4DKXA

Crystal structure of the rab 6a'(q72l)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
162
structure length
152
Chain Sequence
KFKLVFLGEQSVGKTSLITRFMYDSFDFLSKTMYLEDRTIRLQLWDTAGLERFRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Rab6A'(Q72L) mutant reveals unexpected GDP/Mg2+ binding with opened GTP-binding domain
pubmed doi rcsb
molecule keywords Ras-related protein Rab-6A
source organism Homo sapiens
molecule tags Protein transport
total genus 52
structure length 152
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dkxA00
3C4JA 3RDPA 4TTQA 3P32A 1VKJA 4JSYA 1DPFA 1AQUA 1ZM4A 3T5DA 3DPUA 1Y3AA 3NC0C 1E4VA 1J7KA 4QL3A 5BQ5A 3A37A 2WWIA 4O2LA 2DFKB 2JLSA 3BB4A 3RHFA 1T8UA 3IDQA 2FA9A 2GESA 4WZBE 5FTJA 1I4TD 4FN5A 4CT4B 3BWDD 1HY3A 3MWLA 2GVDC 2OO7A 2XSZD 1OKKD 2NOAA 3K0AA 2YVUA 4X8LA 3LRPA 3OEEA 1Q1BA 2ZI5A 5FL7D 5CIWA 5JS7A 1XCPA 3JZMA 2QTHA 2ORWA 3F3YA 2XTZA 4WVFA 5BN4A 4LHZA 3DMDA 1JR3E 2GNOA 3HU2A 5CJPA 4A8JA 3T06B 4Q4HA 3CWQA 2XTNA 4Q48A 1GFIA 2P6RA 2R65A 3BFVA 1FNNA 2ASEA 4QHSA 3RC8A 1LS1A 4MH0R 4HUTA 2WBLC 4JBXA 4ZO4A 4MA4A 1KI7A 2R6GA 4US0R 2O8BA 2IK8A 4TZ6A 3P26A 3U44B 2BV3A 4BLSA 2W0MA 2ZE8A 1EK0A 1TF2A 4EIWA 3HU1A 4DUGA 2DWOA 1TU3A 1XTRA 3HYRA 4V0OA 3LQQA 3RYTC 3UXMA 5JRJA 1QHGA 1KI2A 3SJAA 1N0VC 5KYKA 4F92B 3AKCA 4O25A 4EPWA 3SZRA 1NVVQ 3SFVA 2I3BA 2OILA 3PEWA 3VQTA 4B74A 5A5GA 2VBCA 4G5GA 2ZYTX 5FUYA 1N3BA 5LD2C 1KK1A 4KFTA 3ADCA 3UMFA 1QG4A 5JS8A 1FQJA 3QPUA 4P4SB 3GLFE 2Q3MA 4JLNA 2ZS8A 1J8MF 1NY5A 2BMEA 3AP1A 4A9AA 4TQ9A 3GLGB 4DSUA 4NCHA 2ZRPA 1YZUA 2CLDX 2QQ0A 1G6HA 2IUUA 1BMFD 4ABYA 4JYBA 4V0NA 4D0GA 2J0UB 3N70A 4DLUA 5DN6A 1CULC 1D9XA 2LKDA 3BE4A 5FOWA 5KDLA 3TUJC 2O8EB 4TQAA 3LXXA 2QT0A 2GKSA 1AGPA 4AK9A 1E1QA 1ZC4A 3KQNA 1KDPA 4JLBA 1TQ2A 2HXYA 3KKMA 1YZTA 3MCAA 3DO6A 3N2EA 4I1VA 5BXQC 5KNCA 4KV9A 3B1YA 1E9DA 4IVQA 421PA 1E9CA 5AJVB 4AY2A 2F7SA 3I4LA 2DYKA 4FWIB 1MRNA 5HTKA 2CK3D 1HYQA 1XD2A 2GF0A 1P3JA 4IXMA 1AS0A 2ODEA 4NYMR 5EXXA 2H17A 1QHHB 2ZS7A 2GF9A 3HWSA 1K8RA 3MRSA 4LRWA 4CYMA 1KIMA 1KAGA 5CM8B 3MMPA 5D3QA 1Q20A 4KFRA 2QP9X 4LJ7A 3QI2A 1AKYA 3TVDA 3REFA 2XJ4A 1XTKA 1CEEA 2ZRBA 1NIJA 3RANA 1G4UR 4MRSA 2G88A 3DM9B 3K9HA 4DLVA 4KFSA 2VHJA 2ZEJA 1DE0A 2IYXA 1R2QA 3U7HB 3FKQA 3K9GA 1UEJA 3AEZA 2REBA 2GJ8A 2XTMA 3T61A 1XEWX 1UKVY 2IWRA 4URYR 2F1RA 1FTSA 4CGZA 4BLRA 4MGIR 1BS1A 1Z5ZA 3QXCA 4MGYR 5KDDA 5DIFA 2R62A 4XVUA 4Z51A 4ASUA 1CIPA 2UZIR 3NEJA 4OQNA 5JECA 2DY1A 1SULA 1UDWA 2C8VA 1UBGA 2QAGA 4US1R 1US8A 1U8AA 4QJ4A 3W3AA 2PX0A 4B73A 1GL6A 1A5TA 2JGNA 3OFNA 4QXAA 2WMNB 3NG1A 2XXAB 1OF1A 2AWOA 1G3QA 1WA5A 3M1IA 3ZD7A 4A6PA 4B75A 5CITA 3ECCA 3QENA 4HUQA 3QXSA 1QBKC 4M8NE 3T1TA 2AK2A 1XEXB 2F1HA 4TLCA 3EC1A 1KY3A 3W6PA 1KI1A 4Q9LA 2OCAA 2ZU6A 2EVWX 4PO9A 1G8GA 4D25A 2A5DA 2CJWB 3CF2A 4HZUA 4IRUB 3N5CA 2QU8A 4JIMA 4PZYA 4D26A 4HLUA 2YWGA 1OSNA 4DCNA 1W46A 4ESVA 1N6PA 4R2HA 2GJ9A 5B2ZA 4M1KA 3Q72A 1K5DA 1D9ZA 1J99A 4UJ5A 2OV2A 4S35A 2P67A 5KPDA 4TSFA 5K8LA 2FZ4A 4Q1FA 2ZRIA 3HJNA 3PQCA 1KJYA 4NYIR 2CCKA 3VX4A 4CDGA 2XITA 3RRNA 1XDBA 3D8BA 3ADDA 1KTVA 1OIVA 2C04A 4HLQB 3ZVLA 4Q21A 4ESHA 3AVUA 1ZU4A 2BBOA 1PLJA 2PBRA 4HB2A 4ON9A 1G18A 4OJKA 1TQ4A 2W00A 2K5UA 2ZROA 3RS5A 4BFXA 4D2IA 5JSZB 4GL2A 3HR8A 5BWMA 3ZDQA 2O8FA 4C7OA 4NHOA 5AUNB 4I4LA 2PLRA 2RGDA 3A58B 4NCJA 4WAUA 3LLMA 1ESNA 3NH9A 1OB2A 3KUCA 2H1LA 3KFXA 4AG6A 1HV8A 2HJVA 3B2EA 1HE1C 5IHPA 5CLLA 4UXHA 4A1FA 1RVDA 5EXPA 1YU9A 2ZRDA 2JLWA 2KBFA 1YVDA 3DHWC 3TSZA 4X8MA 3AF1A 1GWNA 3GLHB 3CR7A 4JVSB 2REXB 1XRJA 3VU9B 3THYB 1KMHA 1W5TA 1KO7A 2CXXA 3IEUA 1G3IA 1DARA 2ZRKA 3WYGA 3MD0A 4KYUA 5FTMA 3THWA 2C03A 1KNQA 1S2MA 3ICEA 2ZAMA 3A8TA 3KKQA 4QBGB 1IHUA 3UKDA 2YC4C 1IM2A 4ZDIA 5TV2A 2BM1A 3QIAA 4A82A 1E9RA 4F7WA 3QF7A 3JZAA 4D4JA 2KJQA 1GNPA 3J81k 1U81A 2J41A 1AZSC 1KGDA 3CRW1 2RCNA 4EFNA 1CR1A 3L0OA 1TUEA 2OE2A 4OQLA 2IYLD 4GBMA 2VHTA 4TLEA 1KHTA 4MUAA 5GJVC 1Q57A 3KQHA 1V43A 4Q47A 4FMDB 3NBFA 2OSBA 2L0XA 4B3XA 1JALA 3B9PA 2GEUA 2ZE6A 3LD9A 2A7QA 2DFNA 1AA9A 3U60B 1JECA 3QE0A 1HURA 3UPUA 5H70A 5KO2A 3CR8A 4IDPA 2IEYA 1HQYE 4TN1A 5G41A 2JLZA 2R9VA 1P2SA 3SJBA 2GCOB 1YZGA 4HAYA 1XPRA 2PEZA 4EDHA 4RKEA 2JLRA 2OAP1 3TBKA 2IYVA 4A36A 3IGFA 4W7SA 1JPNA 1T5IA 2G1JA 5EXTA 2J0QA 4JKIA 3CX6A 4R71A 2WPDA 2QRZA 1XP8A 4OI4A 2P6UA 2VRWA 2NGRA 1JJVA 2D3WA 2ZRAA 1VTKA 2QP3A 3IQWA 3WBKA 1P6XA 5JWOA 3VHLB 5A0FA 1F3OA 2TMKA 2ZJOA 1EFUA 1CBUA 2LKCA 1CJTC 1T3LA 4IDHA 1SKQA 2OEPA 1E0KA 4TYYA 2EWWA 4IHQA 3KQKA 3V4RA 2IW3A 4A15A 1OH6A 4TL7A 2GEDA 1ZBDA 1YZLA 4HLCA 1AN0A 1P9WA 2QUZA 4G1UC 5CDFE 2QORA 3MFYA 3OIYA 5E3HA 1X1SA 2CVHA 1XD8A 1M74A 2Y8EA 5FOUA 4EQ6B 2MSEB 1X6VA 2EFCB 1VCMA 2CHVA 4TQUS 3UMSA 4ARZA 4GDFA 4HAXA 3LH5A 3OEED 4DXAA 621PA 4BFYA 2IX3A 4Z8YA 4DIEA 3HR7A 3WRXC 1E96A 1KZGB 1LFDB 3T34A 4AYXA 4JLJA 1KY2A 2XXAA 4C3ZA 2GRJA 2JIZA 2NMVA 1U99A 1ZM3A 2W6IA 5K8IA 2YV5A 2HT1A 2ANCA 2EFDB 1NN0A 4KLNA 4A4DA 4MDFA 4TLDA 5LB4A 2F1IA 1KAOA 1LVGA 2GBLA 1QVRA 3W34A 4JL6A 2AXNA 4PO8A 1L4YA 3O8BA 3BBPA 4DUGD 2QENA 1OW3B 2ZUBA 4IOJA 4OI1A 3KL4A 2XB2A 2GJKA 2OFXA 