4DKLA

Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
442
structure length
442
Chain Sequence
MVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLKSVRNIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the {mu}-opioid receptor bound to a morphinan antagonist.
pubmed doi rcsb
molecule keywords Mu-type opioid receptor, lysozyme chimera
molecule tags Signaling protein/antagonist
source organism Mus musculus
total genus 160
structure length 442
sequence length 442
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 4dklA02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 4dklA01
1C67A 3UONA 1C65A 247LA 168LA 1K28A 3HTGA 5DHHA 5G2AA 3S3DB 4EKSA 1OVHA 2OU8A 3FA0A 4LDLA 3QBGA 1UCQA 2L78A 3OE9A 1SX7A 1G07A 1L17A 4W59A 4ARMB 2WJKA 3DN1A 2PEDA 1G1WA 1C61A 2OU9A 3VI0A 3HAOA 3QJSB 1KNIA 1F4ZA 2F93A 4L35A 2F32A 3DN8A 1C6PA 1CV0A 2RBRA 4FBZA 1L24A 5AZDA 5EN0A 170LA 1G0LA 1IXFA 3S3BB 1OYUA 4FPDA 1L35A 1L88A 4TL3A 4AMJA 1L03A 1LYJA 229LA 2JAFA 3HTFA 1DYBA 222LA 119LA 2Y04A 3KJ6A 3V2WA 1G0PA 4N4YB 3L64A 1C8SA 1C64A 1PQIA 1L50A 1L52A 1S52A 3VG9A 4WAVA 2RB2X 5JJJA 1C6KA 1L73A 114LA 4W58A 1L12A 1C6BA 223LA 1L42A 4I7RA 4QIDA 2AT9A 2ZZLA 3QDCA 2Q9EA 174LA 1C6HA 1D2YA 2B74A 1LN6A 2KSBA 3PWHA 4G72B 4JR8A 1L19A 3L2XA 1L0JA 5H2JA 1P56A 4W55A 3C8QA 3NYAA 1L06A 1C6LA 1LYFA 220LA 2HUMA 1ZURA 4GRVA 1LW9A 1L71A 2HUKA 4I7SA 1PQKA 1L81A 3JR6A 2RBOA 118LA 1C6DA 5LZMA 1P36A 2B75A 3OE8A 145LA 5BR2A 1CV6A 1D3FA 1QS9A 3DN3A 4MQTA 227LA 3RZEA 218LA 162LA 2B73A 4UG2A 1DYGA 230LA 1DYCA 3UTXA 5AX1A 188LA 261LA 1M0MA 2KSYA 1L0MA 1OWZA 3EH3B 3PQRA 3PDSA 3HU9A 3HT7A 3GUIA 1L99A 3SN6R 3QJRB 4PXFA 2KSAA 4S0WA 1QT5A 4FA7B 2LZMA 1T8AA 1KG9A 182LA 4BV0A 3SB8A 2YCZA 4GPOA 1PQMA 1LI2A 1L37A 1L39A 2R4SA 3GUNA 3BVDB 238LA 4OO9A 2OU0X 4EXMA 3C9LA 3X3BA 2O4WA 3SBBC 5H2PA 1L83A 5H2MA 258LA 4G70B 4N4WA 4X32A 2BRDA 185LA 1CV1A 1L26A 1C60A 3HU8A 5ITCA 1L94A 2NTUA 157LA 3C9MA 1C6EA 1P8UA 3OAXA 2ANXA 4GYCA 1L05A 1I6SA 4XTLA 4EKQA 2IGCA 3HAQA 2F47A 4EKPA 1TLAA 1U19A 5H2NA 1CX6A 4W56A 197LA 1VJMA 5BR5A 4BVNA 144LA 1L22A 4KNFA 3C83A 1SSYA 4N6HA 245LA 1X0I1 5G28A 3QJQB 3HARA 2WJLA 2QPDB 244LA 1L0KA 2RB1X 4W57A 3FI5A 4XTNA 5B2NA 3UTVA 1L64A 125LA 1C6TA 1NHBA 1PQOA 1PQDA 2ZIYA 109LA 1L36A 5G36A 3ZEVA 4BEZA 2Y02A 1FBKA 148LE 1L74A 1L98A 1L30A 1XMEB 2NTHA 1G0QA 1UAZA 1C3WA 4XTOA 3ABWA 4I7MA 262LA 1LGXA 2QARC 3DNAA 3A7KA 1L45A 1X0K1 1L38A 1LPYA 1P2LA 177LA 5G54A 3REYA 3QJUB 5AWZA 191LA 3C8SA 1CU2A 254LA 1QTZA 5B6ZA 137LA 239LA 3PBLA 4Y9HA 212LA 1C6IA 224LA 1L55A 1L61A 1JGJA 1LGUA 1LWGA 4JQ6A 5AX0A 1X0SA 2RB0X 2O79A 1L97A 2I20A 3SB6A 4W52A 4MQSA 4I7TA 217LA 2RBQA 3C8RA 104LA 1L90A 215LA 173LA 178LA 2QPEB 2B72A 1CU5A 4W53A 175LA 1D3MA 163LA 1KY0A 234LA 1P37A 1LYDA 2ZFEA 2LC9A 3UZAA 4BUOA 4HYJA 216LA 5A8EA 1L72A 1CWQA 4FAAB 113LA 4AQNA 1QS5A 3T45A 126LA 1QSBA 3C7ZA 200LA 1KGBA 1L9HA 1T97A 2YDOA 5AHZA 1D2WA 4I7KA 4EIYA 4ARQB 2OE9X 1G06A 1P46A 3HUAA 3LZMA 1MGYA 3CDOA 1C63A 176LA 3RFMA 1LYIA 2QB0B 5TGZA 4G7SB 3HH6A 1G1VA 3SBAA 1JTMA 3HT6A 1C66A 1L77A 211LA 1QM8A 4ARMA 1L41A 2I21A 5I14A 233LA 1LWKA 150LA 4YXAC 1L51A 1L58A 252LA 3P0GA 1L13A 1CX7A 1KS3A 151LA 2B6XA 225LA 1TN5A 213LA 3DQBA 1QTDA 1AP9A 4GP8B 3CDTA 195LA 1L80A 3NY8A 3UG9A 3HH4A 242LA 2X72A 3QAKA 4I7NA 4IAQA 1L44A 3AYMA 5AHYA 5C1MA 2RAZX 1E12A 1L84A 3DDLA 3F9LA 1H68A 1L29A 257LA 1T8GA 3X3CA 4ARQA 4E97A 189LA 2B6YA 1L75A 1L82A 1B6IA 2G87A 3OE6A 3QBKA 3GUJA 1L08A 111LA 2F2QA 3QBLA 1L48A 1QTVA 1C6MA 3C81A 1CV3A 5A45A 1L87A 1L15A 3EH5B 1L93A 102LA 1QTHA 1GZMA 1L49A 210LA 201LA 2O7AA 246LA 4XT3A 5ETZA 2M3GA 1P6YA 4GP4B 1C6JA 1L28A 4IARA 3C7WA 5H2LA 158LA 1QT4A 5B34A 1G0JA 5B6WA 1L57A 2B7XA 3C7YA 1QKOA 1L34A 5H2OA 253LA 4QRYA 3CODA 1C6CA 3DMXA 3HDEA 3HUKA 4MD1A 5H2KA 143LA 256LA 3CDRA 3DN2A 1L10A 4I7OA 1JV6A 1GU8A 1BRRA 159LA 1PQJA 3DN6A 2YDVA 3S3CB 166LA 1JFPA 1L70A 3DN4A 127LA 160LA 1C6FA 5G53A 3G3XA 3PXOA 1L96A 1GUEA 4G71B 1L66A 1QTCA 260LA 131LA 1L01A 3VGAA 5JJNA 3C80A 4YXCA 112LA 1L33A 1BM1A 1L62A 1KG8A 5JJEA 235LA 1L85A 161LA 1O0AA 2YCXA 3FADA 4JKVA 187LA 1QT3A 1R2NA 2OTYX 1BRDA 5ITEA 2NTGA 1SWZA 115LA 129LA 1QUGA 3CAPA 2OEAX 1L65A 3QAPA 180LA 1G0GA 3UTWA 1P8IA 1QTBA 3F8VA 3K2RA 1S8JA 2VT4A 3HWLA 1L32A 146LA 4I7PA 3S8FB 3WQJA 4IB4A 4EJ4A 3DMZA 4BEYA 3RUNA 5A44A 4IAPA 3QJTB 1S51A 2HPYA 3HASA 1P7SA 2Z73A 3HUQA 1L86A 3GUOA 2ANVA 4ARLA 2NTWA 1DYAA 3G3WA 167LA 1C6QA 192LA 4ARPA 4LDOA 1L56A 5KKHA 3UTYA 1D9WA 3VW7A 3OE0A 4PK0A 1C69A 205LA 3GULA 155LA 3GUMA 5B0WA 1IW9A 1M0KA 231LA 3ODUA 1L95A 3SB5A 4HWLA 1L20A 3D4SA 4X1HA 1L40A 241LA 1PY6A 1CU3A 1L47A 3NS0A 1G0KA 221LA 4XT1A 4L6RA 2J4YA 4ZPUA 3HH5A 236LA 259LA 130LA 1WTHA 2RAYX 1P8HA 2LNLA 1L18A 3G3VA 120LA 4GBRB 3NSBA 196LA 1L02A 3CDQA 1D3NA 3NY9A 3V2YA 1SSWA 2YCYA 1S8LA 3MBVA 4AMIA 1P64A 1DYDA 1Q5JA 1CVKA 1L60A 1QSQA 1DYFA 1SX2A 1H2SA 1L11A 1L68A 1L63A 139LA 1CU6A 1CUQA 1LYHA 3HANA 1LGWA 214LA 4G7QB 1S53A 1L91A 1ZWNA 1L76A 5B6VA 219LA 4QI1A 237LA 1L07A 1QT7A 4KLYA 2Y03A 164LA 4W51A 1L79A 123LA 4WW3A 1QUOA 4NC3A 3VVKA 149LA 1E0PA 1EHKB 1OVKA 1L04A 3QJVB 4XXJA 5B35A 184LA 152LA 165LA 3EMLA 206LA 1XEPA 4I7QA 1XIOA 1L59A 5H2IA 172LA 181LA 2B6ZA 2Y01A 3UZCA 1L54A 4EPFA 4EKRA 4GBRA 2Z55A 4LZMA 2EI4A 4DKLA 3HTDA 1QKPA 1XJTA 5H2HA 3HH3A 1KMEA 1CUPA 1C6GA 1EPYA 1LI6A 4K5YA 142LA 251LA 255LA 4OV0A 1F88A 4I7JA 3SB7A 1OV5A 2F95A 1L46A 1QT6A 3HT9A 4UHRA 3ZPQA 1L14A 3VHZA 190LA 186LA 1VGOA 1L09A 3HTBA 4HYXA 1HZXA 1QHJA 243LA 2OE4X 1CU0A 1L53A 1L00A 122LA 5B6YA 3HDFA 1DZEA 1L92A 108LA 250LA 183LA 1CV4A 1DYEA 1C68A 2RBPA 1S54A 147LA 1QUDA 2I35A 2YCWA 171LA 4GP5B 1C6AA 1P2RA 1L21A 4EPIA 2KS9A 1CTWA 1L31A 2R4RA 1JQUA 1L43A 1L27A 1L89A 4EA3A 7LZMA 2Z6BA 226LA 3C82A 2B6WA 2RBNA 3DN0A 1L25A 5FJGA 156LA 5F8UA 1T8FA 1LLHA 1D3JA 4I7LA 4PXKA 1SWYA 4G7RB 3DKEX 1M0LA 138LA 228LA 3COCA 209LA 199LA 3GUKA 107LA 1KW5A 2A4TA 2OE7X 4DAJA 1PXRA 1C6NA 1XJUA 5DHGA 3CDVA 1KY1A 103LA 2OTZX 1BRXA 1L67A 249LA 1C8RA 4X31A 3EH4B 4YX7C 3ZPRA 5G2CA 4DJHA 1F50A 1L23A 2CUUA 1CV5A 1AT9A 4W54A 3AYNA 1LI3A 4MBSA 5B6XA 1R84A 2HULA 1C62A 2RH1A 1QT8A 2Y00A 1JTNA 1XJIA 2I1XA 5DYSA 1L16A 4BWBA 1KW7A 169LA 1T6HA 3GUPA 2B6TA 3QBIA 128LA 1OWYA 232LA 3SB9A 1Q5IA 248LA 110LA 2JAGA 2L6XA 198LA 6LZMA 5LWEA 1P3NA 4LDEA 1QUHA 2B70A 2LCBA 1TN0A 1LYGA 4PJZA 1ZYTA 2Q9DA 1FBBA 3AM6A 3HAPA 1OVJA 4ARJA 2RBSA 240LA 3DMVA 1IW6A 1G0MA 1OV7A 3HT8A 140LA 1L69A 4J4QA 5J7AA 4A4MA 141LA 3S8GB 1JV7A 5G2DA 1P5CA 1LYEA 4MD2A 1PXSA
chains in the Genus database with same CATH superfamily
1IO5A 247LA 3HTGA 2FYDA 1OVHA 2OU8A 3A91A 2D4JA 2XBRA 1VATA 1LSFA 2OU9A 4L35A 1KNIA 3AW7A 2F32A 3RZ4A 1C6PA 4IASA 1IXFA 2A7DA 1GE2A 1T3PA 1GFRA 2FBDA 1L03A 4NEBA 2Y04A 222LA 119LA 5B1GA 3KJ6A 3V2WA 1OP9B 3WPKA 2DQHY 5KXMA 1C8SA 4DYGA 2YBJA 3VG9A 5JJJA 2RB2X 4WG7A 5L3HA 4OWEA 2AT9A 3QDCA 2Q9EA 4G72B 3PWHA 1DPXA 3TXGA 1IC4Y 1L19A 1D0KA 1P56A 1CNSA 5HMVA 6LYTA 1TDYA 1LHMA 2CDSA 3WXUA 1ZURA 4GRVA 4QY9A 1L81A 2RBOA 1C10A 2I25L 145LA 5BR2A 3DN3A 4UG2A 1OQMA 1DXJA 261LA 4HJYA 2BQAA 5B59A 4DC4A 5KXKA 3HT7A 3SN6R 1QSAA 4FA7B 1IR7A 1T8AA 4DD9A 2B5ZA 1PQMA 4MCKA 1LI2A 1L37A 2R4SA 2DQCY 2ZYCA 3K3TA 3C9LA 1I20A 5F16A 3SBBC 3W6AA 4G70B 4N4WA 1CV1A 1C60A 1RCMA 1C6EA 3OAXA 4GYCA 1L05A 1I6SA 4EKQA 3HAQA 4EKPA 2W1LA 3AZ5A 5H2NA 5LYTA 1VJMA 5BR5A 4BVNA 2BQEA 3FI7A 1D6PA 1F0WA 245LA 5G28A 3HARA 2WJLA 244LA 4W57A 3WVXA 2Z38A 1IR8A 4Z98A 1RI8B 1C6TA 4B4EA 1NHBA 1PQOA 1IP5A 4C5FA 3A34A 4ET9A 1UACY 1IWWA 1L98A 1L30A 4WM5A 2EKSC 2NTHA 1UAZA 1KIRC 1OUEA 4XTOA 3ABWA 2QARC 3DNAA 1L45A 1X0K1 4H93A 4PJ2C 1HHLA 191LA 3C8SA 254LA 3E3DA 1GF5A 4Y9HA 212LA 1C6IA 3TXKA 1L61A 4H8ZA 1GBWA 2GV0A 1LAAA 4I7TA 217LA 1T6VL 2ZQ4A 1IOQA 1LYDA 2LC9A 4BUOA 1GBXA 1L72A 1QTKA 4N0JA 4FAAB 1LJGA 1L9HA 4D9ZA 2OE9X 1P46A 1MGYA 3CDOA 1LCNA 1LYIA 2QB0B 2VB1A 3CSQA 4G7SB 1LSZA 1G1VA 1JTMA 5B1FA 1L77A 211LA 3AW6A 4J7VA 2I21A 1L41A 5F9UA 1GBZA 1REYA 1L58A 1AZFA 5KKIA 1C43A 3HFMY 2LZTA 1AP9A 4GP8B 4HP0A 1L80A 1V7TA 3A93A 3UG9A 3AYMA 5AHYA 5T3FA 1E12A 1L29A 3WPJA 4HSFA 1NQIA 1LSNA 2H9KA 189LA 1LMPA 4DS7E 1KXWA 1L75A 4RW1A 1B6IA 1L08A 2ZQ3A 2F2QA 3IJUA 1C6MA 1CV3A 4G4BA 5LAGA 102LA 1L93A 4BADA 201LA 3GXKA 4B1AA 1C6JA 1L28A 3C7WA 158LA 4GN5C 5LA8A 1L57A 4DD7A 3C7YA 1L34A 253LA 4H9IA 4QRYA 3CODA 1C7PA 3DMXA 3AGIA 143LA 256LA 4Z3MA 2YDVA 5IELA 3S3CB 5DL9A 1C6FA 4NG1A 1IP6A 1L66A 4ETAA 3C80A 4DD3A 1IORA 4GCBA 2ZWBA 1O0AA 2YCXA 3FADA 4JKVA 187LA 5KY1A 3W3EA 1SWZA 1OUCA 4TWSA 4HTQA 5LYMA 3P68A 3LZTA 3HWLA 146LA 1OUDA 5FELA 3WQJA 1LMCA 2Z39A 5A44A 3QJTB 2MEEA 3EO5A 1JISA 3TMUA 3GUOA 1G7HC 167LA 1C6QA 3ATOA 4ARPA 4NSGA 4LDOA 2MEIA 5KXRA 1JSEA 4WM6A 4H90A 1IOCA 1JJ1A 4WOAA 3BKHA 205LA 3GULA 3GUMA 1JHLA 5B0WA 1IX0A 2HU1A 1WQMA 1LOZA 4HWLA 1PY6A 1L47A 4L6RA 3TXDA 3HBDA 2J4YA 130LA 1IY4A 1HMKA 1P8HA 1L18A 3G3VA 5B06A 196LA 1L02A 3MBVA 5ILFA 2DQIY 1A2YC 1UA6Y 1L60A 1H2SA 1CU6A 4GCEA 3HANA 214LA 5HNCA 1NBYC 1B5UA 2MEHA 5B6VA 1FN5A 4QI1A 1QT7A 1L79A 1BWJA 1F6RA 4XJFA 1EHKB 3QJVB 206LA 3G3AB 2Y01A 4EPFA 1CKGA 3AJNA 3HTDA 1IVMA 4WO9A 3HH3A 4DDCA 4K5YA 142LA 255LA 3CT5A 5IDDA 5J7CA 1C46A 2X0AA 1L14A 1WVVA 5A3ZA 1IWZA 1CU0A 1IOTA 1DZEA 4XADA 1CV4A 1C68A 171LA 1L21A 1QIOA 5I5QA 1CTWA 2Y8PA 2B6WA 3DN0A 1L25A 5LVJA 5F8UA 1T8FA 1D3JA 4I7LA 1UBZA 4N5RA 138LA 4XYYA 3AGGG 199LA 3CDVA 1TEWA 2AUBA 2OTZX 4J0LA 1BRXA 1GEZA 4YX7C 5G2CA 4WL7A 5LYZA 4DD0A 3AYNA 1GF4A 4ML7A 4XN6A 1L16A 1T6HA 1OUBA 3WU7A 2B6TA 128LA 2BQNA 1Q5IA 110LA 135LA 1HFZA 1VEDA 3A96A 5LWEA 4AXTA 2BQFA 3ZEKA 3A67Y 4J1BA 4PJZA 3TMXA 4H92A 1YAQA 2BLYA 5J7AA 3A6CY 5G2DA 1D0MA 3WUNA 5F9XA 1UC0A 3FA0A 153LA 1UCQA 2L78A 3OE9A 2WJKA 3WW6A 2PEDA 4WMGA 3A3RX 2F93A 1B7OA 5EN0A 1LJJA 4WL6A 4FPDA 1CJ8A 4AMJA 1BVKC 1XFPL 