scaffold
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
251
structure length
251
Chain Sequence
IFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLLGSSWIVTAAHCLHQSLDPKDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTLHPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPETLMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQWYLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Monospecific Inhibitors Show That Both Mannan-binding Lectin-associated Serine Protease-1 (MASP-1) and -2 Are Essential for Lectin Pathway Activation and Reveal Structural Plasticity of MASP-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mannan-binding lectin serine protease 1 heavy chain
total genus 44
structure length 251
sequence length 251
chains with identical sequence D
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4djzB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4djzB01
1W10U 1CBWB 5AHGH 1DWDH 2FEQH 1BBRK 1CVWH 2QGRA 1NPMA 1BB0B 2FP7B 1RTLA 3L6PA 4OS6A 1GI4A 2ODYB 1WQVH 2J92A 1XUGA 1NFUA 2PHBA 5L6NH 4GSOA 8KME2 4WMDA 4FUFA 4Q2KA 1AKSB 3VXFH 4ISLA 4IMQA 2XWBI 2G55A 3GYLB 3P6ZB 1BMAA 2HNTF 1AIXH 2FX4A 1O0DH 1K1NA 5E2PA 1HIAB 4MNWA 5FHTA 1OYTH 4ZROA 4ISOA 1ARCA 1QY6A 2P3FH 1GJ5H 4FUJA 3FAOA 4J2YB 2GV6A 1C2JA 3SUDA 4Y79A 1E0FD 3PLKA 4CR5A 1UK2A 3SU5A 1HYLA 1O3IA 5GWZA 6LPRA 1O31A 1N1LA 1O2MA 3UIRA 4IGDA 3EE0B 4O03A 1O33A 1YPGH 1LVOA 2ZTZA 1B5GH 2D26C 1P04A 3GY5A 5DP9A 5DKMA 2WUBA 2BDAA 1P06A 2VWNA 1TBRH 3KCGH 1DE7H 1TFXA 1GMCG 1VGCC 1UTLM 3BTGE 1OX1A 3TH2H 3SNEA 1C2MA 5L2YH 3F6UH 4Y8YA 2A5AA 1O5BB 5AFYH 1YLDA 3TGJE 4BAOB 2FO9A 5LH8A 3AAUA 2BZAA 1EPTA 1PFXC 2FOHA 4JMYA 1O36A 3T5FH 4B2BA 3EYDA 4MPWA 1G3CA 2D2DA 2JKHA 1NN6A 9ESTA 3BIUH 4ZXXH 2BQ7B 4MNXA 3PLPA 2BDGA 5FPTA 3M35A 4I8HA 5J4SA 3H7TA 1AUTC 5GXPA 1O3KA 5DGJA 1C5LH 1EJMA 1YP9A 4JZFH 5DP3A 1C5YB 4I32A 2TRMA 1XUIA 1MQ6A 3KIDU 1BRCE 4R0IA 2GD4B 3BG4B 2FLBH 1LQDB 1TWXB 3O8CA 1UK4A 2BTCE 4CRGA 1GJ7B 1TQ0B 2A7HA 5FCRA 2BLQA 4CHAC 2Q1JA 2BX4A 2Y81A 3I78A 1FIWA 2P3UB 3FP6E 1O2HA 4I33A 1GBDA 1BRAA 3GISB 1HDTH 4CRCA 5A0BA 1V3XA 3SN8A 1CQQA 1C5VA 1GJDB 2Q6DA 1UVSH 1V2NT 1SBWA 4K1EA 1ZTKA 2B0FA 4JZEH 3ZYEA 4I8KA 1N6XA 4WMFA 2A1DB 1A0LA 1BA8B 3PWCA 3LC3A 3C1KA 1H9LB 2ESTE 3UY9A 2GZ8A 5C1XA 1GVKB 1UVPA 5E2OA 2V6NA 2GCTC 3BTME 5EU8A 4JZIA 1O3NA 1P09A 3UUZA 1DT2A 1O5CB 2HLCA 2FESH 1GG6B 2VB0A 1EKBB 3GCTG 2CN0H 3ZZAA 1DLEA 3A7ZA 2ZNKH 4X8VH 2V35A 3D23A 1K1MA 1Y8TA 1DWBH 2K1QA 3PMBB 5ABWA 3KGPA 1A5GH 4Y71A 3E16B 3AASA 5A8YA 5C5NA 4CBNA 1S82A 2SGFE 3RC4A 6GCHF 1SI5H 3SQHE 5I46H 3QTOH 1O3DA 1GCDA 4TYDA 4BAHB 3OSYA 4YOIA 3RXGA 4D76A 1C2DA 1P9SA 1T4VH 1YCPK 3Q00A 1Z8JB 2NU1E 2C8ZB 4X1PU 3E91A 1WTHD 2O9QA 1W3CA 1F92A 1WCZA 3A88A 3PB1E 2CHAB 3MH6A 2RA0A 1K1JA 3M61U 3TITA 4Y10E 1DITH 4DW2U 1P05A 3VB4A 3VGCC 2VIDA 5SGAE 1C2LA 4XBBA 4FVDA 3M7TA 3ITIA 3SUEA 1MD8A 1ZJDA 2BLVA 1HJ8A 1FIZA 1PYTC 2FX6A 3OU0A 4AFQA 2XCNA 3OY5U 1KLIH 1MKXK 1GJCB 3OTJE 4NIXA 5ESBA 1DFPA 4I8LA 2BHGA 4KTCA 3UPEA 1TNIA 4ZKOU 2A4GA 3UWIA 9LPRA 4VGCC 1V2RT 2YNAA 2G81E 1OWKA 1OS8A 2QIQA 2H5DA 4KTSA 3RU4D 2BDHA 2GCHG 1RRKA 1O5EH 2CF8H 2OUAA 1NESE 1MMJN 1P0SH 1QL8A 2WPHS 1BJUA 2XBYA 5JYIA 1O3CA 2FXRA 2PLXA 3L3TA 3Q76A 2A32A 1O2KA 1HXFH 4GLYA 1D4PB 3A89A 1CO7E 2ANWA 2XBWA 3SHAH 1CGIE 1A3BH 2BY9X 4ZHMU 2Y6TA 4BAQB 1QHRB 4Y7AA 3SV6A 4UFEH 1LVBA 1BT7A 4LZ1H 1UVUH 4O9VA 3ATIA 3UOPA 3GY8A 3SU2A 4JYUH 1VITH 1EZQA 5C1YA 1J14A 2QYIA 1AZ8A 1EB1H 3QGJA 1BMLA 1T4UH 2ZU4A 1C4U2 1G3DA 4A1VA 1Z1JA 1HAVB 2BVRH 2RG3A 1GGDB 1HAIH 1GHBG 1RS0A 1YCPM 1DDJA 5C20A 1QQUA 1MZAA 4RSPA 4AFUA 2PUQH 1F7ZA 2OD3B 3LONA 3SJKA 1MBQA 2FZZA 1T31A 5GDSH 2C8XB 1G32B 1GBKA 4NIVA 5LGOA 3ODDA 2ASUB 2Z6BD 2AIQA 1QB9A 5GCHG 2Z3EA 1SGFA 2FOMB 3TLOA 2ANYA 1ZRKA 1D6WA 4FUCA 2HOBA 1K1OA 1FZZA 1P10A 2LPRA 2ZDNA 3SORA 1MKWK 1UTNA 2BVXH 4UFFH 1MH0A 2WPIS 1H8IH 1SGNE 3RXLA 3R0FA 4AFSA 3QGNB 1ZMLA 1U6QA 1HV7A 1KDQA 4ABFA 3E8LA 2BDCA 2F3CE 1WBGB 4BAMB 1THRH 4JYVH 4ZMAH 1W7XH 1BBRE 2LNCA 2OTVA 2P93A 1ELEE 5K0HA 2AERH 4ABAA 4Q7XA 2TIOA 2OC1A 2VWOA 2STAE 1CHOG 2EI6A 3MFJA 5T6DA 4UFGH 1MQ5A 1ORFA 1O3AA 1C1UH 1TOCB 2OQUA 1YPLH 2ILNA 3KQBA 1GBBA 3UTUH 4A5TS 2Z9KA 1C5NH 1Z8IB 1SPJA 2AEIH 1HXEH 2IJOB 2ZIQH 1WOFA 2NU2E 1LVYA 1YKTA 4GVUA 1QFKH 4AB8A 1AHTH 4PROA 1BDAA 1DS2E 1Y5BT 1Z71A 1HLTH 4XE4A 3V7TA 2QAAA 4GCHG 3BSQA 2C8WB 1BQYA 1UO6A 3MU0A 3GDVA 1VCPA 3A7WA 3RDZA 1UTKA 2ANMH 1TRMA 1LPGB 1CGHA 3HKIB 4K5ZA 1L2EA 3LGYA 5FPSA 2PWXA 1T8LA 1BBRH 3TNSA 5GJ4B 5FBIA 2R2MB 4Y7BA 3A83A 2ZWLH 2ZGXH 4H42U 1G36A 1K22H 1A0HB 1NRNH 3LH1A 3PMAB 4WY3A 1A61H 3FZZA 3W94A 1O34A 5K7RA 5A0AE 1FAKH 1UTJA 1RTKA 1TONA 4GAWA 1PPZA 1CT0E 1Y5AT 1MZDA 1TOMH 1SHHB 3RXVA 2PSYA 3U98H 2A4QA 2GV7A 3BTWE 4KP0A 2C93B 2PGQB 1SQOA 3UR6A 1FN6A 1H4WA 1FPHH 1K2I1 2ZFRH 1KXCA 1C1WH 4YO9A 3O8BA 5JBBS 2XWAA 2ZPSA 3BEIB 3MHWU 2FODA 2A2XH 3M7QA 3VGCB 1GHVH 3CP7A 1CT2E 3QWCH 4NIWA 2FOEA 2AMPA 1PYTD 1EZXC 2ZKSA 2H9TH 5T6FA 2BY5X 3SV9A 1F2SE 1O38A 5EGMA 2C3SA 2QF3A 2GKVE 3NUMA 3LJJA 1TGCA 2QV1A 1L1NA 3BEUA 2XYAA 1MTVA 1RTFB 5C2ZA 4TWWA 4B73A 2A5IA 1AE5A 1WSSH 2GTBA 1K1IA 