2OZEA 2SHKA 1G3MA 1R7RA 1VIYA 1CJKC 2WICA 2J0SA 2N1BA 4KI0A 3SQWA 3IHLA 4BEBA 4JT2A 1KJZA 5CK5A 1SXJE 2IL1A 4Q4JA 1E94E 4NE2A 4KVGA 1RZ3A 2NPIA 5JFGA 1DAIA 5CLQA 3LV8A 5LBIA 821PA 1ZNZA 3P4YA 1FFHA 2NO1A 2EFEB 3CF0A 1QHIA 1AQYA 2JDIA 3CNNA 3OAAA 4V0LA 1NP6A 2B92A 5EZ5A 3GEHA 4FI3C 1L8QA 4C0JA 2PZEA 3SBEA 1TPZA 3TUZC 4UNNA 4JS0A 1DTSA 1GZSA 4AG5A 4R7ZA 1CRQA 2IYSA 4A0HA 5EE5B 2WJIA 1TAGA 2VHQA 5DN6D 5JEEA 3AB3A 3U6KA 1E1QD 3AVOA 3FYHA 1W44A 4DB4A 3SE0A 4JBWA 2CBZA 2FV8A 2D7CA 5TXGA 2JATA 5JJLA 4LCBA 3ZZTA 3FB4A 2GILA 3KTAB 5EE3A 2YOFA 3V00A 4ZCIA 1I2DA 2OLJA 3BK7A 4C0SA 4DLRA 4F93B 2ODNA 4UKDA 3Q5EA 3BJIC 4GSYA 4B71A 1KI6B 3U3OA 3U7EB 2C5LA 1OFTA 3EXAA 3EZ7A 4PR0A 1P75A 1KI8A 2VF8A 1UF9A 1U8YA 4ACBA 5B57C 3EIHA 2ZRGA 1LF0A 1F6BA 1E69A 1YR8A 4NP6A 4QBFA 3L0SA 2AX4A 1XXHE 2YYZA 1N6IA 2H18A 2IBMA 3ZQJA 4G5QA 3U4QA 3R7WB 1GKIA 3MWYW 3A1SA 1XJQA 3UWOA 2Z6VA 2ONKA 1ONBA 2CNWD 4CIDA 1CKEA 4L16A 4GZMA 3O8RA 1Q1ZA 4Q9KA 2ONJA 1U9IC 4D4MA 1W0JA 3BH7A 4KLZA 1E79A 2RGXA 2W6JA 5TDHA 2Q21A 1OH7A 3TMKA 2X8AA 1N6KA 1XF9A 2BWJA 2GJAA 4CZ2A 5DO9A 4QNRA 5GVRA 2F3RA 1EGAA 2ZVQX 4PQYA 3V4FA 2RGCA 3PVSA 4LBWA 4N3NA 3PEYA 2JAQA 1SXJA 4ASUD 4OHWA 5FI1B 1YR9A 1X86B 2ERXA 4LJ4A 4QGGA 3SEAA 1XJ0A 2NPFA 3M0EA 3K70B 2X2FA 4OQMA 1NMZA 1COWA 3IQXA 3K9LA 4CF7A 2WHXA 2GCOA 2YC2C 3IIMA 2GXQA 4TL8A 1DOAA 3VR6A 5EJEA 4RZ2A 3OFND 4LHYA 2MSCB 3KXLA 4EFMA 4M1SA 1IY2A 1S8FA 3K0FB 4LHVA 4KYIB 1DAHA 3EPLA 4TL6A 4UXIA 1E6CA 1N25A 1P2VA 3P20A 2RH5A 4KFUA 4ERNA 4KU4A 1UKZA 2ZQ5A 3PUXA 2J46A 2KSQA 3LFUA 1OPXA 2OFWA 4HB0A 1UM8A 1J8YF 3W90A 2HV8A 1OT3A 2GZHA 2B6HA 3PCRB 3U5ZB 2P6NA 2B21A 3AV0B 1G7TA 2VEDA 4OQXA 3T1VA 1N6RA 2B7BA 4Y0AA 1SVMA 2IYYA 4URWR 2W83A 1EFHA 1SKYB 2HYDA 4TSFD 4L15A 1Z0JA 2FMXA 2ZR9A 5CM9C 1RPZA 2BEJA 4EQ6A 1DO0A 4JL5A 4PSKA 4NMMA 4M9QA 2ORVA 3ZQ6A 4C0AC 4BUJA 1W47A 4D82A 1JEEA 3SDZA 3Q5DA 4M9SA 4XSGA 2C9OA 2GTPA 1IXSB 1G5RA 1BO6A 2VYFA 3QBTA 1E0JA 2HF8A 3H86A 1Z0KA 4JT4A 4RD1A 5JWRA 1FQKA 5TVKA 2PEYA 3PIRA 2QBYA 3I5YA 3A1WA 4MKFA 1L4UA 3SJCA 3WNBA 2ZRHA 3ZVNA 5JCPA 2ZYUX 4HDOB 3VAAA 1W7AA 2IUTA 5A4JA 1P9NA 1OYYA 3FE2A 3BD9A 4LY6A 3UG7A 5JJKA 4GT1A 3RRYA 1C4OA 2BC9A 3QPWA 4QHTA 5EP3A 2WSMA 3TQFA 4QGHA 2QRNA 5FH9A 3TR5A 4U5XA 3U7FB 3SHWA 1G19A 2H7VA 4Q03A 2J7PD 3JVUA 5BYKA 1E98A 4L9SA 1W4AA 5AJYA 1XTIA 1ZNWA 3A36A 3LW7A 2HJGA 6Q21A 2J7KA 1QVAA 2EYUA 2JLVA 3SHFA 1RFLA 3A4LA 4XVRA 1RYFA 3O8CA 3IEVA 3WP1B 4X8OA 2VSXA 4G0NA 2YINC 1IN6A 3RVBA 3GPLA 3X1ZA 5JZVA 4M9XA 1YZQA 4KJZA 2V1XA 1I4DD 1YR6A 1QG2A 2C95A 3K0CA 3QKSB 2QNRA 5SZIA 3T1OA 4R2IA 3BAFA 4CEJB 2PT5A 1NSFA 1JXOA 3I5XA 4E07A 2HT6A 2YWFA 5EUQB 2WWGA 3EX7C 1KJWA 2HCJB 1ETUA 3DMNA 3A1UA 2EYQA 1TUIA 4B3BA 3ICQB 3KZ1E 2D2EA 2GAAA 3H2YA 3RAPR 1OLOA 1YE8A 2FFHA 5EP2A 5EP1A 5AWFC 2D06A 4DDVA 1KI6A 2O8DA 5KOYA 4Q7MB 1O87A 3IIJA 4NU0A 3GLFB 5J4HA 1Z2AA 3AVXA 4G5SA 1D5CA 2DR3A 2IF2A 4UXJA 1XEFA 4EJSC 2YWEA 3EPJA 5DI9A 4IFEA 1R5BA 4QBIA 5CJ2A 3PITA 2QM7A 3R8CA 1RKBA 3BB1A 2WKRA 2WPDD 1FNMA 1GILA 5FOTA 4PHHA 3H4MA 1Z8FA 3PENA 4FXPA 2QG6A 3IILA 4Q4AA 3CH4B 1U0HC 3OZXA 3NDPA 4HB4A 3AF2A 2IF0A 3OEHA 1DAKA 4JLAA 1FW6A 1E0AA 1MO3A 4LX0A 2BBTA 1FOEB 5BW8A 1UEIA 1MOZA 4POAA 1NY6A 2R8RA 4EJSB 3M6AA 5EE9A 4B2IA 3AGPA 2IHYA 3QKRB 3LQRA 3PEVA 4RKFA 4C0HA 3AVQA 4C0LA 521PA 4ZIRB 4FW9A 1G21E 4DSOA 4PXAA 4CEIB 3MGCA 2ZRLA 3GP8A 2VPPA 2KWIA 1IJFA 4RFSB 4JBYA 2RGBA 5CYOA 2DB3A 5J4KA 3QY0A 2NTYC 2GHIA 4KODA 3U6BA 3EIQA 5F9HA 4GI7A 1QDEA 3PJRA 1P7CA 3UANA 4MYCA 2VLIA 2VHCA 2BCJQ 4XIGS 3B5JA 2O0JA 1OIWA 2E87A 4KVAA 3WMEA 2A5YB 1KK2A 2ZRNA 5DYGA 2PH1A 2NO6A 4FMDF 3NH6A 1WE2A 4DEXA 1NVVR 4KSBA 3RS3A 3AM1A 2F3TA 3K0FA 2JIZD 2WAXA 1CU1A 2W6ID 2ZXUA 1WMSA 1XCGB 3G0HA 1MRSA 2ZR7A 4RSGA 2YZ2A 2J3EA 5L3QB 3ASZA 4C9BA 1TQ6A 3FOZA 3THXB 4O2RA 5JMTA 2WZQA 2A78A 2FGJA 4B3GA 1E99A 1KK0A 2F1JA 3QXJA 4LYHA 3GEEA 2DPXA 3MWKA 4UNQA 5IK2D 3QXHA 5CK4A 3VR1A 5EUMA 5JI2E 4XTCS 4B2PA 3BGWA 1SQ5A 2O5VA 1P4SA 5LD2B 2JCSA 1NRJB 1Q3TA 1G64A 1NVXQ 4DLYA 3WMFA 1E9FA 4DT1B 1KDTA 3VR3A 2PJZA 1C1YA 1ZNXA 3OAAD 2JDID 3K09A 4YONB 3GJ0A 2J5XA 3NXSA 1MABA 3EG5A 3D31A 5FOSA 1CR4A 1II8A 3RWMB 4ZDKA 4EPRA 1G41A 2VA8A 1GDDA 4PC6A 4LOAA 1H8EA 4P32A 2XB4A 1AZTA 5IRCD 1VHLA 1PZNA 1TX4B 5E4FA 4IW3B 3AVYA 3LBNA 2FZLA 3C16C 2ZI3A 1HT2E 4CEHA 5FUWA 3CX8A 2CHGA 4JVMA 1HE8B 1GNRA 4JYCA 5GADl 3WRYC 2RHDA 4I1UA 3KQLA 4OHZA 3A4MA 3VKHA 3BFKA 1NL3A 2CNWA 1VYTA 5FR1A 2EFGA 2ZYWX 4AURA 4W5WA 1G17A 2C78A 3BIFA 3FMIA 5J4VA 5JI3E 1ZM2A 1PLKA 3GJ4A 2V4ZA 2EW1A 1KSFX 1CS4C 4NCIA 1HTWA 1OV4A 1JB1A 3NBXX 4PPNA 3SYLA 1GRNA 1RRFA 1OFUX 1QHYA 3Q7PA 1Z47A 3REGA 3GLIA 2DHRA 4P4TA 3IO5A 4C4PA 2QROA 1NKSA 4IKEA 1LV7A 1JPJA 2ZI9A 1I2MA 3MUFA 4BZQA 1G6OA 1M1YE 1QHXA 3L2OB 3L43A 5L3SA 2IYZA 4YDSA 1FX0A 2AKAB 2ATVA 5DYIA 1ZU5A 2FJUA 3ETLA 5G40A 3QKSA 1MR3F 2LCFA 5JRZA 1D2EA 1W0JD 1K5GA 1E79D 2QN6A 4URUR 1PVOA 1FP6A 1H65A 1RJ9A 2W6JD 4HI0E 4QHYA 1NBMA 1SVWA 1W48A 2IT1A 4GPTA 4IXNA 4M0LA 5J4LA 1TEVA 5KSOA 1XBTA 2I1VB 4FMCB 3VNUA 1DAFA 4KSCA 5EP4A 2XNDA 1NN5A 2BDTA 3LXRA 1DAMA 1SXJD 4TL9A 2B8WA 4A2PA 3KFVA 