2YDGA 1UIEA 1JJ0A 4PGJB 5KXLA 1LSBA 1PQIA 1L50A 1TBYA 4H94A 3A8ZA 114LA 223LA 2BAAA 4I7RA 1C6HA 2B74A 4G9SA 1YL0X 4LYTA 4B0DA 4NHIA 3C8QA 1HSWA 3TXHA 1QUTA 1L06A 2F4AA 220LA 1JKDA 1YAPA 3ATNA 2HUMA 4H91A 1AT5A 4UWNA 1L71A 3RNXA 3JR6A 1DI5A 1C6DA 1LJKA 3OE8A 1XEIA 4I0CA 1QSWA 5C6IA 1CV6A 1D3FA 2BQKA 4HPIA 227LA 3RZEA 218LA 2B73A 1LJ3A 1DYGA 4WLTA 3OJPA 3UTXA 207LA 2F4GA 1M0MA 1RE2A 3EH3B 3PQRA 3HU9A 3S3DB 3QJRB 4S0WA 1QT5A 1B5WA 1W6ZA 2Z18A 182LA 4GPOA 3GUNA 2HEBA 1VFBC 2HTXA 4EXMA 3X3BA 1LSEA 2D6BA 2O4WA 4N1CC 5H2MA 1HEPA 2BRDA 185LA 4LT2A 1L94A 5KJ9A 1LJIA 1G7IC 1U19A 1CX6A 144LA 3C83A 1EQEA 4N6HA 1GBSA 3AZ6A 2EPEA 3WXTA 2RB1X 1NMMA 4ETEA 3CT1A 1LSAA 1MELL 2HU3A 125LA 1PQDA 2ZIYA 3OK0A 109LA 5G36A 3ZEVA 1FBKA 148LE 1L74A 1YAOA 1QUSA 208LA 1IP2A 3QNGA 4N8ZA 1G0QA 1CKFA 1DPWA 1LZRA 2C8OA 3WULA 1F6SA 5KXWA 5DM9A 3A7KA 1L38A 1LPYA 3WL2A 5G54A 3QJUB 4M6DA 5AWZA 1CU2A 1QTZA 3PBLA 4W96A 4KT3A 1L55A 2D4KA 1GF6A 1LGUA 4ZEEA 2O79A 1L97A 4YF2A 1DI4A 3IJVA 1G7JC 215LA 5KXTA 178LA 4QEQA 1XGQC 2ZFEA 3CQLA 4HYJA 216LA 1OUHA 1CWQA 113LA 3T45A 1QS5A 126LA 1QSBA 3C7ZA 1GAYA 4EMNA 1RJCB 4ARQB 1G06A 7LYZA 176LA 3RFMA 2BQIA 3SBAA 1AT6A 1C66A 4ARMA 1YKZX 5I14A 233LA 1LWKA 5E9RA 1L51A 3WYHA 2CJLA 225LA 1TN5A 3DQBA 4H8XA 2DKVA 3HH4A 1J1OY 3TXBA 3QAKA 2DQJY 1GE4A 4E3UA 1L84A 3F9LA 1T8GA 3X3CA 1HSXA 5APDA 1JEFA 1JKAA 2B6YA 1KIQC 1L82A 3GUJA 1L48A 3C81A 4R6CA 1L87A 4QGZA 4XJBA 1GZMA 4XT3A 1REXA 4GP4B 1P6YA 3TXJA 2DBTA 1JKBA 1QT4A 5B34A 1G0JA 4WLDA 5B6WA 2B7XA 4LT0A 1D0LA 4ZIXA 4UWVA 4MD1A 4I7OA 1GU8A 1NHEA 4DQ5A 2MECA 2I6ZA 166LA 1L70A 4BAPA 127LA 160LA 3PXOA 1L96A 2ZNWY 4ZFPA 1QTCA 260LA 3VGAA 4U3XB 5E4PA 5L9JA 3B0IA 1L33A 4NGZA 1LZNA 1BM1A 5JJEA 1GFHA 1B7LA 1QT3A 2OTYX 3G3BB 115LA 5I54A 4N1EI 3QAPA 180LA 5JENB 3F8VA 1V7SA 1GHLA 2BQGA 3EMSA 3RUNA 1GFKA 1S51A 4Z46A 3HASA 1P7SA 4II8A 2Z73A 4AMIA 2NTWA 2ANVA 4Z41A 1DYAA 1WTMA 3VWOA 3BKVA 2MEAA 1L56A 3UTYA 1PZYA 1YL1X 1C69A 1GFUA 155LA 1YAMA 1IW9A 1B7NA 3LYTA 4MSTA 1LJHA 1GB8A 1ZVYB 3SB5A 1B7QA 4X1HA 1L40A 1IWYA 1CU3A 3NS0A 4YEOA 4ZPUA 1NWGA 3HH5A 259LA 1HFYA 1JTOL 2ZIJA 3NY9A 3V2YA 1SSWA 2YCYA 2PC2A 1P64A 1HF4A 1DYDA 1GPQC 1QSQA 1JUGA 1XEKA 4DWXA 1CUQA 1LYHA 2BQHA 4G7QB 4O34A 1ZWNA 4NHSA 1WQOA 219LA 4H9HA 4W51A 2Y03A 4GN3A 123LA 4WW3A 149LA 1L04A 5B35A 1IP1A 1XEPA 1L59A 4LGKA 3WH1A 1GAZA 2Z55A 3A6BY 1P2CC 1B0DA 4DKLA 1FLWA 1XJTA 1CUPA 1UUZC 251LA 1F88A 2CWIA 3VHZA 186LA 2BLXA 4HYXA 1HZXA 1BVXA 122LA 3M18B 4G4HA 4NGYA 108LA 4ETBA 2RBPA 2I35A 4GP5B 2D4IA 1C6AA 3RW8A 1L31A 1HFXA 4FJRA 5LVIA 2XQOA 1WQRA 2Z12A 2LYMA 1SWYA 3DKEX 3COCA 2OE7X 4YEMA 1IIZA 1D6QA 3LYOA 1H6MA 1IY3A 3TXFA 3ZPRA 4DJHA 1AT9A 1CV5A 4W54A 5ILCA 1R84A 3B72A 2RH1A 3F6ZA 3LHMA 4WLYA 4DQ7A 1LZCA 4OWAA 5DYSA 1BGIA 3A94A 2WARA 5DLAA 1OWYA 232LA 4OWHA 248LA 2L6XA 1ZV5L 193LA 1NF5A 2LHMA 1P3NA 4LDEA 5I4WA 5M1YA 3AM6A 3HAPA 1IW6A 4RLMA 4NHPA 140LA 4HV2A 141LA 1P5CA 4CHXA 168LA 1B5ZA 1K28A 5FDJA 5G2AA 4EKSA 4LDLA 2MEBA 1XGRC 2H5ZA 1CKDA 4W59A 5L3IA 4N9RA 4NGLA 5B05A 3VI0A 1GXXA 1EQ4A 3EBAB 3DN8A 4FBZA 1HEWA 1L24A 5AZDA 170LA 4NGVA 1OYUA 1L88A 4TL3A 4WM4A 2JAFA 2ZIKA 1G0PA 4N4YB 2G4PA 1LMNA 2MEFA 1L52A 1S52A 5LVHA 3P64A 4G4CA 1L73A 1L12A 1C6BA 4QIDA 2ZZLA 1YKXX 4YENA 3TXEA 4JR8A 1D2YA 3N9AA 5LIOA 4NWHA 2XTHA 3L2XA 1L0JA 5H2JA 1QQYA 1FLYA 3NYAA 1CJ9A 2Q0MX 5FEKA 1LW9A 5I4XA 2HUKA 2W1MA 3T6UA 1P36A 3LYZA 1QS9A 5LVGA 230LA 1FDLY 3AB6A 4IATA 5AX1A 4PRUA 188LA 1GE3A 1OWZA 2A7FA 1IWTA 4NGJA 3PDSA 3GUIA 4PXFA 2LZMA 1OUIA 1KG9A 4GLAA 2YCZA 1L39A 3BVDB 1B7PA 1LZYA 2OU0X 5HLLA 5KXNA 1J1PY 3J4GA 5H2PA 258LA 1IC7Y 3AYQA 1L26A 5ITCA 3ZVQB 2NTUA 2Z37A 157LA 1HMLA 1TAYA 3C9MA 1P8UA 2ANXA 1CKHA 4XTLA 1A4VA 2IGCA 2F47A 2ZYPA 4W56A 4LYCA 1L22A 1QTEA 1SSYA 5FCPA 3QJQB 4DD1A 5B2NA 2H9JA 1C08C 1L64A 1E8LA 4TUNA 1L36A 4BEZA 2Y02A 4GCDA 4OOOA 1JTPL 1XMEB 1F10A 1UIHA 1FKQA 1BB4A 1XGPC 3CSZA 4I7MA 1LGXA 1HEOA 1BHZA 3REYA 177LA 3B0OA 5C6LA 1GF7A 5B6ZA 2G4NA 5APCA 224LA 1YKYX 1DI3A 1LHLA 1LWGA 4WM2A 5AX0A 1X0SA 1BB6A 4NGWA 4H9EA 2I20A 1LJ4A 4NGOA 1Z55A 8LYZA 4MQSA 5HQ1A 1LHJA 2RBQA 4HJVA 104LA 1LKSA 173LA 1CU5A 163LA 3UZAA 234LA 4AQNA 200LA 1KGBA 1T97A 5AHZA 4I7KA 4EIYA 3LZMA 3HBHA 1RFPA 3HH6A 4B4JA 3WU8A 1D9UA 4DT3A 150LA 4NGIA 4NHQA 252LA 2MEDA 3P0GA 1CX7A 1KS3A 2B6XA 1GFEA 1LZ6A 1IP4A 1QTDA 3CDTA 5I53A 242LA 2X72A 1TCYA 2RAZX 2BQDA 3D3DA 4ARQA 1LHHA 1LMOA 2G87A 3QBLA 1QTVA 5B07A 1L15A 5LINA 1QTHA 1L49A 2O7AA 4ETCA 4B4IA 4IJ4A 5ETZA 2M3GA 4DDBA 5H2LA 2YBMA 1DKJA 4NGKA 1QKOA 5H2OA 1GEVA 3TXIA 1GBYA 2XJWA 5A45A 3S8GB 5H2KA 1JV6A 1L10A 1PQJA 3DN4A 1OUGA 1LZBA 1LJFA 1GUEA 5JJNA 3RU5A 1JKCA 4YXCA 2ZNXY 1L62A 1L85A 161LA 1GDWA 1LSCA 1I56A 1R2NA 1BRDA 4WM1A 3CAPA 2OEAX 1L65A 4HTNA 3UTWA 1P8IA 3K2RA 2FBBA 1GE0A 2YBHA 3WUAA 4GCFA 4TSCA 5KXOA 4IB4A 4EJ4A 3DMZA 4BEYA 4IAPA 3A95A 2LZ2A 1GB2A 3HUQA 1L86A 1CJ7A 3G3WA 1INUA 3HBEX 2NWDX 4WM3A 4BAFA 5KKHA 1D9WA 3VW7A 1DKKA 1JSFA 2BQJA 4I8SA 1LZ5A 4OWBA 3D4SA 4ANRA 1G0KA 1HEMA 1WQPA 4XT1A 4HPEA 4PPOA 236LA 1LZSA 1GB6A 1HNLA 1B9OA 1LZEA 4GBRB 1LSGA 3WVYA 4RW2A 5KXSA 1UIFA 1CVKA 5KXYA 1CJ6A 1BWHA 1L11A 4KXIA 139LA 3B6LA 4H9AA 5F81A 2YBIA 1LHIA 132LA 4NC3A 3VVKA 4XXJA 1B2KA 1LZ4A 5LXWA 3EMLA 1B7RA 4I7QA 5H2IA 2B6ZA 1L54A 2DQFC 4EKRA 1LYSA 5LA5A 4LZMA 5KXPA 4M4OA 1LJEA 1QKPA 1KMEA 4J1AA 1C6GA 1EPYA 1LI6A 4RDSA 3J6KA 4OV0A 4I7JA 2G4QA 3RT5X 1L46A 2DQEY 3HT9A 4UHRA 3ZPQA 1VGOA 1FLQA 3HTBA 1GF9A 1QHJA 3P66A 1L53A 1L00A 4H9CA 3HDFA 250LA 1S54A 147LA 1QUDA 4B49A 2YCWA 1IP7A 1P2RA 2R4RA 1JQUA 1L43A 1L89A 4EA3A 4LYZA 4XJIA 1B5VA 1IEEA 1LLHA 2YVBA 5FSTA 1YROA 2XBSA 3TMVA 4PXKA 4H8YA 4HTKA 4LT3A 2LYZA 2BQMA 2BPUA 209LA 3GUKA 1KW5A 1I1ZA 2A4TA 4HV1A 1C6NA 1XJUA 103LA 1LJNA 4OWCA 2LYOA 3A92A 1C8RA 4XJHA 2EQLA 2RSCA 3EH4B 2MEGA 1GF0A 2CUUA 4GCCA 3WW5A 4MBSA 1LI3A 1C62A 4P2EA 1QT8A 1XJIA 2I1XA 2EIZC 4BWBA 1KW7A 4XENA 1GE1A 4QDNA 1IP3A 1JPOA 1BQLY 1WVUA 1HC0A 2JAGA 1OUJA 1GB7A 1QUHA 2B70A 1LYGA 3M3UA 4ARJA 2RBSA 1OV7A 3HT8A 1L69A 3CB7A 5FHWA 1IWVA 1B7SA 1LYOA 1LYEA 4PHIA 5EBHA 1PXSA 1JITA 1C67A 2F30A 3UONA 1C65A 4LYOA 5DHHA 4A7DA 1LMTA 3QBGA 4LYBA 5A3EA 4CFOA 1SX7A 1G07A 1L17A 4ARMB 3DN1A 5K7OA 1G1WA 1VDTA 1C61A 3HAOA 3QJSB 1LZ9A 1F4ZA 4LFPA 4GLVA 1CV0A 2RBRA 4XJGA 1G0LA 1XGTC 2HUBA 3S3BB 4WLXA 1L35A 1LYJA 4BS7A 229LA 3HTFA 1DYBA 1LSPA 3L64A 1LYYA 3WU9A 1C64A 4EOFA 4WAVA 1C6KA 4W58A 1L42A 2DQGY 1WQQA 2W1YA 174LA 1LN6A 2KSBA 1HELA 5HNLA 4W55A 1KXYA 4NIJA 1C6LA 1GB5A 1LYFA 3QE8A 4KL7A 3D9AC 1LSDA 4I7SA 1EQ5A 2Z2EA 1PQKA 118LA 5LZMA 2B75A 1LPIA 1LZ8A 1DQJC 1UIDA 3QY4A 4MQTA 162LA 1DYCA 1WQNA 1LZTA 2KSYA 1L0MA 1L99A 1GXV2 1WTNA 4GN4A 2KSAA 4BV0A 3SB8A 1IWXA 4OOTA 3T36A 238LA 4OO9A 1HENA 1SLYA 1ZMYL 3AGHA 1L83A 4H9BA 3TMWA 4X32A 1REZA 3HU8A 1UIBA 1SQ2L 1IWUA 1TLAA 197LA 1AM7A 1LZDA 4KNFA 4ET8A 1LZGA 1B5XA 1X0I1 1GB9A 2W1XA 2QPDB 2HEFA 1L0KA 4HJZA 4KPMA 1LKRA 3FI5A 4XTNA 3UTVA 1YANA 4WO6A 2ZILA 4PRQA 3W6DA 4CJ2A 3ZVQA 1C3WA 1EL1A 262LA 1O23A 5APFA 1P2LA 5IHGA 2HECA 4H1PA 137LA 239LA 1YIKA 3IWRA 1HERA 1JGJA 3WMKA 5D5CA 4JQ6A 1XSFA 1VAUA 133LA 2BQOA 2RB0X 1JWRA 1KXXA 1GF8A 4G49A 3SB6A 4W52A 3C8RA 1L90A 1LYZA 2QPEB 2B72A 2DQDY 4W53A 175LA 1D3MA 1KY0A 1P37A 5A8EA 4R0FA 3SP3A 2YDOA 1D2WA 1JIYA 2IFFY 3HUAA 2BQCA 1C63A 1IR9A 3AZ4A 5I4YA 5TGZA 2DQAA 2Z19A 3HT6A 1QM8A 4NG8A 1NBZC 4YXAC 1GWDA 1L13A 151LA 213LA 3LN2A 195LA 4CFPA 3NY8A 1UIAA 2CGIA 4I7NA 3W6CA 4IAQA 1QDRA 1L44A 1LHKA 6LYZA 5C1MA 1IC5Y 4RLNA 3DDLA 5C6JA 1H68A 257LA 4NSIA 3EXDA 1YQVY 4E97A 1BWIA 1H87A 1B5YA 1GB3A 1J1XY 3LYMA 3OE6A 3QBKA 4TTDA 111LA 3WUMA 9LYZA 3EH5B 210LA 2HEDA 246LA 5APEA 4IARA 2D91A 3N9CA 4NSJA 1KIPC 2Z2FA 1N4FA 1YILA 3N9EA 2F2NA 1C6CA 3HDEA 4X3BA 3HUKA 4NSHA 3CDRA 3DN2A 3LZ2A 1BRRA 159LA 3DN6A 3WPLA 1VDPA 1CKCA 1JFPA 1W08A 5G53A 3G3XA 4G71B 4TX7A 131LA 1L01A 112LA 3A90A 4LYMA 1KG8A 235LA 5DN4A 1GF3A 4MR1A 5ITEA 2NTGA 129LA 1QUGA 4LZTA 5F14A 134LA 1G0GA 4LFXA 1QTBA 2VT4A 1S8JA 1PS5A 5LVKA 1L32A 4I7PA 3S8FB 5II3A 1C45A 5KKJA 1GFVA 1BB7A 4YOPA 2HPYA 1LMQA 4C3WA 3A3QA 4ARLA 4H9FA 1DZBX 192LA 1LTMA 1FKVA 3OE0A 4NWEA 4PK0A 3KAMA 3GXRA 1M0KA 231LA 3ODUA 1L95A 1GFGA 1NDGC 1L20A 241LA 221LA 1VDQA 1UCOA 4AGAA 1JTTL 3CSRA 1IOSA 3B0KA 1WTHA 3W6FA 3P4ZA 2RAYX 3W6BA 2LNLA 120LA 3NSBA 3CDQA 1D3NA 5AMYA 1GBOA 1S8LA 4FDYA 1AKIA 1Q5JA 1FBIX 1LZ1A 4DD2A 1DYFA 2HEEA 1SX2A 1L68A 1L63A 1QDTA 1MLCE 5KXZA 1LGWA 1S53A 1L91A 1L76A 4ETDA 237LA 1L07A 4KLYA 4OW1A 164LA 1XGUC 2YBNA 4NY5A 4CGEA 1QUOA 1E0PA 3MGWA 1OVKA 1NKHA 184LA 152LA 165LA 3AZ7A 1UICA 1XIOA 172LA 181LA 3UZCA 1BB5A 4LT1A 4GBRA 1JJ3A 2EI4A 194LA 1G7LC 2YSSC 1LSYA 3W6EA 5H2HA 2BQBA 2YBLA 1UIGA 1NDMC 3SB7A 1OV5A 2F95A 1QT6A 190LA 1L09A 1ALCA 3P65A 2I26L 243LA 2OE4X 1GDXA 5B6YA 2HEAA 1B7MA 1L92A 183LA 1DYEA 4NHTA 2BQLA 4L41A 4EPIA 2KS9A 5HMJA 1XEJA 1L27A 7LZMA 2Z6BA 226LA 3C82A 4NFVA 5DN5A 1LZAA 2RBNA 5FJGA 156LA 1ZVHL 3CT0A 1G7MC 2FYCA 4G7RB 1HEQA 1M0LA 228LA 1OUFA 4DAJA 107LA 5DHGA 4XJDA 1PXRA 154LA 1KY1A 4W94A 1GFJA 4DDAA 1L67A 249LA 1GB0A 4X31A 1FLUA 1BB3A 1F50A 1L23A 3FE0A 1LMAA 5B6XA 1LSMA 2HULA 2Y00A 1JTNA 5LAFA 1GFAA 169LA 5KXXA 3GUPA 3QBIA 5D5FA 3SB9A 4TSBA 2IHLA 3ULRA 198LA 4WG1A 6LZMA 1OUAA 4YM8A 2LCBA 1TN0A 1ZYTA 2Q9DA 4UWUA 1FBBA 2C8PA 1OVJA 1VDSA 1GD6A 240LA 4DQJA 3DMVA 1GFTA 1G0MA 4J4QA 4A4MA 2N5ZA 1REMA 1JV7A 4MD2A
chains in the Genus database with same CATH topology