3O8RA 3OX7U 1AFQC 1C2HA 3AW1A 1D9IA 2OXSA 2BX3A 3SNDA 1AQ7A 2UWPA 1IQGA 2VVUA 1KXBA 3IWMA 3V3MA 2PKAB 1T8MA 1LPKB 1OWIA 3MU1A 3M3VA 4D8NA 1C4Y2 1GBIA 2A0QB 2AGEX 2FTMA 2P8OB 2UWLA 1VJAU 3LH3A 2FPZA 1CA8B 1LO6A 4NIYA 5GIBA 3GCHB 4DGJA 3LGIA 2F9NA 2ZCKP 3KN2A 1DXPA 1HGTH 1E38B 4KKDA 1GGDC 1TNKA 5A09A 1ANBA 2ZF0H 4BTUB 4ABBA 3ZZDA 3MWIU 4HFPB 2BYAX 3F1SB 3KQDA 1UCYH 2UWOA 5JB9S 4GPGA 2FS8A 5IYTA 1XKAC 1O2QA 3U1IB 4AOQA 3S9CA 1BTWA 1LQEA 1ELDE 3M5LA 3ZZ9A 4A6LA 1CE5A 1W0YH 2ZFPH 1Z1IA 3PYHA 2WYJA 4U32A 3SW2B 1ANDA 1EOLA 5DO4H 3M3TA 2CHAC 1AWFH 2WPJS 3MYWA 1GHAG 3T28A 2QA9E 1JRSA 3QZRA 5E8EH 3MNSA 2PKSB 2HGTH 2VU8E 2R3UA 1DOJA 1H1BA 4JZ1A 1AN1E 1A0JA 2JH0D 3RXOA 4MPVA 1F5KU 5HXFA 1OKXA 1GBJA 1ZR0A 1O2JA 3BF6H 1G37A 4X6OA 1BTXA 1V2QT 1C2FA 1TX6A 1A5HA 1S5SA 2BVSH 1XUKA 1JBUH 1C1VH 4K60A 1ID5H 4H6SB 4DIIH 5EQRA 4INKA 1GJ8B 1TNJA 1GJ9B 1P2KA 1FNIA 1OWJA 2CF9H 4MDSA 1DWEH 1HAZB 4HTCH 5E0JA 1HCGA 1QNJA 2BY6X 2OINA 4AG2A 2G5NA 3A81A 1IOEA 1YCPH 2XC4A 2YOLA 1ZZZA 1MTNB 3RU4E 1YPMH 4O3TA 1ACBE 4E7RG 2ZZUH 2FI3E 3UNSA 5DK1A 1S0RA 2B5TB 2AGIX 1TPAE 3T29A 1OOKB 2J94A 2BLOA 2RA3A 1J9CH 1LHFH 2BXUH 4H6TA 2NU3E 2QCYA 1HAXB 3A87A 1RGQA 1RIWB 3BTDE 1GHBF 2SNWA 3SQEE 2ZU5A 1RFNA 2QXHA 4J1YA 4TPYA 4X2VA 2G52A 4YESB 1K9OE 1O3LA 2BMGB 1TNHA 4O97A 4AORA 1O5FH 4IC5A 1QJ7B 3BTTE 4B74A 2FOAA 3RXCA 2VWLA 4NA7A 2PFEA 5HM9A 2C4FH 1TGSZ 4UEHH 2FDAA 2AMDA 2J95A 2XBVA 2VH6A 1JWTA 4Z0KA 2F9BH 1GMDF 1ESAA 2Y82A 3AW0A 1DXWA 1X7AC 4THNH 1SQAA 1PQ5A 4LOYH 1MTNC 1L4DA 1P9UA 3PM3A 2SGAA 1CBWC 3A8CA 2A2QH 1GCTC 3RXPA 1PPHE 3F9EA 4ASHA 3P95A 3A8DA 4XOJA 1ANEA 1GI1A 2WYGA 6CHAC 1SLWB 4B2CA 2QF0A 3L33A 7GCHG 1FJSA 4FU7A 1O3FA 3RXMA 2EA3A 3GY6A 4BNRA 3RM0H 3MOCA 4Y76A 1C5ZB 4GHTA 7ESTE 2XCFA 2HPPH 2J38A 3BTEE 2Y7XA 3A7YA 3URCA 1P3CA 4BTIB 1NZQH 4AGJA 2ODPA 2GP9B 5FAHA 5IDKA 3V13A 4IN1A 1AKSA 2B8OH 1BTUA 2FWWA 1PQ7A 3OY6U 4H4FA 4KGAA 3CS0A 2ZFFH 3K65B 4UD9H 4DIHH 5B6OA 3S9BA 1ZGVA 1UTQA 1S6HA 3PO1C 1E34B 3QX5H 2ZEBA 1XXFA 3M5OA 1E35B 3JZ1B 1AD8H 1E37B 3BTHE 3E0PB 3SU6A 1BJVA 3GCNA 3BN9A 3HK3B 4CRAA 1AGJA 3KQEA 3R3GB 1FN8A 2ZU3A 5A0CA 1HAGE 4CRDA 1O2WA 1V2MT 3SZNA 1DY8A 1VGCB 4YT6H 1V2TT 1SGFG 1MKXH 1YM0A 4ZXYH 2TGAA 4O3UA 1BUIA 5C67A 5PTPA 2D1JA 2ZECA 4YT7H 2QC2A 3GCTF 4X2YA 3STIA 1Y3YA 2WPLS 4K1SA 4MPUA 3P70B 2IOTA 2F9UA 1C5MD 2GT7A 1LHCH 4KELA 1P2MA 1QCPA 4X1RU 2WPKS 4U01A 3SJOA 1UTOA 1YPJH 4WXVA 1NROH 6GCHG 2H5CA 1BMMH 2CMYA 2ZDKA 4Z6AH 2UUFB 1IQHA 1FXYA 1TNLA 1VCWA 1SG8B 2H9EH 3VPKA 1ANCA 3U8OH 1G9IE 1F0TA 5I25A 4IBLH 4K8YA 5ETXA 3K6ZA 5EOKA 3SNCA 1Q31A 5C3NA 3F9HA 1D6RA 3ZZCA 2F9VA 2O8TA 3RXTA 3S7KB 1ZSLA 1NT1A 2VINA 4UE7H 3PTBA 1UMAH 4NSYA 3DD2H 4OS1A 1SSXA 4A92A 2XNIA 1DSTA 2W7SA 2Y80A 3U8TH 3TH3H 1P03A 4IN2A 3TH4H 1ETSH 4XSKU 2VVVA 2ZDMA 1HB0B 4NFFA 3NK8A 3FFGA 1MCTA 3RUOA 3D62A 1DVAH 1UJ1A 5H4IB 1G30B 2FOCA 1GDUA 3ZZ5A 1O2XA 1SFQB 1O3PB 1PPBH 4DT7B 1O2PA 3U8RH 3RXHA 2C90B 3M37A 4HGCA 3MU4A 1C1SA 1NRQH 1ELGA 1OP2A 5EODA 3E90B 2C8YB 3A8BA 2OCVB 1HFDA 1JOUB 2ZHDA 1GI7B 3UWJH 4CBOA 2SNVA 1TPOA 3TK9A 1HRTH 2FIRH 2TPIZ 2EC9H 3OYPA 1YPEH 3MNCA 1O37A 2PUXB 3BIVH 3T25A 2QN5T 7LPRA 1HIAA 1KYNA 1O2LA 4X8SH 1ZHPA 3RXSA 4B75A 1YLCA 4OS7A 2OBOA 7KMEH 4BAKB 1VITG 3FVFB 4X0WU 1GVZA 2VGCB 3UOUA 2ZTYA 2HRVA 4FUBA 1F5RA 1Q2WA 1NC6A 3T62A 1O2OA 2ANKH 2W3IA 5JPMH 4BTTB 4CRBA 1TAWA 3ZZBA 1S6FA 4WH8A 1GPZA 1O2TA 3ATLA 1BIOA 1EAIA 3ZVGA 3RXDA 3SJIA 1V2OT 2A4RA 2IPHA 3SU4A 1G2MA 4ISNA 4WXIA 2THFB 3E3TA 3F9FA 1HBTH 1PQAA 1YF4A 2TBSA 3BG4C 3VFEA 3GDUA 4I31A 4X2WA 2BY8X 1OWDA 1UTMA 2CJIA 3O8DA 1O2RA 2BLWA 1EAXA 3MMGA 1DSUA 4MNVA 4ZKNU 1QA0A 3A7XA 5FX5A 2ZHQH 2SGPE 2GDEH 4QT8C 2Y7ZA 2GMTB 4K1TA 3BEFB 3BTQE 3NZIA 4NCYA 1MTUA 5T3HA 1O30A 3ATKA 1P2JA 1DUAA 5L30H 2NU0E 1RJXB 2GCHF 4IC6A 2GX4A 1HAPH 1MU6B 2ZI2H 4A1TA 1QR3E 2J4IA 2WUCA 4X8TH 4YTAA 5EXLA 1FY1A 5DPAA 1GI3A 1QRWA 3TGIE 2ZPRA 3RXQA 3LIWA 1Y3VA 4K2YA 4K3JA 1XUFA 3NPSA 1TMTH 1K1LA 3M5MA 1A46H 2XC0A 4A1XA 1MUEB 1UHBA 1ARBA 2JH6D 2BXTH 3KF2A 1W7GH 1SGEE 1V2PT 2ZQ1A 1L1GA 2VIPA 1V2UT 2ZTXA 4MTBA 2FYRA 1QB1A 2OP9A 3EQ0H 1OWHA 1WTGH 5DJ7A 3UQOA 2A5KA 1UVOA 1GI2A 1F5LA 3HK6B 1HAOH 1Z6EA 2R9PA 2BDIA 3H7OA 1IQIA 2PGBB 3U1JB 3SV7A 1JRTA 1G2LA 2TGPZ 3RXRA 1C1TA 3NKKA 2ZFSA 3JZ2B 3MO9A 1DICA 1C5PA 1SQTA 3TPIZ 1O2IA 1O39A 1SGYE 3GCHC 1IQNA 5LPRA 1BHXB 1AB9B 1MAXA 3KL6A 1SC8U 1EAWA 1SOTA 1QQ4A 2BB4A 1L0ZA 2DE9A 1A4WH 1EB2A 2R3YA 1ELAA 4Q80A 4DG4A 1CSOE 3MNBA 1QRZA 1FI8A 2Z9GA 1E36B 2H9HA 2W7UA 1Z7KA 2FI5E 4GCHF 4X8UH 4VGCB 3NCLA 4ABDA 1YPHC 2D8WA 5A8ZA 5F8TA 2FYQA 3U9AH 2ZA5A 3RXJA 3ZZ7A 2BY7X 4YOJA 1N6YA 1IQFA 2Z9IA 1GBMA 3QN7A 4DY7B 2Z7FE 2A45B 1DY9A 4WVPE 1LTOA 1FAXA 4BXWA 4XBDA 1FONA 1S83A 1D3PB 3EAJA 1IQMA 1NS3A 4YLUA 4OS5A 4IW4E 3ZZ6A 1B0FA 1GI8B 2G8TA 1H9HE 2A31A 1VR1H 1W14U 1QJ6B 2H6MA 1QBOA 1VZQH 5EW2H 5GCHF 3M7UA 3TGKE 1C1RA 2PSXA 1FMGA 2TGDA 1SR5C 3VEQB 3IITA 2F91A 3SI4H 1VCQA 1DUEA 3N7OA 3S9AA 1AI8H 5BPEA 1JXPA 4U2WA 3RM2H 3F68H 2ZGCA 2BOKA 4Y8ZA 2J34A 2Z94A 2ZDVH 2BDYA 3VXEH 1EATA 2PKAA 3KEEA 1ZPCA 4TY7A 1O3GA 1NFWA 2OC7A 4TWYA 1F0SA 5T6GA 2UUYA 1ZLRA 1RIWC 4LZ4B 1MU8B 3ZZ8A 1KXEA 1TB6H 1SB1H 