4DDWA 5HR5A 2V6JA 3DVLA 3QQ5A 1ZD9A 2HCBA 2WM9B 4LV5B 2IYRA 1COWD 3HP1A 2VO1A 1IY1A 1W36D 2CCJA 4B3FX 4L9WA 3EAQA 3B13B 1VYUA 3O47A 1W4RA 4LZZA 2PMDA 4PPFA 4EPVA 5H8WA 3EARA 4Q7KA 4PC3A 1R0ZA 3GMTA 3WNDA 1GVNB 2CDNA 2R6DA 4OL0A 3F5FA 4BLOA 1OXUA 3R20A 3EPKA 3B1ZA 3C15C 3TIFA 4RFVA 2IUSA 5GVSA 3CZQA 3IO3A 4DLXA 3WMGA 1XMJA 3AF3A 3KXKA 3M4YA 1CRPA 4AI6A 1NJFA 1JAIA 3WYAA 3K8YA 4A2QA 1UAAA 3SU8A 3GJ5A 4JLOA 4DDUA 3T12A 3SQXA 4NYIQ 2GXAA 5HCIA 2HXSA 1U8ZA 1F2TB 2FE4A 3U44A 2IXEA 3GJ3A 2G9NA 5J5CA 1G9XA 2MSDB 5LB2A 4DHEA 2D2FA 1D2MA 4ZKEA 3TKLA 5EQTA 4DC9A 1VIAA 1HT1E 2ZSDA 1Q0UA 4B76A 2QI9C 2YOGA 4M2LA 4O0MA 2J7PA 2RGGA 5C4MA 4H9GA 1F2UB 3SI7A 2QP4A 3NKVA 3LO5A 4D4KA 2QE7A 1A4RA 1OHHA 3E1SA 3NVAA 1Z28A 4DWJA 3ZZUA 3DL0A 3C5HA 3KKOA 3DZ8A 2JJ8A 4P4SA 4XJXA 2OT3B 3TW4A 2WIBA 3IBYA 4OQFA 4Q9JA 5E7JA 2AHOA 3AF4A 4JMPA 3KJEA 4S2EA 3F0TA 4WBSA 1S3GA 3C41J 1N0WA 1ZC3A 4JSTA 3RLFA 4LV8B 4A92A 2J0UA 4C2TA 3H0KA 1EWRA 1X8JA 2O8EA 4B2LA 1GKYA 1PV4A 2BCGY 2XZPA 1R0WA 3LX5A 4TYWA 3D7MA 2IS1A 2B7CA 4KITB 3A1VA 3V9PA 4MRVA 5KSZA 1NG9A 2GXUA 3UWKA 4II7A 3IPYA 4QBHA 3CRQA 3EIEA 1TF5A 2MMCA 5FL3A 2F9MA 3OIVA 4UJ3A 4DSNA 4AKGA 2WOJA 2A5JA 1JBKA 4H1VA 1LTQA 1QF9A 4WW0A 4YMUA 1MKYA 2QA5A 1QHHA 1RRGA 4UNSA 1LNZA 4GMXA 4YMSA 3O8DA 2XNSA 2CL0X 3WNCA 1ZM9A 3ASYA 3CH5A 3L8YA 4HSEA 1AS2A 1IQPA 1KNXA 1XWIA 2BMDA 2P2LA 3VTKA 2HYIC 1VMAA 1CF4A 4RD6A 3A4NA 4BQSA 4NPHA 3B78A 4F91B 2ZVPX 1XCMA 4JVNA 4EPTA 4URZR 4B6EA 3SR0A 1E2PA 2J1LA 3VR5A 3EZFA 4NZYA 1P73A 1ZUHA 3OE7A 1GIAA 4FINA 1GRRA 4YC7A 5AJXA 1JQLB 2VHUA 5HCNA 1S1MA 5KTYA 1Q21A 2ZRJA 4LK2A 4FMBB 3CRMA 4ZI3A 3GLHE 1A2KC 2BEKA 1WP9A 1ZRHA 2ECKA 3QG5A 2NG1A 2FDCA 1YKSA 4YMVA 4H1UA 1KI9A 2ZYVX 3CWZA 1R6BX 4W9MC 3OEHD 3PUWA 2ZRCA 4TMZA 1DVRA 3AVVA 1NN3A 3B7GA 3U3JA 2W0SA 3Q8XB 1Z29A 1NIPA 2ZJZA 2ZM5A 3ZVMA 1Z63A 3AF0A 3F8TA 2CCGA 2FWRA 1KKLA 1FMJA 2V54A 1QHSA 3LY5A 1WCV1 2QAJA 1RRPA 1IXZA 1VCNA 1ODFA 4NH0A 4B48A 1XEXA 3W3ZB 2O52A 4B43A 4TLAA 2WIAA 2F43B 4HDCA 2WJHA 2JJ1D 1OB5A 2CJWA 2ZJ5A 3FMFA 3BORA 4F4JA 2VP2A 4V0KA 4AYWA 721PA 3C5CA 3CUEF 4MGKR 5SZJA 3K70D 3VKGA 1II0A 2FSGA 2FSHA 2IC5A 1BYIA 2EWVA 5IK2A 2PX3A 4DRZA 4CW7A 2QQEA 4TTPA 3G5UA 3CLVA 3X1WA 4HYYA 2XX3A 3MG9A 1R0XA 4JLMA 4XVQA 1IONA 4HZIA 4Q1AA 3GD7A 4Q18A 3FVQA 2AD5A 1LY1A 4I99A 1KYIA 1UBEA 5E7MA 1ZVQA 1S1CA 1P2UA 2CE7A 3QF4B 2RAPA 3PFIA 2NO0A 1E2HA 1XZQA 3MWJA 4JLDA 5IDVA 3AUYA 4QG7A 3A6PC 1HA3A 5JSZA 1RW4A 4P3YA 4OYHA 1Y63A 1C9KA 2IS2A 2GEVA 5C18A 5DISB 1E2LA 2NZJA 2BVNA 1G8PA 5GJWC 2ATXA 2WWHA 1UFQA 3EA0A 4GP6A 5D3MB 5F2EA 5GJBA 4Q4LA 4LYFA 4MKHA 1SVLA 3U7GA 2WV9A 3QG1A 1Q1QA 2OUKA 2YOHA 4MYHA 3GLHA 1NI3A 2JLYA 3VU9A 3THYA 2P5TB 4QOSA 1F2UA 1HEIA 1VG9B 3L0IB 4TMVA 4WZ6A 1N6NA 5G3ZA 3OESA 2WWYA 4BPBA 4I81A 4X8HA 5EXSA 1H8ED 1H8HA 2X2EA 1R10A 2A2ZA 3LA6A 2XEXA 1IN4A 3B8HA 2UKDA 4BWYA 4RVCA 5HE9A 3NBYC 1YJ5A 2BIFA 2YNMA 3W9YA 1AM4D 2CE2X 4BEJA 2IXFA 4MQBA 4Q01A 3ZLJA 1NLYA 3FFBA 4DKXA 4F38A 1XPOA 2GK6A 2O0HA 1LB1B 4L8GA 1R4AA 4FD2A 4DCTA 3AVTA 1R8QA 2OBMA 3AKEA 5E7IA 5HKKA 1TF7A 4C0BA 2RMKA 4WIAA 1AGRA 4PC7A 3KXIA 3FDIA 4IOMA 4TYPA 1O3YA 1S9DA 4PTLA 4A8JC 3TK1A 1U94A 4J0QA 4IDNA 3RS7A 2BOVA 3C14C 5FTLA 5KNDA 2D62A 1IY0A 1EFTA 5B58C 1P61B 2FEOA 3W8RA 4EPYA 5DLQC 2QTFA 1NG1A 3E5HA 4DVGA 2UVQA 1W5SA 3EPHA 3K0AB 1HUQA 4RCZA 1JI0A 3TSWA 1MO4A 1PUJA 3PR1A 5AUOB 4Q1EA 4MRNA 4DJTA 4YXWA 3X1DA 4A8JB 3LVQE 1Z08A 4Q4HB 4QFMA 4OI2A 4YQFA 1XB2A 3THOA 1XEWY 3QKUA 4DLSA 4UNRA 3E70C 4XD7A 1TU4A 1TL7C 1E2DA 1ZIPA 2OLKA 1NBMD 3L82B 1IAQA 3R9XA 3EWAA 4Z54A 5ELXA 2O8BB 1EX6A 4Q7LA 1ZJ6A 2F9LA 4ACAA 3ZZ0A 1P2TA 2RGAA 2XNDD 4KCGA 4ZCMA 2IA5A 2VL7A 1DEKA 1JJ7A 3T15A 5JHGB 4OK5A 4Q02A 5KSPA 3ZH9B 1OJLA 2YJTD 2OXCA 2VQSA 5FUXA 1SVKA 2I1QA 3BH0A 4PANA 3CB4A 2Q9AA 1NLFA 5G3YA 1M7BA 3T1QA 3FKSA 4LPSA 3BOSA 4LSGA 3EWSA 3I32A 1VCOA 2ZITA 4B34A 1NSTA 3WHKA 4OJQA 3K0EA 3Q85A 3NWJA 1KOFA 3QVVA 4IDQA 1E2EA 2QTVB 4FCVA 3DM5A 1JEDA 3SOPA 3SN6A 2NO9A 3ZIAA 2FPLA 2QT1A 1B23P 3RABA 2HDNB 5FBWB 2GETA 4Q9HA 2ODBA 3EZ6A 4M1MA 3S1AB 1JQJC 1U2RA 3P27A 1P72A 4BFWA 3VNVA 1GL9B 1KKMA 3ONWA 4B3DA 2ZJAA 3TUIC 5FPHA 1IN7A 4EUNA 3X1XA 2LWIA 2REOA 3CONA 3H84A 4HB3A 4OKSA 1UDXA 3I61A 3N2IA 1R0YA 1T9HA 2RGNA 4TTRA 4B33A 4G3XA 5K8UA 3VKWA 1GUAA 3IBGA 3VX3A 1ZIOA 3LVRE 4TLBA 5AJWA 4YDHB 3ZS9A 3RC3A 5CIQA 2ZREA 3EC2A 1UKEA 1XZPA 1GTVA 4Z1MA 3WY9A 2GJSA 2C96A 3NDBB 1N2CE 4P4UA 1K6MA 1MO5A 4Q66C 1XD2B 5FFMA 3PUYA 4EAQA 5CB8A 4FMCF 2ZUCA 4Y0VA 1W4CA 3B1WA 1G7CA 2FNAA 4Q1CA 4HEJA 4A0GA 4IOLA 2QMUA 2QE7D 1OHHD 1OIXA 1S0UA 2BBSA 4QNMA 4GRAA 2IWHA 2A5FA 3AKDA 1IBRA 3GJXC 4AKIA 2H16A 1NKTA 2ZR0A 4P31A 4OK6A 5H68A 2WJGA 2ZE5A 4HAUA 4YMWA 1E9BA 2GCPA 2J0VA 1E9SA 4GMDA 2QAGC 4MYUA 4PC1A 1BKDR 4WXPA 5FTNA 5FBQB 3CW2A 4M9ZA 2F55A 2BM0A 2FPMA 4LJ6A 4NYJR 4D0LB 5M04A 1YRBA 2VP9A 2NZ8A 2J9RA 1KO1A 4DZZA 4MYTA 1Z6XA 5FBLB 1JNYA 4OHVA 1EXMA 2HLDA 2IYUA 2FPKA 1GP2A 1UADA 4RZUA 3KTAA 2WTUA 1YR7A 2XZOA 2HEIA 4V03A 1SKYE 2QAGB 1DAEA 3A1TA 1KZ7B 4HLUC 2WSSA 1OXVA 2X77A 1MT0A 1VDZA 5AJZA 4LV6A 1EFCA 4YLGA 1NVWQ 2FH5B 2GAOA 4JZKA 3QKTA 