4DLNA

Crystal structure of the cftr inhibitory factor cif with the d129s mutation
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
297
structure length
297
Chain Sequence
AEEFPVPNGFESAYREVDGVKLHYVKGGQGPLVMLVHGFGQTWYEWHQLMPELAKRFTVIAPDLPGLGQSEPPKTGYSGEQVAVYLHKLARQFSPDRPFDLVAHSIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGESLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNTEVFSERLLDLYARSYAKPHSLNASFEYYRALNESVRQNAELAKTRLQMPTMTLAGGGHGGMGTFQLEQMKAYAEDVEGHVLPGCGHWLPEECAAPMNRLVIDFLSRGRHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative hydrolase
publication title Inhibiting an Epoxide Hydrolase Virulence Factor from Pseudomonas aeruginosa Protects CFTR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 112
structure length 297
sequence length 297
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4dlnA01
4LIPD 3IUNA 4WDRA 1BN7A 5ESRA 2ZSIA 1E66A 4Y2XA 5EHNA 3SX4A 1T2NA 4BATA 4JYMA 2EDAA 2I03A 1MJ5A 1XZDA 2Z8ZA 1JJIA 1J07A 1GKLA 2PU5A 5LZ4A 2QUBA 5BWCA 3W2TA 3R3WA 2AJLI 1EB9A 2Y1KA 3C45A 4MEBA 3WKEA 3PE6A 2VAXA 2BUCA 4QLAA 5AM4A 1R88A 2DCMA 2O7VA 4Y9SA 2VATA 4KAFA 2HA5A 3P2MA 1Q84A 1S8OA 4NMWA 3QMVA 2DHEA 5JIBA 3G9UA 2XMRA 1QIKA 5D6OA 5ALKA 5E2IA 2XQKA 1ZGCA 1CIJA 2GYVA 5BOVA 4M0EA 4AN1A 3NOXA 3FYUB 1BN6A 1EVQA 2WUFA 3DL4A 2I3ZA 1HLGA 2H1IA 1CUFA 5SYNA 5ALNA 1Q83A 2I78A 3G0IA 3DS8A 1UWCA 5JD5A 2ACEA 3MUNA 4BZWA 5HK8A 1GPLA 3R40A 4UBLA 4AO7A 5A6VA 1DWQA 2DQYA 2ACKA 5BV7A 3D0KA 3BJRA 5D3KA 4OYYA 2HU5A 3DNMA 3R3XA 4X6YA 4OU5A 3O4HA 3FCXA 5AICA 1YA4A 4YPVA 1CUBA 1HQDA 1H23A 4W9RA 1YAJA 1R50A 4G8CA 1UT6A 1GZ7A 5EHXA 3HACA 4JUIA 3WKBA 5LKAA 5C81A 2XLBA 2FX5A 1U4NA 4UFOA 5JADA 3V1LA 3V1KA 1EDEA 1JJBA 2V96A 1CUHA 4PQEA 2X76A 2VTVA 4W1PA 3EQ9A 1VZ3A 5ALFA 3BL8A 3D2CA 5FV4A 3E3AA 2JGFA 