3LC5A 2F9OA 2HALA 5FX6A 1D3QB 2CGAA 1YPKH 1ZPBA 2OC0A 1G3EA 1LKAA 4D7GA 3RMNH 5HGGA 2ZGJA 3GOVB 1ZSJA 1O5GH 2UUKB 3UREA 8GCHG 3HPTB 2M5TA 1TABE 3W95A 3RXAA 1CGJE 4B2AA 3A86A 3A7VA 4DJZB 5E0HA 3RMOH 5EW1H 1C5SA 1MAYA 1LHGH 3HGPA 4D7FA 3P8OA 1OXGA 2P95A 4OS4A 3ZVBA 3PWBA 1XVMA 1GBAA 4MQAA 2DE8A 4FUEA 1GJAB 1IQEA 3Q3XA 3AAVA 4XDEA 1GHZA 1ESBA 3UR9A 1WUNH 1CT4E 2G4UA 3RU4T 1BTYA 1UHBB 1WU1A 5JBCS 1BITA 3RC5A 1MBMA 3UQVA 1GMHF 1O3HA 3BTFE 4GHQA 5HYOA 1A3EH 1BHXF 3S7HB 1C1MA 2ZC9H 4X6MA 4OGYA 3SU3A 3TVJB 4K8BA 2P59A 2BD7A 1SGTA 2ALPA 1T8NA 3BG8A 1GBEA 3P8GA 2PV9B 2XW9A 4BXSA 1S81A 6CHAB 4CHAB 4FU8A 1P3EA 1O2SA 5LPEA 3RXFA 3LGWA 2ZCLP 3GY2A 3DT0H 1TYNA 3F9GA 2W3KA 1EP6A 1WQSA 3GYMA 2VJ1A 3QDZB 3ESTA 1PPEE 1ZMNA 4NA8A 1YPHE 5G4BA 2QY0B 1HAHH 1LKBA 1LHEH 2VWMA 3DFJA 2ZQ2A 1QB6A 1W2KH 2G00A 3SUFA 3ZVAA 4CREA 1NTPA 1PPCE 3E1XB 3QO6A 4AX9H 3GY7A 2R2WU 1IHSH 2O8UA 5C1UA 1LCYA 4MNYA 4FXGH 3SNAA 2AGGX 1C5XB 1O2NA 3T26A 1ZTLA 1MTWA 2Z3DA 1A7SA 1C4V2 3D49H 3RMLH 1KSNA 5GPIB 4ISIH 4NWKA 1OP0A 1O35A 1KDQB 1ETTH 1NY22 3DFLA 4X1NU 5L2ZH 4Y6DA 3PLBA 1TIOA 1UK3A 2FTLE 4MLFB 3LPRA 4XFQA 2BD8A 4ZKRU 1SGIB 2GMTC 1QRXA 4I8JA 2RDLA 4ZAEA 3UNRA 1J17T 3CS7A 1GJ4H 1D3DB 3SUGA 3ZVCA 3DHKH 1C5UA 1UVTH 2FMJA 5EPYA 3MH7A 1P2QA 3NWUA 1PPGE 5TCAA 3MH5A 1NU9A 1FY3A 4ABIA 1XMNB 1N8OB 2DUCA 2G5VA 3A82A 5DP8A 3P8NA 3VB6A 3ZVEA 1K21H 1ELBA 1EJAA 2Y5GA 4F4OC 1T8OA 3ATWA 3TJUA 1J8AA 1ETRH 2BDBA 1Z8RA 5CE1A 1TX7A 2P8OC 3TIUA 2P16A 4NGAH 1QA7A 1OYQA 2OC8A 3LOXA 2ZFQH 4AN7A 2HNTE 1XVOA 1NRSH 3LDXH 2G51A 2XXLA 1DWCH 5DP6A 3B9FH 5EQQA 3DA9B 3EA8A 2ZHFH 1AWHB 3P8FA 3ZVDA 4YLQH 4E05H 4BANB 1AY6H 5A8XA 2P94A 1GDNA 1KXDA 3NXPA 1BOQA 3ZYDA 4AYYB 1UCYK 4WMEA 2A7CA 3V0XA 3A7TA 3LGVA 4UFDH 3TNTA 1B7XB 4WF8A 5CMXH 4Y11E 2BZ6H 1AVGH 4IS5A 5E0GA 4YZUA 1EJNA 1TBZH 1INCA 1P2OA 1A1RA 3HKJB 4FUIA 4JK5A 2O8LA 2W26A 6ESTA 1O3OA 1FUJA 3KHVA 3RLYH 2V3OH 1GMCF 1MCVA 4X6NA 2AH4X 1GG6C 4CRFA 4B71A 5CHAC 2EEKA 1KXAA 2BD2A 2V3HH 3EDXB 5JDUB 1SL3A 1SGDE 5A2MH 2VIVA 3QTVH 3RXKA 4AYVB 4RKOB 4KTUA 1ZSKA 1O2UA 1VJ9U 3Q3YA 1V2ST 1IQKA 5AFZH 5JBAS 4OGXA 3GDSA 2BD3A 2VIWA 1FY8E 4HZHA 1C9TA 2GZ7A 3ATMA 1C5QA 2R0LA 1DANH 4Y8XA 1GBTA 8LPRA 1C1PA 4X6PA 2STBE 4Q7YA 1GWAA 3B23B 4DURA 3PMHB 2W5EA 3BV9B 3LGUA 4SGAE 2H2ZA 2SGDE 1F0RA 4TPIZ 1ESTA 2FLRH 2G4TA 3HATH 4ABHA 5EXNA 5LPFA 3Q3KA 3MU5A 1YC0A 1A5IA 2ULLA 5F03A 4B76A 1S0QA 3ENSB 1TBQH 4D9QA 1AE8H 1O5DH 1SLUB 3EA7A 1GHYH 4NSVA 3K2UA 3VB3A 3SU1A 1Y5UT 2V0BA 4FU9A 1TX8A 1P57B 2HVXA 3EGKH 1YBWA 1TGBA 1GHAF 4ZH8A 1K28D 4MG3A 4CH2B 1SFIA 1Y3WA 2PW8H 1QBNA 1DPOA 5C5OA 1Y3UA 3PTNA 2FS9A 1XX9A 3G01A 1FY4A 3K6YA 1KY9A 1EZSC 3GY3A 1EX3A 2QXIA 4ISHH 3A8AA 1C5TA 3FZDA 2Z3CA 3ZZ4A 1P8VC 3FP8E 1NFXA 1HAYB 3QK1A 1V2JT 1TRNA 1ZOMA 2ZGHA 2FM2A 5F8ZA 3T27A 3MI4A 3A85A 4Y0YE 4ABJA 1SGRE 1CHOF 2AIPA 3QUMP 1SLXB 1EPTB 4NZLA 1G3BA 1NRRH 1V2KT 1JIRA 1TMBH 4NWLA 4INHA 5F6MA 1KTTB 3ZZ3A 4M7GA 1ZRBA 2JH5D 4XBCA 5F8XA 1V2LT 4MPXA 1PQ8A 2Q6GA 2GVFA 1ZMJA 2J2UA 1C1NA 1FLEE 1A2CH 2TGTA 2A4OA 3HGNA 2ZGBH 4UONA 1W8BH 4X2XA 1HUTH 1Y59T 1SVPA 1THSH 8ESTE 3SHCH 3TJVA 1O3MA 2VNTA 4NZQA 5TCCA 1BRUP 4RKJB 4DOQA 3I77A 2PTNA 2VIQA 3FP7E 3RMMH 1LDTT 1GBLA 2HNTC 5FXLA 3MH4A 1AVWA 2PKSC 3M36A 3MO6A 1YGCH 1KTSB 1N8OC 1TNGA 1AO5A 2VGCC 3I29A 4JCNA 4E7NA 1FDPA 1SGQE 1BRBE 1C5RA 1D3TB 1IHTH 2PR3A 5AF9H 2GDDA 3RXUA 8GCHF 5JB8S 1TA2A 5HM2A 1HJAB 1S84A 2BD9A 3S69A 4AB9A 4ZHAA 1TGTA 4LXBH 2YNBA 2ZPQA 4E06H 1BTZA 1TRYA 1Y3XA 3K9XB 1KIGH 4X1QU 5J4QA 2VVCA 2WINI 1FQ3A 1L1JA 1O32A 1WAYB 1YYY1 4I8GA 1OP8A 1JIMA 2FOBA 1ELFA 1P11E 5TJXA 1ZTJA 1QTFA 1S85A 1F0UA 1C5WB 1O2GH 3DUXH 1HNEE 1ELCA 1NM6A 1B0EA 2VH0A 3TU7H 2BQ6B 4X1SU 1C1QA 1H8DH 3A80A 1TPSA 1GJBB 4BOHA 2Y5FA 1EXFA 3URDA 1C2IA 1SLVB 4Q7ZA 5EXMA 1AFQB 2JETC 1GMDG 1KXFA 4AG1A 5FCKA 3VB5A 1HJAC 4IMZA 1AVXA 1C9PA 2ZU1A 1ZGIA 3RLWH 1GHWH 1MD7A 1IQLA 1NU7B 5EPNA 4AZ2B 4K69A 3VB7A 1LVMA 3QZQA 2O8WA 2B9LA 4D9RA 2ODQA 3M5NA 2HWLB 3ELAH 2Z9JA 2I6SA 3A84A 4I7YH 3ZV9A 1K1PA 2ZDAH 1UCYE 3SBKA 3SU0A 4Y0ZE 3RXIA 1UTPA 1V2WT 1Z8GA 4AFZA 1ZHRA 1DM4B 1NO9H 2BD4A 3MO3A 3GCOA 2SGEE 1KLTA 1GDQA 3MNXA 3E6PH 3TK6A 1TPPA 1GHXH 1ZYOA 1KLJH 1O5AB 1RXPA 3D65E 1CA0C 1J15A 3Q77A 1GMHG 4FUHA 2ZG0H 1O3BA 2VIOA 1Z6JH 2ZP0H 5FPYA 1TQ7B 4TY6A 1GL0E 1C2GA 1FY5A 1XUHA 1GI6A 1TA6A 4HI3A 3SOSA 1XM1A 1P02A 4LK4A 2OLGA 3SGAE 4AGKA 1GI9B 2XC5A 1SMFE 3MU8A 1V6DA 1THPB 3SNBA 2J9NA 1NFYA 1GI0A 1BZXE 4YOGA 3GY4A 3TK5A 3S0NA 3CENA 2ZO3H 1BMNH 1AUJA 4R8TB 1SOZA 3SGQE 3PO1B 1W0ZU 1J16A 4WJG2 4ZHLU 1P2IA 1GJ6A 2XBXA 4F49A 1BCUH 1C1OA 2GGVB 4ABGA 1AU8A 3KNXA 1QBVH 2GCTB 1C5OH 1EAUA 2GT8A 3SV2H 4B1TA 2QXJA 3PMJA 3U69H 2P3TB 7GCHF 1AB9C 1GL1A 5JBTA 1ZHMA 1GBHA 2XRCA 2BOHB 3B8JA 4A7IB 2KAIA 3GICB 1VITF 4DVAU 2FOGA 4NFEA 1QGFA 1FV9A 1LMWB 2B7DH 4FVBA 1TGNA 1EASA 1OSSA 3TJOA 1ZPZA 4UDWH 3SJ9A 4YM9A 1O2ZA 5DG6A 3FANA 3P17H 3SO3A 1ELTA 2UUJB 2ZU2A 2ZFTA 4ZKSU 4ABEA 4ZUHA 5FBEA 2HPQH 1QL7A 1RD3B 5CHAB 1MKWH 2Y5HA 1EPTC 2QXGA 3V12A 2OQ5A 2CV3A 1MTSA 2ZDLA 3H5CB 3LT3A 5EG4A 2EI7A 3LGTA 1DX5M 4ESTE 3LU9B 3SV8A 2ZCHP 2PTCE 3E0NB 3QLPH 1PPFE 3BTKE 2AFQB 4MVNA 2F83A 1P2NA 1QURH 1O2VA 