3ADBA 4HUQB 4MGZR 1Z0DA 1RRCA 3FFAA 1E1RA 1Q3HA 1XFAA 1EG7A 3Q7QA 3CNOA 3RSLA 3CBQA 4LYAA 4QM7A 3R7WA 2XGJA 2HF9A 4M1YA 2V3CC 1Z07A 2GK7A 4C0KA 1G5PA 1ANKA 4HZUB 2MMGA 1P60A 1J2JA 2VF7A 1T5LA 2V7QA 4IDOA 1XPUA 4PX9A 1XMVA 1KSGA 4LBZA 1Z22A 3I3SR 4AIIA 4B3CA 1G7RA 2CLCX 3FTQA 2OG2A 3SBDA 4XWKA 3OE7D 4QJ3A 3OIUA 4LJ8A 2ZANA 5KUTA 1N5LA 5FPYA 1QRAA 2YWHA 3PEUA 5FTKA 5TB5A 1CJVC 3SNHA 3T35A 4XWAA 1A7JA 5TY0A 2OBNA 4M1TA 3ZYCA 4ITRC 2G77B 2JJ1A 2R2AA 1CXZA 2QMEA 4RD4A 2ZJYA 1GRQA 2BJWA 1I4LD 1E2KA 5BN5A 5F9FA 3GCGA 1U9IA 4M22A 1R5NA 5DNYB 1WXQA 2BKEA 3CM0A 5IT5A 1W0KA 4BFUA 1ELOA 1UBCA 3GLIE 1WBDA 2IS6A 2GWHA 3LBIA 2O8FB 4C7OB 4Q5IA 1BH2A 1T91A 3GFTA 4IVRA 1Z0IA 2QMHA 1S3SA 2FOLA 4FCWA 3AP3A 2W2VA 3CPJB 3PV0A 5IF9A 1E3MA 1PJRA 5AK0A 4NDZA 4BFSA 4PQRA 3E2IA 2A3RA 4B32A 2JA1A 4BFZA 2IYTA 4LYJA 1NJGA 3NBZC 1NBME 3CPHA 1ZCBA 3GFPA 1KMHB 5L3VA 3DEFA 4LI0A 1OH8A 1EFRA 2ZPTX 4RCYA 3GJ8A 4K46A 1SHKA 3THWB 4MRRA 1M2OB 1G8FA 1G8HA 3G82C 3W5JA 5B30A 2WWFA 1Q12A 1MV5A 1DELA 1KSHA 3UIEA 3CO5A 1V5WA 2DWQA 1BIFA 2EFHB 3MJRA 4LJ9A 3AKYA 3I72A 2BBWA 3S1AA 1TMKA 2R44A 2D74A 2ZS9A 1EWQA 3CNLA 4GP7A 2C9YA 3B85A 2QL6A 1YHNA 2ZRFA 2GA8A 1DADA 2ODWA 3SFZA 1ZINA 4V0ME 3RSOA 3KDSE 1E2NA 2D7DA 4C0QC 3L8ZA 2GDJA 1ZD8A 2PT7A 4ZCLA 4BECA 5FUVA 1G16A 1U0JA 2XOKA 1IOZA 2W2XA 2WKQA 4HAVA 4WOPA 2H5EA 2O8CB 4N0EA 1VYVA 1SGWA 4US2R 1WF3A 3VR2A 4XTRA 1X1RA 1UPTA 4A2WA 5SZKB 2PL3A 1OXTA 4NYMQ 5KHOC 5DHFA 1ZW6A 2V9PA 1E0SA 1H8HD 1JR3A 4D4LA 5L8VA 5KSYA 1GKUB 3IKJA 5J47A 4PZLA 1G7SA 2WWXA 5JWHA 1R8SA 4Z8XA 4FCTA 1II9A 2WMOB 2QGZA 3EZ2A 3TW8B 2O0KA 3VMFA 3PXGA 4A0RA 3B1XA 4LBVA 1ZCAA 2P0EA 3LNCA 2VSFA 4G5RA 1KO5A 4LBYA 3ZVRA 4PHTA 1S9HA 3FPAA 5KU1A 4LHXA 1E2GA 4ZDWA 1U98A 3QEOA 4URVR 1T8TA 2WJVA 1E2IA 5HKKD 1W2GA 2FF7A 2FN4A 1R5OA 3K9NA 1YQTA 3LBHA 3AQ4A 4LC0A 5FR2A 4IFBA 4CEJA 3FHTA 4JKYA 2BMJA 2QPAA 2VP5A 2NIPA 1FTNA 5CYPA 4MITA 3FGNA 4KBFA 3TNFA 5BYJA 2GBLC 2CMKA 2QPTA 5FBVB 1KI3A 4BLQA 1NMYA 4ARZB 1P62B 4V02A 2ZIAA 1E2QA 4YXWD 3LDAA 3GLFA 4DLTA 3D6TB 4E09A 5ANRB 1Z2CA 4JLPA 3WP0A 2CL6X 3TR0A 3X2SA 2V1UA 4XD7D 4GOKA 3DZDA 1RE0A 2G0TA 3U3RA 3CZPA 2VP6A 4RZXA 2AKYA 4PSVA 3IUYA 2R6AA 3HDTA 4DIDA 4OHYA 4ZKDA 4LGMA 3CRRA 1WDTA 3K53A 1E9AA 3CPEA 2Q3FA 4KAXA 4V0MA 8OHMA 1T6NA 4ILEA 2WAYA 2P5SA 1AJEA 2ZI6A 3RS4A 3MJHA 1ZAKA 1TTTA 4PPQA 2KBEA 4QC2A 3SJZA 4EJSA 3LW8A 3RWOA 1G4AE 3W5IA 3QKRA 3Q9LA 4ZIRA 3QOFA 2DBYA 3NC1C 4CEIA 4Q4JB 3AP2A 3FKSD 2OFOA 3UK6A 4Q1BA 5AUPB 1ZYUA 4RFSA 1T3SA 2QSZA 1E2JA 1IXRC 2R6FA 3I1FA 4IJMA 1KO8A 4M53A 5DHAA 1KDRA 2PMKA 5EZ6B 1M8PA 1XJCA 1UBFA 4QRHA 3ZIAD 1L2TA 2J45A 2KI5A 4PSAA 3TQCA 4BRWA 4DCUA 4XWOA 3P4XA 4GZLA 2ZRMA 3ND9A 4P33A 3LX8A 4PPGA 4Q9IA 1FMLA 3BC1A 4D0NA 2JLXA 4GNKA 2AD1A 3DDCA 2JLQA 2JJ2A 2QGNA 1GL7A 2CHQA 2C98A 4Q19A 3D3QA 2C99A 2GZAA 3AH8A 5FI0B 2N46A 5L3QA 5DH9A 1OE0A 1YZNA 3MSXA 3W6NA 2NQ2C 3KJGA 3TGPA 2AFIE 2OM2A 2Z0MA 1SZPA 3THXA 3WXMA 1G5TA 2R6CA 4Q1DA 4WXRA 3KKNA 3WBJA 2JLUA 4Z1MD 4FWTA 3MAAC 4Q00A 4RD2A 4RJLA 1VG1A 2PCJA 1LW7A 1W2HA 2ZSBA 4HDQB 4K8OA 5HZHA 4TMWA 4BGDA 2ZTSA 4C2UA 1SHZA 3ND8A 4TT3A 1JXMA 3H1TA 3QVUA 4BLPA 1SVIA 2Z4SA 2QEQA 4DEYA 1NF3A 3NTUA 4DT1A 5C4GB 1XX6A 3ZGXA 1VG0B 1XTSA 2PZFA 4TYQA 2DCUA 3U4QB 3SS8A 1AKEA 5JEDA 2J87A 2V8OA 3DKVA 4E5UA 4MDEA 1SXJC 2W2TA 4U02A 3U3MA 1LF5A 4GOJA 5LDDC 1Q22A 3NHBA 3CRVA 1QZXA 5HE8A 4TMKA 4JL8A 3T5GA 4EPXA 5JLJA 4BFVA 1N6HA 1W36C 1TEXA 2PZGA 1T3HA 2VH5R 2WJYA 3BFXA 3HYTA 3KQUA 2IS4A 3BH6A 4JVLA 2CL7X 3VHXA 3GFOA 3LAWA 1PLLA 4B47A 3IPXA 1HQCA 1VG8A 2H8KA 2RB4A 3L0PA 2O8CA 1SXJB 2UZ3A 3PG5A 2HLDD 4IEIA 1DS6A 2DWPA 2W58A 2JASA 4OBEA 1B0UA 1OXSC 221PA 4LJ5A 4MKGA 1W36B 1FL9A 1A2BA 2WSSD 1UJ2A 3ADKA 3AUXA 4LC1A 2OAQ1 4LUCA 1FUKA 2ZJ8A 5FPTA 5SZHB 2FEMA 3CIOA 4C30A 1S96A 2H92A 4FIDA 1G3RA 2CVFA 1DG1G 4TMXA 1N6OA 2IHBA 1N5IA 2XSZA 1U0LA 3C7KA 1E1RD 1OKKA 4LDJA 4NL4H 3WYFA 4LHWA 3I73A 4BZPA 4BFTA 4JJKA 5FL7A 2ZSEA 4QJ5A 2OESA 4GOXA 4E03A 4F4CA 3DOFA 3EZ9A 4IEEA 5B64A 5F98A 2FGKA 2FSFA 2V7QD 1SVOA 2BHRA 1SVSA 5DI3B 3TE6A 2EQBA 4W5HA 1DAGA 5P21A 2XAUA 4P0TA 5F3WB 3B6EA 3BB3A 5BN3A 1N5KA 3WHLA 4G5OA 5FPKA 2RGNC 2RKOA 3EW9A 3RRZA 2G3YA 4QGAA 1KI4A 2IYQA 5J40A 2BJVA 2P65A 3TSOA 3PUVA 1FPMA 3GJ7A 5AR1A 1G3UA 1ZNYA 1XXHB 3OF5A 1DO2A 3KB2A 1N5JA 3FHCB 4YMTA 1W0KD 1T0HB 2I4IA 4NKRA 2QMOA 2C9CA 4HLDA 3I8SA 1VCIA 3HU3A 2QBYB 4NTZA 1RIFA 5DE3A 1KSJA 3AGQA 3LLUA 2Z43A 3I8XA 1CR2A 4DB2A 3RS0A 1IJEA 3CF6R 4NCNA 3GJ6A 3KUDA 4RD0A 3P1JA 3FHOA 3SYKA 1GITA 1XTJA 3K1JA 4BASA 2OBLA 1BMFA 3ZD6A 1W1WA 3K0SA 2G83A 4PHFA 1XU4A 4MKIA 3OIWA 1G1MA 3IIKA 3SC3A 5G53C 1F60A 2WWWA 2ZUDA 4Q7JB 1EFRD 1GG2A 1JR6A 2RGEA 1JAHA 4DCVA 2AR7A 1VPLA 3K0CC 5FOXA 2C2HA 2RHMA 2ZU0C 3BRWD 4TWZA 2AWNA 1ZD1A 1CJMA 1FP7A 2WKPA 1FZQA 2QY9A 4M21A 1F2TA 1D2NA 1ZMXA 4AC9A 1LS6A 3QSYA 3TRFA 2V55B 2Z5FA 2ZAOA 1EESA 1NVUQ 4I1SA 2CK3A 3VR4A 1Z6YA 3B1VA 2ZI4A 4KO8A 4N0DA 4N1AA 1FUUA 1XD9A 1KDOA 1OH5A 2GCNA 4DBLC 4IVPA 1G8YA 4BZXA 3UMRA 4E22A 1Q1EA 4L5BA 1XMIA 4TYNA 1E2MA 3BXZA 1GAJA 2BMFA 1Z6TA 2Q9CA 3Q3JB 4PQFA 2GZDA 2QSYA 3HPQA 4K81B 4DDTA 