1IO5A 247LA 3HTGA 2FYDA 1OVHA 2OU8A 3A91A 2D4JA 2XBRA 1VATA 1LSFA 2OU9A 4L35A 1KNIA 3AW7A 2F32A 3RZ4A 1C6PA 4IASA 1IXFA 2A7DA 1GE2A 1T3PA 1GFRA 2FBDA 1L03A 4NEBA 2Y04A 222LA 119LA 5B1GA 3KJ6A 3V2WA 1OP9B 3WPKA 2DQHY 5KXMA 1C8SA 4DYGA 2YBJA 3VG9A 5JJJA 2RB2X 4WG7A 5L3HA 4OWEA 2AT9A 3QDCA 2Q9EA 4G72B 3PWHA 1DPXA 3TXGA 1IC4Y 1L19A 1D0KA 1P56A 1CNSA 5HMVA 6LYTA 1TDYA 1LHMA 2CDSA 3WXUA 1ZURA 4GRVA 4QY9A 1L81A 2RBOA 1C10A 2I25L 145LA 5BR2A 3DN3A 4UG2A 1OQMA 1DXJA 261LA 4HJYA 2BQAA 5B59A 4DC4A 5KXKA 3HT7A 3SN6R 1QSAA 4FA7B 1IR7A 1T8AA 4DD9A 2B5ZA 1PQMA 4MCKA 1LI2A 1L37A 2R4SA 2DQCY 2ZYCA 3K3TA 3C9LA 1I20A 5F16A 3SBBC 3W6AA 4G70B 4N4WA 1CV1A 1C60A 1RCMA 1C6EA 3OAXA 4GYCA 1L05A 1I6SA 4EKQA 3HAQA 4EKPA 2W1LA 3AZ5A 5H2NA 5LYTA 1VJMA 5BR5A 4BVNA 2BQEA 3FI7A 1D6PA 1F0WA 245LA 5G28A 3HARA 2WJLA 244LA 4W57A 3WVXA 2Z38A 1IR8A 4Z98A 1RI8B 1C6TA 4B4EA 1NHBA 1PQOA 1IP5A 4C5FA 3A34A 4ET9A 1UACY 1IWWA 1L98A 1L30A 4WM5A 2EKSC 2NTHA 1UAZA 1KIRC 1OUEA 4XTOA 3ABWA 2QARC 3DNAA 1L45A 1X0K1 4H93A 4PJ2C 1HHLA 191LA 3C8SA 254LA 3E3DA 1GF5A 4Y9HA 212LA 1C6IA 3TXKA 1L61A 4H8ZA 1GBWA 2GV0A 1LAAA 4I7TA 217LA 1T6VL 2ZQ4A 1IOQA 1LYDA 2LC9A 4BUOA 1GBXA 1L72A 1QTKA 4N0JA 4FAAB 1LJGA 1L9HA 4D9ZA 2OE9X 1P46A 1MGYA 3CDOA 1LCNA 1LYIA 2QB0B 2VB1A 3CSQA 4G7SB 1LSZA 1G1VA 1JTMA 5B1FA 1L77A 211LA 3AW6A 4J7VA 2I21A 1L41A 5F9UA 1GBZA 1REYA 1L58A 1AZFA 5KKIA 1C43A 3HFMY 2LZTA 1AP9A 4GP8B 4HP0A 1L80A 1V7TA 3A93A 3UG9A 3AYMA 5AHYA 5T3FA 1E12A 1L29A 3WPJA 4HSFA 1NQIA 1LSNA 2H9KA 189LA 1LMPA 4DS7E 1KXWA 1L75A 4RW1A 1B6IA 1L08A 2ZQ3A 2F2QA 3IJUA 1C6MA 1CV3A 4G4BA 5LAGA 102LA 1L93A 4BADA 201LA 3GXKA 4B1AA 1C6JA 1L28A 3C7WA 158LA 4GN5C 5LA8A 1L57A 4DD7A 3C7YA 1L34A 253LA 4H9IA 4QRYA 3CODA 1C7PA 3DMXA 3AGIA 143LA 256LA 4Z3MA 2YDVA 5IELA 3S3CB 5DL9A 1C6FA 4NG1A 1IP6A 1L66A 4ETAA 3C80A 4DD3A 1IORA 4GCBA 2ZWBA 1O0AA 2YCXA 3FADA 4JKVA 187LA 5KY1A 3W3EA 1SWZA 1OUCA 4TWSA 4HTQA 5LYMA 3P68A 3LZTA 3HWLA 146LA 1OUDA 5FELA 3WQJA 1LMCA 2Z39A 5A44A 3QJTB 2MEEA 3EO5A 1JISA 3TMUA 3GUOA 1G7HC 167LA 1C6QA 3ATOA 4ARPA 4NSGA 4LDOA 2MEIA 5KXRA 1JSEA 4WM6A 4H90A 1IOCA 1JJ1A 4WOAA 3BKHA 205LA 3GULA 3GUMA 1JHLA 5B0WA 1IX0A 2HU1A 1WQMA 1LOZA 4HWLA 1PY6A 1L47A 4L6RA 3TXDA 3HBDA 2J4YA 130LA 1IY4A 1HMKA 1P8HA 1L18A 3G3VA 5B06A 196LA 1L02A 3MBVA 5ILFA 2DQIY 1A2YC 1UA6Y 1L60A 1H2SA 1CU6A 4GCEA 3HANA 214LA 5HNCA 1NBYC 1B5UA 2MEHA 5B6VA 1FN5A 4QI1A 1QT7A 1L79A 1BWJA 1F6RA 4XJFA 1EHKB 3QJVB 206LA 3G3AB 2Y01A 4EPFA 1CKGA 3AJNA 3HTDA 1IVMA 4WO9A 3HH3A 4DDCA 4K5YA 142LA 255LA 3CT5A 5IDDA 5J7CA 1C46A 2X0AA 1L14A 1WVVA 5A3ZA 1IWZA 1CU0A 1IOTA 1DZEA 4XADA 1CV4A 1C68A 171LA 1L21A 1QIOA 5I5QA 1CTWA 2Y8PA 2B6WA 3DN0A 1L25A 5LVJA 5F8UA 1T8FA 1D3JA 4I7LA 1UBZA 4N5RA 138LA 4XYYA 3AGGG 199LA 3CDVA 1TEWA 2AUBA 2OTZX 4J0LA 1BRXA 1GEZA 4YX7C 5G2CA 4WL7A 5LYZA 4DD0A 3AYNA 1GF4A 4ML7A 4XN6A 1L16A 1T6HA 1OUBA 3WU7A 2B6TA 128LA 2BQNA 1Q5IA 110LA 135LA 1HFZA 1VEDA 3A96A 5LWEA 4AXTA 2BQFA 3ZEKA 3A67Y 4J1BA 4PJZA 3TMXA 4H92A 1YAQA 2BLYA 5J7AA 3A6CY 5G2DA 1D0MA 3WUNA 5F9XA 1UC0A 3FA0A 153LA 1UCQA 2L78A 3OE9A 2WJKA 3WW6A 2PEDA 4WMGA 3A3RX 2F93A 1B7OA 5EN0A 1LJJA 4WL6A 4FPDA 1CJ8A 4AMJA 1BVKC 1XFPL 2YDGA 1UIEA 1JJ0A 4PGJB 5KXLA 1LSBA 1PQIA 1L50A 1TBYA 4H94A 3A8ZA 114LA 223LA 2BAAA 4I7RA 1C6HA 2B74A 4G9SA 1YL0X 4LYTA 4B0DA 4NHIA 3C8QA 1HSWA 3TXHA 1QUTA 1L06A 2F4AA 220LA 1JKDA 1YAPA 3ATNA 2HUMA 4H91A 1AT5A 4UWNA 1L71A 3RNXA 3JR6A 1DI5A 1C6DA 1LJKA 3OE8A 1XEIA 4I0CA 1QSWA 5C6IA 1CV6A 1D3FA 2BQKA 4HPIA 227LA 3RZEA 218LA 2B73A 1LJ3A 1DYGA 4WLTA 3OJPA 3UTXA 207LA 2F4GA 1M0MA 1RE2A 3EH3B 3PQRA 3HU9A 3S3DB 3QJRB 4S0WA 1QT5A 1B5WA 1W6ZA 2Z18A 182LA 4GPOA 3GUNA 2HEBA 1VFBC 2HTXA 4EXMA 3X3BA 1LSEA 2D6BA 2O4WA 4N1CC 5H2MA 1HEPA 2BRDA 185LA 4LT2A 1L94A 5KJ9A 1LJIA 1G7IC 1U19A 1CX6A 144LA 3C83A 1EQEA 4N6HA 1GBSA 3AZ6A 2EPEA 3WXTA 2RB1X 1NMMA 4ETEA 3CT1A 1LSAA 1MELL 2HU3A 125LA 1PQDA 2ZIYA 3OK0A 109LA 5G36A 3ZEVA 1FBKA 148LE 1L74A 1YAOA 1QUSA 208LA 1IP2A 3QNGA 4N8ZA 1G0QA 1CKFA 1DPWA 1LZRA 2C8OA 3WULA 1F6SA 5KXWA 5DM9A 3A7KA 1L38A 1LPYA 3WL2A 5G54A 3QJUB 4M6DA 5AWZA 1CU2A 1QTZA 3PBLA 4W96A 4KT3A 1L55A 2D4KA 1GF6A 1LGUA 4ZEEA 2O79A 1L97A 4YF2A 1DI4A 3IJVA 1G7JC 215LA 5KXTA 178LA 4QEQA 1XGQC 2ZFEA 3CQLA 4HYJA 216LA 1OUHA 1CWQA 113LA 3T45A 1QS5A 126LA 1QSBA 3C7ZA 1GAYA 4EMNA 1RJCB 4ARQB 1G06A 7LYZA 176LA 3RFMA 2BQIA 3SBAA 1AT6A 1C66A 4ARMA 1YKZX 5I14A 233LA 1LWKA 5E9RA 1L51A 3WYHA 2CJLA 225LA 1TN5A 3DQBA 4H8XA 2DKVA 3HH4A 1J1OY 3TXBA 3QAKA 2DQJY 1GE4A 4E3UA 1L84A 3F9LA 1T8GA 3X3CA 1HSXA 5APDA 1JEFA 1JKAA 2B6YA 1KIQC 1L82A 3GUJA 1L48A 3C81A 4R6CA 1L87A 4QGZA 4XJBA 1GZMA 4XT3A 1REXA 4GP4B 1P6YA 3TXJA 2DBTA 1JKBA 1QT4A 5B34A 1G0JA 4WLDA 5B6WA 2B7XA 4LT0A 1D0LA 4ZIXA 4UWVA 4MD1A 4I7OA 1GU8A 1NHEA 4DQ5A 2MECA 2I6ZA 166LA 1L70A 4BAPA 127LA 160LA 3PXOA 1L96A 2ZNWY 4ZFPA 1QTCA 260LA 3VGAA 4U3XB 5E4PA 5L9JA 3B0IA 1L33A 4NGZA 1LZNA 1BM1A 5JJEA 1GFHA 1B7LA 1QT3A 2OTYX 3G3BB 115LA 5I54A 4N1EI 3QAPA 180LA 5JENB 3F8VA 1V7SA 1GHLA 2BQGA 3EMSA 3RUNA 1GFKA 1S51A 4Z46A 3HASA 1P7SA 4II8A 2Z73A 4AMIA 2NTWA 2ANVA 4Z41A 1DYAA 1WTMA 3VWOA 3BKVA 2MEAA 1L56A 3UTYA 1PZYA 1YL1X 1C69A 1GFUA 155LA 1YAMA 1IW9A 1B7NA 3LYTA 4MSTA 1LJHA 1GB8A 1ZVYB 3SB5A 1B7QA 4X1HA 1L40A 1IWYA 1CU3A 3NS0A 4YEOA 4ZPUA 1NWGA 3HH5A 259LA 1HFYA 1JTOL 2ZIJA 3NY9A 3V2YA 1SSWA 2YCYA 2PC2A 1P64A 1HF4A 1DYDA 1GPQC 1QSQA 1JUGA 1XEKA 4DWXA 1CUQA 1LYHA 2BQHA 4G7QB 4O34A 1ZWNA 4NHSA 1WQOA 219LA 4H9HA 4W51A 2Y03A 4GN3A 123LA 4WW3A 149LA 1L04A 5B35A 1IP1A 1XEPA 1L59A 4LGKA 3WH1A 1GAZA 2Z55A 3A6BY 1P2CC 1B0DA 4DKLA 1FLWA 1XJTA 1CUPA 1UUZC 251LA 1F88A 2CWIA 3VHZA 186LA 2BLXA 4HYXA 1HZXA 1BVXA 122LA 3M18B 4G4HA 4NGYA 108LA 4ETBA 2RBPA 2I35A 4GP5B 2D4IA 1C6AA 3RW8A 1L31A 1HFXA 4FJRA 5LVIA 2XQOA 1WQRA 2Z12A 2LYMA 1SWYA 3DKEX 3COCA 2OE7X 4YEMA 1IIZA 1D6QA 3LYOA 1H6MA 1IY3A 3TXFA 3ZPRA 4DJHA 1AT9A 1CV5A 4W54A 5ILCA 1R84A 3B72A 2RH1A 3F6ZA 3LHMA 4WLYA 4DQ7A 1LZCA 4OWAA 5DYSA 1BGIA 3A94A 2WARA 5DLAA 1OWYA 232LA 4OWHA 248LA 2L6XA 1ZV5L 193LA 1NF5A 2LHMA 1P3NA 4LDEA 5I4WA 5M1YA 3AM6A 3HAPA 1IW6A 4RLMA 4NHPA 140LA 4HV2A 141LA 1P5CA 4CHXA 168LA 1B5ZA 1K28A 5FDJA 5G2AA 4EKSA 4LDLA 2MEBA 1XGRC 2H5ZA 1CKDA 4W59A 5L3IA 4N9RA 4NGLA 5B05A 3VI0A 1GXXA 1EQ4A 3EBAB 3DN8A 4FBZA 1HEWA 1L24A 5AZDA 170LA 4NGVA 1OYUA 1L88A 4TL3A 4WM4A 2JAFA 2ZIKA 1G0PA 4N4YB 2G4PA 1LMNA 2MEFA 1L52A 1S52A 5LVHA 3P64A 4G4CA 1L73A 1L12A 1C6BA 4QIDA 2ZZLA 1YKXX 4YENA 3TXEA 4JR8A 1D2YA 3N9AA 5LIOA 4NWHA 2XTHA 3L2XA 1L0JA 5H2JA 1QQYA 1FLYA 3NYAA 1CJ9A 2Q0MX 5FEKA 1LW9A 5I4XA 2HUKA 2W1MA 3T6UA 1P36A 3LYZA 1QS9A 5LVGA 230LA 1FDLY 3AB6A 4IATA 5AX1A 4PRUA 188LA 1GE3A 1OWZA 2A7FA 1IWTA 4NGJA 3PDSA 3GUIA 4PXFA 2LZMA 1OUIA 1KG9A 4GLAA 2YCZA 1L39A 3BVDB 1B7PA 1LZYA 2OU0X 5HLLA 5KXNA 1J1PY 3J4GA 5H2PA 258LA 1IC7Y 3AYQA 1L26A 5ITCA 3ZVQB 2NTUA 2Z37A 157LA 1HMLA 1TAYA 3C9MA 1P8UA 2ANXA 1CKHA 4XTLA 1A4VA 2IGCA 2F47A 2ZYPA 4W56A 4LYCA 1L22A 1QTEA 1SSYA 5FCPA 3QJQB 4DD1A 5B2NA 2H9JA 1C08C 1L64A 1E8LA 4TUNA 1L36A 4BEZA 2Y02A 4GCDA 4OOOA 1JTPL 1XMEB 1F10A 1UIHA 1FKQA 1BB4A 1XGPC 3CSZA 4I7MA 1LGXA 1HEOA 1BHZA 3REYA 177LA 3B0OA 5C6LA 1GF7A 5B6ZA 2G4NA 5APCA 224LA 1YKYX 1DI3A 1LHLA 1LWGA 4WM2A 5AX0A 1X0SA 1BB6A 4NGWA 4H9EA 2I20A 1LJ4A 4NGOA 1Z55A 8LYZA 4MQSA 5HQ1A 1LHJA 2RBQA 4HJVA 104LA 1LKSA 173LA 1CU5A 163LA 3UZAA 234LA 4AQNA 200LA 1KGBA 1T97A 5AHZA 4I7KA 4EIYA 3LZMA 3HBHA 1RFPA 3HH6A 4B4JA 3WU8A 1D9UA 4DT3A 150LA 4NGIA 4NHQA 252LA 2MEDA 3P0GA 1CX7A 1KS3A 2B6XA 1GFEA 1LZ6A 1IP4A 1QTDA 3CDTA 5I53A 242LA 2X72A 1TCYA 2RAZX 2BQDA 3D3DA 4ARQA 1LHHA 1LMOA 2G87A 3QBLA 1QTVA 5B07A 1L15A 5LINA 1QTHA 1L49A 2O7AA 4ETCA 4B4IA 4IJ4A 5ETZA 2M3GA 4DDBA 5H2LA 2YBMA 1DKJA 4NGKA 1QKOA 5H2OA 1GEVA 3TXIA 1GBYA 2XJWA 5A45A 3S8GB 5H2KA 1JV6A 1L10A 1PQJA 3DN4A 1OUGA 1LZBA 1LJFA 1GUEA 5JJNA 3RU5A 1JKCA 4YXCA 2ZNXY 1L62A 1L85A 161LA 1GDWA 1LSCA 1I56A 1R2NA 1BRDA 4WM1A 3CAPA 2OEAX 1L65A 4HTNA 3UTWA 1P8IA 3K2RA 2FBBA 1GE0A 2YBHA 3WUAA 4GCFA 4TSCA 5KXOA 4IB4A 4EJ4A 3DMZA 4BEYA 4IAPA 3A95A 2LZ2A 1GB2A 3HUQA 1L86A 1CJ7A 3G3WA 1INUA 3HBEX 2NWDX 4WM3A 4BAFA 5KKHA 1D9WA 3VW7A 1DKKA 1JSFA 2BQJA 4I8SA 1LZ5A 4OWBA 3D4SA 4ANRA 1G0KA 1HEMA 1WQPA 4XT1A 4HPEA 4PPOA 236LA 1LZSA 1GB6A 1HNLA 1B9OA 1LZEA 4GBRB 1LSGA 3WVYA 4RW2A 5KXSA 1UIFA 1CVKA 5KXYA 1CJ6A 1BWHA 1L11A 4KXIA 139LA 3B6LA 4H9AA 5F81A 2YBIA 1LHIA 132LA 4NC3A 3VVKA 4XXJA 1B2KA 1LZ4A 5LXWA 3EMLA 1B7RA 4I7QA 5H2IA 2B6ZA 1L54A 2DQFC 4EKRA 1LYSA 5LA5A 4LZMA 5KXPA 4M4OA 1LJEA 1QKPA 1KMEA 4J1AA 1C6GA 1EPYA 1LI6A 4RDSA 3J6KA 4OV0A 4I7JA 2G4QA 3RT5X 1L46A 2DQEY 3HT9A 4UHRA 3ZPQA 1VGOA 1FLQA 3HTBA 1GF9A 1QHJA 3P66A 1L53A 1L00A 4H9CA 3HDFA 250LA 1S54A 147LA 1QUDA 4B49A 2YCWA 1IP7A 1P2RA 2R4RA 1JQUA 1L43A 1L89A 4EA3A 4LYZA 4XJIA 1B5VA 1IEEA 1LLHA 2YVBA 5FSTA 1YROA 2XBSA 3TMVA 4PXKA 4H8YA 4HTKA 4LT3A 2LYZA 2BQMA 2BPUA 209LA 3GUKA 1KW5A 1I1ZA 2A4TA 4HV1A 1C6NA 1XJUA 103LA 1LJNA 4OWCA 2LYOA 3A92A 1C8RA 4XJHA 2EQLA 2RSCA 3EH4B 2MEGA 1GF0A 2CUUA 4GCCA 3WW5A 4MBSA 1LI3A 1C62A 4P2EA 1QT8A 1XJIA 2I1XA 2EIZC 4BWBA 1KW7A 4XENA 1GE1A 4QDNA 1IP3A 1JPOA 1BQLY 1WVUA 1HC0A 2JAGA 1OUJA 1GB7A 1QUHA 2B70A 1LYGA 3M3UA 4ARJA 2RBSA 1OV7A 3HT8A 1L69A 3CB7A 5FHWA 1IWVA 1B7SA 1LYOA 1LYEA 4PHIA 5EBHA 1PXSA 1JITA 1C67A 2F30A 3UONA 1C65A 4LYOA 5DHHA 4A7DA 1LMTA 3QBGA 4LYBA 5A3EA 4CFOA 1SX7A 1G07A 1L17A 4ARMB 3DN1A 5K7OA 1G1WA 1VDTA 1C61A 3HAOA 3QJSB 1LZ9A 1F4ZA 4LFPA 4GLVA 1CV0A 2RBRA 4XJGA 1G0LA 1XGTC 2HUBA 3S3BB 4WLXA 1L35A 1LYJA 4BS7A 229LA 3HTFA 1DYBA 1LSPA 3L64A 1LYYA 3WU9A 1C64A 4EOFA 4WAVA 1C6KA 4W58A 1L42A 2DQGY 1WQQA 2W1YA 174LA 1LN6A 2KSBA 1HELA 5HNLA 4W55A 1KXYA 4NIJA 1C6LA 1GB5A 1LYFA 3QE8A 4KL7A 3D9AC 1LSDA 4I7SA 1EQ5A 2Z2EA 1PQKA 118LA 5LZMA 2B75A 1LPIA 1LZ8A 1DQJC 1UIDA 3QY4A 4MQTA 162LA 1DYCA 1WQNA 1LZTA 2KSYA 1L0MA 1L99A 1GXV2 1WTNA 4GN4A 2KSAA 4BV0A 3SB8A 1IWXA 4OOTA 3T36A 238LA 4OO9A 1HENA 1SLYA 1ZMYL 3AGHA 1L83A 4H9BA 3TMWA 4X32A 1REZA 3HU8A 1UIBA 1SQ2L 1IWUA 1TLAA 197LA 1AM7A 1LZDA 4KNFA 4ET8A 1LZGA 1B5XA 1X0I1 1GB9A 2W1XA 2QPDB 2HEFA 1L0KA 4HJZA 4KPMA 1LKRA 3FI5A 4XTNA 3UTVA 1YANA 4WO6A 2ZILA 4PRQA 3W6DA 4CJ2A 3ZVQA 1C3WA 1EL1A 262LA 1O23A 5APFA 1P2LA 5IHGA 2HECA 4H1PA 