1DLKB 1O2YA 1ABJH 4JK6A 1FPCH 2ALVA 1Q3XA 1TALA 2SGQE 4NA9H 1GCTB 2H1UA 1O3JA 2Z9LA 5DP4A 4RN6A 4JYTA 4WWYA 2AMQA 2WV5A 3WY8A 4INLA 5EQSA 3STJA 1BTHH 1GVLA 1P12E 1SGCA 3M3SA 1EQ9A 1TMUH 1WYKA 4WH6A 1HPGA 4FUDA 1ZJKA 1AMHA 3C27B 2R0KA 2SFAA 2F9PA 2XTTB 4U30A 1EUFA 3PROA 4CH8B 1O3EA 2NWNA 3PV4A 2BM2A 4NG9H 1W11U 2NU4E 3LKWA 4JZDH 4CR9A 3IG6B 4GUXA 1QJ1B 2FOFA 1ABIH 2FI4E 1QIXB 1SHYA 1LHDH 1XXDA 3ZVFA 3KQCA 1P01A 1XKBC 2KAIB 5DP7A 1JMOH 1W12U 2RCEA 2BQWB 1WV7H 2WV4A 3ZV8A 2BD5A 1ELVA 1C2KA 3UFAA 2O8MA 1T7CA 2I6QA 3ODFA 3EA9A 1OPHB 5BRRE 3LJOA 4OS2A 1XUJA 1HJ9A 2ZHWH 1IQJA 3TJNA 1CHGA 2IN2A 5AVDA 4FUGA 1AZZA 1GBCA 1TLDA 1GBFA 1CA0B 5HMAA 3RP2A 1EZUC 4DCDA 1QL9A 3SGBE 2OBQA 1M9UA 3RXEA 1SGPE 1C2EA 1EP5A 5DP5A 3MTYA 1BTPA 2Q6FA 3RXBA 1NRPH 2JETB 3T2NA 1OWEA 2A7JA 5ESTE 1HAVA 1AFEH 3RC6A 1V2VT 2WPMS 1L4ZA 2EI8A 3AVZA 4SGBE 1CU1A 3SI3H 3UNQA 1IAUA 2GZ9A 2AS9A 1H9IE 1EOJA 1LPZB 1GI5A 1TE0A 1W13U 2AYWA 2CXVA 2ZHEH 1T32A 1PJPA 3SJ8A 3P92A
chains in the Genus database with same CATH superfamily
1W10U 1CBWB 5AHGH 1DWDH 2FEQH 1BBRK 1CVWH 2QGRA 1NPMA 1BB0B 2FP7B 1RTLA 3L6PA 4OS6A 1GI4A 2ODYB 1WQVH 2J92A 1XUGA 1NFUA 5CDFE 2PHBA 5L6NH 4GSOA 8KME2 4WMDA 4FUFA 4Q2KA 1AKSB 3VXFH 4ISLA 4IMQA 2XWBI 2G55A 5T1VA 3GYLB 3P6ZB 1BMAA 2HNTF 1AIXH 2FX4A 1O0DH 1K1NA 5E2PA 1HIAB 4MNWA 5FHTA 1OYTH 4ZROA 4ISOA 1ARCA 1QY6A 1NBME 2P3FH 1GJ5H 4FUJA 3FAOA 4J2YB 2GV6A 1C2JA 3SUDA 4Y79A 1E0FD 3PLKA 4CR5A 1UK2A 3SU5A 1HYLA 1O3IA 5GWZA 6LPRA 1O31A 2KR7A 1N1LA 1O2MA 3UIRA 4IGDA 3EE0B 4O03A 1O33A 1YPGH 1LVOA 2ZTZA 1B5GH 2D26C 1P04A 3GY5A 5DP9A 5DKMA 2WUBA 2BDAA 1P06A 2VWNA 1TBRH 3KCGH 1DE7H 1TFXA 1GMCG 1VGCC 1UTLM 3BTGE 1OX1A 3TH2H 3SNEA 1C2MA 5L2YH 3F6UH 4Y8YA 2A5AA 1O5BB 5AFYH 1YLDA 3TGJE 4BAOB 2FO9A 5LH8A 3AAUA 2BZAA 1EPTA 1PFXC 2FOHA 4JMYA 1O36A 3T5FH 4B2BA 3EYDA 4MPWA 1G3CA 2D2DA 2JKHA 1NN6A 5KECA 9ESTA 3BIUH 4ZXXH 2BQ7B 4MNXA 3PLPA 2BDGA 5FPTA 3M35A 4I8HA 5J4SA 3H7TA 1AUTC 5GXPA 1O3KA 5DGJA 1C5LH 1COWD 1EJMA 1YP9A 4JZFH 5DP3A 1C5YB 4I32A 2TRMA 1XUIA 4HG6A 1MQ6A 3KIDU 1BRCE 4R0IA 4RT0A 2GD4B 3BG4B 2FLBH 1LQDB 1TWXB 3O8CA 1UK4A 2BTCE 4CRGA 1GJ7B 1TQ0B 2A7HA 5FCRA 2BLQA 4CHAC 2Q1JA 2BX4A 2Y81A 3I78A 1FIWA 2P3UB 3FP6E 1O2HA 4I33A 1GBDA 3DSGA 1BRAA 3GISB 1HDTH 4CRCA 5A0BA 1V3XA 3SN8A 1CQQA 1C5VA 1GJDB 2Q6DA 1UVSH 1V2NT 1SBWA 4K1EA 1ZTKA 2B0FA 3F0PA 4JZEH 3ZYEA 4I8KA 5C17A 1N6XA 4WMFA 2A1DB 1A0LA 1BA8B 3PWCA 3LC3A 3C1KA 1H9LB 2ESTE 3UY9A 2GZ8A 5C1XA 1GVKB 1UVPA 5E2OA 2V6NA 2GCTC 3BTME 5EU8A 4JZIA 1O3NA 1P09A 3UUZA 1DT2A 1O5CB 2HLCA 2FESH 1GG6B 2VB0A 1EKBB 3GCTG 2CN0H 3ZZAA 1DLEA 3A7ZA 2ZNKH 4X8VH 2V35A 3D23A 1K1MA 1Y8TA 1E1RD 1DWBH 2K1QA 3PMBB 5ABWA 3KGPA 1A5GH 4Y71A 3E16B 3AASA 5A8YA 5C5NA 4CBNA 1S82A 2SGFE 3RC4A 6GCHF 1SI5H 3F0OA 3SQHE 2J5UA 5I46H 3QTOH 1O3DA 1GCDA 4TYDA 4BAHB 3OSYA 4YOIA 3RXGA 4D76A 1C2DA 1P9SA 1T4VH 1YCPK 3Q00A 1Z8JB 2NU1E 2C8ZB 4X1PU 3E91A 1WTHD 2O9QA 1W3CA 1F92A 1WCZA 3A88A 3PB1E 2CHAB 3MH6A 2RA0A 1K1JA 3M61U 3TITA 4Y10E 1DITH 4DW2U 1P05A 3VB4A 3VGCC 2VIDA 5SGAE 1C2LA 4XBBA 4FVDA 5HIYA 1MABB 3M7TA 3ITIA 3SUEA 1MD8A 1ZJDA 2BLVA 1HJ8A 1FIZA 1PYTC 2FX6A 3OU0A 1E79D 4AFQA 2JDID 4RT1A 2XCNA 3OY5U 1KLIH 1MKXK 1GJCB 3OTJE 4NIXA 5ESBA 1DFPA 4I8LA 2BHGA 4KTCA 3UPEA 1TNIA 4ZKOU 2A4GA 3UWIA 9LPRA 4VGCC 1V2RT 2JJ2D 2YNAA 2G81E 1OWKA 1OS8A 2QIQA 2H5DA 4KTSA 3RU4D 2BDHA 2GCHG 1RRKA 1O5EH 2CF8H 2OUAA 1NESE 1MMJN 1P0SH 1QL8A 2WPHS 1BJUA 2XBYA 5JYIA 1O3CA 2FXRA 2PLXA 3L3TA 3Q76A 2A32A 1O2KA 1HXFH 4GLYA 1D4PB 3A89A 1CO7E 2ANWA 2XBWA 3SHAH 1CGIE 1A3BH 2BY9X 4ZHMU 2Y6TA 1QZ8A 1QHRB 4BAQB 4Y7AA 3SV6A 4UFEH 1LVBA 1BT7A 3PRDA 4LZ1H 1UVUH 4O9VA 3ATIA 3UOPA 3GY8A 3SU2A 4JYUH 1VITH 1EZQA 5C1YA 1J14A 2QYIA 1AZ8A 1EB1H 3QGJA 1BMLA 1T4UH 2ZU4A 3WW7A 1C4U2 1G3DA 4A1VA 1Z1JA 1HAVB 2BVRH 2RG3A 1GGDB 1HAIH 1GHBG 1RS0A 1YCPM 1DDJA 5C20A 1QQUA 1MZAA 4RSPA 4AFUA 2PUQH 1F7ZA 2OD3B 3LONA 3SJKA 1MBQA 2FZZA 1T31A 4Z1MD 5GDSH 2C8XB 1G32B 1GBKA 4NIVA 5LGOA 3ODDA 2ASUB 2Z6BD 2AIQA 1QB9A 5GCHG 2Z3EA 1SGFA 2L6OA 2FOMB 3TLOA 2ANYA 3N99A 1ZRKA 1D6WA 4FUCA 2HOBA 1K1OA 1FZZA 1P10A 2LPRA 1NBMD 2ZDNA 3SORA 1MKWK 1UTNA 2BVXH 4UFFH 1MH0A 2WPIS 1H8IH 1SGNE 3RXLA 3R0FA 4AFSA 3QGNB 1ZMLA 1U6QA 1HV7A 1KDQA 4ABFA 3E8LA 2BDCA 2F3CE 1WBGB 4BAMB 1THRH 4JYVH 4ZMAH 1W7XH 1BBRE 2LNCA 2OTVA 2P93A 1ELEE 5K0HA 2AERH 4ABAA 4Q7XA 2TIOA 2OC1A 2VWOA 2STAE 1CHOG 2EI6A 3MFJA 3PV5A 4UFGH 5T6DA 1MQ5A 1ORFA 1O3AA 1C1UH 1TOCB 2OQUA 1YPLH 2ILNA 3KQBA 1GBBA 2YMSD 3UTUH 4A5TS 2Z9KA 1C5NH 1Z8IB 1SPJA 2AEIH 1HXEH 2IJOB 2ZIQH 1WOFA 2NU2E 1LVYA 1YKTA 4GVUA 1QFKH 4AB8A 1AHTH 4PROA 1BDAA 1DS2E 1Y5BT 1Z71A 1HLTH 4FOUC 4XE4A 3V7TA 2QAAA 4GCHG 3BSQA 2C8WB 1BQYA 1UO6A 3MU0A 5GNDA 3GDVA 1VCPA 3A7WA 3RDZA 1UTKA 2ANMH 1TRMA 1LPGB 1CGHA 3HKIB 4K5ZA 1L2EA 3LGYA 5FPSA 2PWXA 1T8LA 1BBRH 4ACBA 3TNSA 5GJ4B 5FBIA 2R2MB 4XRNA 4Y7BA 3A83A 2ZWLH 1S6LA 2ZGXH 4H42U 1G36A 1K22H 1A0HB 1NRNH 3LH1A 3PMAB 4WY3A 1A61H 3FZZA 3W94A 1O34A 5K7RA 5A0AE 2XNDD 1FAKH 1UTJA 1RTKA 1TONA 4GAWA 1PPZA 1CT0E 1Y5AT 1MZDA 1TOMH 1SHHB 3RXVA 2PSYA 3U98H 2A4QA 2GV7A 3BTWE 4KP0A 2C93B 2PGQB 1SQOA 3UR6A 1FN6A 1H4WA 1FPHH 1K2I1 2ZFRH 