1N6LA 1KMQA 3KX2A 2ZSAA 5KNBA 2ERYA 5CDFA 4O3MA 3R9IA 1VECA 2WJJA 2XOKD 1E2FA 2AL7A 3UG6A 1X8KA 1TNDA 2F6RA 4PAQA 1PUIA 1RYHA 2X1VA 5FOVA 2O8DB 1D6JA 5JJIA 1ZUNB 2N42A 2FFBA 2BKUA 3QJYA 3VFDA 5HPYB 4RY2A 3CX7A 1OFIA 1XTQA 2GVZC 2P3SA 4L4UA 4CRWB 3FMOB 1A82A 4JLKA 3QUSA 3U2QA 4U00A 2AN9A 4W5JA 5L3RA 2AK3A 3TAHA 1JR3D 1M7GA 1WQ1R 3QBVA 4JLVA 4LWZA 3HPRA 4TMTA 1E4YA 1CTQA 2XZLA 4RZ3A 1GM5A 4Q4AB 1CJUC 1YZKA 4KHZA 1E9EA 1WRBA 1F5NA 1P9RA 4UNPA 4LJAA 5DSZA 3ZJYA 4KBGA 5CB6A 3DOEA 2XJ9A 4CVNA 3RS2A 3JVVA 4WA7A 2Q0HA 1X8LA 4OK3A 3GLGE 4M1WA 3K70C 3AVWA 4PC2A 2ZETA 1EX7A 5EE1A 3FWYA 1WBBA 5HZKA 4UQOA 5C46F 5K8TA 1WB9A 4ZDJA 1X3SA 2QZ4A 5JCZA 1Z83A 2AFHE 4OHXA 2A30A 1M34E 1RC8A 2QM8A 1OXXK 2FX3A 4M4SA 2FFAA 1Z0FA 1TADA 4PAMA 2D4HA 2E9SA 4GFDA 2Q3HA 4HATA 2Q6TA 4OI0A 4URXR 2YHSA 3ZS8A 3GEIA 1J90A 1GNQA 3PUZA 1G291 1GOTA 2YKGA 4HAWA 4XSHA 2ZE7A 4NONA 1Z0AA 4D81A 2OCPA 1ZUIA 1E32A 4BLTA 4EKDA 3R9WA 4PO1A 3KKPA 1KO4A 2HUPA 1AK2A 2VIIA 3NHAA 3TVTA 1MO6A 2ZJBA 4AYTA 5JBQA 4PAOA 3I92A 4ZI2A 3R8FA 3LWNA 1AIPA 2KB0A 4B35A 1BYUA 2OCBA 1M7HA 4DLWA 1IN8A 2FSIA 3BERA 3BS4A 1D8TA 1J70A 3CKLA 1ZM7A 1Z06A 2E1RA 3RRMA 1XMSA 1KK3A 2CEAA 3KJHA 1QHNA 4G01B 4BRUA 1M6NA 4XH9B 1CR0A 1MH1A 1OFHA 5FPSA 2GXSA 2A9KA 1G20E 3K09C 1GSIA 4D80A 2Z4RA 2OHFA 1HH4A 1ZP6A 5DI3A 1NNEA 3W8NA 5GJCA 2WVJA 2Z83A 3U61B 4MUBA 4R9UC 4DLZA 3B9QA 4M1OA 4DSTA 2VTKA 5TMPA 2H57A 5H1YA 2B8TA 5LPNA 2X19A 3NEYA 5C1BA 2CLSA 2FFQA 4EFLA 1U90A 2F43A 4B6FA 2PCLA 3IHWA 1CLUA 2OXRA 3QXXA 3EASA 3W6OA 2C77A 1UKYA 4U7DA 3U3KA 1ESMA 5FBRB 1XXHA 5AUQA 2A5GA 2IXGA 3B60A 3EA5A 1YRAA 1P5ZB 3DKPA 1MABB 4PHGA 1NN1A 2NO7A 1II8B 2Q9BA 3X1YA 5J4YA 3QNUA 4AKHA 2JEOA 1VHTA 4A6XA 3TLXA 3SYNA 3MLEA 5UKDA 2DFLA 4CT5A 2JJ2D 2QPOA 4RD3A 5KDOA 2IYWA 3GLGA 2G1KA 4CEHB 2AXPA 2EU8A 4BE7B 2ZJ2A 2ANBA 1W49A 4ZV4A 2J59A 2PJRA 1DG3A 3QF4A 2G0NA 3QPVA 4XOIA 4MRPA 4QGFA 1L7VC 1Z6GA 1XNJA 3AVPA 3GQBA 4QM6A 3TAUA 2V6IA 3C8UA 1S4QA 1TQDA 4AD8A 4B44A 2VP4A 121PA 4NCKA 5TARA 2VSOA 4AWXA 1N0UA 4QKQA 1DBSA 3TJZA 1Q44A 2DFTA 4NBSA 1W4BA 2ZI7A 4I1OA 4TT3D 2FU5C 1NLZA 5D3MA 2VP0A 3B82A 5C2JB 5JHHB 4R98A 1CP2A 1F48A 4PZZA 3GLIB 3I62A 4LPKA 2ZSFA 2ORIA 3QEJA 4D6PA 3FMPB 1BOFA 4AKEA 5L3SB 4HAZA 4LJYA 2IEZA 3UATA 4F4IA 1FX0B 1A1VA 3KB1A 1US8B 3TH5A 1T4GA 4ZPXA 5DGXA 5E95A 4A0FA 4DCSA 3OHMA 4TZ0A 1T0JB 1OYWA 3NIBA 1RJ9B 4IOKA 2FG5A 1IN5A 2G6BA 4WZAE 2WOOA 4NYJQ 1AS3A 5KPJA 4JJZA 4PFSA 3RNLA 2OCYC 3KJIA 1Z3IX 4KXFB 2PLFA 5EE0A 1NMXA 2KE5A 1Z6AA
chains in the Genus database with same CATH superfamily
3D2CA 3RDPA 2ADFA 2M6KA 3GNLA 1DPFA 2PH5A 3G7UA 2P9ZA 4RM3A 5CLHA 3T5DA 3DPUA 3CO0S 3HJUA 3RUAA 4JI8B 4AJ2A 3IX7A 1TCAA 1W29A 1OR8A 3SJZA 3QE9Y 3BB4A 4RF4A 3AFMA 1L7XA 5FTJA 1I4TD 4K05A 1YKFA 3ZHBA 3V1UA 3LX4A 2J33A 3MJFA 3SMVA 2HQSA 2ZQZA 2NU7B 2OQIA 2XA2A 4EKGA 1R8JA 3FI0A 5EC8A 3RARA 2EKLA 4G8CA 5LOVB 1OKKD 1EWKA 2O7SA 1O57A 3I1YA 4JVOA 1FDWA 3VZRA 5CIWA 1QDUA 4IZIA 3CZMA 3STHA 2J9ZB 3KZVA 4CKXA 1U5CA 3D2LA 2ZLBA 3KB6A 3NNDA 2R6HA 3CWQA 4Q48A 1R4ZA 3DTTA 4QHSA 2WD7A 3RC8A 1QR2A 3KL2A 4NRDA 3RHTA 3FNHA 3PUHA 4IKOA 5BSMA 4YP5A 5A6VA 3AERA 4US0R 4QU5A 1J49A 4HNGA 1NBEA 4BO7A 4D5GA 3P26A 7ABPA 2BV3A 1X70A 3EFOB 3P9PA 2WZCA 1LH0A 4AWBA 3LCRA 4GVXA 4DUGA 1Q50A 1RCUA 2MR5A 2J08A 3HYRA 3IHKA 3L6DA 3KWLA 1P91A 3GBSA 3RYTC 4F1JA 1KI2A 3HGQA 4IR7A 1V8BA 5KYKA 3AKCA 1UKAA 4MUYA 1HG1A 4O25A 3PFWO 4D9IA 2AI3A 2B0CA 4J0CA 2I3BA 3PEWA 1GTMA 3RYHA 1MAVA 2P2NA 4S04A 4E3ZA 1T35A 4IRMA 5A5GA 1QV9A 1J5XA 2ZYTX 1JEYB 4NU6A 1N3BA 1UMKA 5E2AA 4L6AA 2J6BA 1OPRA 4KFTA 4NC9A 3UMFA 1M6HA 1VHJA 3QPUA 2Q2QA 4R83A 1D6SA 1V6CA 4Y9UA 4RK7A 4B73A 1KVQA 1J8MF 1NY5A 2GARA 4G09A 4EB6B 5KC9A 5A7HA 1L7EA 1ZKMA 3IUBA 3EGEA 4R0VA 2R25B 2ZIEA 3S28A 4QDXA 1KQNA 2ZDHA 1TRHA 4GRDA 3ZNNA 4DJDC 1EGMB 4N40A 3N70A 4DLUA 1R6UA 2VJBA 3EDYA 5JAZA 4GOLD 2O8EB 4YREA 1LI5A 3DMTA 4TQAA 1RAFA 1DC3A 2HFJA 3ENZA 4LXIA 3M82A 3N0TA 4G0OA 2LCIA 1EEHA 1KDPA 4B4OA 4AU1A 2HXYA 3R9KA 1SC1A 2PKYX 1Z4PX 2R8ZA 1YZTA 3KKMA 3MUOA 4C89A 4I1VA 5BXQC 5KNCA 3K2IA 3UMGA 5F73A 3W2GA 1E9DA 1OJ7A 3DNFA 3K6RA 3O7MA 3RYIA 3T3PB 5CEEA 3DZJA 1SXPA 3HNPA 3I4LA 4LNHA 2CK3D 2ISQA 4MS1A 1XD2A 2GF0A 3BIJA 1EBBA 2HSDA 2ODEA 3KYJB 1QHHB 3UK7A 2I2BA 1K8RA 1AQIA 4UZEA 1I4EB 1VJ5A 3OFKA 4UDNA 7ADHA 1L1RA 3T1HB 1S2NA 3KAPA 1YFLA 1DUSA 2I6QA 1MN6A 1ZEMA 1NI5A 3CXRA 5DBIA 4PYKA 4DMUB 4BIIA 3INNA 4MW9A 4ZVNA 2VRCA 5KQSA 3B12A 4YRSA 1CEEA 2Z3ZA 1UM9A 1ZOOA 2HO4A 2HH9A 3TGWA 1NIJA 3WWYA 3G7SA 1VLLA 4MRSA 3UOAB 1LI4A 4OQ4A 3V6LA 4DLVA 1EAMA 2X15A 3EWIA 2A58A 3H0CA 4HGRA 4ZCQA 5ITVA 5LN1A 4QVIA 2VHJA 2ZEJA 1V45E 3CLSD 4LY0A 3EGXB 4TV8B 4ZOCA 3U9TA 3FKQA 4XYGA 5H9WA 4K6MA 3FAZA 1VJCA 1XEWX 3IOCA 4ZOLF 3HCCA 3O7WA 4NBLA 3TOCA 3WIUA 5ARBA 2JIMA 4YRZA 3UV3A 2F1RA 1SC4A 3ERCA 1D8AA 1Z5ZA 2R2GA 4Y9RA 1R64A 2PLNA 4IIJF 3NORA 1LUAA 2NZWA 4FMPA 1PFUA 2UZIR 2GN8A 2W6MA 2WINI 2ZUUA 2XGGA 3NEJA 5FWDA 4ZMSA 3NMUF 4PU0A 4HPWA 4Q1VA 3I9V6 1UDWA 3T7AA 1LLCA 2OFFA 3KUKA 1US8A 2E5WA 2N75A 4H3SA 4A3SA 2BONA 4QJ4A 3IR6A 4MAMA 2HLHA 5JYDA 2JGNA 2PLWA 2WMNB 