137LA 239LA 1YIKA 3IWRA 1HERA 1JGJA 3WMKA 5D5CA 4JQ6A 1XSFA 1VAUA 133LA 2BQOA 2RB0X 1JWRA 1KXXA 1GF8A 4G49A 3SB6A 4W52A 3C8RA 1L90A 1LYZA 2QPEB 2B72A 2DQDY 4W53A 175LA 1D3MA 1KY0A 1P37A 5A8EA 4R0FA 3SP3A 2YDOA 1D2WA 1JIYA 2IFFY 3HUAA 2BQCA 1C63A 1IR9A 3AZ4A 5I4YA 5TGZA 2DQAA 2Z19A 3HT6A 1QM8A 4NG8A 1NBZC 4YXAC 1GWDA 1L13A 151LA 213LA 3LN2A 195LA 4CFPA 3NY8A 1UIAA 2CGIA 4I7NA 3W6CA 4IAQA 1QDRA 1L44A 1LHKA 6LYZA 5C1MA 1IC5Y 4RLNA 3DDLA 5C6JA 1H68A 257LA 4NSIA 3EXDA 1YQVY 4E97A 1BWIA 1H87A 1B5YA 1GB3A 1J1XY 3LYMA 3OE6A 3QBKA 4TTDA 111LA 3WUMA 9LYZA 3EH5B 210LA 2HEDA 246LA 5APEA 4IARA 2D91A 3N9CA 4NSJA 1KIPC 2Z2FA 1N4FA 1YILA 3N9EA 2F2NA 1C6CA 3HDEA 4X3BA 3HUKA 4NSHA 3CDRA 3DN2A 3LZ2A 1BRRA 159LA 3DN6A 3WPLA 1VDPA 1CKCA 1JFPA 1W08A 5G53A 3G3XA 4G71B 4TX7A 131LA 1L01A 112LA 3A90A 4LYMA 1KG8A 235LA 5DN4A 1GF3A 4MR1A 5ITEA 2NTGA 129LA 1QUGA 4LZTA 5F14A 134LA 1G0GA 4LFXA 1QTBA 2VT4A 1S8JA 1PS5A 5LVKA 1L32A 4I7PA 3S8FB 5II3A 1C45A 5KKJA 1GFVA 1BB7A 4YOPA 2HPYA 1LMQA 4C3WA 3A3QA 4ARLA 4H9FA 1DZBX 192LA 1LTMA 1FKVA 3OE0A 4NWEA 4PK0A 3KAMA 3GXRA 1M0KA 231LA 3ODUA 1L95A 1GFGA 1NDGC 1L20A 241LA 221LA 1VDQA 1UCOA 4AGAA 1JTTL 3CSRA 1IOSA 3B0KA 1WTHA 3W6FA 3P4ZA 2RAYX 3W6BA 2LNLA 120LA 3NSBA 3CDQA 1D3NA 5AMYA 1GBOA 1S8LA 4FDYA 1AKIA 1Q5JA 1FBIX 1LZ1A 4DD2A 1DYFA 2HEEA 1SX2A 1L68A 1L63A 1QDTA 1MLCE 5KXZA 1LGWA 1S53A 1L91A 1L76A 4ETDA 237LA 1L07A 4KLYA 4OW1A 164LA 1XGUC 2YBNA 4NY5A 4CGEA 1QUOA 1E0PA 3MGWA 1OVKA 1NKHA 184LA 152LA 165LA 3AZ7A 1UICA 1XIOA 172LA 181LA 3UZCA 1BB5A 4LT1A 4GBRA 1JJ3A 2EI4A 194LA 1G7LC 2YSSC 1LSYA 3W6EA 5H2HA 2BQBA 2YBLA 1UIGA 1NDMC 3SB7A 1OV5A 2F95A 1QT6A 190LA 1L09A 1ALCA 3P65A 2I26L 243LA 2OE4X 1GDXA 5B6YA 2HEAA 1B7MA 1L92A 183LA 1DYEA 4NHTA 2BQLA 4L41A 4EPIA 2KS9A 5HMJA 1XEJA 1L27A 7LZMA 2Z6BA 226LA 3C82A 4NFVA 5DN5A 1LZAA 2RBNA 5FJGA 156LA 1ZVHL 3CT0A 1G7MC 2FYCA 4G7RB 1HEQA 1M0LA 228LA 1OUFA 4DAJA 107LA 5DHGA 4XJDA 1PXRA 154LA 1KY1A 4W94A 1GFJA 4DDAA 1L67A 249LA 1GB0A 4X31A 1FLUA 1BB3A 1F50A 1L23A 3FE0A 1LMAA 5B6XA 1LSMA 2HULA 2Y00A 1JTNA 5LAFA 1GFAA 169LA 5KXXA 3GUPA 3QBIA 5D5FA 3SB9A 4TSBA 2IHLA 3ULRA 198LA 4WG1A 6LZMA 1OUAA 4YM8A 2LCBA 1TN0A 1ZYTA 2Q9DA 4UWUA 1FBBA 2C8PA 1OVJA 1VDSA 1GD6A 240LA 4DQJA 3DMVA 1GFTA 1G0MA 4J4QA 4A4MA 2N5ZA 1REMA 1JV7A 4MD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C67 A;  3UON A;  1C65 A;  247L A;  168L A;  1K28 A;  3HTG A;  5DHH A;  5G2A A;  3S3D B;  4EKS A;  1OVH A;  2OU8 A;  3FA0 A;  4LDL A;  3QBG A;  1UCQ A;  2L78 A;  3OE9 A;  1SX7 A;  1G07 A;  1L17 A;  4W59 A;  4ARM B;  2WJK A;  3DN1 A;  2PED A;  1G1W A;  1C61 A;  2OU9 A;  3VI0 A;  3HAO A;  3QJS B;  1KNI A;  1F4Z A;  2F93 A;  4L35 A;  2F32 A;  3DN8 A;  1C6P A;  1CV0 A;  2RBR A;  4FBZ A;  1L24 A;  5AZD A;  5EN0 A;  170L A;  1G0L A;  1IXF A;  3S3B B;  1OYU A;  4FPD A;  1L35 A;  1L88 A;  4TL3 A;  4AMJ A;  1L03 A;  1LYJ A;  229L A;  2JAF A;  3HTF A;  1DYB A;  222L A;  119L A;  2Y04 A;  3KJ6 A;  3V2W A;  1G0P A;  4N4Y B;  3L64 A;  1C8S A;  1C64 A;  1PQI A;  1L50 A;  1L52 A;  1S52 A;  3VG9 A;  4WAV A;  2RB2 X;  5JJJ A;  1C6K A;  1L73 A;  114L A;  4W58 A;  1L12 A;  1C6B A;  223L A;  1L42 A;  4I7R A;  4QID A;  2AT9 A;  2ZZL A;  3QDC A;  2Q9E A;  174L A;  1C6H A;  1D2Y A;  2B74 A;  1LN6 A;  2KSB A;  3PWH A;  4G72 B;  4JR8 A;  1L19 A;  3L2X A;  1L0J A;  5H2J A;  1P56 A;  4W55 A;  3C8Q A;  3NYA A;  1L06 A;  1C6L A;  1LYF A;  220L A;  2HUM A;  1ZUR A;  4GRV A;  1LW9 A;  1L71 A;  2HUK A;  4I7S A;  1PQK A;  1L81 A;  3JR6 A;  2RBO A;  118L A;  1C6D A;  5LZM A;  1P36 A;  2B75 A;  3OE8 A;  145L A;  5BR2 A;  1CV6 A;  1D3F A;  1QS9 A;  3DN3 A;  4MQT A;  227L A;  3RZE A;  218L A;  162L A;  2B73 A;  4UG2 A;  1DYG A;  230L A;  1DYC A;  3UTX A;  5AX1 A;  188L A;  261L A;  1M0M A;  2KSY A;  1L0M A;  1OWZ A;  3EH3 B;  3PQR A;  3PDS A;  3HU9 A;  3HT7 A;  3GUI A;  1L99 A;  3SN6 R;  3QJR B;  4PXF A;  2KSA A;  4S0W A;  1QT5 A;  4FA7 B;  2LZM A;  1T8A A;  1KG9 A;  182L A;  4BV0 A;  3SB8 A;  2YCZ A;  4GPO A;  1PQM A;  1LI2 A;  1L37 A;  1L39 A;  2R4S A;  3GUN A;  3BVD B;  238L A;  4OO9 A;  2OU0 X;  4EXM A;  3C9L A;  3X3B A;  2O4W A;  3SBB C;  5H2P A;  1L83 A;  5H2M A;  258L A;  4G70 B;  4N4W A;  4X32 A;  2BRD A;  185L A;  1CV1 A;  1L26 A;  1C60 A;  3HU8 A;  5ITC A;  1L94 A;  2NTU A;  157L A;  3C9M A;  1C6E A;  1P8U A;  3OAX A;  2ANX A;  4GYC A;  1L05 A;  1I6S A;  4XTL A;  4EKQ A;  2IGC A;  3HAQ A;  2F47 A;  4EKP A;  1TLA A;  1U19 A;  5H2N A;  1CX6 A;  4W56 A;  197L A;  1VJM A;  5BR5 A;  4BVN A;  144L A;  1L22 A;  4KNF A;  3C83 A;  1SSY A;  4N6H A;  245L A;  1X0I 1;  5G28 A;  3QJQ B;  3HAR A;  2WJL A;  2QPD B;  244L A;  1L0K A;  2RB1 X;  4W57 A;  3FI5 A;  4XTN A;  5B2N A;  3UTV A;  1L64 A;  125L A;  1C6T A;  1NHB A;  1PQO A;  1PQD A;  2ZIY A;  109L A;  1L36 A;  5G36 A;  3ZEV A;  4BEZ A;  2Y02 A;  1FBK A;  148L E;  1L74 A;  1L98 A;  1L30 A;  1XME B;  2NTH A;  1G0Q A;  1UAZ A;  1C3W A;  4XTO A;  3ABW A;  4I7M A;  262L A;  1LGX A;  2QAR C;  3DNA A;  3A7K A;  1L45 A;  1X0K 1;  1L38 A;  1LPY A;  1P2L A;  177L A;  5G54 A;  3REY A;  3QJU B;  5AWZ A;  191L A;  3C8S A;  1CU2 A;  254L A;  1QTZ A;  5B6Z A;  137L A;  239L A;  3PBL A;  4Y9H A;  212L A;  1C6I A;  224L A;  1L55 A;  1L61 A;  1JGJ A;  1LGU A;  1LWG A;  4JQ6 A;  5AX0 A;  1X0S A;  2RB0 X;  2O79 A;  1L97 A;  2I20 A;  3SB6 A;  4W52 A;  4MQS A;  4I7T A;  217L A;  2RBQ A;  3C8R A;  104L A;  1L90 A;  215L A;  173L A;  178L A;  2QPE B;  2B72 A;  1CU5 A;  4W53 A;  175L A;  1D3M A;  163L A;  1KY0 A;  234L A;  1P37 A;  1LYD A;  2ZFE A;  2LC9 A;  3UZA A;  4BUO A;  4HYJ A;  216L A;  5A8E A;  1L72 A;  1CWQ A;  4FAA B;  113L A;  4AQN A;  1QS5 A;  3T45 A;  126L A;  1QSB A;  3C7Z A;  200L A;  1KGB A;  1L9H A;  1T97 A;  2YDO A;  5AHZ A;  1D2W A;  4I7K A;  4EIY A;  4ARQ B;  2OE9 X;  1G06 A;  1P46 A;  3HUA A;  3LZM A;  1MGY A;  3CDO A;  1C63 A;  176L A;  3RFM A;  1LYI A;  2QB0 B;  5TGZ A;  4G7S B;  3HH6 A;  1G1V A;  3SBA A;  1JTM A;  3HT6 A;  1C66 A;  1L77 A;  211L A;  1QM8 A;  4ARM A;  1L41 A;  2I21 A;  5I14 A;  233L A;  1LWK A;  150L A;  4YXA C;  1L51 A;  1L58 A;  252L A;  3P0G A;  1L13 A;  1CX7 A;  1KS3 A;  151L A;  2B6X A;  225L A;  1TN5 A;  213L A;  3DQB A;  1QTD A;  1AP9 A;  4GP8 B;  3CDT A;  195L A;  1L80 A;  3NY8 A;  3UG9 A;  3HH4 A;  242L A;  2X72 A;  3QAK A;  4I7N A;  4IAQ A;  1L44 A;  3AYM A;  5AHY A;  5C1M A;  2RAZ X;  1E12 A;  1L84 A;  3DDL A;  3F9L A;  1H68 A;  1L29 A;  257L A;  1T8G A;  3X3C A;  4ARQ A;  4E97 A;  189L A;  2B6Y A;  1L75 A;  1L82 A;  1B6I A;  2G87 A;  3OE6 A;  3QBK A;  3GUJ A;  1L08 A;  111L A;  2F2Q A;  3QBL A;  1L48 A;  1QTV A;  1C6M A;  3C81 A;  1CV3 A;  5A45 A;  1L87 A;  1L15 A;  3EH5 B;  1L93 A;  102L A;  1QTH A;  1GZM A;  1L49 A;  210L A;  201L A;  2O7A A;  246L A;  4XT3 A;  5ETZ A;  2M3G A;  1P6Y A;  4GP4 B;  1C6J A;  1L28 A;  4IAR A;  3C7W A;  5H2L A;  158L A;  1QT4 A;  5B34 A;  1G0J A;  5B6W A;  1L57 A;  2B7X A;  3C7Y A;  1QKO A;  1L34 A;  5H2O A;  253L A;  4QRY A;  3COD A;  1C6C A;  3DMX A;  3HDE A;  3HUK A;  4MD1 A;  5H2K A;  143L A;  256L A;  3CDR A;  3DN2 A;  1L10 A;  4I7O A;  1JV6 A;  1GU8 A;  1BRR A;  159L A;  1PQJ A;  3DN6 A;  2YDV A;  3S3C B;  166L A;  1JFP A;  1L70 A;  3DN4 A;  127L A;  160L A;  1C6F A;  5G53 A;  3G3X A;  3PXO A;  1L96 A;  1GUE A;  4G71 B;  1L66 A;  1QTC A;  260L A;  131L A;  1L01 A;  3VGA A;  5JJN A;  3C80 A;  4YXC A;  112L A;  1L33 A;  1BM1 A;  1L62 A;  1KG8 A;  5JJE A;  235L A;  1L85 A;  161L A;  1O0A A;  2YCX A;  3FAD A;  4JKV A;  187L A;  1QT3 A;  1R2N A;  2OTY X;  1BRD A;  5ITE A;  2NTG A;  1SWZ A;  115L A;  129L A;  1QUG A;  3CAP A;  2OEA X;  1L65 A;  3QAP A;  180L A;  1G0G A;  3UTW A;  1P8I A;  1QTB A;  3F8V A;  3K2R A;  1S8J A;  2VT4 A;  3HWL A;  1L32 A;  146L A;  4I7P A;  3S8F B;  3WQJ A;  4IB4 A;  4EJ4 A;  3DMZ A;  4BEY A;  3RUN A;  5A44 A;  4IAP A;  3QJT B;  1S51 A;  2HPY A;  3HAS A;  1P7S A;  2Z73 A;  3HUQ A;  1L86 A;  3GUO A;  2ANV A;  4ARL A;  2NTW A;  1DYA A;  3G3W A;  167L A;  1C6Q A;  192L A;  4ARP A;  4LDO A;  1L56 A;  5KKH A;  3UTY A;  1D9W A;  3VW7 A;  3OE0 A;  4PK0 A;  1C69 A;  205L A;  3GUL A;  155L A;  3GUM A;  5B0W A;  1IW9 A;  1M0K A;  231L A;  3ODU A;  1L95 A;  3SB5 A;  4HWL A;  1L20 A;  3D4S A;  4X1H A;  1L40 A;  241L A;  1PY6 A;  1CU3 A;  1L47 A;  3NS0 A;  1G0K A;  221L A;  4XT1 A;  4L6R A;  2J4Y A;  4ZPU A;  3HH5 A;  236L A;  259L A;  130L A;  1WTH A;  2RAY X;  1P8H A;  2LNL A;  1L18 A;  3G3V A;  120L A;  4GBR B;  3NSB A;  196L A;  1L02 A;  3CDQ A;  1D3N A;  3NY9 A;  3V2Y A;  1SSW A;  2YCY A;  1S8L A;  3MBV A;  4AMI A;  1P64 A;  1DYD A;  1Q5J A;  1CVK A;  1L60 A;  1QSQ A;  1DYF A;  1SX2 A;  1H2S A;  1L11 A;  1L68 A;  1L63 A;  139L A;  1CU6 A;  1CUQ A;  1LYH A;  3HAN A;  1LGW A;  214L A;  4G7Q B;  1S53 A;  1L91 A;  1ZWN A;  1L76 A;  5B6V A;  219L A;  4QI1 A;  237L A;  1L07 A;  1QT7 A;  4KLY A;  2Y03 A;  164L A;  4W51 A;  1L79 A;  123L A;  4WW3 A;  1QUO A;  4NC3 A;  3VVK A;  149L A;  1E0P A;  1EHK B;  1OVK A;  1L04 A;  3QJV B;  4XXJ A;  5B35 A;  184L A;  152L A;  165L A;  3EML A;  206L A;  1XEP A;  4I7Q A;  1XIO A;  1L59 A;  5H2I A;  172L A;  181L A;  2B6Z A;  2Y01 A;  3UZC A;  1L54 A;  4EPF A;  4EKR A;  4GBR A;  2Z55 A;  4LZM A;  2EI4 A;  4DKL A;  3HTD A;  1QKP A;  1XJT A;  5H2H A;  3HH3 A;  1KME A;  1CUP A;  1C6G A;  1EPY A;  1LI6 A;  4K5Y A;  142L A;  251L A;  255L A;  4OV0 A;  1F88 A;  4I7J A;  3SB7 A;  1OV5 A;  2F95 A;  1L46 A;  1QT6 A;  3HT9 A;  4UHR A;  3ZPQ A;  1L14 A;  3VHZ A;  190L A;  186L A;  1VGO A;  1L09 A;  3HTB A;  4HYX A;  1HZX A;  1QHJ A;  243L A;  2OE4 X;  1CU0 A;  1L53 A;  1L00 A;  122L A;  5B6Y A;  3HDF A;  1DZE A;  1L92 A;  108L A;  250L A;  183L A;  1CV4 A;  1DYE A;  1C68 A;  2RBP A;  1S54 A;  147L A;  1QUD A;  2I35 A;  2YCW A;  171L A;  4GP5 B;  1C6A A;  1P2R A;  1L21 A;  4EPI A;  2KS9 A;  1CTW A;  1L31 A;  2R4R A;  1JQU A;  1L43 A;  1L27 A;  1L89 A;  4EA3 A;  7LZM A;  2Z6B A;  226L A;  3C82 A;  2B6W A;  2RBN A;  3DN0 A;  1L25 A;  5FJG A;  156L A;  5F8U A;  1T8F A;  1LLH A;  1D3J A;  4I7L A;  4PXK A;  1SWY A;  4G7R B;  3DKE X;  1M0L A;  138L A;  228L A;  3COC A;  209L A;  199L A;  3GUK A;  107L A;  1KW5 A;  2A4T A;  2OE7 X;  4DAJ A;  1PXR A;  1C6N A;  1XJU A;  5DHG A;  3CDV A;  1KY1 A;  103L A;  2OTZ X;  1BRX A;  1L67 A;  249L A;  1C8R A;  4X31 A;  3EH4 B;  4YX7 C;  3ZPR A;  5G2C A;  4DJH A;  1F50 A;  1L23 A;  2CUU A;  1CV5 A;  1AT9 A;  4W54 A;  3AYN A;  1LI3 A;  4MBS A;  5B6X A;  1R84 A;  2HUL A;  1C62 A;  2RH1 A;  1QT8 A;  2Y00 A;  1JTN A;  1XJI A;  2I1X A;  5DYS A;  1L16 A;  4BWB A;  1KW7 A;  169L A;  1T6H A;  3GUP A;  2B6T A;  3QBI A;  128L A;  1OWY A;  232L A;  3SB9 A;  1Q5I A;  248L A;  110L A;  2JAG A;  2L6X A;  198L A;  6LZM A;  5LWE A;  1P3N A;  4LDE A;  1QUH A;  2B70 A;  2LCB A;  1TN0 A;  1LYG A;  4PJZ A;  1ZYT A;  2Q9D A;  1FBB A;  3AM6 A;  3HAP A;  1OVJ A;  4ARJ A;  2RBS A;  240L A;  3DMV A;  1IW6 A;  1G0M A;  1OV7 A;  3HT8 A;  140L A;  1L69 A;  4J4Q A;  5J7A A;  4A4M A;  141L A;  3S8G B;  1JV7 A;  5G2D A;  1P5C A;  1LYE A;  4MD2 A;  1PXS A; 