3QMMA 4BVKA 4Q3LA 3IURA 4AZ0A 1EXWA 1VXRA 2OCGA 5IVKA 2XMDA 3RK4A 4QWMA 1CUGA 3QPCA 2QZPA 3H18A 4XX1A 2FJPA 3G0CA 1UKAA 4CIBA 5ALHA 1XZMA 2OGTA 4J0HA 4QE3A 4B82A 4Q3OA 5LIPA 1L7RA 5ALLA 3WZLA 4CCWA 3NGMA 4QDOA 1WOMA 4GWLA 1R9NA 2VJBA 3WJ1A 1F8UA 5AK4A 4BDTA 5AKHA 1ORVA 1IUPA 2HHAA 2ZYSA 3FAKA 4IHAA 3WJ2A 2CKMA 2YH2A 1EX9A 5FDFA 3WWDA 4FFVA 3G9TA 4J03A 1SCKA 1VA5A 5DJ5A 1GGVA 5FP0A 2XQFA 2VJAA 4ARAA 2FJ0A 1FJ2A 1ZD2P 2OG1A 1E8NA 4PW0A 5HF8A 3G02A 4MEAA 3L1IA 1WM1A 4H77A 5AIAA 3OC0A 3BE8A 1QIDA 1GQRA 4S0XA 4TPKA 4BRSA 3FYUC 3WWCA 1OCEA 1TAHA 4TVKA 1XKLA 1KU0A 4H7FA 1H2YA 3OG9A 3H2HA 2OLEA 2B61A 4EZIA 4EUSA 3T4UA 4FDMA 3EF3A 1JT2A 4CFSA 3KWFA 1CQZA 2NW6A 1EINA 1ZJ5A 1AZWA 1LPOA 2RI6A 1Q0ZA 4YASA 1AGYA 4BZZA 3NWOA 2LIPA 4J7AA 5AOCA 5K5EA 4B0OA 3VVLA 1QO9A 3ZI7A 5FPQA 3D3NA 1W4LA 4GEGA 3AZQA 1IMJA 5J3JA 3UMJA 3TJMA 3C5WP 2E3JA 5YASA 2QXUA 3AFIA 4L72A 2K2QB 5LKRA 1GPNA 4BAZA 3FYTA 1QZ3A 2QMQA 4AQDA 5D3ZA 1A8UA 2XUAA 3FSGA 5HF5A 3DL7A 5CMLA 2CUTA 2VT6A 1JJFA 5T4EA 5CRIA 4Q05A 1DTEA 5DYTA 1EI9A 1XLUA 3CCBA 3G0BA 2OCLA 2JEZA 3F67A 2XMBA 4EBBA 3FLBA 4KAAA 4P92A 4ZI5A 4Y2SA 1PV1A 3M82A 1GT6A 5CT5A 3GROA 1SOMA 3DD5A 2RGUA 3H1AA 4IH4A 2WTNA 1CUXA 1XZJA 3VJLA 5IVDA 3QBJA 4H7JA 3IVMA 1C7IA 3D7RA 3GBSA 5EIHA 2WIGA 5HF9A 3TGLA 2Z3WA 2ROQA 5AKJA 1RYYA 4M0MA 2Y6UA 5AKIA 3F8SA 5AHXA 1VOTA 1CUWA 2XUKA 2X8BA 3H17A 2GBGA 4OD0A 2VEOA 3M3DA 4UBJA 2OCKA 4EB0A 1GXSA 3N0TA 4L0CA 4UBIA 1CUEA 1VZ2A 3DKKA 3LS2A 3OPMA 2HRRA 2BKLA 5EI5A 1CUAA 2XUQA 1YA8A 4JNCA 4BP8A 3ESDA 2Z8XA 2FUKA 1XZFA 3C70A 1QIFA 2GBIA 3QM1A 1PJAA 2GBCA 5T4FA 1VA4A 2Q0XA 5JASA 4E46A 2WUDA 1SFRA 2WHPA 4WJLA 2XQIA 1IZ8A 2XLCA 2XUIA 1DWPA 5AP9A 3FCYA 2XMQA 3W04A 4OSEA 4QLOA 1UK7A 4K2AA 4B6GA 4FTWA 2C4HA 3DOHA 4N5HX 4H7DA 3W06A 4H0CA 5CH3A 5AI4A 5KWJA 1FFAA 