2L18A 3NG1A 2G5GX 1OF1A 1UZLA 3M1IA 1S5PA 3PL1A 5CVJA 5DGCA 3VZQA 3UK1A 5LZ9A 3ZD7A 1A8QA 4GI5A 4A6PA 2N9UA 3MTQA 1QBKC 2DULA 4QTZA 4UMDA 4TLCA 3QBEA 2H3HA 4FGLA 2J6CA 4YCMA 4RDXA 1KI1A 5CG1A 4ZI7B 2OCAA 4WXHA 1LFAA 1XTZA 1BEUB 2ZU6A 4PO9A 4R51A 4D25A 2CJWB 2HGSA 4FQ7A 4QEKA 4D26A 1OSNA 1PT5A 2HZBA 4UCFA 1EM8A 1N6PA 4R2HA 5EJAA 5LL6P 1A98A 3ZWMA 5KYVA 5FA6A 4NVRA 1L8OA 4QSMA 2OQVA 5M7EA 1K5DA 3EF0A 2PD4A 2BRUA 2IYNA 1YRHA 3N76A 4UJ5A 5AHWA 3NM5A 3C3AA 3W9SA 1SCAA 2P62A 1NBOA 3SDBA 3SLGA 1TJ5A 2FPGB 3FCSB 5K5EA 1QH9A 2Q6VA 4RV4A 5HF8A 2CCKA 2XBLA 2WYHA 1FU4A 3VX4A 4CDGA 5HFJA 5LXTA 3HVRA 1RQNA 4Y98A 4BWVA 1U3CA 1C3LA 3D8BA 5KU7A 1H2XA 1VE5A 2G8NA 1D1QA 1MTOA 2I8CA 4P36A 1A5ZA 1H05A 1K7EB 1N77A 4MW0A 1JFLA 3MWFA 4DC1A 2PX2A 2BBOA 4O4JB 4YCDA 5G1OA 3WLNA 2R66A 3ZU4A 2SKEA 3P71T 2W00A 2K5UA 3GD5A 2YZNA 4MP3A 2ECQA 4D2IA 4QPPA 3HR8A 3ZDQA 5TRTA 2GEBA 4QLAA 3WL4A 1LK0A 1QH8B 4EG0A 4LHSA 4C7OA 2X9VA 3I2JA 2QQ5A 4OF4A 4X1YA 1PTKA 1QIJA 1YS1X 3NH9A 1FK8A 2HJVA 2NUAA 4IM7A 2BFFA 1ENOA 2YJ3A 2WHEA 3JQQA 4UXHA 3SM9A 4YIKA 3M1YA 2ZRDA 3LY8A 3UHAA 4XVCA 3VAZA 4RTJA 2OKGA 2KBFA 4OXQA 1YVDA 3AW9A 3B7WA 4UUNA 3TSZA 1W6UA 3AF1A 2V0NA 2XQFA 4NG4A 3VYVA 1DT5A 3GIDA 3S2GA 3SQMA 1NKVA 3DV2A 3PHGA 5DBOA 1KARA 4G0QA 3R3VA 1G3IA 1GO2A 2A9JA 4YFYA 3U31A 2HMYB 5CT9A 3U4HA 3WYGA 5IASA 1MBZA 1R00A 3AOEA 3KKQA 3UKDA 5KVSA 1WMEA 1IM2A 5DEIA 3B36A 4ZDIA 3DBOB 4ND1A 1ORWA 3KWFA 3Q7IA 3MJCA 4M7PA 3O93A 1YUBA 1MJGA 3QF7A 5SICE 3JZAA 4XYMA 3HCBA 2I2AA 3ABSB 4D4JA 4B1FA 5LKAA 1M6EX 3FSRA 4RWZA 2M6LA 3BSSA 3ZU5A 5HUQA 1WSWA 2CMDA 3N8NA 3OI7A 5K6TA 5LNK6 3J81k 4L7VA 1T1JA 2XODA 1AZSC 4XDZA 4HNRA 4CR7A 3CRW1 3ECSA 2FJ0A 3WJ1A 1BX3A 2H3EA 1AVTA 3HA2A 4GBMA 4HYTA 3JATA 3UENA 5TQJA 1OLUA 1RZUA 1ZIYA 4MUAA 4ZREA 2NXCA 1FMTA 1U02A 1NU6A 5EOVA 1AXRA 3VDRA 1VE9A 1VSUA 3BMNB 3L1HA 2RI1A 2FPWA 3ENVA 3EE6A 1DOZA 3HLKA 3I6IA 2LD4A 1B8PA 1VPVA 4KZKA 4A10A 5BOSB 3OZUA 3G02A 4HNSA 2FQXA 4MX8A 2QLJA 5H70A 2Z30A 4EI9A 2VDJA 1FP2A 3CR8A 3GPBA 2E1PA 2IEYA 3FI9A 1AZWA 1P7VA 3NEAA 3H05A 5G41A 3CGWA 3ZYZA 2JLZA 2GCOB 1YZGA 4HAYA 4XQEA 3PYMA 4MMZB 3L8DA 3ILVA 4PGFA 3ZCVA 4DXDA 2IYVA 2X6TA 2GAJA 3JARB 1UQUA 4L3OA 1U1EA 5TX7A 3NANA 1T5IA 3UMMA 4TUYB 5CFQA 2PBFA 1B8NA 4R71A 2C1ZA 1ZL2A 3DQQA 5IKMA 1XP8A 3R9XB 1HLGA 1O4VA 2NYRA 2P6UA 2XB9A 4OI4A 4EKYA 1XVIA 1JJVA 2HX1A 5CCBA 1Y7LA 1NF9A 1VTKA 1PE0A 2D3WA 1IVYA 3P19A 4CDNA 1TYDE 1TIPA 2O1XA 3FVTA 3HDQA 2Y66A 5T4FA 3N0XA 1MEOA 2TMKA 2QMYA 1CBUA 1SRQA 3SLRA 1T3LA 1SKQA 2OEPA 2HWXA 1QJCA 1E0KA 2DC1A 4G2NA 4TYYA 3F9CA 4YLEA 3AOGA 4QOJA 4DNQA 1M8FA 3NAQA 4JBGA 4MGHA 4URHA 5L3ZA 4A15A 2WF7A 2J3DA 1ZBDA 1YZLA 1HTTA 4CKEB 1P9WA 1QH0A 2QUZA 4CTMA 4PLFA 2QORA 4MWBA 2G08A 2RC6A 2XIJA 1PL6A 1M74A 3LY7A 2OO5C 1W8DA 5FOUA 3GFGA 2MSEB 5AJHA 2CHVA 4MK4A 4BQNA 4K9OA 5CA0A 1KJ9A 4ARZA 4GDFA 4CLEA 1IOVA 2BFNA 4CCSA 4DXAA 4EVRA 4RULA 621PA 2G70A 2ACVA 2IX3A 4U2DA 3R0IA 3W2EA 4DIEA 1Z4NA 4KXQA 1IM8A 4CIAA 4KMOA 1J1UA 2IH4A 2GPAA 1E96A 1KZGB 1T0IA 3IMFA 4QJBA 1FYVA 4O02B 3RFCA 3Q0TA 3RJTA 2JIOA 4AYXA 4CKYA 2WM3A 5LIRA 1U99A 1ZM3A 1BFUA 2IZOA 2W6IA 1J42A 2PGLA 4U9HS 2R8PA 1N9ZA 2JAOA 3MEQA 5A2GA 1IZ7A 1NN0A 4A4DA 3VO1A 4N01A 4MDFA 4Y6LA 2F1IA 2PZJA 1PR9A 1SQSA 3W34A 3KR2A 3T6KA 3AFNA 1BMTA 1M33A 3SX0A 2WYOA 3KSRA 3L9XA 5FAKA 3BBPA 1N9KA 1JHMA 2IEAA 2QENA 2ZUBA 3MT0A 1CUUA 5EZSA 4IOJA 2OVFA 4XDGA 4AMZA 3KOUA 1AK9A 5CX4A 2NLOA 4EG4A 4OMCA 1VIYA 2J0SA 1UK9A 1WU8A 2R1VB 4IGAA 5D5HA 4GX5A 4BCBA 2ZTVA 2XUQA 3CE9A 3RIYA 4GQAA 4BEBA 1SUPA 2JVIA 3OQHA 4CWAA 4JJEA 1BXZA 4KNWA 2VK4A 4LCJA 4KVGA 5IUKC 1JDVA 3N7TA 4WNCA 1V7PC 5KX5A 1SBZA 3FCYA 3FNGA 3OT5A 1U2EA 1IUKA 3T7TA 2H29A 3M33A 4MWOA 1UOQA 3RK0A 1LZLA 1XTUA 1QHIA 2R751 3E9EA 1L5NA 2HW8A 2Q6LA 1NP6A 3E9YA 4WT7A 3R0VA 4LVUA 5K3FB 4ZVOA 4IVNA 1T2UA 3BSYA 2TRSB 3CLRD 4IV8A 4UNNA 4JS0A 4XEHA 3ZHQA 3BXPA 3AYZB 4CMKA 1CRQA 2XDWA 4A0HA 3BF8A 3RVMA 2PFKA 3ZE9A 3F5DA 1PKXA 1TAGA 3V5NA 2CLKB 4PZ9A 3BL8A 1ZVVA 1ZZEA 5JEEA 2E4UA 2PANA 5D6OA 3U6KA 1T29A 2H4YA 4DB4A 3AVOA 4J94A 3CG4A 3K8OE 2YXEA 3FOAA 1KPHA 2X6QA 2V5UA 4JBWA 3A4TA 4D5EA 2J6HA 4LCBA 5ALLA 3DOHA 4Q12A 3KTAB 3PNQA 2OK8A 2OORA 1ZX1A 3WKDA 4DA7A 4ZHQA 4DAOA 3L7CA 4F93B 4C0SA 3TGLA 2BF7A 4ENQA 1XQ1A 4BL5A 3JTMA 5DMHA 1KI6B 3FHJA 4AL4A 1Y5NA 1GU0A 1ZCZA 2ONZA 1K98A 1N7JA 3DAGA 5LP6A 3C5VA 1CZKA 1Y8AA 1JBQA 2WC1A 2P2CA 3LWZA 1NWCA 5F35A 3EIHA 1R9JA 2MSLA 2ZRGA 2ZTHA 3A4YA 3PPXA 5LMCA 4UCWA 2NVUB 2P7IA 1XI2A 3N0VA 2AX4A 1XXHE 2PIAA 5BYAA 1SK8A 3IV6A 3ZQJA 1YJXA 2Q1WA 3U4QA 1GKIA 5CCDA 1XJQA 5ARDA 2K2WA 2Z6VA 2GDZA 1Z4MA 4EKIA 3PX2A 1QWSA 1NOIA 1VSQA 5BUZA 1IC6A 4WGFA 2IXAA 4E5NA 3O8RA 3AI1A 1L5KA 1RZRD 1VGQA 1U9IC 1GUDA 1F9EA 1MAHA 2ODQA 2ONJA 4Q7EA 1W0JA 3BH7A 4KLZA 5DK4A 4A8PA 1JG6A 3KUUA 4LFBB 2XT9A 4A03A 3EEBA 3C3PA 2Q21A 3AUKA 5DX1A 1WZUA 3NOXA 1SBHA 5EMNA 4DEVA 1PZGA 2C88A 4UUPA 4Z7QB 3QNMA 4WBXC 1Z4KA 2QPLA 1M8JA 1CHNA 2YWBA 3AY0A 3UJ6A 2JAWA 4CZ2A 3FYUA 4KN5A 1NUHA 5DO9A 1EGAA 2V7VA 1S3IA 2IGTA 1CETA 3ZQKA 3GY0A 1HT3A 2VF2A 2YFYA 4ASUD 2PH3A 1X86B 1BGVA 2AIRA 5IJ9B 1RXVA 3TLKA 