#chains in the Genus database with same CATH topology
 1IO5 A;  247L A;  3HTG A;  2FYD A;  1OVH A;  2OU8 A;  3A91 A;  2D4J A;  2XBR A;  1VAT A;  1LSF A;  2OU9 A;  4L35 A;  1KNI A;  3AW7 A;  2F32 A;  3RZ4 A;  1C6P A;  4IAS A;  1IXF A;  2A7D A;  1GE2 A;  1T3P A;  1GFR A;  2FBD A;  1L03 A;  4NEB A;  2Y04 A;  222L A;  119L A;  5B1G A;  3KJ6 A;  3V2W A;  1OP9 B;  3WPK A;  2DQH Y;  5KXM A;  1C8S A;  4DYG A;  2YBJ A;  3VG9 A;  5JJJ A;  2RB2 X;  4WG7 A;  5L3H A;  4OWE A;  2AT9 A;  3QDC A;  2Q9E A;  4G72 B;  3PWH A;  1DPX A;  3TXG A;  1IC4 Y;  1L19 A;  1D0K A;  1P56 A;  1CNS A;  5HMV A;  6LYT A;  1TDY A;  1LHM A;  2CDS A;  3WXU A;  1ZUR A;  4GRV A;  4QY9 A;  1L81 A;  2RBO A;  1C10 A;  2I25 L;  145L A;  5BR2 A;  3DN3 A;  4UG2 A;  1OQM A;  1DXJ A;  261L A;  4HJY A;  2BQA A;  5B59 A;  4DC4 A;  5KXK A;  3HT7 A;  3SN6 R;  1QSA A;  4FA7 B;  1IR7 A;  1T8A A;  4DD9 A;  2B5Z A;  1PQM A;  4MCK A;  1LI2 A;  1L37 A;  2R4S A;  2DQC Y;  2ZYC A;  3K3T A;  3C9L A;  1I20 A;  5F16 A;  3SBB C;  3W6A A;  4G70 B;  4N4W A;  1CV1 A;  1C60 A;  1RCM A;  1C6E A;  3OAX A;  4GYC A;  1L05 A;  1I6S A;  4EKQ A;  3HAQ A;  4EKP A;  2W1L A;  3AZ5 A;  5H2N A;  5LYT A;  1VJM A;  5BR5 A;  4BVN A;  2BQE A;  3FI7 A;  1D6P A;  1F0W A;  245L A;  5G28 A;  3HAR A;  2WJL A;  244L A;  4W57 A;  3WVX A;  2Z38 A;  1IR8 A;  4Z98 A;  1RI8 B;  1C6T A;  4B4E A;  1NHB A;  1PQO A;  1IP5 A;  4C5F A;  3A34 A;  4ET9 A;  1UAC Y;  1IWW A;  1L98 A;  1L30 A;  4WM5 A;  2EKS C;  2NTH A;  1UAZ A;  1KIR C;  1OUE A;  4XTO A;  3ABW A;  2QAR C;  3DNA A;  1L45 A;  1X0K 1;  4H93 A;  4PJ2 C;  1HHL A;  191L A;  3C8S A;  254L A;  3E3D A;  1GF5 A;  4Y9H A;  212L A;  1C6I A;  3TXK A;  1L61 A;  4H8Z A;  1GBW A;  2GV0 A;  1LAA A;  4I7T A;  217L A;  1T6V L;  2ZQ4 A;  1IOQ A;  1LYD A;  2LC9 A;  4BUO A;  1GBX A;  1L72 A;  1QTK A;  4N0J A;  4FAA B;  1LJG A;  1L9H A;  4D9Z A;  2OE9 X;  1P46 A;  1MGY A;  3CDO A;  1LCN A;  1LYI A;  2QB0 B;  2VB1 A;  3CSQ A;  4G7S B;  1LSZ A;  1G1V A;  1JTM A;  5B1F A;  1L77 A;  211L A;  3AW6 A;  4J7V A;  2I21 A;  1L41 A;  5F9U A;  1GBZ A;  1REY A;  1L58 A;  1AZF A;  5KKI A;  1C43 A;  3HFM Y;  2LZT A;  1AP9 A;  4GP8 B;  4HP0 A;  1L80 A;  1V7T A;  3A93 A;  3UG9 A;  3AYM A;  5AHY A;  5T3F A;  1E12 A;  1L29 A;  3WPJ A;  4HSF A;  1NQI A;  1LSN A;  2H9K A;  189L A;  1LMP A;  4DS7 E;  1KXW A;  1L75 A;  4RW1 A;  1B6I A;  1L08 A;  2ZQ3 A;  2F2Q A;  3IJU A;  1C6M A;  1CV3 A;  4G4B A;  5LAG A;  102L A;  1L93 A;  4BAD A;  201L A;  3GXK A;  4B1A A;  1C6J A;  1L28 A;  3C7W A;  158L A;  4GN5 C;  5LA8 A;  1L57 A;  4DD7 A;  3C7Y A;  1L34 A;  253L A;  4H9I A;  4QRY A;  3COD A;  1C7P A;  3DMX A;  3AGI A;  143L A;  256L A;  4Z3M A;  2YDV A;  5IEL A;  3S3C B;  5DL9 A;  1C6F A;  4NG1 A;  1IP6 A;  1L66 A;  4ETA A;  3C80 A;  4DD3 A;  1IOR A;  4GCB A;  2ZWB A;  1O0A A;  2YCX A;  3FAD A;  4JKV A;  187L A;  5KY1 A;  3W3E A;  1SWZ A;  1OUC A;  4TWS A;  4HTQ A;  5LYM A;  3P68 A;  3LZT A;  3HWL A;  146L A;  1OUD A;  5FEL A;  3WQJ A;  1LMC A;  2Z39 A;  5A44 A;  3QJT B;  2MEE A;  3EO5 A;  1JIS A;  3TMU A;  3GUO A;  1G7H C;  167L A;  1C6Q A;  3ATO A;  4ARP A;  4NSG A;  4LDO A;  2MEI A;  5KXR A;  1JSE A;  4WM6 A;  4H90 A;  1IOC A;  1JJ1 A;  4WOA A;  3BKH A;  205L A;  3GUL A;  3GUM A;  1JHL A;  5B0W A;  1IX0 A;  2HU1 A;  1WQM A;  1LOZ A;  4HWL A;  1PY6 A;  1L47 A;  4L6R A;  3TXD A;  3HBD A;  2J4Y A;  130L A;  1IY4 A;  1HMK A;  1P8H A;  1L18 A;  3G3V A;  5B06 A;  196L A;  1L02 A;  3MBV A;  5ILF A;  2DQI Y;  1A2Y C;  1UA6 Y;  1L60 A;  1H2S A;  1CU6 A;  4GCE A;  3HAN A;  214L A;  5HNC A;  1NBY C;  1B5U A;  2MEH A;  5B6V A;  1FN5 A;  4QI1 A;  1QT7 A;  1L79 A;  1BWJ A;  1F6R A;  4XJF A;  1EHK B;  3QJV B;  206L A;  3G3A B;  2Y01 A;  4EPF A;  1CKG A;  3AJN A;  3HTD A;  1IVM A;  4WO9 A;  3HH3 A;  4DDC A;  4K5Y A;  142L A;  255L A;  3CT5 A;  5IDD A;  5J7C A;  1C46 A;  2X0A A;  1L14 A;  1WVV A;  5A3Z A;  1IWZ A;  1CU0 A;  1IOT A;  1DZE A;  4XAD A;  1CV4 A;  1C68 A;  171L A;  1L21 A;  1QIO A;  5I5Q A;  1CTW A;  2Y8P A;  2B6W A;  3DN0 A;  1L25 A;  5LVJ A;  5F8U A;  1T8F A;  1D3J A;  4I7L A;  1UBZ A;  4N5R A;  138L A;  4XYY A;  3AGG G;  199L A;  3CDV A;  1TEW A;  2AUB A;  2OTZ X;  4J0L A;  1BRX A;  1GEZ A;  4YX7 C;  5G2C A;  4WL7 A;  5LYZ A;  4DD0 A;  3AYN A;  1GF4 A;  4ML7 A;  4XN6 A;  1L16 A;  1T6H A;  1OUB A;  3WU7 A;  2B6T A;  128L A;  2BQN A;  1Q5I A;  110L A;  135L A;  1HFZ A;  1VED A;  3A96 A;  5LWE A;  4AXT A;  2BQF A;  3ZEK A;  3A67 Y;  4J1B A;  4PJZ A;  3TMX A;  4H92 A;  1YAQ A;  2BLY A;  5J7A A;  3A6C Y;  5G2D A;  1D0M A;  3WUN A;  5F9X A;  1UC0 A;  3FA0 A;  153L A;  1UCQ A;  2L78 A;  3OE9 A;  2WJK A;  3WW6 A;  2PED A;  4WMG A;  3A3R X;  2F93 A;  1B7O A;  5EN0 A;  1LJJ A;  4WL6 A;  4FPD A;  1CJ8 A;  4AMJ A;  1BVK C;  1XFP L;  2YDG A;  1UIE A;  1JJ0 A;  4PGJ B;  5KXL A;  1LSB A;  1PQI A;  1L50 A;  1TBY A;  4H94 A;  3A8Z A;  114L A;  223L A;  2BAA A;  4I7R A;  1C6H A;  2B74 A;  4G9S A;  1YL0 X;  4LYT A;  4B0D A;  4NHI A;  3C8Q A;  1HSW A;  3TXH A;  1QUT A;  1L06 A;  2F4A A;  220L A;  1JKD A;  1YAP A;  3ATN A;  2HUM A;  4H91 A;  1AT5 A;  4UWN A;  1L71 A;  3RNX A;  3JR6 A;  1DI5 A;  1C6D A;  1LJK A;  3OE8 A;  1XEI A;  4I0C A;  1QSW A;  5C6I A;  1CV6 A;  1D3F A;  2BQK A;  4HPI A;  227L A;  3RZE A;  218L A;  2B73 A;  1LJ3 A;  1DYG A;  4WLT A;  3OJP A;  3UTX A;  207L A;  2F4G A;  1M0M A;  1RE2 A;  3EH3 B;  3PQR A;  3HU9 A;  3S3D B;  3QJR B;  4S0W A;  1QT5 A;  1B5W A;  1W6Z A;  2Z18 A;  182L A;  4GPO A;  3GUN A;  2HEB A;  1VFB C;  2HTX A;  4EXM A;  3X3B A;  1LSE A;  2D6B A;  2O4W A;  4N1C C;  5H2M A;  1HEP A;  2BRD A;  185L A;  4LT2 A;  1L94 A;  5KJ9 A;  1LJI A;  1G7I C;  1U19 A;  1CX6 A;  144L A;  3C83 A;  1EQE A;  4N6H A;  1GBS A;  3AZ6 A;  2EPE A;  3WXT A;  2RB1 X;  1NMM A;  4ETE A;  3CT1 A;  1LSA A;  1MEL L;  2HU3 A;  125L A;  1PQD A;  2ZIY A;  3OK0 A;  109L A;  5G36 A;  3ZEV A;  1FBK A;  148L E;  1L74 A;  1YAO A;  1QUS A;  208L A;  1IP2 A;  3QNG A;  4N8Z A;  1G0Q A;  1CKF A;  1DPW A;  1LZR A;  2C8O A;  3WUL A;  1F6S A;  5KXW A;  5DM9 A;  3A7K A;  1L38 A;  1LPY A;  3WL2 A;  5G54 A;  3QJU B;  4M6D A;  5AWZ A;  1CU2 A;  1QTZ A;  3PBL A;  4W96 A;  4KT3 A;  1L55 A;  2D4K A;  1GF6 A;  1LGU A;  4ZEE A;  2O79 A;  1L97 A;  4YF2 A;  1DI4 A;  3IJV A;  1G7J C;  215L A;  5KXT A;  178L A;  4QEQ A;  1XGQ C;  2ZFE A;  3CQL A;  4HYJ A;  216L A;  1OUH A;  1CWQ A;  113L A;  3T45 A;  1QS5 A;  126L A;  1QSB A;  3C7Z A;  1GAY A;  4EMN A;  1RJC B;  4ARQ B;  1G06 A;  7LYZ A;  176L A;  3RFM A;  2BQI A;  3SBA A;  1AT6 A;  1C66 A;  4ARM A;  1YKZ X;  5I14 A;  233L A;  1LWK A;  5E9R A;  1L51 A;  3WYH A;  2CJL A;  225L A;  1TN5 A;  3DQB A;  4H8X A;  2DKV A;  3HH4 A;  1J1O Y;  3TXB A;  3QAK A;  2DQJ Y;  1GE4 A;  4E3U A;  1L84 A;  3F9L A;  1T8G A;  3X3C A;  1HSX A;  5APD A;  1JEF A;  1JKA A;  2B6Y A;  1KIQ C;  1L82 A;  3GUJ A;  1L48 A;  3C81 A;  4R6C A;  1L87 A;  4QGZ A;  4XJB A;  1GZM A;  4XT3 A;  1REX A;  4GP4 B;  1P6Y A;  3TXJ A;  2DBT A;  1JKB A;  1QT4 A;  5B34 A;  1G0J A;  4WLD A;  5B6W A;  2B7X A;  4LT0 A;  1D0L A;  4ZIX A;  4UWV A;  4MD1 A;  4I7O A;  1GU8 A;  1NHE A;  4DQ5 A;  2MEC A;  2I6Z A;  166L A;  1L70 A;  4BAP A;  127L A;  160L A;  3PXO A;  1L96 A;  2ZNW Y;  4ZFP A;  1QTC A;  260L A;  3VGA A;  4U3X B;  5E4P A;  5L9J A;  3B0I A;  1L33 A;  4NGZ A;  1LZN A;  1BM1 A;  5JJE A;  1GFH A;  1B7L A;  1QT3 A;  2OTY X;  3G3B B;  115L A;  5I54 A;  4N1E I;  3QAP A;  180L A;  5JEN B;  3F8V A;  1V7S A;  1GHL A;  2BQG A;  3EMS A;  3RUN A;  1GFK A;  1S51 A;  4Z46 A;  3HAS A;  1P7S A;  4II8 A;  2Z73 A;  4AMI A;  2NTW A;  2ANV A;  4Z41 A;  1DYA A;  1WTM A;  3VWO A;  3BKV A;  2MEA A;  1L56 A;  3UTY A;  1PZY A;  1YL1 X;  1C69 A;  1GFU A;  155L A;  1YAM A;  1IW9 A;  1B7N A;  3LYT A;  4MST A;  1LJH A;  1GB8 A;  1ZVY B;  3SB5 A;  1B7Q A;  4X1H A;  1L40 A;  1IWY A;  1CU3 A;  3NS0 A;  4YEO A;  4ZPU A;  1NWG A;  3HH5 A;  259L A;  1HFY A;  1JTO L;  2ZIJ A;  3NY9 A;  3V2Y A;  1SSW A;  2YCY A;  2PC2 A;  1P64 A;  1HF4 A;  1DYD A;  1GPQ C;  1QSQ A;  1JUG A;  1XEK A;  4DWX A;  1CUQ A;  1LYH A;  2BQH A;  4G7Q B;  4O34 A;  1ZWN A;  4NHS A;  1WQO A;  219L A;  4H9H A;  4W51 A;  2Y03 A;  4GN3 A;  123L A;  4WW3 A;  149L A;  1L04 A;  5B35 A;  1IP1 A;  