3FSGD 2PSFA 3C43A 5IVIA 1D07A 2QS9A 5JAHA 2BCEA 4DIUA 5F4ZA 1DX6A 3VVMA 4FNGA 3SC2A 2PX6A 1QIJA 1CQWA 3ZLVA 1QFMA 4BE9A 1CPYA 1ZJ4A 3LIIA 1OXMA 1K8QA 1XQYA 1MU0A 2O2IA 4G1FA 2XUPA 3PDCA 3O95A 5K3CA 1IUOA 4G4GA 4RPCA 4UHDA 4K6HA 1MX5A 4KR0A 4KYVA 4HZGA 3D2AA 3F97A 1ZICA 5K3DA 1BS9A 4FNMA 4Q82A 4XJVA 5AJHA 2WHRA 1LLFA 4IO0A 3LLCA 3KDAA 2OAGA 1LBSA 4X91A 4I19A 5JD4A 5A7GA 5ALDA 1WB5A 2WIFA 3RARA 1GQSA 4LXIA 3AJAA 2OXEA 1WPXA 3KWJA 3I6YA 3L1JA 1CUCA 4Y2RA 1EVEA 4X97A 1DINA 3FVTA 1N5RA 2J3DA 2XDWA 3DYVA 3R3YA 4WFIA 4BCDA 2DFPA 4BTLA 1QONA 2J4CA 1NX9A 1ZIXA 1BRTA 1O6GA 4B0PA 1HKHA 4RNCA 5A62A 3A6ZA 5AKLA 1UKBA 4HXGA 2ES4A 3G0DA 3DEAA 1CRLA 4PV7A 4KE7A 1CUSA 1GKKA 1UK8A 4UHHA 5LLSA 1LPSA 3E4DA 3WK8A 1XLWA 3FVRA 1MN6A 3QPDA 2XMSA 3A70A 2XMZA 5DWDA 3HJUA 4FBMA 5DNUA 5EHZA 4UFNA 3G8YA 2WHPB 2PUHA 2G5PA 4KAJA 2PSHA 5JAUA 1CFJA 3AIOA 2H7XA 2QOEA 4LXHA 2AJBA 4NVRA 1FFDA 4X85A 2WIKA 1ZI8A 5ALIA 3UUEA 1K6EA 2H9YA 1AKNA 1BU8A 2XQGA 3CN9A 4ROTA 5E4JA 4Y2TA 3WA7A 1K4YA 2HIHA 1XQWA 2GYUA 2WLSA 4G4IA 5LP1A 5CT9A 1FFBA 5LZ8A 2QR5A 1ZI9A 3WKCA 5C8XA 4AO8A 1JI3A 5CW2A 5ALWA 4QA9A 2BFNA 4BYMA 5AI8A 1WHTA 1MNAA 1VE6A 1E3QA 4KJXA 4HRYA 3HI4A 5KWIA 2XUFA 3I2HA 4PF1A 3U1TA 3K2IA 4P08A 3X3HA 2WIDA 4B80A 1R4ZA 3F96A 5I9IA 1WB4A 4WDQA 1TIBA 1LPNA 1LPPA 3QH4A 1X2EA 2G5TA 1OILA 2HFKA 2OCIA 1W6RA 3FLEA 4A16A 1QO7A 1TCBA 3R0VA 3O0DA 5SYMA 4K6KA 3W9UA 2BAGA 4E14A 3HXKA 3WL5A 3W9BA 1YSCA 1DX4A 5E4YA 5KBYA 3JWEA 2QJRA 4RGYA 4FMPA 3DCNA 1QIHA 2IIVA 3C5VA 3FWHA 1QOZA 4Y2VA 2WFMA 3ICWA 1JKMA 4DYHA 4EY7A 2HFJA 1DT3A 5ALYA 3R3ZA 3STTA 4N8DA 1ZGBA 4NS4A 3WA6A 1WPRA 2VJCA 2YYSA 1LPAB 3C8HA 4B83A 4OUKX 4QDZA 1Q0RA 2PUJA 4A23A 2B20A 1A7UA 1E8MA 4CIAA 3G9XA 4C6HA 2J4FA 1N8SA 3QPAA 5E4TA 5K3BA 1UK6A 3ZV7A 3VDXA 5ALRA 1THGA 1ZD4A 2JBWA 5JZBA 2JGJA 