2IVFA 4LJ4A 5AH0A 6CHYA 4OQEA 1XJ0A 2BSXA 4OQMA 5I9MA 3KRTA 3RE1A 1F51E 4CV2A 2CB9A 3CMMA 2R5WA 3IUPA 1PR3A 2YC2C 4QUDA 2GXQA 2F2TA 2WE7A 1DOAA 5MN4A 3VR6A 4EI2A 1CY4A 1ULZA 1A7KA 1JA0A 4I6JA 2IZ7A 3GWZA 1DAHA 3EPLA 5BURA 1N25A 1P2VA 2OXFA 1E3WA 1E8DA 2RH5A 2AQIA 2ZRQA 3UBMA 5LJIA 3N87A 2IY9A 4MVJM 2PU5A 2GCGA 3R3HA 2J46A 3E22A 3SIRA 3IT1A 2GO7A 1OPXA 1H85A 3R7LA 2TMGA 2OFWA 3SR3A 3ZWYA 3E9DA 2QWXA 3GRRA 4WXYB 4XQ0A 1JSZA 1E3SA 3QFHA 4FEGA 3VV3A 1UINA 1Q74A 2ZUSA 4PFJA 4MQMA 4NZNA 4Y1FA 2J5BA 3P45A 3PCRB 2B21A 3H4TA 1G7TA 2VEDA 1TA4A 3B8EA 4J6FA 4ZU1X 1IQ0A 1UJ4A 2DHDA 1SVMA 4URWR 4I55B 2XPCA 5TJHA 1A2QA 3U7IA 3G23A 1EFHA 1NWHA 3C87A 4UEQA 3OE4A 5CURA 4C22A 1L5MA 2ZT7A 1NI4B 3T7IA 3VVMA 1VC2A 2W6ZA 4Y2TA 4PN3A 4F4FA 2JHCA 4DBLE 5GM1A 5EHZA 3GQVA 3P0JA 4BXOA 3UAOA 3IT0A 3CZRA 4BUJA 2WFAA 1XHLA 4ZVRA 8ABPA 3DQPA 1JEEA 2O1WA 5ADVA 3T52A 2ZB7A 5IMBA 3SDZA 5HSGA 1H6AA 4XSGA 4BDSA 1R27A 1G8SA 1M1UA 1T1GA 1DIGA 1GPWB 1W25A 1YA8A 3OEWA 1U5BA 3ZY2A 3NASA 1BO6A 4G8BA 2VYFA 4JT4A 4IF6A 4PCVA 2AQHA 1Z0KA 5EWMA 1N8KA 2R8EA 3PGLA 3RVQA 5B6IA 3L1UA 1FQKA 1KYXA 5PGMA 1AGNA 3QELB 3A1WA 4D8TA 4MKFA 2IYAA 3QEMA 3F6PA 4EHFA 3QX7A 2F8MA 4OU5A 1FFSA 2Z2IA 3ETNA 3G88A 4M49A 3WNBA 2ZYUX 5CA0F 5LQUA 4MJLA 3ODGA 3ROQA 1I2AA 3WK8A 2HPHA 1OYYA 2IE0A 3BD9A 3CTPA 4FKMA 2WVGA 4G5XA 3GCWA 1AMUA 5JATA 2C4KA 4BGEA 2RHLA 3SXJA 3KR9A 4GT1A 3WJ7A 3H1FA 1GDHA 1URPA 1BE1A 5JZSA 1E20A 2J48A 5GONB 1V9CA 4QGHA 5B3JA 4U8GA 1GUZA 1T5DX 4YAWA 5T7BA 2O2GA 4RJKA 4XGQA 5T4BA 2QN9A 1A8PA 4F9FA 4ZYTA 4URFA 2ORYA 4YJFB 4CU2A 4GU5A 4L9SA 2B83A 4D9JA 1Z56C 5A9RA 1P9OA 1T2VA 1XTIA 2CMFA 4GPEA 3R3SA 4GZ6A 3A36A 3QUBA 2HJGA 4J0IA 2FI1A 1OV6A 4YAJA 4AZTA 5F2OA 1DPGA 1GNLA 5ESWA 3QSGA 2JLVA 2Y1XA 2A33A 4QFCA 4XVRA 3VU0A 4JYPA 4Q3BA 1EZ4A 1U31A 1WCXA 3ACCA 4L0QA 4LGVA 3ZIDA 4D3YA 1IN6A 3ZHRA 4IZHA 5TMBA 4MRMB 4R8VA 5GZ1A 5IP5A 3AYXB 4M9XA 2YJ6A 1PZXA 4I4CA 4KJZA 4DLKA 1O95C 1PJ3A 1ULHA 1YR6A 1QPBA 1QG2A 2I55A 3PICA 4IMPA 4P7GA 4D9BA 1K2WA 3HKBB 4ZT2A 1C8KA 3LP6A 1RAAA 4UATA 1NFFA 5SZIA 3T1OA 4WECA 2R86A 4MJ7A 1NSFA 1JXOA 4P34A 3P2OA 4V1CI 1LC3A 2FN3A 3DDOA 4E07A 3OX3A 4UTXA 5EIHA 1VBMA 2YY7A 3L7NA 1L8AA 1KJWA 2HCJB 4JEMA 3IKLA 2O5RA 5EIBD 4P8RA 3D8SA 4YBZA 5JXWA 2NP6A 3VRHA 3S2IA 2D2EA 2IX9A 2BW0A 1CDEA 1U3WA 2TMDA 3DFUA 1RI2A 4O2BF 4X0EA 5EN4A 4RA9A 1GTZA 3IIJA 4NU0A 3F6RA 4Y2SA 2DR3A 1X77A 2Z4TA 1FCJA 4EJSC 3IJPA 1U4OA 3O2NA 5THQA 1LDNA 2XMZA 1R5BA 5CJ2A 2VPZA 1OBVA 3BHIA 1QVZA 3NLLA 4S0XA 1REQB 5FOTA 5U4QA 3H4MA 1Z8FA 1KJIA 4JSRA 3RT1A 2GFQA 1U2GC 3M6IA 1IIBA 5CG2A 3RKSA 2VTBB 3HP4A 3OZXA 3L92A 4JLAA 3IDZA 3FBWA 2O5CA 1L8LA 1YVUA 4IXWA 2HXGA 4IGEA 2R8RA 4MDHA 2OHOA 4ALIA 1VIDA 5EE9A 5H02A 4BNNA 5DW0A 2DLDA 4RIIA 5AVOA 1Z6PA 4HYQA 4YIHA 3RTGA 5I8WA 3D4NA 4R1UA 1T15A 3UVEA 1G21E 5ESXA 4BGVA 2BGTA 4DSOA 4CEIB 2Q5HA 3BEDA 5DSXA 1XSEA 2ZRLA 2P9BA 4ALJA 2KWIA 5EJMA 2PDAA 4W1PA 4FHCA 1E59A 2RGBA 4JBYA 4JUIA 3ER9A 2QRJA 2DB3A 1AUXA 2NTYC 2GHIA 3U6BA 5F9HA 3RTEA 4GI7A 1BA2A 1GPDG 1PFYA 4QXQA 4K6FA 3PJRA 3IEXA 4CF3A 4MYCA 5K4GA 2BCJQ 3RFXA 3AM3A 1L7MA 1C8BA 1FLDA 1TOAA 1Q0ZA 4L74A 3IXLA 1FP4B 3TX2A 1KK2A 1IM5A 2RH4A 2ZRNA 3CLTC 3KR0A 4KQKA 4O5OA 5JZOA 3UUFA 3A2NA 5J3JA 3RS3A 4MW4A 4JN6B 2WUWE 3K0FA 3GAMA 1UAGA 4BNMA 4E2XA 1LVUA 1R0RE 5B7PA 1WMSA 2HLNA 4Q3KA 5JVDA 1F38A 3QVGB 1CK4A 2PS9A 1NAHA 3C8MA 3P9SA 4RSGA 4RZHA 4DYDA 3S29A 5EKTA 5DCWA 4KWCA 4I4IA 4I1IA 1TQ6A 4KB5A 4OGFA 5KWSA 1B8OA 2QV0A 3ZHCA 4P0QB 1YHYA 2WILA 3RUDA 5JMTA 2WZQA 1NM5C 1X19A 1E99A 1Q7BA 1ILEA 1KK0A 2F1JA 2X3FA 4PIMA 3WLLA 4ENSA 4RH0A 3QXJA 4RL6A 4LYHA 4RVFA 2A1IA 3HK2A 3MTAA 3F47A 5FF9A 1RHRA 1VJ0A 2CL5A 2CNNA 4G07A 1JHPA 4N39A 4KRGA 1XK7A 4BTVA 1YR2A 3PC8C 2O2IA 4WD3A 5JI2E 5K4HA 5L9AA 3KXDA 4N12A 4B2PA 1JG1A 5HMMA 2VWGA 3FPCA 1M0SA 4Y6RA 1ZPDA 3PXUA 1ZA2A 4R2MA 4Y7CA 3IP9A 3I9V1 3FDZB 4Y2JA 1O8BA 1KDTA 2PJZA 5A9SA 2QIPA 1BCRB 4LKOA 3Q7TA 1GCIA 2J8ZA 5T5QA 1HRKA 3GJ0A 1G5IA 3OMLA 3AI2A 1A4UA 3L8CA 1II8A 1XZHA 2XF2A 4PQGA 5ERYA 5FOSA 5FJJA 3QVOA 4DDMA 4E4RA 4EPRA 9ABPA 5JT1A 1IRIA 2CXOA 1A9PA 3GDGA 4W9RA 4H27A 4JBIA 5IAEA 1B42A 2ET6A 1C7JA 1AZTA 5DTMA 1VHLA 2MDTA 3AL0C 1TX4B 1L5VA 5E4FA 4FDUA 4MB2A 4R1LA 5FA5A 2FZLA 4CQMD 3AVYA 1JR4A 3C16C 1N75A 2HQRA 3GUUA 1HT2E 3HZHA 3PEFA 4HQ6A 4I46A 4JVMA 3M6WA 4QO8A 1RMQA 4YUAA 4KAJA 5GADl 2RHDA 4X00A 2IEBA 4TXNA 4MKRA 2PGNA 1MB2A 2Y0CA 1EIWA 1D6NA 2P0YA 3VKHA 1CUZA 4PZUA 2BMAA 2BUAA 1VYTA 2WMYA 3LQ2A 4PZEA 4DJ5X 2EIHA 2ZYWX 4U7JA 5MFPA 4AURA 1A4IA 2Q29A 3CLUC 2VJAA 2IXTA 3SZLA 2C78A 3SM3A 13PKA 5HHTA 5J4VA 2WG1A 4UQPA 2OLEA 2CJYA 3IAXA 2GN1A 1BWPA 2V4ZA 1X1TA 3BK1A 3HO6A 1TCCA 3UCFA 2PMFA 3RV3A 1QIDA 3SYLA 1YDFA 2Q1XA 5DM60 1CY6A 1R9NA 1ABEA 1V39A 3F6BX 2VZ9A 1Z47A 1U1FA 2MTBA 4G5HA 4YAEA 3KQTA 4F6LA 3GLIA 1FU8A 3IO5A 4P4TA 3W1VA 2QROA 1NKSA 2B98A 3C48A 3WAGA 3KELA 4KIUA 3O92A 4BCCA 2ZI9A 1NQOA 2XGOA 5IC4A 1E3EA 1M1YE 3D3NA 3JQAA 4YDSA 1F06A 1X0VA 4OH1A 2AKAB 2ATVA 1WM1A 5DYIA 1IEXA 1XQ9A 2GPBA 4KXVA 3DAFA 5JRZA 4HN9A 1K5GA 1E79D 1JX6A 4OQPA 5EINA 1E7QA 2W6JD 3HACA 5L7TA 3IEKA 1RWOA 