1XEP A;  1L59 A;  4LGK A;  3WH1 A;  1GAZ A;  2Z55 A;  3A6B Y;  1P2C C;  1B0D A;  4DKL A;  1FLW A;  1XJT A;  1CUP A;  1UUZ C;  251L A;  1F88 A;  2CWI A;  3VHZ A;  186L A;  2BLX A;  4HYX A;  1HZX A;  1BVX A;  122L A;  3M18 B;  4G4H A;  4NGY A;  108L A;  4ETB A;  2RBP A;  2I35 A;  4GP5 B;  2D4I A;  1C6A A;  3RW8 A;  1L31 A;  1HFX A;  4FJR A;  5LVI A;  2XQO A;  1WQR A;  2Z12 A;  2LYM A;  1SWY A;  3DKE X;  3COC A;  2OE7 X;  4YEM A;  1IIZ A;  1D6Q A;  3LYO A;  1H6M A;  1IY3 A;  3TXF A;  3ZPR A;  4DJH A;  1AT9 A;  1CV5 A;  4W54 A;  5ILC A;  1R84 A;  3B72 A;  2RH1 A;  3F6Z A;  3LHM A;  4WLY A;  4DQ7 A;  1LZC A;  4OWA A;  5DYS A;  1BGI A;  3A94 A;  2WAR A;  5DLA A;  1OWY A;  232L A;  4OWH A;  248L A;  2L6X A;  1ZV5 L;  193L A;  1NF5 A;  2LHM A;  1P3N A;  4LDE A;  5I4W A;  5M1Y A;  3AM6 A;  3HAP A;  1IW6 A;  4RLM A;  4NHP A;  140L A;  4HV2 A;  141L A;  1P5C A;  4CHX A;  168L A;  1B5Z A;  1K28 A;  5FDJ A;  5G2A A;  4EKS A;  4LDL A;  2MEB A;  1XGR C;  2H5Z A;  1CKD A;  4W59 A;  5L3I A;  4N9R A;  4NGL A;  5B05 A;  3VI0 A;  1GXX A;  1EQ4 A;  3EBA B;  3DN8 A;  4FBZ A;  1HEW A;  1L24 A;  5AZD A;  170L A;  4NGV A;  1OYU A;  1L88 A;  4TL3 A;  4WM4 A;  2JAF A;  2ZIK A;  1G0P A;  4N4Y B;  2G4P A;  1LMN A;  2MEF A;  1L52 A;  1S52 A;  5LVH A;  3P64 A;  4G4C A;  1L73 A;  1L12 A;  1C6B A;  4QID A;  2ZZL A;  1YKX X;  4YEN A;  3TXE A;  4JR8 A;  1D2Y A;  3N9A A;  5LIO A;  4NWH A;  2XTH A;  3L2X A;  1L0J A;  5H2J A;  1QQY A;  1FLY A;  3NYA A;  1CJ9 A;  2Q0M X;  5FEK A;  1LW9 A;  5I4X A;  2HUK A;  2W1M A;  3T6U A;  1P36 A;  3LYZ A;  1QS9 A;  5LVG A;  230L A;  1FDL Y;  3AB6 A;  4IAT A;  5AX1 A;  4PRU A;  188L A;  1GE3 A;  1OWZ A;  2A7F A;  1IWT A;  4NGJ A;  3PDS A;  3GUI A;  4PXF A;  2LZM A;  1OUI A;  1KG9 A;  4GLA A;  2YCZ A;  1L39 A;  3BVD B;  1B7P A;  1LZY A;  2OU0 X;  5HLL A;  5KXN A;  1J1P Y;  3J4G A;  5H2P A;  258L A;  1IC7 Y;  3AYQ A;  1L26 A;  5ITC A;  3ZVQ B;  2NTU A;  2Z37 A;  157L A;  1HML A;  1TAY A;  3C9M A;  1P8U A;  2ANX A;  1CKH A;  4XTL A;  1A4V A;  2IGC A;  2F47 A;  2ZYP A;  4W56 A;  4LYC A;  1L22 A;  1QTE A;  1SSY A;  5FCP A;  3QJQ B;  4DD1 A;  5B2N A;  2H9J A;  1C08 C;  1L64 A;  1E8L A;  4TUN A;  1L36 A;  4BEZ A;  2Y02 A;  4GCD A;  4OOO A;  1JTP L;  1XME B;  1F10 A;  1UIH A;  1FKQ A;  1BB4 A;  1XGP C;  3CSZ A;  4I7M A;  1LGX A;  1HEO A;  1BHZ A;  3REY A;  177L A;  3B0O A;  5C6L A;  1GF7 A;  5B6Z A;  2G4N A;  5APC A;  224L A;  1YKY X;  1DI3 A;  1LHL A;  1LWG A;  4WM2 A;  5AX0 A;  1X0S A;  1BB6 A;  4NGW A;  4H9E A;  2I20 A;  1LJ4 A;  4NGO A;  1Z55 A;  8LYZ A;  4MQS A;  5HQ1 A;  1LHJ A;  2RBQ A;  4HJV A;  104L A;  1LKS A;  173L A;  1CU5 A;  163L A;  3UZA A;  234L A;  4AQN A;  200L A;  1KGB A;  1T97 A;  5AHZ A;  4I7K A;  4EIY A;  3LZM A;  3HBH A;  1RFP A;  3HH6 A;  4B4J A;  3WU8 A;  1D9U A;  4DT3 A;  150L A;  4NGI A;  4NHQ A;  252L A;  2MED A;  3P0G A;  1CX7 A;  1KS3 A;  2B6X A;  1GFE A;  1LZ6 A;  1IP4 A;  1QTD A;  3CDT A;  5I53 A;  242L A;  2X72 A;  1TCY A;  2RAZ X;  2BQD A;  3D3D A;  4ARQ A;  1LHH A;  1LMO A;  2G87 A;  3QBL A;  1QTV A;  5B07 A;  1L15 A;  5LIN A;  1QTH A;  1L49 A;  2O7A A;  4ETC A;  4B4I A;  4IJ4 A;  5ETZ A;  2M3G A;  4DDB A;  5H2L A;  2YBM A;  1DKJ A;  4NGK A;  1QKO A;  5H2O A;  1GEV A;  3TXI A;  1GBY A;  2XJW A;  5A45 A;  3S8G B;  5H2K A;  1JV6 A;  1L10 A;  1PQJ A;  3DN4 A;  1OUG A;  1LZB A;  1LJF A;  1GUE A;  5JJN A;  3RU5 A;  1JKC A;  4YXC A;  2ZNX Y;  1L62 A;  1L85 A;  161L A;  1GDW A;  1LSC A;  1I56 A;  1R2N A;  1BRD A;  4WM1 A;  3CAP A;  2OEA X;  1L65 A;  4HTN A;  3UTW A;  1P8I A;  3K2R A;  2FBB A;  1GE0 A;  2YBH A;  3WUA A;  4GCF A;  4TSC A;  5KXO A;  4IB4 A;  4EJ4 A;  3DMZ A;  4BEY A;  4IAP A;  3A95 A;  2LZ2 A;  1GB2 A;  3HUQ A;  1L86 A;  1CJ7 A;  3G3W A;  1INU A;  3HBE X;  2NWD X;  4WM3 A;  4BAF A;  5KKH A;  1D9W A;  3VW7 A;  1DKK A;  1JSF A;  2BQJ A;  4I8S A;  1LZ5 A;  4OWB A;  3D4S A;  4ANR A;  1G0K A;  1HEM A;  1WQP A;  4XT1 A;  4HPE A;  4PPO A;  236L A;  1LZS A;  1GB6 A;  1HNL A;  1B9O A;  1LZE A;  4GBR B;  1LSG A;  3WVY A;  4RW2 A;  5KXS A;  1UIF A;  1CVK A;  5KXY A;  1CJ6 A;  1BWH A;  1L11 A;  4KXI A;  139L A;  3B6L A;  4H9A A;  5F81 A;  2YBI A;  1LHI A;  132L A;  4NC3 A;  3VVK A;  4XXJ A;  1B2K A;  1LZ4 A;  5LXW A;  3EML A;  1B7R A;  4I7Q A;  5H2I A;  2B6Z A;  1L54 A;  2DQF C;  4EKR A;  1LYS A;  5LA5 A;  4LZM A;  5KXP A;  4M4O A;  1LJE A;  1QKP A;  1KME A;  4J1A A;  1C6G A;  1EPY A;  1LI6 A;  4RDS A;  3J6K A;  4OV0 A;  4I7J A;  2G4Q A;  3RT5 X;  1L46 A;  2DQE Y;  3HT9 A;  4UHR A;  3ZPQ A;  1VGO A;  1FLQ A;  3HTB A;  1GF9 A;  1QHJ A;  3P66 A;  1L53 A;  1L00 A;  4H9C A;  3HDF A;  250L A;  1S54 A;  147L A;  1QUD A;  4B49 A;  2YCW A;  1IP7 A;  1P2R A;  2R4R A;  1JQU A;  1L43 A;  1L89 A;  4EA3 A;  4LYZ A;  4XJI A;  1B5V A;  1IEE A;  1LLH A;  2YVB A;  5FST A;  1YRO A;  2XBS A;  3TMV A;  4PXK A;  4H8Y A;  4HTK A;  4LT3 A;  2LYZ A;  2BQM A;  2BPU A;  209L A;  3GUK A;  1KW5 A;  1I1Z A;  2A4T A;  4HV1 A;  1C6N A;  1XJU A;  103L A;  1LJN A;  4OWC A;  2LYO A;  3A92 A;  1C8R A;  4XJH A;  2EQL A;  2RSC A;  3EH4 B;  2MEG A;  1GF0 A;  2CUU A;  4GCC A;  3WW5 A;  4MBS A;  1LI3 A;  1C62 A;  4P2E A;  1QT8 A;  1XJI A;  2I1X A;  2EIZ C;  4BWB A;  1KW7 A;  4XEN A;  1GE1 A;  4QDN A;  1IP3 A;  1JPO A;  1BQL Y;  1WVU A;  1HC0 A;  2JAG A;  1OUJ A;  1GB7 A;  1QUH A;  2B70 A;  1LYG A;  3M3U A;  4ARJ A;  2RBS A;  1OV7 A;  3HT8 A;  1L69 A;  3CB7 A;  5FHW A;  1IWV A;  1B7S A;  1LYO A;  1LYE A;  4PHI A;  5EBH A;  1PXS A;  1JIT A;  1C67 A;  2F30 A;  3UON A;  1C65 A;  4LYO A;  5DHH A;  4A7D A;  1LMT A;  3QBG A;  4LYB A;  5A3E A;  4CFO A;  1SX7 A;  1G07 A;  1L17 A;  4ARM B;  3DN1 A;  5K7O A;  1G1W A;  1VDT A;  1C61 A;  3HAO A;  3QJS B;  1LZ9 A;  1F4Z A;  4LFP A;  4GLV A;  1CV0 A;  2RBR A;  4XJG A;  1G0L A;  1XGT C;  2HUB A;  3S3B B;  4WLX A;  1L35 A;  1LYJ A;  4BS7 A;  229L A;  3HTF A;  1DYB A;  1LSP A;  3L64 A;  1LYY A;  3WU9 A;  1C64 A;  4EOF A;  4WAV A;  1C6K A;  4W58 A;  1L42 A;  2DQG Y;  1WQQ A;  2W1Y A;  174L A;  1LN6 A;  2KSB A;  1HEL A;  5HNL A;  4W55 A;  1KXY A;  4NIJ A;  1C6L A;  1GB5 A;  1LYF A;  3QE8 A;  4KL7 A;  3D9A C;  1LSD A;  4I7S A;  1EQ5 A;  2Z2E A;  1PQK A;  118L A;  5LZM A;  2B75 A;  1LPI A;  1LZ8 A;  1DQJ C;  1UID A;  3QY4 A;  4MQT A;  162L A;  1DYC A;  1WQN A;  1LZT A;  2KSY A;  1L0M A;  1L99 A;  1GXV 2;  1WTN A;  4GN4 A;  2KSA A;  4BV0 A;  3SB8 A;  1IWX A;  4OOT A;  3T36 A;  238L A;  4OO9 A;  1HEN A;  1SLY A;  1ZMY L;  3AGH A;  1L83 A;  4H9B A;  3TMW A;  4X32 A;  1REZ A;  3HU8 A;  1UIB A;  1SQ2 L;  1IWU A;  1TLA A;  197L A;  1AM7 A;  1LZD A;  4KNF A;  4ET8 A;  1LZG A;  1B5X A;  1X0I 1;  1GB9 A;  2W1X A;  2QPD B;  2HEF A;  1L0K A;  4HJZ A;  4KPM A;  1LKR A;  3FI5 A;  4XTN A;  3UTV A;  1YAN A;  4WO6 A;  2ZIL A;  4PRQ A;  3W6D A;  4CJ2 A;  3ZVQ A;  1C3W A;  1EL1 A;  262L A;  1O23 A;  5APF A;  1P2L A;  5IHG A;  2HEC A;  4H1P A;  137L A;  239L A;  1YIK A;  3IWR A;  1HER A;  1JGJ A;  3WMK A;  5D5C A;  4JQ6 A;  1XSF A;  1VAU A;  133L A;  2BQO A;  2RB0 X;  1JWR A;  1KXX A;  1GF8 A;  4G49 A;  3SB6 A;  4W52 A;  3C8R A;  1L90 A;  1LYZ A;  2QPE B;  2B72 A;  2DQD Y;  4W53 A;  175L A;  1D3M A;  1KY0 A;  1P37 A;  5A8E A;  4R0F A;  3SP3 A;  2YDO A;  1D2W A;  1JIY A;  2IFF Y;  3HUA A;  2BQC A;  1C63 A;  1IR9 A;  3AZ4 A;  5I4Y A;  5TGZ A;  2DQA A;  2Z19 A;  3HT6 A;  1QM8 A;  4NG8 A;  1NBZ C;  4YXA C;  1GWD A;  1L13 A;  151L A;  213L A;  3LN2 A;  195L A;  4CFP A;  3NY8 A;  1UIA A;  2CGI A;  4I7N A;  3W6C A;  4IAQ A;  1QDR A;  1L44 A;  1LHK A;  6LYZ A;  5C1M A;  1IC5 Y;  4RLN A;  3DDL A;  5C6J A;  1H68 A;  257L A;  4NSI A;  3EXD A;  1YQV Y;  4E97 A;  1BWI A;  1H87 A;  1B5Y A;  1GB3 A;  1J1X Y;  3LYM A;  3OE6 A;  3QBK A;  4TTD A;  111L A;  3WUM A;  9LYZ A;  3EH5 B;  210L A;  2HED A;  246L A;  5APE A;  4IAR A;  2D91 A;  3N9C A;  4NSJ A;  1KIP C;  2Z2F A;  1N4F A;  1YIL A;  3N9E A;  2F2N A;  1C6C A;  3HDE A;  4X3B A;  3HUK A;  4NSH A;  3CDR A;  3DN2 A;  3LZ2 A;  1BRR A;  159L A;  3DN6 A;  3WPL A;  1VDP A;  1CKC A;  1JFP A;  1W08 A;  5G53 A;  3G3X A;  4G71 B;  4TX7 A;  131L A;  1L01 A;  112L A;  3A90 A;  4LYM A;  1KG8 A;  235L A;  5DN4 A;  1GF3 A;  4MR1 A;  5ITE A;  2NTG A;  129L A;  1QUG A;  4LZT A;  5F14 A;  134L A;  1G0G A;  4LFX A;  1QTB A;  2VT4 A;  1S8J A;  1PS5 A;  5LVK A;  1L32 A;  4I7P A;  3S8F B;  5II3 A;  1C45 A;  5KKJ A;  1GFV A;  1BB7 A;  4YOP A;  2HPY A;  1LMQ A;  4C3W A;  3A3Q A;  4ARL A;  4H9F A;  1DZB X;  192L A;  1LTM A;  1FKV A;  3OE0 A;  4NWE A;  4PK0 A;  3KAM A;  3GXR A;  1M0K A;  231L A;  3ODU A;  1L95 A;  1GFG A;  1NDG C;  1L20 A;  241L A;  221L A;  1VDQ A;  1UCO A;  4AGA A;  1JTT L;  3CSR A;  1IOS A;  3B0K A;  1WTH A;  3W6F A;  3P4Z A;  2RAY X;  3W6B A;  2LNL A;  120L A;  3NSB A;  3CDQ A;  1D3N A;  5AMY A;  1GBO A;  1S8L A;  4FDY A;  1AKI A;  1Q5J A;  1FBI X;  1LZ1 A;  4DD2 A;  1DYF A;  2HEE A;  1SX2 A;  1L68 A;  1L63 A;  1QDT A;  1MLC E;  5KXZ A;  1LGW A;  1S53 A;  1L91 A;  1L76 A;  4ETD A;  237L A;  1L07 A;  4KLY A;  4OW1 A;  164L A;  1XGU C;  2YBN A;  4NY5 A;  4CGE A;  1QUO A;  1E0P A;  3MGW A;  1OVK A;  1NKH A;  184L A;  152L A;  165L A;  3AZ7 A;  1UIC A;  1XIO A;  172L A;  181L A;  3UZC A;  1BB5 A;  4LT1 A;  4GBR A;  1JJ3 A;  2EI4 A;  194L A;  1G7L C;  2YSS C;  1LSY A;  3W6E A;  5H2H A;  2BQB A;  2YBL A;  1UIG A;  1NDM C;  3SB7 A;  1OV5 A;  2F95 A;  1QT6 A;  190L A;  1L09 A;  1ALC A;  3P65 A;  2I26 L;  243L A;  2OE4 X;  1GDX A;  5B6Y A;  2HEA A;  1B7M A;  1L92 A;  183L A;  1DYE A;  4NHT A;  2BQL A;  4L41 A;  4EPI A;  2KS9 A;  5HMJ A;  1XEJ A;  1L27 A;  7LZM A;  2Z6B A;  226L A;  3C82 A;  4NFV A;  5DN5 A;  1LZA A;  2RBN A;  5FJG A;  156L A;  1ZVH L;  3CT0 A;  1G7M C;  2FYC A;  4G7R B;  1HEQ A;  1M0L A;  228L A;  1OUF A;  4DAJ A;  107L A;  5DHG A;  4XJD A;  1PXR A;  154L A;  1KY1 A;  4W94 A;  1GFJ A;  4DDA A;  1L67 A;  249L A;  1GB0 A;  4X31 A;  1FLU A;  1BB3 A;  1F50 A;  1L23 A;  3FE0 A;  1LMA A;  5B6X A;  1LSM A;  2HUL A;  2Y00 A;  1JTN A;  5LAF A;  1GFA A;  169L A;  5KXX A;  3GUP A;  3QBI A;  5D5F A;  3SB9 A;  4TSB A;  2IHL A;  3ULR A;  198L A;  4WG1 A;  6LZM A;  1OUA A;  4YM8 A;  2LCB A;  1TN0 A;  1ZYT A;  2Q9D A;  4UWU A;  1FBB A;  2C8P A;  1OVJ A;  1VDS A;  1GD6 A;  240L A;  4DQJ A;  3DMV A;  1GFT A;  1G0M A;  4J4Q A;  4A4M A;  2N5Z A;  1REM A;  1JV7 A;  4MD2 A; 