2XUJA 1USWA 3ESCA 3LIPA 2PSDA 1K63A 4FKBA 3HSSA 5HQ3A 4DSAA 3H2IA 2XB6A 3E1GA 1HBJA 1XQXA 3MGAA 4MYDA 4UBOA 1CVLA 2W22A 5AK3A 3EQ7A 5JAOA 2C0PA 4ZV7A 3T52A 4BP9A 5EHQA 4DGQA 1CUYA 3K6KA 5EIEA 1THTA 2GYWA 4N5IX 2JGMA 3F9CA 2O7RA 4A5SA 3H19A 2O2GA 1SCIA 1NU8A 4PSCA 2B4KA 1M33A 1P0IA 2BUBA 3OTQA 3PICA 4HXFB 1O6FA 1FFEA 2OAEA 3ICVA 1Y7HA 2JF0A 3C6XA 3BIXA 1QTRA 4JEIA 4X95A 1ZD5A 1ODTC 4ETWA 1L7QA 5FKJA 4YK7A 4RE6A 4XWGA 2C0QA 3ZLTA 4BRZA 2Y2UA 1YB7A 3AINA 5I8PA 2YASA 5A2GA 2HA0A 4GECA 5IKXA 1Z68A 2CBGA 2H7YA 4WCVA 2G63A 2O2HA 3CN7A 3R3UA 1H2WA 3IUQA 4C4ZA 4FWBA 3BXPA 4AZ3A 5JYCA 1F0PA 1HPLA 1ACJA 3HZOA 2GZSA 5LZ2A 4C89A 2HU8A 1K5PA 3ESAA 5CT4A 3K9BA 5JANA 4AXBA 4B9AA 3KXPA 4DNFA 3I2GA 3I2KA 3OM8A 4DMFA 4GBGA 2XT0A 4J0GA 5HFNA 2XMGA 4FLMA 5T4HA 3ED1A 5AI0A 1MTZA 4NZZA 3ANTA 3W05A 3V1NA 4FLFA 1YB6A 4G9EA 1W1IA 4L3WA 4DNQA 3ZPXA 4KE6A 5AKKA 5A7HA 5KREA 4ZWNA 2RONA 4LHEA 1P0QA 4BTVA 3HABA 1UOPA 1DT5A 3VKFA 3PF8A 1YAHA 1A8QA 1VJ5A 4BDSA 2OGSA 1A88A 4AB1A 1UFOA 4QDTA 4GI1A 2PSJA 3Q0TA 4U2GA 4ZV9A 3TRDA 3CCCA 4TGLA 4GXNA 5ALZA 3AUKA 4QDUA 5FUMA 3PUHA 4PNZA 3LCRA 4K6GA 1BCRA 3H2GA 2XQJA 3DYIA 4W1SA 4KRYA 4DLNA 4Q3KA 5HQ3B 5ALSA 3O4JA 4X6XA 3ZLUA 4KEAA 4D9JA 4KRXA 5AM1A 5CXXA 2WUEA 1AQLA 2VQ6A 1XRNA 5ALUA 4Y7DA 3RKSA 3I6MA 2OQVA 2ONCA 2B9VA 2WSLA 3KD2A 3C6BA 5JARA 2D5LA 4J0JA 4WY8A 5DTIA 3WK4A 5JZ9A 3CXUA 2WFZA 1X2BA 3FOBA 4OB6A 4YX9A 2PKYX 3BDIA 5CXUA 3DQZA 4G5XA 1QLWA 3BF7A 1XZCA 1RP1A 3GA7A 4H18A 3H2JA 2WU4A 1Y7IA 3V48A 5AKXA 2QM0A 1UZAA 3VISA 1VXOA 5D7BA 1VKHA 3WK7A 3PFBA 5LZ5A 2D0DA 4XVCA 1TCAA 1CUZA 2HA7A 1NU6A 5AH0A 1CUIA 4ZREA 3WI7A 5AKEA 4Y2PA 1ISPA 2HM7A 3SK0A 4OB7A 3I6ZA 3C6YA 2VF2A 1RWQA 2PU7A 1MX9A 1QTIA 4KE8A 1MO2A 4U2EA 2WTMA 4I3FA 5FRDA 3U0VA 2Y6VA 3I2FA 1ODCA 1XZLA 2DHDA 3BDVA 1QE3A 4LXGA 2BUAA 