1KXCA 1C1WH 4YO9A 3O8BA 5JBBS 2XWAA 2ZPSA 3BEIB 3MHWU 2FODA 2A2XH 3M7QA 3VGCB 1GHVH 3CP7A 1CT2E 3QWCH 2JJ1D 4NIWA 2FOEA 2AMPA 1PYTD 1EZXC 2ZKSA 2H9TH 5T6FA 2BY5X 3SV9A 1F2SE 1KMHB 1O38A 5EGMA 2C3SA 2QF3A 2GKVE 3NUMA 1E1QD 3LJJA 1TGCA 2QV1A 1L1NA 3BEUA 2XYAA 1MTVA 1RTFB 5C2ZA 4TWWA 4B73A 2A5IA 1AE5A 1WSSH 2GTBA 1K1IA 3O8RA 3OX7U 1YWUA 5EJLA 1AFQC 1C2HA 3AW1A 1D9IA 2OXSA 2BX3A 3SNDA 1AQ7A 2UWPA 1IQGA 2VVUA 1KXBA 3IWMA 3V3MA 2PKAB 1T8MA 1LPKB 1OWIA 3MU1A 3M3VA 4D8NA 1C4Y2 1GBIA 2A0QB 2AGEX 2FTMA 2P8OB 2UWLA 1VJAU 3LH3A 2FPZA 1CA8B 1LO6A 4NIYA 5GIBA 3GCHB 4DGJA 3LGIA 2F9NA 2ZCKP 3KN2A 1DXPA 1HGTH 1E38B 4KKDA 1GGDC 5C94A 1TNKA 5A09A 1ANBA 2ZF0H 4BTUB 4ABBA 3ZZDA 3MWIU 3F2GA 4HFPB 2BYAX 3F1SB 3KQDA 1UCYH 2UWOA 2JIZD 3OE7D 5JB9S 4GPGA 2FS8A 5IYTA 3F2HA 1XKAC 1O2QA 3U1IB 4AOQA 5C0UA 3S9CA 1BTWA 1LQEA 1ELDE 3M5LA 4FETA 3ZZ9A 4A6LA 1CE5A 1W0YH 2ZFPH 1Z1IA 3PYHA 2WYJA 4U32A 3SW2B 1ANDA 1EOLA 5DO4H 3M3TA 2CHAC 1AWFH 2QF5A 2WPJS 3KYFA 3MYWA 1GHAG 3T28A 2QA9E 1JRSA 3QZRA 5E8EH 3MNSA 2HLDD 2PKSB 2HGTH 2VU8E 2R3UA 1DOJA 1H1BA 4JZ1A 1AN1E 1A0JA 1YY3A 2JH0D 3RXOA 4MPVA 1F5KU 5HXFA 1OKXA 1GBJA 1ZR0A 1O2JA 3BF6H 1G37A 4X6OA 1BTXA 1V2QT 1C2FA 1TX6A 2V7QD 1A5HA 1S5SA 2BVSH 1XUKA 1JBUH 3SYJA 1C1VH 4K60A 1ID5H 4H6SB 4DIIH 5EQRA 2AHME 4INKA 1GJ8B 1TNJA 1GJ9B 1P2KA 1FNIA 1OWJA 3NRLA 2CF9H 4MDSA 1DWEH 1HAZB 4HTCH 5E0JA 1HCGA 1QNJA 2BY6X 2OINA 4AG2A 2G5NA 3A81A 1IOEA 1YCPH 2XC4A 2YOLA 1ZZZA 1MTNB 3RU4E 1YPMH 4O3TA 1ACBE 4E7RG 2ZZUH 2FI3E 3UNSA 5DK1A 1S0RA 2B5TB 2AGIX 1TPAE 3T29A 1OOKB 2F43B 2J94A 5IK2D 2BLOA 2RA3A 1J9CH 1LHFH 2BXUH 4H6TA 4YXWD 2NU3E 2QCYA 1HAXB 3A87A 1RGQA 1RIWB 3BTDE 1GHBF 2SNWA 2IPQX 3SQEE 2ZU5A 1RFNA 2QXHA 4J1YA 4TPYA 4X2VA 2G52A 4YESB 1K9OE 1O3LA 2BMGB 2W6ID 1TNHA 4O97A 4AORA 1O5FH 4IC5A 1QJ7B 3BTTE 4B74A 2FOAA 3RXCA 2VWLA 4NA7A 2PFEA 5HM9A 2C4FH 1TGSZ 4UEHH 2FDAA 2AMDA 2J95A 2XBVA 2VH6A 1JWTA 5DN6D 2KCAA 4Z0KA 2F9BH 1GMDF 1ESAA 2Y82A 3AW0A 1DXWA 1X7AC 4THNH 1SQAA 3OAAD 1PQ5A 4LOYH 1MTNC 5CHBA 1L4DA 1P9UA 3PM3A 2SGAA 1CBWC 3A8CA 2A2QH 3FO8D 1GCTC 3RXPA 1PPHE 3F9EA 4ASHA 3P95A 3A8DA 4XD7D 4XOJA 1ANEA 1GI1A 2WYGA 6CHAC 1SLWB 4B2CA 2QF0A 3L33A 7GCHG 1FJSA 4FU7A 1O3FA 3RXMA 2EA3A 3GY6A 4BNRA 3RM0H 3MOCA 4Y76A 1C5ZB 3SZEA 4GHTA 7ESTE 2XCFA 2HPPH 2J38A 3BTEE 2Y7XA 3A7YA 3URCA 1P3CA 4BTIB 3VG8A 1NZQH 4AGJA 2ODPA 2GP9B 2YMSB 5FAHA 5IDKA 3V13A 4IN1A 1AKSA 2B8OH 1BTUA 2FWWA 1PQ7A 3OY6U 4H4FA 4KGAA 3CS0A 2ZFFH 3K65B 4UD9H 4DIHH 5B6OA 3S9BA 1ZGVA 1UTQA 1S6HA 3PO1C 1E34B 3QX5H 2ZEBA 1XXFA 3M5OA 1E35B 3JZ1B 1AD8H 1E37B 3BTHE 3E0PB 3SU6A 1BJVA 3GCNA 3BN9A 3HK3B 4CRAA 1AGJA 3KQEA 3R3GB 1FN8A 2ZU3A 5A0CA 1HAGE 4CRDA 1O2WA 1V2MT 3SZNA 1DY8A 1OHHD 1VGCB 4YT6H 1V2TT 1SGFG 1MKXH 1YM0A 4ZXYH 2TGAA 4O3UA 1BUIA 5C67A 5PTPA 2KX4A 2D1JA 2ZECA 4YT7H 2QC2A 3GCTF 4X2YA 3STIA 1Y3YA 2WPLS 4K1SA 4MPUA 3P70B 2IOTA 2F9UA 1C5MD 2GT7A 1LHCH 1SQRA 4KELA 1P2MA 1QCPA 4X1RU 2WPKS 4U01A 3SJOA 1UTOA 1YPJH 4WXVA 1NROH 6GCHG 2H5CA 1BMMH 2CMYA 2ZDKA 4Z6AH 2UUFB 1IQHA 1FXYA 1TNLA 1VCWA 1SG8B 2H9EH 3VPKA 1ANCA 3U8OH 1G9IE 1F0TA 5I25A 4IBLH 4K8YA 5ETXA 3K6ZA 5EOKA 3SNCA 1Q31A 5C3NA 2KM0A 2HVYB 3F9HA 1D6RA 3ZZCA 1H8ED 2F9VA 2O8TA 3RXTA 3S7KB 1ZSLA 1NT1A 2VINA 4UE7H 3PTBA 1UMAH 4NSYA 3DD2H 4OS1A 1SSXA 4A92A 2XNIA 1DSTA 2W7SA 2Y80A 3U8TH 3TH3H 1P03A 4IN2A 3TH4H 1ETSH 4XSKU 2KCOA 2VVVA 2ZDMA 1HB0B 4NFFA 3NK8A 3FFGA 1MCTA 3RUOA 3D62A 1DVAH 1UJ1A 5H4IB 2VBCA 1G30B 2FOCA 1GDUA 3ZZ5A 1O2XA 4I86A 1SFQB 1O3PB 1PPBH 4DT7B 1O2PA 3U8RH 3RXHA 2C90B 3M37A 4HGCA 3MU4A 1C1SA 1NRQH 1ELGA 1OP2A 5EODA 3E90B 2C8YB 3A8BA 2OCVB 1HFDA 1JOUB 2ZHDA 1GI7B 3UWJH 4CBOA 2SNVA 1TPOA 3TK9A 1HRTH 2FIRH 2TPIZ 2EC9H 3OYPA 1YPEH 3MNCA 1O37A 2PUXB 3BIVH 3T25A 2QN5T 7LPRA 1HIAA 1KYNA 1O2LA 4X8SH 1ZHPA 3RXSA 2XOKD 4B75A 1YLCA 4OS7A 2OBOA 7KMEH 4BAKB 1VITG 3FVFB 4Q63A 4X0WU 1GVZA 2VGCB 3UOUA 2ZTYA 2HRVA 4FUBA 1F5RA 1Q2WA 5B6LA 1NC6A 3T62A 1O2OA 2ANKH 2W3IA 5JPMH 4BTTB 4CRBA 1TAWA 1SKYE 3ZZBA 1S6FA 4WH8A 1GPZA 1O2TA 3ATLA 1BIOA 1EAIA 3ZVGA 3RXDA 3FKSD 3SJIA 1V2OT 2A4RA 2IPHA 3DCLA 1G2MA 3SU4A 4ISNA 4WXIA 5F53A 2THFB 3E3TA 3F9FA 1HBTH 1PQAA 1YF4A 2TBSA 3BG4C 3VFEA 3GDUA 4I31A 4X2WA 2BY8X 1OWDA 1UTMA 2CJIA 3O8DA 4B6EA 1O2RA 2BLWA 1EAXA 3MMGA 1DSUA 4MNVA 4ZKNU 1QA0A 3A7XA 5FX5A 2ZHQH 2SGPE 2GDEH 4QT8C 2Y7ZA 2GMTB 4K1TA 3BEFB 3BTQE 3F3BA 3NZIA 1MTUA 4NCYA 5T3HA 1O30A 3ATKA 1P2JA 1DUAA 5L30H 2NU0E 1RJXB 2GCHF 4IC6A 2GX4A 1HAPH 1MU6B 2ZI2H 4A1TA 1QR3E 1UW7A 2J4IA 2WUCA 4X8TH 4YTAA 5EXLA 1FY1A 5DPAA 1GI3A 1QRWA 3TGIE 2ZPRA 3RXQA 3LIWA 1Y3VA 4K2YA 4K3JA 1XUFA 3NPSA 3PRBA 1TMTH 1K1LA 2GJGA 1A46H 3M5MA 2XC0A 4A1XA 2KCPA 1MUEB 1UHBA 1ARBA 2JH6D 2BXTH 3KF2A 1W7GH 1SGEE 1V2PT 2ZQ1A 3OEED 1L1GA 2VIPA 3UAIC 1V2UT 2ZTXA 4MTBA 2WV9A 2FYRA 3F2FA 1QB1A 2OP9A 3EQ0H 1OWHA 4F48B 1WTGH 5DJ7A 3UQOA 2A5KA 1UVOA 1GI2A 1F5LA 3HK6B 1HAOH 1Z6EA 2R9PA 3FOAA 5EJZA 2BDIA 3H7OA 1IQIA 2PGBB 3U1JB 1FX0B 3SV7A 1JRTA 1G2LA 2TGPZ 3RXRA 1C1TA 3NKKA 2ZFSA 3ZIAD 3JZ2B 3MO9A 1DICA 1C5PA 1SQTA 3TPIZ 1O2IA 2J98A 1O39A 1SGYE 5EIYA 3GCHC 1IQNA 5LPRA 1BHXB 1AB9B 1MAXA 3KL6A 1SC8U 1EAWA 1SOTA 1QQ4A 2BB4A 1L0ZA 2DE9A 1A4WH 