2EJWA 3DEAA 1NBMA 4GPTA 3TQTA 4C6SA 2B6NA 3WADA 1L7QA 2XWQA 2IPLA 2GHRA 3HR4A 4KIJA 1TEVA 2NSYA 4NR0A 1FPQA 1XBTA 1DC7A 3MCWA 5KSOA 5C52B 3VNUA 3JQ9C 4FOSA 2XNDA 5HJEA 4I36A 3A6HA 1BE0A 1B8VA 2O2JA 2JFBA 1P17A 2B8WA 4A2PA 4D9FA 1XGKA 3GT4A 2V6JA 2VPYA 2PKQP 3N5KA 3S81A 5A5EA 2MR6A 5L6LB 1ZD9A 2QW8A 3KTFA 3JQFC 4LV5B 4O0LA 2IYRA 1COWD 3F2IA 2IOHA 3TZ6A 1IY1A 2CCJA 1BWSA 4RKRA 3I1JA 2JRLA 5BWLA 2RHOA 3EAQA 3B13B 4JP5A 3TZCA 2J9GA 1XAIA 4EJFA 3WIOA 1L3BA 5L4NA 4FI3F 3IVGA 5BUCA 3EARA 4KI7A 5CNIA 2NU7A 4Z4IA 2PN1A 2YYAA 4AZ0A 1AHNA 3A6EA 1GVNB 4F3YA 4BJ1A 3PXXA 4OXIA 3HXQA 4KW7A 4ZRDA 1Q5PA 3WAJA 3O1LA 4FBGA 4CV0A 4YGXB 1DDIA 5HCUA 1M83A 3IO3A 4I9GA 4IZ6A 2IEDA 4UMVA 1MVOA 3UT6A 1CNEA 1ZOSA 2QE6A 3QTLA 4UM9D 4W99A 5EIWA 1SD1A 5G1NA 4XD2A 4Y9SA 3ZKWB 4KQMA 1VMIA 4MVJE 3GK3A 4WFIA 5DNAA 3MPOA 5EY5B 1GCUA 2BEUB 5FV7A 2JAXA 3DJYA 2JH9A 3E9NA 1P1JA 3CYFA 4PTZA 4TS3A 3ZH2A 3OX2A 4QTYA 4LF7B 2YVKA 1G8MA 1EJ0A 4K88A 3S68A 3WLEA 4JJ6A 3T12A 5HOEA 1PR1A 2GH1A 4H1HA 5HCIA 4O5AA 1T2FA 5AHKA 2XYVA 2IXEA 1EXVA 3Q4GA 2VJLA 2MSDB 3RJ5A 2Z8YM 2I3AA 3BZUA 5IM4F 4R5HA 2FPIB 4HSGA 4UU1A 4KTTE 4ZKEA 3G17A 1H2AS 3KQOA 1OI4A 3TKLA 5KVAA 1VIAA 3MWGA 3Q9SA 1KY4A 3QVXA 3ZPXA 1WABA 3NUGA 5KNDH 3U3DA 2P77A 4M2LA 3KTDA 5C4MA 2J7PA 1K9SA 2QMQA 1OYOA 3ONEA 3GGGA 4H9GA 4I4TB 3SXPA 3TLAA 2D0PB 4HQLA 3VSBA 1NDHA 3ZNOA 4M0KA 4D43A 1GUFA 2QP4A 5HDQA 1K1EA 3LO5A 2IXDA 2I76A 5FUBA 3OX1A 3BX1A 4IHJF 3NHSA 4D45A 2FSUA 1FZTA 2Z9BA 4H6WA 3IL2A 1E4EB 2VR1A 3HFRA 4DQLA 1JMYA 1IK4A 4CU5A 1TC2A 1UFRA 2Q5OA 5CT4A 3V1YA 4AJ1A 2OT3B 5AOBA 4EB6A 4Q9JA 2G9QA 3RTAA 2VDRB 4XQGA 1KFBB 3KBOA 5EQFA 3NT4A 4RHEA 2DM6A 1PV2A 1UBOS 2XR1A 4JSTA 4WN3A 4OQZA 3OTHA 3DAHA 5T4HA 5J2TB 4EUKA 3P8ZA 4A92A 4BVJA 4POOA 1AG9A 1QGZA 2H1HA 3H0KA 1JKFA 2XQVA 3OZGA 1X8JA 4DCOA 2I91A 3CSSA 2CLFB 2XXJA 3A3NA 3A9TA 3WRVA 2O8EA 1K86A 2CUZA 3AXTA 1O8CA 2WLTA 1JSCA 4JDPA 3ESYA 4KITB 3IPRA 2O2XA 1ACLA 3PKIA 4LTNA 4MRVA 1P3Y1 1VJDA 3ZG6A 4W5RA 3RADC 4MUGA 3OF3A 4QBHA 3EIEA 4G1MB 2Y2VA 1P45A 4WBNA 3ROTA 3ROKA 5FL3A 3QFTA 1C2TA 3OIVA 3V7NA 5TLSA 3SWWA 2WOJA 1A9SA 3AJDA 5CB4B 4O4IF 5DLPA 2RE8A 2FSVC 1MKYA 3PPVA 1QHHA 4Y0NA 3PK0A 4NOMA 4UNSA 4LXYA 4GMXA 3WLIA 4CMIB 3O0DA 4F1WA 4ZXFA 1JZTA 1LWOA 1IHYA 4Y2QA 5DM1A 4D8YA 3K7EA 4JIGA 2D8MA 1L5FA 4IEFB 1QR6A 1ZM9A 3KCQA 3L8YA 2VHZA 3ESRA 4L4SA 4BNVA 4HSEA 4CTKA 1AS2A 5KMGA 1XZGA 1IQPA 2BMDA 5DBFA 2HYIC 1CDZA 3O9VA 2WI8A 2OCLA 4BHTA 4C7VA 3VPFA 3OM0A 3GRUA 2PGAA 1RFGE 1UP7A 1W4ZA 3K9WA 3R0JA 4NPHA 4LE2A 4D3XA 2BMWA 2BI8A 3GFVA 4JY7A 5ECWA 4F91B 1T1EA 4JVNA 4Z3DA 3GR6A 2Q27A 4FS8A 4URZR 3WDKA 3RBAA 4JA2A 1B0AA 1NVTA 1BU5A 3HBFA 3EGXA 2D0IA 4TV8A 5EJGA 4E5SA 3OE7A 3EMDA 3TSCA 1GV0A 4BQPA 1GRRA 2W43A 4CCWA 1EM6A 5K05A 1F8GA 5KTYA 1S1MA 3F98A 1Z7BA 4XARA 4ZV7A 5HTOA 1U9ZA 3CRMA 1BCSB 4IMIB 4NG5A 1A2KC 1K8YB 1ONSA 2BEKA 1RLMA 4ZC1A 4BB6A 1GLVA 1XF1A 2ECKA 5LWHA 4JQYA 2FDCA 4IYRA 5DXJA 5CVVA 3DCNA 1YKSA 1YTUA 1PWEA 4GX0A 2XE7A 2NU8B 3TPZA 4YMVA 1PZEA 3M6MD 4YRCA 4WKOA 3CWZA 5E7QA 4F71A 1PFWA 4J0GA 3PUWA 3AR9A 2WJPA 4MQLA 1NN3A 3PHIA 5TC4A 2P7HA 2D6FA 4R84A 5K0TA 2JD1A 1NIPA 3ZVMA 4IMJB 1PEYA 4ME6A 3U9SA 4IG4A 2CCGA 2FWRA 4I5IA 3FCXA 2R7AA 2PL5A 1WCV1 4B80A 4NH0A 2HGZA 1VCNA 1ODFA 3DBVO 5JDIC 3N2KB 3ZTTA 1XNHA 1M2KA 2R1TB 4ZI7A 5F1KA 2JFYA 3CIFA 4YBRA 2F43B 4B43A 1WMDA 1XDSA 2WJHA 1OB5A 2CJWA 2GCIA 2ZJ5A 3AR8A 3HABA 4BX8A 4AYWA 1W96A 2ZJ0A 3DGEC 1J2YA 4FOLA 5SZJA 5KOHB 3K70D 4U6NA 3KOZA 3EXG1 2GZ2A 2IC5A 1BYIA 1QNFA 4YNBA 5IK2A 3N3BC 3OTQA 2YL2A 3Q11A 3RSHA 5KZMB 6ADHA 3AIMA 3STTA 4CW7A 1RYBA 4H6PA 1QIFA 2FPGA 3JWHA 1JQ5A 3H11B 4HYYA 3MG9A 4RF2A 3G3EA 2Y77A 3GD7A 3FVQA 4FYXA 4MVXA 1LDGA 1OI3A 3PE4A 3CVUA 4I99A 4F8EA 1S7CA 2HBRA 3ICWA 2ZULA 1FLVA 1JYSA 5HRCA 5KJCA 3PPWA 5CYGA 1TO2E 3F6SA 2R97A 4I8XA 2WHQA 5TSDA 1SCUB 1MQAA 1XZQA 3MWJA 4JLDA 4X6YA 3UFBA 1SD5A 2NQ8A 1SVNA 1Y6ZA 3AUYA 3H3JA 3JAWB 5IDVA 5ECDA 3RUPA 3GF4A 3DXZA 3C1TA 4ALNA 2FRXA 3PXCX 4TVKA 3KOOA 4ZK6A 1O97C 4OYHA 2WQ6A 1QH8A 1JZSA 1Y63A 2IS2A 3TM5A 2AMJA 1IEVA 2VPXA 2I6XA 1GPBA 1TVEA 3MWDB 2NZJA 4MI6A 4H6XA 1G8PA 4L75A 2QX8A 3W7BA 3SSNA 5DULA 1HO3A 5ITSA 2D5LA 4NZ9A 1XTVA 4LYFA 4B3MB 4WCFC 3CWCA 3I0NA 2RIPA 5FNVF 3F4LA 1B93A 2DQSA 3ORSA 2P5TB 3OCVA 4QOSA 1F2UA 5JR3A 3PF8A 1JEQA 2P8JA 2IDZA 1QB7A 3LK6A 4HBGA 2F3PA 4WZ6A 4KGZA 4YP9A 2JGFA 2IV7A 4I5GA 5CBPB 3S7TA 3QBDA 3UTCA 1J0DA 4JI2B 2PQMA 2X2EA 3P0EA 1JBEA 1TJ4A 1R10A 3AFOA 2W8ZA 2LP4Y 2J0EA 4YT5A 3B8HA 1CLEA 2UKDA 3KNZA 4BWYA 4RTQA 1YJ5A 1D1TA 1KBQA 3EZLA 1C7QA 5EWLB 3W77A 4BEJA 4KE7A 1SMKA 3FN4A 2KHZA 1P80A 1NLYA 2J3HA 3FFBA 4JCOA 3VOAA 2GK6A 4L8GA 1XPOA 3AVTA 3L0DA 2DQYA 4JB8A 1V4NA 5KWJA 1CERA 3KJFA 2RMKA 3H83A 5H3LA 1ID1A 3T3NA 1WCWA 1R0KA 2XYHA 4PTLA 3RQIA 2B94A 1OFVA 2AUMA 4J0QA 5D8DA 3TK1A 4WFQA 3F7OA 1EFTA 4L27A 1OAKA 1QUEA 2FEOA 2O2CA 2DHEA 2K2QB 2C3UA 4YV2A 5K0GA 5EMMA 4J0JA 3ZU2A 4EPYA 3BMNA 3NRBA 3M3PA 3SEFA 4REQB 3VO9A 5F23A 1ACMA 4OG2A 2WHPB 1RRMA 3PQ6A 3Q40A 1HUQA 3KLNA 1X14A 4RCZA 2PGJA 5BOSA 2C54A 3INGA 3ED1A 4WHMA 3UWPA 3VJLA 2JEZA 5LZ2A 3FPGA 4YXWA