#chains in the Genus database with same CATH homology
 1IO5 A;  247L A;  3HTG A;  2FYD A;  1OVH A;  2OU8 A;  3A91 A;  2D4J A;  2XBR A;  1VAT A;  1LSF A;  2OU9 A;  4L35 A;  1KNI A;  3AW7 A;  2F32 A;  3RZ4 A;  1C6P A;  4IAS A;  1IXF A;  2A7D A;  1GE2 A;  1T3P A;  1GFR A;  2FBD A;  1L03 A;  4NEB A;  2Y04 A;  222L A;  119L A;  5B1G A;  3KJ6 A;  3V2W A;  1OP9 B;  3WPK A;  2DQH Y;  5KXM A;  1C8S A;  4DYG A;  2YBJ A;  3VG9 A;  5JJJ A;  2RB2 X;  4WG7 A;  5L3H A;  4OWE A;  2AT9 A;  3QDC A;  2Q9E A;  4G72 B;  3PWH A;  1DPX A;  3TXG A;  1IC4 Y;  1L19 A;  1D0K A;  1P56 A;  1CNS A;  5HMV A;  6LYT A;  1TDY A;  1LHM A;  2CDS A;  3WXU A;  1ZUR A;  4GRV A;  4QY9 A;  1L81 A;  2RBO A;  1C10 A;  2I25 L;  145L A;  5BR2 A;  3DN3 A;  4UG2 A;  1OQM A;  1DXJ A;  261L A;  4HJY A;  2BQA A;  5B59 A;  4DC4 A;  5KXK A;  3HT7 A;  3SN6 R;  1QSA A;  4FA7 B;  1IR7 A;  1T8A A;  4DD9 A;  2B5Z A;  1PQM A;  4MCK A;  1LI2 A;  1L37 A;  2R4S A;  2DQC Y;  2ZYC A;  3K3T A;  3C9L A;  1I20 A;  5F16 A;  3SBB C;  3W6A A;  4G70 B;  4N4W A;  1CV1 A;  1C60 A;  1RCM A;  1C6E A;  3OAX A;  4GYC A;  1L05 A;  1I6S A;  4EKQ A;  3HAQ A;  4EKP A;  2W1L A;  3AZ5 A;  5H2N A;  5LYT A;  1VJM A;  5BR5 A;  4BVN A;  2BQE A;  3FI7 A;  1D6P A;  1F0W A;  245L A;  5G28 A;  3HAR A;  2WJL A;  244L A;  4W57 A;  3WVX A;  2Z38 A;  1IR8 A;  4Z98 A;  1RI8 B;  1C6T A;  4B4E A;  1NHB A;  1PQO A;  1IP5 A;  4C5F A;  3A34 A;  4ET9 A;  1UAC Y;  1IWW A;  1L98 A;  1L30 A;  4WM5 A;  2EKS C;  2NTH A;  1UAZ A;  1KIR C;  1OUE A;  4XTO A;  3ABW A;  2QAR C;  3DNA A;  1L45 A;  1X0K 1;  4H93 A;  4PJ2 C;  1HHL A;  191L A;  3C8S A;  254L A;  3E3D A;  1GF5 A;  4Y9H A;  212L A;  1C6I A;  3TXK A;  1L61 A;  4H8Z A;  1GBW A;  2GV0 A;  1LAA A;  4I7T A;  217L A;  1T6V L;  2ZQ4 A;  1IOQ A;  1LYD A;  2LC9 A;  4BUO A;  1GBX A;  1L72 A;  1QTK A;  4N0J A;  4FAA B;  1LJG A;  1L9H A;  4D9Z A;  2OE9 X;  1P46 A;  1MGY A;  3CDO A;  1LCN A;  1LYI A;  2QB0 B;  2VB1 A;  3CSQ A;  4G7S B;  1LSZ A;  1G1V A;  1JTM A;  5B1F A;  1L77 A;  211L A;  3AW6 A;  4J7V A;  2I21 A;  1L41 A;  5F9U A;  1GBZ A;  1REY A;  1L58 A;  1AZF A;  5KKI A;  1C43 A;  3HFM Y;  2LZT A;  1AP9 A;  4GP8 B;  4HP0 A;  1L80 A;  1V7T A;  3A93 A;  3UG9 A;  3AYM A;  5AHY A;  5T3F A;  1E12 A;  1L29 A;  3WPJ A;  4HSF A;  1NQI A;  1LSN A;  2H9K A;  189L A;  1LMP A;  4DS7 E;  1KXW A;  1L75 A;  4RW1 A;  1B6I A;  1L08 A;  2ZQ3 A;  2F2Q A;  3IJU A;  1C6M A;  1CV3 A;  4G4B A;  5LAG A;  102L A;  1L93 A;  4BAD A;  201L A;  3GXK A;  4B1A A;  1C6J A;  1L28 A;  3C7W A;  158L A;  4GN5 C;  5LA8 A;  1L57 A;  4DD7 A;  3C7Y A;  1L34 A;  253L A;  4H9I A;  4QRY A;  3COD A;  1C7P A;  3DMX A;  3AGI A;  143L A;  256L A;  4Z3M A;  2YDV A;  5IEL A;  3S3C B;  5DL9 A;  1C6F A;  4NG1 A;  1IP6 A;  1L66 A;  4ETA A;  3C80 A;  4DD3 A;  1IOR A;  4GCB A;  2ZWB A;  1O0A A;  2YCX A;  3FAD A;  4JKV A;  187L A;  5KY1 A;  3W3E A;  1SWZ A;  1OUC A;  4TWS A;  4HTQ A;  5LYM A;  3P68 A;  3LZT A;  3HWL A;  146L A;  1OUD A;  5FEL A;  3WQJ A;  1LMC A;  2Z39 A;  5A44 A;  3QJT B;  2MEE A;  3EO5 A;  1JIS A;  3TMU A;  3GUO A;  1G7H C;  167L A;  1C6Q A;  3ATO A;  4ARP A;  4NSG A;  4LDO A;  2MEI A;  5KXR A;  1JSE A;  4WM6 A;  4H90 A;  1IOC A;  1JJ1 A;  4WOA A;  3BKH A;  205L A;  3GUL A;  3GUM A;  1JHL A;  5B0W A;  1IX0 A;  2HU1 A;  1WQM A;  1LOZ A;  4HWL A;  1PY6 A;  1L47 A;  4L6R A;  3TXD A;  3HBD A;  2J4Y A;  130L A;  1IY4 A;  1HMK A;  1P8H A;  1L18 A;  3G3V A;  5B06 A;  196L A;  1L02 A;  3MBV A;  5ILF A;  2DQI Y;  1A2Y C;  1UA6 Y;  1L60 A;  1H2S A;  1CU6 A;  4GCE A;  3HAN A;  214L A;  5HNC A;  1NBY C;  1B5U A;  2MEH A;  5B6V A;  1FN5 A;  4QI1 A;  1QT7 A;  1L79 A;  1BWJ A;  1F6R A;  4XJF A;  1EHK B;  3QJV B;  206L A;  3G3A B;  2Y01 A;  4EPF A;  1CKG A;  3AJN A;  3HTD A;  1IVM A;  4WO9 A;  3HH3 A;  4DDC A;  4K5Y A;  142L A;  255L A;  3CT5 A;  5IDD A;  5J7C A;  1C46 A;  2X0A A;  1L14 A;  1WVV A;  5A3Z A;  1IWZ A;  1CU0 A;  1IOT A;  1DZE A;  4XAD A;  1CV4 A;  1C68 A;  171L A;  1L21 A;  1QIO A;  5I5Q A;  1CTW A;  2Y8P A;  2B6W A;  3DN0 A;  1L25 A;  5LVJ A;  5F8U A;  1T8F A;  1D3J A;  4I7L A;  1UBZ A;  4N5R A;  138L A;  4XYY A;  3AGG G;  199L A;  3CDV A;  1TEW A;  2AUB A;  2OTZ X;  4J0L A;  1BRX A;  1GEZ A;  4YX7 C;  5G2C A;  4WL7 A;  5LYZ A;  4DD0 A;  3AYN A;  1GF4 A;  4ML7 A;  4XN6 A;  1L16 A;  1T6H A;  1OUB A;  3WU7 A;  2B6T A;  128L A;  2BQN A;  1Q5I A;  110L A;  135L A;  1HFZ A;  1VED A;  3A96 A;  5LWE A;  4AXT A;  2BQF A;  3ZEK A;  3A67 Y;  4J1B A;  4PJZ A;  3TMX A;  4H92 A;  1YAQ A;  2BLY A;  5J7A A;  3A6C Y;  5G2D A;  1D0M A;  3WUN A;  5F9X A;  1UC0 A;  3FA0 A;  153L A;  1UCQ A;  2L78 A;  3OE9 A;  2WJK A;  3WW6 A;  2PED A;  4WMG A;  3A3R X;  2F93 A;  1B7O A;  5EN0 A;  1LJJ A;  4WL6 A;  4FPD A;  1CJ8 A;  4AMJ A;  1BVK C;  1XFP L;  2YDG A;  1UIE A;  1JJ0 A;  4PGJ B;  5KXL A;  1LSB A;  1PQI A;  1L50 A;  1TBY A;  4H94 A;  3A8Z A;  114L A;  223L A;  2BAA A;  4I7R A;  1C6H A;  2B74 A;  4G9S A;  1YL0 X;  4LYT A;  4B0D A;  4NHI A;  3C8Q A;  1HSW A;  3TXH A;  1QUT A;  1L06 A;  2F4A A;  220L A;  1JKD A;  1YAP A;  3ATN A;  2HUM A;  4H91 A;  1AT5 A;  4UWN A;  1L71 A;  3RNX A;  3JR6 A;  1DI5 A;  1C6D A;  1LJK A;  3OE8 A;  1XEI A;  4I0C A;  1QSW A;  5C6I A;  1CV6 A;  1D3F A;  2BQK A;  4HPI A;  227L A;  3RZE A;  218L A;  2B73 A;  1LJ3 A;  1DYG A;  4WLT A;  3OJP A;  3UTX A;  207L A;  2F4G A;  1M0M A;  1RE2 A;  3EH3 B;  3PQR A;  3HU9 A;  3S3D B;  3QJR B;  4S0W A;  1QT5 A;  1B5W A;  1W6Z A;  2Z18 A;  182L A;  4GPO A;  3GUN A;  2HEB A;  1VFB C;  2HTX A;  4EXM A;  3X3B A;  1LSE A;  2D6B A;  2O4W A;  4N1C C;  5H2M A;  1HEP A;  2BRD A;  185L A;  4LT2 A;  1L94 A;  5KJ9 A;  1LJI A;  1G7I C;  1U19 A;  1CX6 A;  144L A;  3C83 A;  1EQE A;  4N6H A;  1GBS A;  3AZ6 A;  2EPE A;  3WXT A;  2RB1 X;  1NMM A;  4ETE A;  3CT1 A;  1LSA A;  1MEL L;  2HU3 A;  125L A;  1PQD A;  2ZIY A;  3OK0 A;  109L A;  5G36 A;  3ZEV A;  1FBK A;  148L E;  1L74 A;  1YAO A;  1QUS A;  208L A;  1IP2 A;  3QNG A;  4N8Z A;  1G0Q A;  1CKF A;  1DPW A;  1LZR A;  2C8O A;  3WUL A;  1F6S A;  5KXW A;  5DM9 A;  3A7K A;  1L38 A;  1LPY A;  3WL2 A;  5G54 A;  3QJU B;  4M6D A;  5AWZ A;  1CU2 A;  1QTZ A;  3PBL A;  4W96 A;  4KT3 A;  1L55 A;  2D4K A;  1GF6 A;  1LGU A;  4ZEE A;  2O79 A;  1L97 A;  4YF2 A;  1DI4 A;  3IJV A;  1G7J C;  215L A;  5KXT A;  178L A;  4QEQ A;  1XGQ C;  2ZFE A;  3CQL A;  4HYJ A;  216L A;  1OUH A;  1CWQ A;  113L A;  3T45 A;  1QS5 A;  126L A;  1QSB A;  3C7Z A;  1GAY A;  4EMN A;  1RJC B;  4ARQ B;  1G06 A;  7LYZ A;  176L A;  3RFM A;  2BQI A;  3SBA A;  1AT6 A;  1C66 A;  4ARM A;  1YKZ X;  5I14 A;  233L A;  1LWK A;  5E9R A;  1L51 A;  3WYH A;  2CJL A;  225L A;  1TN5 A;  3DQB A;  4H8X A;  2DKV A;  3HH4 A;  1J1O Y;  3TXB A;  3QAK A;  2DQJ Y;  1GE4 A;  4E3U A;  1L84 A;  3F9L A;  1T8G A;  3X3C A;  1HSX A;  5APD A;  1JEF A;  1JKA A;  2B6Y A;  1KIQ C;  1L82 A;  3GUJ A;  1L48 A;  3C81 A;  4R6C A;  1L87 A;  4QGZ A;  4XJB A;  1GZM A;  4XT3 A;  1REX A;  4GP4 B;  1P6Y A;  3TXJ A;  2DBT A;  1JKB A;  1QT4 A;  5B34 A;  1G0J A;  4WLD A;  5B6W A;  2B7X A;  4LT0 A;  1D0L A;  4ZIX A;  4UWV A;  4MD1 A;  4I7O A;  1GU8 A;  1NHE A;  4DQ5 A;  2MEC A;  2I6Z A;  166L A;  1L70 A;  4BAP A;  127L A;  160L A;  3PXO A;  1L96 A;  2ZNW Y;  4ZFP A;  1QTC A;  260L A;  3VGA A;  4U3X B;  5E4P A;  5L9J A;  3B0I A;  1L33 A;  4NGZ A;  1LZN A;  1BM1 A;  5JJE A;  1GFH A;  1B7L A;  1QT3 A;  2OTY X;  3G3B B;  115L A;  5I54 A;  4N1E I;  3QAP A;  180L A;  5JEN B;  3F8V A;  1V7S A;  1GHL A;  2BQG A;  3EMS A;  3RUN A;  1GFK A;  1S51 A;  4Z46 A;  3HAS A;  1P7S A;  4II8 A;  2Z73 A;  4AMI A;  2NTW A;  2ANV A;  4Z41 A;  1DYA A;  1WTM A;  3VWO A;  3BKV A;  2MEA A;  1L56 A;  3UTY A;  1PZY A;  1YL1 X;  1C69 A;  1GFU A;  155L A;  1YAM A;  1IW9 A;  1B7N A;  3LYT A;  4MST A;  1LJH A;  1GB8 A;  1ZVY B;  3SB5 A;  1B7Q A;  4X1H A;  1L40 A;  1IWY A;  1CU3 A;  3NS0 A;  4YEO A;  4ZPU A;  1NWG A;  3HH5 A;  259L A;  1HFY A;  1JTO L;  2ZIJ A;  3NY9 A;  3V2Y A;  1SSW A;  2YCY A;  2PC2 A;  1P64 A;  1HF4 A;  1DYD A;  1GPQ C;  1QSQ A;  1JUG A;  1XEK A;  4DWX A;  1CUQ A;  1LYH A;  2BQH A;  4G7Q B;  4O34 A;  1ZWN A;  4NHS A;  1WQO A;  219L A;  4H9H A;  4W51 A;  2Y03 A;  4GN3 A;  123L A;  4WW3 A;  149L A;  1L04 A;  5B35 A;  1IP1 A;  1XEP A;  1L59 A;  4LGK A;  3WH1 A;  1GAZ A;  2Z55 A;  3A6B Y;  1P2C C;  1B0D A;  4DKL A;  1FLW A;  1XJT A;  1CUP A;  1UUZ C;  251L A;  1F88 A;  2CWI A;  3VHZ A;  186L A;  2BLX A;  4HYX A;  1HZX A;  1BVX A;  122L A;  3M18 B;  4G4H A;  4NGY A;  108L A;  4ETB A;  2RBP A;  2I35 A;  4GP5 B;  2D4I A;  1C6A A;  3RW8 A;  1L31 A;  1HFX A;  4FJR A;  5LVI A;  2XQO A;  1WQR A;  2Z12 A;  2LYM A;  1SWY A;  3DKE X;  3COC A;  2OE7 X;  4YEM A;  1IIZ A;  1D6Q A;  3LYO A;  1H6M A;  1IY3 A;  3TXF A;  3ZPR A;  4DJH A;  1AT9 A;  1CV5 A;  4W54 A;  5ILC A;  1R84 A;  3B72 A;  2RH1 A;  3F6Z A;  3LHM A;  4WLY A;  4DQ7 A;  1LZC A;  4OWA A;  5DYS A;  1BGI A;  3A94 A;  2WAR A;  5DLA A;  1OWY A;  232L A;  4OWH A;  248L A;  2L6X