3WIOA 1E5TA 5C8VA 4UPDA 5ALJA 4H7HA 3MVEA 1XZEA 3H2KA 2BGRA 5EIAA 4P93A 2VA9A 4H7IA 3NUZA 2QXTA 4J0IA 4BC0A 5AIBA 1LNSA 5JATA 4BC1A 3WK9A 1MX1A 1MAAA 2HA3A 3H1BA 1X70A 5ALXA 3A2NA 3IA2A 4Y2QA 4U2BA 3IULA 1EK1A 4LKOA 5DNWA 5HKAA 1E8DA 2XI4A 3ANSA 4OYLA 5AOAA 4Y2JA 4EY8A 2CJPA 3PF9A 1SCQA 2JEYA 4G8BA 3E0XA 1G66A 4KACA 3RLIA 2DQZA 3I2JA 4J0CA 2HDWA 4GW3A 1JU4A 3I2IA 3HRHA 4BAUA 4UHCA 3QMWA 4UUQA 3I28A 5CH8A 2WKWA 4PSDA 4F0JA 4DNOA 5AKYA 2I3DA 2C5GA 3D2BA 3STVA 4H7EA 4EA6A 5AKZA 2WFLB 2XUGA 4QDXA 1XZHA 3M83A 2ZJFA 3GUUA 2QTBA 2CZQA 3A2MA 1CUUA 3Q8WA 1N1MA 5CURA 2VAVA 3WWPA 1YCDA 2PL5A 1J1IA 4EY5A 1ZIYA 4JH0A 2JGLA 5C7YA 3S2ZA 1LGYA 2V97A 1G42A 3I1IA 4E11A 1H2XA 1KU6A 4DTCA 5HK9A 1XZGA 2VT7A 5AM2A 1DU4A 5AI5A 3V1MA 5ALVA 1DQZA 5K3EA 5HCUA 4QWWA 4CCYA 3TEJA 4F60A 1CUJA 3DJYA 4WY5A 4B84A 1F6WA 3AZOA 4X71A 4MQLA 3WIBA 1UOQA 2GZRA 4UBKA 4BAGA 5EGNA 1H22A 2V98A 4Z49A 3B3QA 3HYSA 4AX4A 4X7BA 3PUIA 1QIEA 1ZI6A 4UBNA 4HVTA 3ZWQA 1XZBA 2ZSHA 4HTAA 5H3HA 5HFAA 3V9AA 4I4CA 6YASA 2H7CA 1ZD3A 3N2ZB 4J3JA 5DLPA 3KSRA 4X92A 4LYDA 2WM2A 1IZ7A 5BWBA 2PM8A 4FOLA 5LYYA 4BCCA 3M81A 4C87A 2G4LA 4PO3X 5AO9A 4GHWA 4CG2A 1AURA 1W75A 1C7JA 1GPKA 1W52X 3PFCA 2PVSA 2ZJ6A 4INZA 2WILA 4XIIA 1QIGA 2WG1A 3ESBA 4MWTA 4EY4A 1A8SA 1LZLA 3WZMA 3FBWA 5A7FA 1LZKA 2PBLA 1ORWA 4BB0A 3HLKA 2P8SA 2HADA 4X94A 2RAUA 4ITVA 4PSUA 2ZJ7A 2IITA 3VXKA 2HU7A 5ISMA 3G0GA 1BROA 4ZGBA 1FFCA 4C4YA 1R1DA 1UXOA 3WL7A 3O9MA 3BF8A 1L7AA 3WK6A 3C87A 3IBTA 4N8SA 3QZUA 3O4GA 2XUHA 5LZ9A 3DDUA 3D59A 5AI9A 3WK5A 1TQHA 4KE9A 1JMKC 3I1YA 4DSZA 4CI9A 1ODSA 3EIOA 4MYSA 3KOOA 1UOOA 2ZYIA 2HA6A 1EB8A 3FNBA 3QVMA 1CEXA 3AILA 3STXA 3G7NA 1JU3A 2JGKA 2WJ3A 4M0FA 2Z3ZA 5CH5A 5AM0A 3BJMA 2EDCA 2EEPA 5AI6A 3BWXA 4EHBA 3A2LA 1CUDA 3R3VA 1C4XA 2VSQA 2RIPA 4F21A 4W63A 4X93A 5K3AA 