1EB2A 2R3YA 1ELAA 4Q80A 4DG4A 1CSOE 3MNBA 1QRZA 1FI8A 2Z9GA 1E36B 2H9HA 2LP6A 2W7UA 1Z7KA 2FI5E 4GCHF 4X8UH 4VGCB 3NCLA 4ABDA 1YPHC 2D8WA 5A8ZA 5F8TA 2FYQA 3U9AH 2ZA5A 3RXJA 3ZZ7A 2BY7X 4YOJA 1N6YA 1IQFA 2Z9IA 1GBMA 3QN7A 4DY7B 2Z7FE 2A45B 1DY9A 4WVPE 1LTOA 1FAXA 4BXWA 4XBDA 1FONA 1S83A 1D3PB 3EAJA 1IQMA 1NS3A 4YLUA 4OS5A 4IW4E 3ZZ6A 1B0FA 1GI8B 2G8TA 1H9HE 2W6JD 2A31A 4Q4LA 1VR1H 1W14U 1QJ6B 2H6MA 1QBOA 1VZQH 5EW2H 5GCHF 3M7UA 3TGKE 1C1RA 2PSXA 4P00A 1FMGA 2TGDA 1SR5C 3VEQB 3IITA 2F91A 3SI4H 1VCQA 1DUEA 3N7OA 3S9AA 1AI8H 5BPEA 1JXPA 4U2WA 3RM2H 3F68H 2ZGCA 2BOKA 4Y8ZA 2J34A 2Z94A 1WXRA 2LELA 2ZDVH 2BDYA 3VXEH 1EATA 2PKAA 3KEEA 1ZPCA 4TY7A 1O3GA 1NFWA 2OC7A 4TWYA 1F0SA 5T6GA 2UUYA 1ZLRA 1RIWC 4LZ4B 1MU8B 3ZZ8A 1KXEA 1TB6H 1SB1H 3LC5A 2F9OA 2HALA 5FX6A 1D3QB 2CGAA 1YPKH 1ZPBA 2OC0A 1G3EA 1LKAA 4D7GA 3RMNH 5HGGA 2ZGJA 3GOVB 1ZSJA 1O5GH 2UUKB 3UREA 8GCHG 3HPTB 2M5TA 1TABE 3W95A 3RXAA 3OTPA 1CGJE 4B2AA 3A86A 3A7VA 4DJZB 5E0HA 3RMOH 5EW1H 1C5SA 3N7DA 2OK5A 1W0JD 1MAYA 1LHGH 3HGPA 3WWFA 4D7FA 3P8OA 1OXGA 2P95A 5KGOA 4OS4A 3ZVBA 3PWBA 1XVMA 2J97A 1GBAA 4MQAA 2DE8A 4FUEA 1GJAB 1IQEA 2YMSC 3AAVA 3Q3XA 4XDEA 1GHZA 1ESBA 3AK5A 3UR9A 1WUNH 1CT4E 2G4UA 3RU4T 1BTYA 1UHBB 1WU1A 5JBCS 1BITA 3RC5A 1MBMA 3UQVA 1GMHF 1O3HA 3BTFE 4GHQA 5HYOA 1A3EH 1BHXF 1W0KD 3S7HB 1C1MA 2ZC9H 4X6MA 4OGYA 3SU3A 3TVJB 1WDIA 1VKYA 3DSPA 2P59A 4K8BA 2BD7A 1SGTA 2ALPA 3EE7A 1T8NA 3BG8A 1GBEA 4P02A 3P8GA 2PV9B 2XW9A 4BXSA 1S81A 6CHAB 4CHAB 2K0QA 4FU8A 1P3EA 1O2SA 5LPEA 3RXFA 3LGWA 2ZCLP 3GY2A 2V3MA 3DT0H 1TYNA 3F9GA 2W3KA 1EP6A 1WQSA 3GYMA 2VJ1A 3QDZB 3ESTA 1PPEE 1ZMNA 4NA8A 2WPDD 1YPHE 5G4BA 2QY0B 1HAHH 1LKBA 1LHEH 2VWMA 3DFJA 2ZQ2A 1QB6A 1W2KH 2G00A 1BMFD 3SUFA 3ZVAA 4CREA 1NTPA 1PPCE 3E1XB 3QO6A 4AX9H 3GY7A 2R2WU 1IHSH 2O8UA 5C1UA 1LCYA 4MNYA 4FXGH 3SNAA 2AGGX 1C5XB 1O2NA 3T26A 1ZTLA 1MTWA 2Z3DA 1A7SA 1C4V2 3D49H 3RMLH 1KSNA 5GPIB 4ISIH 4NWKA 1OP0A 1O35A 1KDQB 1ETTH 1NY22 3DFLA 4X1NU 5L2ZH 4Y6DA 3PLBA 1TIOA 1UK3A 2FTLE 4MLFB 3LPRA 4XFQA 2BD8A 2WZQA 4ZKRU 1SGIB 2GMTC 1QRXA 4I8JA 2RDLA 4ZAEA 3UNRA 1J17T 3CS7A 1GJ4H 1D3DB 3SUGA 3ZVCA 3DHKH 1C5UA 1UVTH 2FMJA 5EPYA 3MH7A 4B6FA 1P2QA 3NWUA 1PPGE 5TCAA 3MH5A 1NU9A 1FY3A 4ABIA 2F4LA 1XMNB 1N8OB 2DUCA 2G5VA 3A82A 5DP8A 3P8NA 3VB6A 3ZVEA 1K21H 1ELBA 1EJAA 2Y5GA 4F4OC 1T8OA 3ATWA 3TJUA 1J8AA 5HKKD 1ETRH 2BDBA 1Z8RA 5CE1A 1TX7A 2P8OC 3TIUA 2P16A 4NGAH 1QA7A 1OYQA 2OC8A 3LOXA 2ZFQH 4AN7A 2HNTE 1XVOA 1NRSH 3LDXH 2G51A 2XXLA 1DWCH 5DP6A 3B9FH 5EQQA 3DA9B 3EA8A 2ZHFH 4TT3D 1AWHB 3P8FA 4AC9A 3ZVDA 4YLQH 4E05H 4BANB 1AY6H 5A8XA 2P94A 1GDNA 1KXDA 3NXPA 1BOQA 3U28C 3ZYDA 4AYYB 1UCYK 4WMEA 2A7CA 3V0XA 3A7TA 3LGVA 4UFDH 3TNTA 1B7XB 4WF8A 5CMXH 4Y11E 2BZ6H 1AVGH 4IS5A 5E0GA 4YZUA 1EJNA 1TBZH 1INCA 1P2OA 1A1RA 3HKJB 4FUIA 4JK5A 3OFND 2O8LA 2W26A 6ESTA 1EFRD 1O3OA 1FUJA 3KHVA 3RLYH 2V3OH 1GMCF 1MCVA 4X6NA 2AH4X 1GG6C 4DT4A 4CRFA 4B71A 4ASUD 5CHAC 2EEKA 1KXAA 2BD2A 2V3HH 3EDXB 4ZCNA 5JDUB 1SL3A 5KEDA 1SGDE 5A2MH 2VIVA 3QTVH 3RXKA 4AYVB 4RKOB 4KTUA 1ZSKA 2PP6A 1O2UA 1VJ9U 3Q3YA 1V2ST 1IQKA 5AFZH 5JBAS 4OGXA 3GDSA 2BD3A 2VIWA 1FY8E 4HZHA 1C9TA 2GZ7A 3ATMA 1C5QA 2R0LA 1DANH 2L74A 4Y8XA 1GBTA 8LPRA 1C1PA 4X6PA 2STBE 4Q7YA 1GWAA 3B23B 4DURA 3PMHB 2W5EA 3BV9B 3LGUA 3H09A 4SGAE 2H2ZA 2SGDE 3UB0A 1F0RA 4TPIZ 1ESTA 2FLRH 2G4TA 2QF4A 3HATH 4ABHA 5EXNA 5LPFA 3Q3KA 3MU5A 1YC0A 1A5IA 2ULLA 5F03A 4B76A 1S0QA 3ENSB 1TBQH 4D9QA 1AE8H 1O5DH 1SLUB 3EA7A 5EJ1A 1GHYH 4NSVA 3K2UA 3VB3A 3SU1A 1Y5UT 2V0BA 4FU9A 1TX8A 1P57B 2HVXA 3EGKH 1YBWA 1TGBA 1GHAF 4ZH8A 1K28D 4MG3A 4CH2B 1SFIA 1Y3WA 2PW8H 1QBNA 1DPOA 5C5OA 1Y3UA 3PTNA 2FS9A 2QE7D 1XX9A 3G01A 1FY4A 3K6YA 1KY9A 1EZSC 3GY3A 1EX3A 2QXIA 4ISHH 3A8AA 1C5TA 3FZDA 3WWBA 2Z3CA 3ZZ4A 1YLNA 1P8VC 2WHXA 3FP8E 1NFXA 1HAYB 3QK1A 1V2JT 1TRNA 1ZOMA 2ZGHA 2FM2A 5F8ZA 3T27A 3MI4A 3A85A 4Y0YE 5HIZA 4ABJA 1SGRE 1CHOF 2AIPA 3QUMP 1SLXB 1EPTB 4NZLA 1G3BA 1NRRH 1V2KT 1JIRA 1TMBH 4NWLA 4INHA 5F6MA 1KTTB 3ZZ3A 4M7GA 1ZRBA 2JH5D 4XBCA 5F8XA 1V2LT 4MPXA 1PQ8A 3KQ5A 2Q6GA 2GVFA 1ZMJA 2J2UA 1C1NA 1FLEE 1A2CH 2TGTA 2A4OA 3HGNA 2ZGBH 4UONA 1W8BH 4X2XA 1HUTH 1Y59T 1SVPA 1THSH 8ESTE 3SHCH 3TJVA 1O3MA 2VNTA 4NZQA 5TCCA 1BRUP 4RKJB 4DOQA 3I77A 2PTNA 2VIQA 3FP7E 3RMMH 1LDTT 1GBLA 2HNTC 5FXLA 3MH4A 1AVWA 5DSFA 2PKSC 3M36A 3MO6A 2KZ4A 1YGCH 1KTSB 1N8OC 1TNGA 1AO5A 2VGCC 3I29A 4JCNA 4E7NA 1FDPA 1SGQE 1BRBE 1C5RA 1D3TB 1IHTH 2PR3A 5AF9H 2GDDA 3RXUA 8GCHF 5JB8S 1TA2A 5HM2A 1HJAB 1S84A 2BD9A 3S69A 4AB9A 4ZHAA 1TGTA 4LXBH 2YNBA 2ZPQA 4E06H 1BTZA 1TRYA 1Y3XA 3K9XB 1KIGH 4X1QU 5J4QA 2VVCA 2WINI 1FQ3A 1L1JA 1O32A 1WAYB 1YYY1 4I8GA 1OP8A 1JIMA 2FOBA 1ELFA 1P11E 5TJXA 1ZTJA 1QTFA 1S85A 1F0UA 1C5WB 1O2GH 3DUXH 4M9FA 1HNEE 1ELCA 1NM6A 1B0EA 2VH0A 3TU7H 2BQ6B 4X1SU 1C1QA 3MQKC 1H8DH 3A80A 1TPSA 1GJBB 4BOHA 2Y5FA 1EXFA 3URDA 1C2IA 1SLVB 4Q7ZA 5EXMA 1AFQB 2JETC 1GMDG 1KXFA 4AG1A 5FCKA 3VB5A 1HJAC 4IMZA 1AVXA 1C9PA 2ZU1A 4OM9A 1ZGIA 3RLWH 1GHWH 1MD7A 1IQLA 1NU7B 5EPNA 4AZ2B 4K69A 3VB7A 1LVMA 3QZQA 2O8WA 2B9LA 4D9RA 2ODQA 3M5NA 2HWLB 3ELAH 2Z9JA 2I6SA 3A84A 3FN8A 2RFKC 4I7YH 3ZV9A 1K1PA 2ZDAH 1UCYE 2EY4C 3SBKA 3SU0A 4Y0ZE 