A;  1ZV5 L;  193L A;  1NF5 A;  2LHM A;  1P3N A;  4LDE A;  5I4W A;  5M1Y A;  3AM6 A;  3HAP A;  1IW6 A;  4RLM A;  4NHP A;  140L A;  4HV2 A;  141L A;  1P5C A;  4CHX A;  168L A;  1B5Z A;  1K28 A;  5FDJ A;  5G2A A;  4EKS A;  4LDL A;  2MEB A;  1XGR C;  2H5Z A;  1CKD A;  4W59 A;  5L3I A;  4N9R A;  4NGL A;  5B05 A;  3VI0 A;  1GXX A;  1EQ4 A;  3EBA B;  3DN8 A;  4FBZ A;  1HEW A;  1L24 A;  5AZD A;  170L A;  4NGV A;  1OYU A;  1L88 A;  4TL3 A;  4WM4 A;  2JAF A;  2ZIK A;  1G0P A;  4N4Y B;  2G4P A;  1LMN A;  2MEF A;  1L52 A;  1S52 A;  5LVH A;  3P64 A;  4G4C A;  1L73 A;  1L12 A;  1C6B A;  4QID A;  2ZZL A;  1YKX X;  4YEN A;  3TXE A;  4JR8 A;  1D2Y A;  3N9A A;  5LIO A;  4NWH A;  2XTH A;  3L2X A;  1L0J A;  5H2J A;  1QQY A;  1FLY A;  3NYA A;  1CJ9 A;  2Q0M X;  5FEK A;  1LW9 A;  5I4X A;  2HUK A;  2W1M A;  3T6U A;  1P36 A;  3LYZ A;  1QS9 A;  5LVG A;  230L A;  1FDL Y;  3AB6 A;  4IAT A;  5AX1 A;  4PRU A;  188L A;  1GE3 A;  1OWZ A;  2A7F A;  1IWT A;  4NGJ A;  3PDS A;  3GUI A;  4PXF A;  2LZM A;  1OUI A;  1KG9 A;  4GLA A;  2YCZ A;  1L39 A;  3BVD B;  1B7P A;  1LZY A;  2OU0 X;  5HLL A;  5KXN A;  1J1P Y;  3J4G A;  5H2P A;  258L A;  1IC7 Y;  3AYQ A;  1L26 A;  5ITC A;  3ZVQ B;  2NTU A;  2Z37 A;  157L A;  1HML A;  1TAY A;  3C9M A;  1P8U A;  2ANX A;  1CKH A;  4XTL A;  1A4V A;  2IGC A;  2F47 A;  2ZYP A;  4W56 A;  4LYC A;  1L22 A;  1QTE A;  1SSY A;  5FCP A;  3QJQ B;  4DD1 A;  5B2N A;  2H9J A;  1C08 C;  1L64 A;  1E8L A;  4TUN A;  1L36 A;  4BEZ A;  2Y02 A;  4GCD A;  4OOO A;  1JTP L;  1XME B;  1F10 A;  1UIH A;  1FKQ A;  1BB4 A;  1XGP C;  3CSZ A;  4I7M A;  1LGX A;  1HEO A;  1BHZ A;  3REY A;  177L A;  3B0O A;  5C6L A;  1GF7 A;  5B6Z A;  2G4N A;  5APC A;  224L A;  1YKY X;  1DI3 A;  1LHL A;  1LWG A;  4WM2 A;  5AX0 A;  1X0S A;  1BB6 A;  4NGW A;  4H9E A;  2I20 A;  1LJ4 A;  4NGO A;  1Z55 A;  8LYZ A;  4MQS A;  5HQ1 A;  1LHJ A;  2RBQ A;  4HJV A;  104L A;  1LKS A;  173L A;  1CU5 A;  163L A;  3UZA A;  234L A;  4AQN A;  200L A;  1KGB A;  1T97 A;  5AHZ A;  4I7K A;  4EIY A;  3LZM A;  3HBH A;  1RFP A;  3HH6 A;  4B4J A;  3WU8 A;  1D9U A;  4DT3 A;  150L A;  4NGI A;  4NHQ A;  252L A;  2MED A;  3P0G A;  1CX7 A;  1KS3 A;  2B6X A;  1GFE A;  1LZ6 A;  1IP4 A;  1QTD A;  3CDT A;  5I53 A;  242L A;  2X72 A;  1TCY A;  2RAZ X;  2BQD A;  3D3D A;  4ARQ A;  1LHH A;  1LMO A;  2G87 A;  3QBL A;  1QTV A;  5B07 A;  1L15 A;  5LIN A;  1QTH A;  1L49 A;  2O7A A;  4ETC A;  4B4I A;  4IJ4 A;  5ETZ A;  2M3G A;  4DDB A;  5H2L A;  2YBM A;  1DKJ A;  4NGK A;  1QKO A;  5H2O A;  1GEV A;  3TXI A;  1GBY A;  2XJW A;  5A45 A;  3S8G B;  5H2K A;  1JV6 A;  1L10 A;  1PQJ A;  3DN4 A;  1OUG A;  1LZB A;  1LJF A;  1GUE A;  5JJN A;  3RU5 A;  1JKC A;  4YXC A;  2ZNX Y;  1L62 A;  1L85 A;  161L A;  1GDW A;  1LSC A;  1I56 A;  1R2N A;  1BRD A;  4WM1 A;  3CAP A;  2OEA X;  1L65 A;  4HTN A;  3UTW A;  1P8I A;  3K2R A;  2FBB A;  1GE0 A;  2YBH A;  3WUA A;  4GCF A;  4TSC A;  5KXO A;  4IB4 A;  4EJ4 A;  3DMZ A;  4BEY A;  4IAP A;  3A95 A;  2LZ2 A;  1GB2 A;  3HUQ A;  1L86 A;  1CJ7 A;  3G3W A;  1INU A;  3HBE X;  2NWD X;  4WM3 A;  4BAF A;  5KKH A;  1D9W A;  3VW7 A;  1DKK A;  1JSF A;  2BQJ A;  4I8S A;  1LZ5 A;  4OWB A;  3D4S A;  4ANR A;  1G0K A;  1HEM A;  1WQP A;  4XT1 A;  4HPE A;  4PPO A;  236L A;  1LZS A;  1GB6 A;  1HNL A;  1B9O A;  1LZE A;  4GBR B;  1LSG A;  3WVY A;  4RW2 A;  5KXS A;  1UIF A;  1CVK A;  5KXY A;  1CJ6 A;  1BWH A;  1L11 A;  4KXI A;  139L A;  3B6L A;  4H9A A;  5F81 A;  2YBI A;  1LHI A;  132L A;  4NC3 A;  3VVK A;  4XXJ A;  1B2K A;  1LZ4 A;  5LXW A;  3EML A;  1B7R A;  4I7Q A;  5H2I A;  2B6Z A;  1L54 A;  2DQF C;  4EKR A;  1LYS A;  5LA5 A;  4LZM A;  5KXP A;  4M4O A;  1LJE A;  1QKP A;  1KME A;  4J1A A;  1C6G A;  1EPY A;  1LI6 A;  4RDS A;  3J6K A;  4OV0 A;  4I7J A;  2G4Q A;  3RT5 X;  1L46 A;  2DQE Y;  3HT9 A;  4UHR A;  3ZPQ A;  1VGO A;  1FLQ A;  3HTB A;  1GF9 A;  1QHJ A;  3P66 A;  1L53 A;  1L00 A;  4H9C A;  3HDF A;  250L A;  1S54 A;  147L A;  1QUD A;  4B49 A;  2YCW A;  1IP7 A;  1P2R A;  2R4R A;  1JQU A;  1L43 A;  1L89 A;  4EA3 A;  4LYZ A;  4XJI A;  1B5V A;  1IEE A;  1LLH A;  2YVB A;  5FST A;  1YRO A;  2XBS A;  3TMV A;  4PXK A;  4H8Y A;  4HTK A;  4LT3 A;  2LYZ A;  2BQM A;  2BPU A;  209L A;  3GUK A;  1KW5 A;  1I1Z A;  2A4T A;  4HV1 A;  1C6N A;  1XJU A;  103L A;  1LJN A;  4OWC A;  2LYO A;  3A92 A;  1C8R A;  4XJH A;  2EQL A;  2RSC A;  3EH4 B;  2MEG A;  1GF0 A;  2CUU A;  4GCC A;  3WW5 A;  4MBS A;  1LI3 A;  1C62 A;  4P2E A;  1QT8 A;  1XJI A;  2I1X A;  2EIZ C;  4BWB A;  1KW7 A;  4XEN A;  1GE1 A;  4QDN A;  1IP3 A;  1JPO A;  1BQL Y;  1WVU A;  1HC0 A;  2JAG A;  1OUJ A;  1GB7 A;  1QUH A;  2B70 A;  1LYG A;  3M3U A;  4ARJ A;  2RBS A;  1OV7 A;  3HT8 A;  1L69 A;  3CB7 A;  5FHW A;  1IWV A;  1B7S A;  1LYO A;  1LYE A;  4PHI A;  5EBH A;  1PXS A;  1JIT A;  1C67 A;  2F30 A;  3UON A;  1C65 A;  4LYO A;  5DHH A;  4A7D A;  1LMT A;  3QBG A;  4LYB A;  5A3E A;  4CFO A;  1SX7 A;  1G07 A;  1L17 A;  4ARM B;  3DN1 A;  5K7O A;  1G1W A;  1VDT A;  1C61 A;  3HAO A;  3QJS B;  1LZ9 A;  1F4Z A;  4LFP A;  4GLV A;  1CV0 A;  2RBR A;  4XJG A;  1G0L A;  1XGT C;  2HUB A;  3S3B B;  4WLX A;  1L35 A;  1LYJ A;  4BS7 A;  229L A;  3HTF A;  1DYB A;  1LSP A;  3L64 A;  1LYY A;  3WU9 A;  1C64 A;  4EOF A;  4WAV A;  1C6K A;  4W58 A;  1L42 A;  2DQG Y;  1WQQ A;  2W1Y A;  174L A;  1LN6 A;  2KSB A;  1HEL A;  5HNL A;  4W55 A;  1KXY A;  4NIJ A;  1C6L A;  1GB5 A;  1LYF A;  3QE8 A;  4KL7 A;  3D9A C;  1LSD A;  4I7S A;  1EQ5 A;  2Z2E A;  1PQK A;  118L A;  5LZM A;  2B75 A;  1LPI A;  1LZ8 A;  1DQJ C;  1UID A;  3QY4 A;  4MQT A;  162L A;  1DYC A;  1WQN A;  1LZT A;  2KSY A;  1L0M A;  1L99 A;  1GXV 2;  1WTN A;  4GN4 A;  2KSA A;  4BV0 A;  3SB8 A;  1IWX A;  4OOT A;  3T36 A;  238L A;  4OO9 A;  1HEN A;  1SLY A;  1ZMY L;  3AGH A;  1L83 A;  4H9B A;  3TMW A;  4X32 A;  1REZ A;  3HU8 A;  1UIB A;  1SQ2 L;  1IWU A;  1TLA A;  197L A;  1AM7 A;  1LZD A;  4KNF A;  4ET8 A;  1LZG A;  1B5X A;  1X0I 1;  1GB9 A;  2W1X A;  2QPD B;  2HEF A;  1L0K A;  4HJZ A;  4KPM A;  1LKR A;  3FI5 A;  4XTN A;  3UTV A;  1YAN A;  4WO6 A;  2ZIL A;  4PRQ A;  3W6D A;  4CJ2 A;  3ZVQ A;  1C3W A;  1EL1 A;  262L A;  1O23 A;  5APF A;  1P2L A;  5IHG A;  2HEC A;  4H1P A;  137L A;  239L A;  1YIK A;  3IWR A;  1HER A;  1JGJ A;  3WMK A;  5D5C A;  4JQ6 A;  1XSF A;  1VAU A;  133L A;  2BQO A;  2RB0 X;  1JWR A;  1KXX A;  1GF8 A;  4G49 A;  3SB6 A;  4W52 A;  3C8R A;  1L90 A;  1LYZ A;  2QPE B;  2B72 A;  2DQD Y;  4W53 A;  175L A;  1D3M A;  1KY0 A;  1P37 A;  5A8E A;  4R0F A;  3SP3 A;  2YDO A;  1D2W A;  1JIY A;  2IFF Y;  3HUA A;  2BQC A;  1C63 A;  1IR9 A;  3AZ4 A;  5I4Y A;  5TGZ A;  2DQA A;  2Z19 A;  3HT6 A;  1QM8 A;  4NG8 A;  1NBZ C;  4YXA C;  1GWD A;  1L13 A;  151L A;  213L A;  3LN2 A;  195L A;  4CFP A;  3NY8 A;  1UIA A;  2CGI A;  4I7N A;  3W6C A;  4IAQ A;  1QDR A;  1L44 A;  1LHK A;  6LYZ A;  5C1M A;  1IC5 Y;  4RLN A;  3DDL A;  5C6J A;  1H68 A;  257L A;  4NSI A;  3EXD A;  1YQV Y;  4E97 A;  1BWI A;  1H87 A;  1B5Y A;  1GB3 A;  1J1X Y;  3LYM A;  3OE6 A;  3QBK A;  4TTD A;  111L A;  3WUM A;  9LYZ A;  3EH5 B;  210L A;  2HED A;  246L A;  5APE A;  4IAR A;  2D91 A;  3N9C A;  4NSJ A;  1KIP C;  2Z2F A;  1N4F A;  1YIL A;  3N9E A;  2F2N A;  1C6C A;  3HDE A;  4X3B A;  3HUK A;  4NSH A;  3CDR A;  3DN2 A;  3LZ2 A;  1BRR A;  159L A;  3DN6 A;  3WPL A;  1VDP A;  1CKC A;  1JFP A;  1W08 A;  5G53 A;  3G3X A;  4G71 B;  4TX7 A;  131L A;  1L01 A;  112L A;  3A90 A;  4LYM A;  1KG8 A;  235L A;  5DN4 A;  1GF3 A;  4MR1 A;  5ITE A;  2NTG A;  129L A;  1QUG A;  4LZT A;  5F14 A;  134L A;  1G0G A;  4LFX A;  1QTB A;  2VT4 A;  1S8J A;  1PS5 A;  5LVK A;  1L32 A;  4I7P A;  3S8F B;  5II3 A;  1C45 A;  5KKJ A;  1GFV A;  1BB7 A;  4YOP A;  2HPY A;  1LMQ A;  4C3W A;  3A3Q A;  4ARL A;  4H9F A;  1DZB X;  192L A;  1LTM A;  1FKV A;  3OE0 A;  4NWE A;  4PK0 A;  3KAM A;  3GXR A;  1M0K A;  231L A;  3ODU A;  1L95 A;  1GFG A;  1NDG C;  1L20 A;  241L A;  221L A;  1VDQ A;  1UCO A;  4AGA A;  1JTT L;  3CSR A;  1IOS A;  3B0K A;  1WTH A;  3W6F A;  3P4Z A;  2RAY X;  3W6B A;  2LNL A;  120L A;  3NSB A;  3CDQ A;  1D3N A;  5AMY A;  1GBO A;  1S8L A;  4FDY A;  1AKI A;  1Q5J A;  1FBI X;  1LZ1 A;  4DD2 A;  1DYF A;  2HEE A;  1SX2 A;  1L68 A;  1L63 A;  1QDT A;  1MLC E;  5KXZ A;  1LGW A;  1S53 A;  1L91 A;  1L76 A;  4ETD A;  237L A;  1L07 A;  4KLY A;  4OW1 A;  164L A;  1XGU C;  2YBN A;  4NY5 A;  4CGE A;  1QUO A;  1E0P A;  3MGW A;  1OVK A;  1NKH A;  184L A;  152L A;  165L A;  3AZ7 A;  1UIC A;  1XIO A;  172L A;  181L A;  3UZC A;  1BB5 A;  4LT1 A;  4GBR A;  1JJ3 A;  2EI4 A;  194L A;  1G7L C;  2YSS C;  1LSY A;  3W6E A;  5H2H A;  2BQB A;  2YBL A;  1UIG A;  1NDM C;  3SB7 A;  1OV5 A;  2F95 A;  1QT6 A;  190L A;  1L09 A;  1ALC A;  3P65 A;  2I26 L;  243L A;  2OE4 X;  1GDX A;  5B6Y A;  2HEA A;  1B7M A;  1L92 A;  183L A;  1DYE A;  4NHT A;  2BQL A;  4L41 A;  4EPI A;  2KS9 A;  5HMJ A;  1XEJ A;  1L27 A;  7LZM A;  2Z6B A;  226L A;  3C82 A;  4NFV A;  5DN5 A;  1LZA A;  2RBN A;  5FJG A;  156L A;  1ZVH L;  3CT0 A;  1G7M C;  2FYC A;  4G7R B;  1HEQ A;  1M0L A;  228L A;  1OUF A;  4DAJ A;  107L A;  5DHG A;  4XJD A;  1PXR A;  154L A;  1KY1 A;  4W94 A;  1GFJ A;  4DDA A;  1L67 A;  249L A;  1GB0 A;  4X31 A;  1FLU A;  1BB3 A;  1F50 A;  1L23 A;  3FE0 A;  1LMA A;  5B6X A;  1LSM A;  2HUL A;  2Y00 A;  1JTN A;  5LAF A;  1GFA A;  169L A;  5KXX A;  3GUP A;  3QBI A;  5D5F A;  3SB9 A;  4TSB A;  2IHL A;  3ULR A;  198L A;  4WG1 A;  6LZM A;  1OUA A;  4YM8 A;  2LCB A;  1TN0 A;  1ZYT A;  2Q9D A;  4UWU A;  1FBB A;  2C8P A;  1OVJ A;  1VDS A;  1GD6 A;  240L A;  4DQJ A;  3DMV A;  1GFT A;  1G0M A;  4J4Q A;  4A4M A;  2N5Z A;  1REM A;  1JV7 A;  4MD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...