3D4LA 3MUOA 1UKCA 1XZAA 3JYHA 4G4JA 4BVJA 4JYPA 1AC5A 4MWSA 4WFKA 4CCYB 2CB9A 5HF6A 4UBMA 4WFJA 2WJ6A 4QEKA 3WKAA 3GELA 1CLEA 3IIIA 3C8DA 3WL8A 1XFDA 2XMCA 1HDEA 5LZ7A 1BEZA 4OCZA 4Y2YA 4DMKA 2C5FA 4DMHA 4O08A 5FLKA 3B5EA 4GLBA 4AO6A 1QFSA 3WQHA 3STWA 3VJMA 2W6CX 2HA4A 1XZIA 1XRQA 1EDBA 4W1QA 4FHZA 4B85A 5ALOA 2ZVDA 3UUFA 3DLTA 1J06A 3JW8A 5FXMA 1EHYA 1YASA 2JGEA 3SWWA 2RHWA 5HZGA 2WG0A 3HC7A 2XUDA 1LPMA 1ETHA 3G9ZA 2ORYA 2V9ZA 4Q1VA 5EFZA 5C8ZA 5ALMA 1IVYA 1DWOA 4Q34A 4U2CA 4N8EA 1XRMA 1YR2A 3EBLA 3C6ZA 2GBFA 5DTJA 1VLQA 2ECFA 2WIJA 3IUMA 4E15A 5AM5A 1T4MA 2JIDA 3IB3A 1CR6A 4K5QA 5JAPA 4ARBA 2BJHA 3AZPA 2DHCA 4X90A 3GFFA 2BGNA 4DMCA 1XROA 5HKBA 3WL6A 5CTAA 4H35A 4GDMA 4C01A 1U65A 4FBLA 1ZOIA 1AMNA 5DNVA 2XUOA 4UHBA 3O4IA 1SC9A 5IH7A 1CUVA 4DM7A 4IH9A 3OOSA 2WQZA 3IUJA 1LBTA 1ACLA 1XLVA 1R3DA 4J0DA 1TCCA 1MT3A 4UHFA 2C58A 4H7KA 4B7ZA 1XZKA 2Z5GA 3WYDA 1U8EA 4W1RA 1E89A 3IDAA 1P0MA 4X6UA 5AK5A 1AUOA 4BE4A 4IQ4A 1XRLA 1QJ4A 2QT9A 3ILSA 2HRQA 4L9AA 4QNNA 1R9MA 4QZVA 3OURA 1JFRA 4AN0A 3STUA 5AKGA 4OB8A 4MJ3A 1H2ZA 5ALPA 4G9GA 1QGED 3PI6A 2AXEA 2WFLA 5DYWA 3R41A 1VE7A 4UHEA 1YS2X 5JZSA 4B81A 5K3FA 1FSSA 1EH5A 4LYEA 4AMZA 3AIKA 2WG2A 5CBKA 2Y2VA 2IX9A 2PPLA 1G4HA 1MPXA 1EDDA 1WCYA 4HS9A 2QUAA 2ZYRA 4CG1A 5ALGA 2VJDA 1B41A 3WWEA 2HA2A 4ZXFA 4P9NA 4C88A 1TKRA 1XRRA 5ALQA 1BE0A 1J2EA 1N5MA 1AX9A 2HL6A 1F0NA 3VJKA 1QIMA 5AK6A 1Y37A 3BIWA 4X00A 3L1HA 4HXEB 1UK9A 5JD6A 2OPHA 3WYNA 1EK2A 2X5XA 3DOIA 1G5FA 1B6GA 4B9EA 4Y2UA 1JMYA 1XRPA 4G8DA 2ZYHA 3LP5A 2DSNA 2AJCA 4OPMA 4MQMA 3AIMA 2WU3A 1LPBB 2UZ0A 7YASA 5ALTA 5AOBA 2XE4A 4IH1A 4DNPA 3FYUA 3QITA 2QKYA 5T4BA 1HL7A 4ZRDA 4V2IA 2AJDA 4BVLA 3HEAA 4OU4A 5CT6A 1EA5A 2WJ4A 3H04A 3DKRA 4F5ZA 4FFWA 5FOQA 4HAIA 1U2EA 4EY6A 1WHSA 2WUGA 1DQYA 1PFQA 1QIIA 3EQ8A 2WHQA 