3RXIA 1UTPA 1V2WT 1Z8GA 4AFZA 1ZHRA 1DM4B 1NO9H 2BD4A 3MO3A 3GCOA 2SGEE 1KLTA 1GDQA 3MNXA 3E6PH 3TK6A 1TPPA 1GHXH 1ZYOA 1KLJH 1O5AB 1RXPA 3D65E 1CA0C 1J15A 3Q77A 1GMHG 4FUHA 2ZG0H 1O3BA 2VIOA 1Z6JH 2ZP0H 5FPYA 1TQ7B 4TY6A 1GL0E 1C2GA 1FY5A 1XUHA 1GI6A 1TA6A 4HI3A 3SOSA 1XM1A 1P02A 4LK4A 2OLGA 3SGAE 4AGKA 1GI9B 2XC5A 1SMFE 3MU8A 1V6DA 1THPB 3SNBA 2J9NA 1NFYA 1GI0A 1BZXE 4YOGA 3GY4A 3TK5A 3KYGA 3S0NA 2KFWA 2ZO3H 1BMNH 3CENA 1AUJA 4R8TB 1SOZA 3SGQE 3PO1B 1W0ZU 1J16A 4WJG2 4ZHLU 1P2IA 1GJ6A 2XBXA 4F49A 1BCUH 1C1OA 2GGVB 4ABGA 1AU8A 3KNXA 1QBVH 2GCTB 1C5OH 1EAUA 2GT8A 3SV2H 4B1TA 2QXJA 3PMJA 3U69H 2P3TB 7GCHF 4F55A 3OEHD 1AB9C 1GL1A 5JBTA 1ZHMA 1GBHA 2XRCA 4ACAA 2BOHB 3B8JA 4A7IB 2KAIA 3GICB 3N7EA 1VITF 4DVAU 2WSSD 2FOGA 4NFEA 1QGFA 1FV9A 1LMWB 2B7DH 4FVBA 1TGNA 1EASA 1OSSA 3TJOA 1ZPZA 4UDWH 3SJ9A 4YM9A 1O2ZA 5DG6A 3FANA 2KCYA 3P17H 3SO3A 1ELTA 2UUJB 2ZU2A 2ZFTA 4ZKSU 4ABEA 4ZUHA 5FBEA 2HPQH 1QL7A 1RD3B 5CHAB 1MKWH 2Y5HA 1EPTC 2QXGA 3V12A 2OQ5A 2CV3A 1MTSA 2ZDLA 3H5CB 3LT3A 5EG4A 2EI7A 3LGTA 1DX5M 4ESTE 3LU9B 3SV8A 2J98B 2ZCHP 2PTCE 3E0NB 3QLPH 1PPFE 3BTKE 2AFQB 4MVNA 2F83A 1P2NA 1QURH 1O2VA 1DLKB 1O2YA 1ABJH 3GS9A 4JK6A 1FPCH 2ALVA 1Q3XA 1TALA 2SGQE 4NA9H 1GCTB 5FL7D 2H1UA 2IJD1 1O3JA 2Z9LA 1K0HA 5DP4A 4RN6A 4JYTA 4WWYA 2AMQA 2WV5A 3WY8A 4TSFD 3CNRA 4INLA 5EQSA 3STJA 1BTHH 1GVLA 1P12E 1SGCA 3M3SA 2M2AA 1EQ9A 1TMUH 1WYKA 4WH6A 1HPGA 4FUDA 1ZJKA 1AMHA 3C27B 2RDEA 2R0KA 2SFAA 2F9PA 2XTTB 4U30A 1EUFA 3PROA 4CH8B 1O3EA 2NWNA 3PV4A 5C0TA 2BM2A 4NG9H 3W1EA 1W11U 2NU4E 3LKWA 4JZDH 4CR9A 3IG6B 2CK3D 4GUXA 3DSOA 1QJ1B 2FOFA 1ABIH 2FI4E 1QIXB 1H8HD 1SHYA 1LHDH 1XXDA 3ZVFA 3KQCA 4RI0A 1P01A 1XKBC 2KAIB 5DP7A 1JMOH 1W12U 2RCEA 2BQWB 1WV7H 2WV4A 3ZV8A 2BD5A 1ELVA 1C2KA 3UFAA 2O8MA 1T7CA 2I6QA 3ODFA 3EA9A 1OPHB 5BRRE 3LJOA 4OS2A 1XUJA 1HJ9A 2ZHWH 1IQJA 3TJNA 1CHGA 2EQNA 2IN2A 5AVDA 4FUGA 1AZZA 1GBCA 1TLDA 1GBFA 1CA0B 5HMAA 3RP2A 3PV2A 1EZUC 4DCDA 1QL9A 3SGBE 2OBQA 1M9UA 3RXEA 1SGPE 1C2EA 1EP5A 5DP5A 3MTYA 1BTPA 2Q6FA 3RXBA 1NRPH 2JETB 3T2NA 1OWEA 2A7JA 5ESTE 1HAVA 1AFEH 3RC6A 1V2VT 2WPMS 1L4ZA 2EI8A 3AVZA 4SGBE 1CU1A 3SI3H 3UNQA 1IAUA 2GZ9A 2AS9A 1H9IE 1EOJA 1LPZB 1GI5A 1TE0A 1W13U 2AYWA 2CXVA 2ZHEH 1T32A 1PJPA 3SJ8A 3P92A 2K8IA
chains in the Genus database with same CATH topology
1W10U 1CBWB 5AHGH 1DWDH 2FEQH 1BBRK 1CVWH 2QGRA 1NPMA 1BB0B 2FP7B 1RTLA 3L6PA 4OS6A 1GI4A 2ODYB 1WQVH 2J92A 1XUGA 1NFUA 2PHBA 5L6NH 4GSOA 8KME2 4WMDA 4FUFA 4Q2KA 1AKSB 3VXFH 4ISLA 4IMQA 2XWBI 2G55A 3GYLB 3P6ZB 1BMAA 2HNTF 1AIXH 2FX4A 1O0DH 1K1NA 5E2PA 1HIAB 4MNWA 5FHTA 1OYTH 4ZROA 4ISOA 1ARCA 1QY6A 2P3FH 1GJ5H 4FUJA 3FAOA 4J2YB 2GV6A 1C2JA 3SUDA 4Y79A 1E0FD 3PLKA 4CR5A 1UK2A 3SU5A 1HYLA 1O3IA 5GWZA 6LPRA 1O31A 1N1LA 1O2MA 3UIRA 4IGDA 3EE0B 4O03A 1O33A 1YPGH 1LVOA 2ZTZA 1B5GH 2D26C 1P04A 3GY5A 5DP9A 5DKMA 2WUBA 2BDAA 1P06A 2VWNA 1TBRH 3KCGH 1DE7H 1TFXA 1GMCG 1VGCC 1UTLM 3BTGE 1OX1A 3TH2H 3SNEA 1C2MA 5L2YH 3F6UH 4Y8YA 2A5AA 1O5BB 5AFYH 1YLDA 3TGJE 4BAOB 2FO9A 5LH8A 3AAUA 2BZAA 1EPTA 1PFXC 2FOHA 4JMYA 1O36A 3T5FH 4B2BA 3EYDA 4MPWA 1G3CA 2D2DA 2JKHA 1NN6A 9ESTA 3BIUH 4ZXXH 2BQ7B 4MNXA 3PLPA 2BDGA 5FPTA 3M35A 4I8HA 5J4SA 3H7TA 1AUTC 5GXPA 1O3KA 5DGJA 1C5LH 1EJMA 1YP9A 4JZFH 5DP3A 1C5YB 4I32A 2TRMA 1XUIA 1MQ6A 3KIDU 1BRCE 4R0IA 2GD4B 3BG4B 2FLBH 1LQDB 1TWXB 3O8CA 1UK4A 2BTCE 4CRGA 1GJ7B 1TQ0B 2A7HA 5FCRA 2BLQA 4CHAC 2Q1JA 2BX4A 2Y81A 3I78A 1FIWA 2P3UB 3FP6E 1O2HA 4I33A 1GBDA 1BRAA 3GISB 1HDTH 4CRCA 5A0BA 1V3XA 3SN8A 1CQQA 1C5VA 1GJDB 2Q6DA 1UVSH 1V2NT 1SBWA 4K1EA 1ZTKA 2B0FA 4JZEH 3ZYEA 4I8KA 1N6XA 4WMFA 2A1DB 1A0LA 1BA8B 3PWCA 3LC3A 3C1KA 1H9LB 2ESTE 3UY9A 2GZ8A 5C1XA 1GVKB 1UVPA 5E2OA 2V6NA 2GCTC 3BTME 5EU8A 4JZIA 1O3NA 1P09A 3UUZA 1DT2A 1O5CB 2HLCA 2FESH 1GG6B 2VB0A 1EKBB 3GCTG 2CN0H 3ZZAA 1DLEA 3A7ZA 2ZNKH 4X8VH 2V35A 3D23A 1K1MA 1Y8TA 1DWBH 2K1QA 3PMBB 5ABWA 3KGPA 1A5GH 4Y71A 3E16B 3AASA 5A8YA 5C5NA 4CBNA 1S82A 2SGFE 3RC4A 6GCHF 1SI5H 3SQHE 5I46H 3QTOH 1O3DA 1GCDA 4TYDA 4BAHB 3OSYA 4YOIA 3RXGA 4D76A 1C2DA 1P9SA 1T4VH 1YCPK 3Q00A 1Z8JB 2NU1E 2C8ZB 4X1PU 3E91A 1WTHD 2O9QA 1W3CA 1F92A 1WCZA 3A88A 3PB1E 2CHAB 3MH6A 2RA0A 1K1JA 3M61U 3TITA 4Y10E 1DITH 4DW2U 1P05A 3VB4A 3VGCC 2VIDA 5SGAE 1C2LA 4XBBA 4FVDA 3M7TA 3ITIA 3SUEA 1MD8A 1ZJDA 2BLVA 1HJ8A 1FIZA 1PYTC 2FX6A 3OU0A 4AFQA 2XCNA 3OY5U 1KLIH 1MKXK 1GJCB 3OTJE 4NIXA 5ESBA 1DFPA 4I8LA 2BHGA 4KTCA 3UPEA 1TNIA 4ZKOU 2A4GA 3UWIA 9LPRA 4VGCC 1V2RT 2YNAA 2G81E 1OWKA 1OS8A 2QIQA 2H5DA 4KTSA 3RU4D 2BDHA 2GCHG 1RRKA 1O5EH 2CF8H 2OUAA 1NESE 1MMJN 1P0SH 1QL8A 2WPHS 1BJUA 2XBYA 5JYIA 1O3CA 2FXRA 2PLXA 3L3TA 3Q76A 2A32A 1O2KA 1HXFH 4GLYA 1D4PB 3A89A 1CO7E 2ANWA 2XBWA 3SHAH 1CGIE 1A3BH 2BY9X 4ZHMU 2Y6TA 4BAQB 1QHRB 4Y7AA 3SV6A 4UFEH 1LVBA 1BT7A 4LZ1H 1UVUH 4O9VA 3ATIA 3UOPA 3GY8A 3SU2A 4JYUH 1VITH 1EZQA 5C1YA 1J14A 2QYIA 1AZ8A 1EB1H 3QGJA 1BMLA 1T4UH 2ZU4A 1C4U2 1G3DA 4A1VA 1Z1JA 1HAVB 2BVRH 2RG3A 1GGDB 1HAIH 1GHBG 1RS0A 1YCPM 1DDJA 5C20A 1QQUA 1MZAA 4RSPA 4AFUA 2PUQH 1F7ZA 2OD3B 3LONA 3SJKA 1MBQA 2FZZA 1T31A 5GDSH 2C8XB 1G32B 1GBKA 4NIVA 5LGOA 3ODDA 2ASUB 2Z6BD 2AIQA 1QB9A 5GCHG 2Z3EA 1SGFA 2FOMB 3TLOA 2ANYA 1ZRKA 1D6WA 4FUCA 2HOBA 1K1OA 1FZZA 1P10A 2LPRA 2ZDNA 3SORA 1MKWK 1UTNA 2BVXH 4UFFH 1MH0A 2WPIS 1H8IH 1SGNE 3RXLA 3R0FA 4AFSA 3QGNB 1ZMLA 1U6QA 1HV7A 1KDQA 4ABFA 3E8LA 2BDCA 2F3CE 1WBGB 4BAMB 1THRH 4JYVH 4ZMAH 1W7XH 1BBRE 2LNCA 2OTVA 2P93A 1ELEE 5K0HA 2AERH 4ABAA 4Q7XA 2TIOA 2OC1A 2VWOA 2STAE 1CHOG 2EI6A 3MFJA 5T6DA 4UFGH 1MQ5A 1ORFA 1O3AA 1C1UH 1TOCB 2OQUA 1YPLH 2ILNA 3KQBA 1GBBA 3UTUH 4A5TS 2Z9KA 1C5NH 1Z8IB 1SPJA 2AEIH 1HXEH 2IJOB 2ZIQH 1WOFA 2NU2E 1LVYA 1YKTA 4GVUA 1QFKH 4AB8A 1AHTH 4PROA 1BDAA 1DS2E 1Y5BT 1Z71A 1HLTH 4XE4A 3V7TA 2QAAA 4GCHG 3BSQA 2C8WB 1BQYA 1UO6A 3MU0A 3GDVA 1VCPA 3A7WA 3RDZA 1UTKA 2ANMH 1TRMA 1LPGB 1CGHA 3HKIB 4K5ZA 1L2EA 3LGYA 5FPSA 2PWXA 1T8LA 1BBRH 3TNSA 5GJ4B 5FBIA 2R2MB 4Y7BA 3A83A 2ZWLH 2ZGXH 4H42U 1G36A 1K22H 1A0HB 1NRNH 3LH1A 3PMAB 4WY3A 1A61H 3FZZA 3W94A 1O34A 5K7RA 5A0AE 1FAKH 1UTJA 1RTKA 1TONA 4GAWA 1PPZA 1CT0E 1Y5AT 1MZDA 1TOMH 1SHHB 3RXVA 2PSYA 3U98H 2A4QA 2GV7A 3BTWE 4KP0A 2C93B 2PGQB 1SQOA 3UR6A 1FN6A 1H4WA 1FPHH 1K2I1 2ZFRH 1KXCA 1C1WH 4YO9A 3O8BA 5JBBS 2XWAA 2ZPSA 3BEIB 3MHWU 2FODA 2A2XH 3M7QA 3VGCB 1GHVH 3CP7A 1CT2E 3QWCH 4NIWA 2FOEA 2AMPA 1PYTD 1EZXC 2ZKSA 2H9TH 5T6FA 2BY5X 3SV9A 1F2SE 1O38A 5EGMA 2C3SA 2QF3A 2GKVE 3NUMA 3LJJA 1TGCA 2QV1A 1L1NA 3BEUA 2XYAA 1MTVA 1RTFB 5C2ZA 4TWWA 4B73A 2A5IA 1AE5A 1WSSH 2GTBA 1K1IA 3O8RA 3OX7U 1AFQC 1C2HA 3AW1A 1D9IA 2OXSA 2BX3A 3SNDA 1AQ7A 2UWPA 1IQGA 2VVUA 1KXBA 3IWMA 3V3MA 2PKAB 1T8MA 1LPKB 1OWIA 3MU1A 3M3VA 4D8NA 1C4Y2 1GBIA 2A0QB 2AGEX 2FTMA 2P8OB 2UWLA 1VJAU 3LH3A 2FPZA 1CA8B 1LO6A 4NIYA 5GIBA 3GCHB 4DGJA 3LGIA 2F9NA 2ZCKP 3KN2A 1DXPA 1HGTH 1E38B 4KKDA 1GGDC 1TNKA 5A09A 1ANBA 2ZF0H 4BTUB 4ABBA 3ZZDA 3MWIU 4HFPB 2BYAX 3F1SB 3KQDA 1UCYH 2UWOA 5JB9S 4GPGA 2FS8A 5IYTA 1XKAC 1O2QA 3U1IB 4AOQA 3S9CA 1BTWA 1LQEA 1ELDE 3M5LA 3ZZ9A 4A6LA 1CE5A 1W0YH 2ZFPH 1Z1IA 3PYHA 2WYJA 4U32A 3SW2B 1ANDA 1EOLA 5DO4H 3M3TA 2CHAC 1AWFH 2WPJS 3MYWA 1GHAG 3T28A 2QA9E 1JRSA 3QZRA 5E8EH 3MNSA 2PKSB 2HGTH 2VU8E 2R3UA 1DOJA 1H1BA 4JZ1A 1AN1E 1A0JA 2JH0D 3RXOA 4MPVA 1F5KU 5HXFA 1OKXA 1GBJA 1ZR0A 1O2JA 3BF6H 1G37A 4X6OA 1BTXA 1V2QT 1C2FA 1TX6A 1A5HA 1S5SA 2BVSH 1XUKA 1JBUH 1C1VH 4K60A 1ID5H 4H6SB 4DIIH 5EQRA 4INKA 1GJ8B 1TNJA 1GJ9B 1P2KA 1FNIA 1OWJA 2CF9H 4MDSA 1DWEH 1HAZB 4HTCH 5E0JA 1HCGA 1QNJA 2BY6X 2OINA 4AG2A 2G5NA 3A81A 1IOEA 1YCPH 2XC4A 2YOLA 1ZZZA 1MTNB 3RU4E 1YPMH 4O3TA 1ACBE 4E7RG 2ZZUH 2FI3E 3UNSA 5DK1A 1S0RA 2B5TB 2AGIX 1TPAE 3T29A 1OOKB 2J94A 2BLOA 2RA3A 1J9CH 1LHFH 2BXUH 4H6TA 2NU3E 2QCYA 1HAXB 3A87A 1RGQA 1RIWB 3BTDE 1GHBF 2SNWA 3SQEE 2ZU5A 1RFNA 2QXHA 4J1YA 4TPYA 4X2VA 2G52A 4YESB 1K9OE 1O3LA 2BMGB 1TNHA 4O97A 4AORA 1O5FH 4IC5A 1QJ7B 3BTTE 4B74A 2FOAA 3RXCA 2VWLA 4NA7A 2PFEA 5HM9A 2C4FH 1TGSZ 4UEHH 2FDAA 2AMDA 2J95A 2XBVA 2VH6A 1JWTA 4Z0KA 2F9BH 1GMDF 1ESAA 2Y82A 3AW0A 1DXWA 1X7AC 4THNH 1SQAA 1PQ5A 4LOYH 1MTNC 1L4DA 1P9UA 3PM3A 2SGAA 1CBWC 3A8CA 2A2QH 1GCTC 3RXPA 1PPHE 3F9EA 4ASHA 3P95A 3A8DA 4XOJA 1ANEA 1GI1A 2WYGA 6CHAC 1SLWB 4B2CA 2QF0A 3L33A 7GCHG 1FJSA 4FU7A 1O3FA 3RXMA 2EA3A 3GY6A 4BNRA 3RM0H 3MOCA 4Y76A 1C5ZB 4GHTA 7ESTE 2XCFA 2HPPH 2J38A 3BTEE 2Y7XA 3A7YA 3URCA 1P3CA 4BTIB 1NZQH 4AGJA 2ODPA 2GP9B 5FAHA 5IDKA 3V13A 4IN1A 1AKSA 2B8OH 1BTUA 2FWWA 1PQ7A 3OY6U 4H4FA 4KGAA 3CS0A 2ZFFH 3K65B 4UD9H 4DIHH 5B6OA 3S9BA 1ZGVA 1UTQA 1S6HA 3PO1C 1E34B 3QX5H 2ZEBA 1XXFA 3M5OA 1E35B 3JZ1B 1AD8H 1E37B 3BTHE 3E0PB 3SU6A 1BJVA 3GCNA 3BN9A 3HK3B 4CRAA 1AGJA 3KQEA 3R3GB 1FN8A 2ZU3A 5A0CA 1HAGE 4CRDA 1O2WA 1V2MT 3SZNA 1DY8A 1VGCB 4YT6H 1V2TT 1SGFG 1MKXH 1YM0A 4ZXYH 2TGAA 4O3UA 1BUIA 5C67A 5PTPA 2D1JA 2ZECA 4YT7H 2QC2A 3GCTF 4X2YA 3STIA 1Y3YA 2WPLS 4K1SA 4MPUA 3P70B 2IOTA 2F9UA 1C5MD 2GT7A 1LHCH 4KELA 1P2MA 1QCPA 4X1RU 2WPKS 4U01A 3SJOA 1UTOA 1YPJH 4WXVA 1NROH 6GCHG 2H5CA 1BMMH 2CMYA 2ZDKA 4Z6AH 2UUFB 1IQHA 1FXYA 1TNLA 1VCWA 1SG8B 2H9EH 3VPKA 1ANCA 3U8OH 1G9IE 1F0TA 5I25A 4IBLH 4K8YA 5ETXA 3K6ZA 5EOKA 3SNCA 1Q31A 5C3NA 3F9HA 1D6RA 3ZZCA 2F9VA 2O8TA 3RXTA 3S7KB 1ZSLA 1NT1A 2VINA 4UE7H 3PTBA 1UMAH 4NSYA 3DD2H 4OS1A 1SSXA 4A92A 2XNIA 1DSTA 2W7SA 2Y80A 3U8TH 3TH3H 1P03A 4IN2A 3TH4H 1ETSH 4XSKU 2VVVA 2ZDMA 1HB0B 4NFFA 3NK8A 3FFGA 1MCTA 3RUOA 3D62A 1DVAH 1UJ1A 5H4IB 1G30B 2FOCA 1GDUA 3ZZ5A 1O2XA 1SFQB 1O3PB 1PPBH 4DT7B 1O2PA 3U8RH 3RXHA 2C90B 3M37A 4HGCA 3MU4A 1C1SA 1NRQH 1ELGA 1OP2A 5EODA 3E90B 2C8YB 3A8BA 2OCVB 1HFDA 1JOUB 2ZHDA 1GI7B 3UWJH 4CBOA 2SNVA 1TPOA 3TK9A 1HRTH 2FIRH 2TPIZ 2EC9H 3OYPA 1YPEH 3MNCA 1O37A 2PUXB 3BIVH 3T25A 2QN5T 7LPRA 1HIAA 1KYNA 1O2LA 4X8SH 1ZHPA 3RXSA 4B75A 1YLCA 4OS7A 2OBOA 7KMEH 4BAKB 1VITG 3FVFB 4X0WU 1GVZA 2VGCB 3UOUA 2ZTYA 2HRVA 4FUBA 1F5RA 1Q2WA 1NC6A 3T62A 1O2OA 2ANKH 2W3IA 5JPMH 4BTTB 4CRBA 1TAWA 3ZZBA 1S6FA 4WH8A 1GPZA 1O2TA 3ATLA 1BIOA 1EAIA 3ZVGA 3RXDA 3SJIA 1V2OT 2A4RA 2IPHA 3SU4A 1G2MA 4ISNA 4WXIA 2THFB 3E3TA 3F9FA 1HBTH 1PQAA 1YF4A 2TBSA 3BG4C 3VFEA 3GDUA 4I31A 4X2WA 2BY8X 1OWDA 1UTMA 2CJIA 3O8DA 1O2RA 2BLWA 1EAXA 3MMGA 1DSUA 4MNVA 4ZKNU 1QA0A 3A7XA 5FX5A 2ZHQH 2SGPE 2GDEH 4QT8C 2Y7ZA 2GMTB 4K1TA 3BEFB 3BTQE 3NZIA 4NCYA 1MTUA 5T3HA 1O30A 3ATKA 1P2JA 1DUAA 5L30H 2NU0E 1RJXB 2GCHF 4IC6A