4X3CA 3FLAA 3QYJA 5DYYA 5FPPA 4BCBA 1BCSA 1IUNA 3WWOA 4FLEA 2QJWA 1YS1X 3WLAA 1KEZA 4MXDA 3WMRA 1XKTA 5A71A 1XQVA 2OQIA 4C4XA 1TRHA 1I6WA 3RM3A 2YXPX 4CG3A 1MNQA 4HRXA 4U2DA 1P0PA 2CEKA 1TK3A 1W76A 2C7BA 4UFPA 2CMFA 2R11A 3F98A 5I7UA 2RHTA 5ALEA 3B12A 4AMYA 5IVHA 4J0KA 4BBZA 2QRUA 3H0CA 5AM3A 4U2FA 3S8YA 5K3FB 1CV2A 3GZJA 2PSEA 3YASA 2OGZA 1WB6A 2J3QA 2AJ8A 3WKDA 3D5EA 1MAHA 5CT8A 4RE5A 5JALA 2QVBA 2JGIA 1BEEA 2DR0A 3STYA 2R8BA 3O9VA
chains in the Genus database with same CATH superfamily
3Q0IA 4LIPD 1QV6A 1RJGA 3DD1A 3TDNA 4CU2A 1Y4ZA 2FPMA 2ZYAA 3TLZA 2OLKA 1SJ9A 3CF2A 1JG2A 1G291 2AX3A 2QW1A 3IUNA 3NHWA 1J0XO 4CKYA 2ZS8A 2MR6A 1NN0A 2V03A 4OQQA 5ESRA 1E66A 2WWIA 3KVVA 4M3NA 5DP2A 5EHNA 2IEBA 4RVUA 3AX6A 1UMDB 3SX4A 2P5TB 1NI3A 5HMLA 2BT4A 4RD0A 3KHTA 3L77A 4JYMA 4BATA 2I03A 1PJBA 1HFWA 1N4DA 3PWKA 5JSFA 1SURA 5IZCC 1E9AA 4DIDA 1ULUA 4FCVA 3UWPA 5KYWB 2W00A 2KI5A 2Z8ZA 2A9FA 4HDRB 3ONNA 2CLIB 4RZ3A 3K6JA 1J07A 1XDDA 2PU5A 4XVRA 1DWUA 2HJGA 4E13A 3X1JA 4E2ZA 2QDXA 2YQZA 3BILA 4IDEA 4OFBA 8ATCA 1IVSA 2W6ID 3SPXA 3W2TA 5JS6A 4POOA 2FPOA 4MX8A 1FB5A 3BXGA 3D7LA 4MEBA 1F8YA 3GBVA 3NAMA 4AECA 1EVZA 1MOPA 1WP9A 2KBFA 2MINA 3FUXA 3GLTA 1JVBA 1QAOA 2Q3CA 3P2IA 4K9NA 4MUFA 3R0ZA 1OOEA 3URMA 5BWNA 5HTOA 2BUCA 4TV9A 4DSNA 3V3TA 5TC4A 2ZSAA 3TRJA 5A2QA 2VXCA 4INPA 2FSFA 1JIXA 1NURA 2O7VA 1YVUA 3IDOA 2HA5A 4PRYA 2UKDA 5BQ3A 1UJMA 1RRKA 4W9NC 5CDUA 5DSXA 5JIBA 1MC8A 3PU6A 3G9UA 5SZHB 1UP7A 2XMRA 4N3CA 3FIUA 2JBHA 4B33A 2QP4A 4RFSA 3K2BA 4FM9A 4WK4B 2HO5A 3G49A 1O95A 4AN1A 1SCUA 1BGWA 1D8AA 4J1TA 3NOXA 4MV3A 2C4MA 2QYTA 2X2OA 4L6IA 4NZPA 5DCYA 5LVAA 3SZ3A 4NOJA 1G8GA 1U6KA 1X7GA 2FPGB 2VAMA 4K46A 4Y6LA 3T12A 1KQOA 5KC8A 2ZI7A 2PHZA 2Z95A 2GZAA 3DL4A 4OQMA 2HSWA 2GOYA 1MP0A 3IOBA 3DDCA 4JB8A 2KB0A 1HLGA 2WSYB 3AB7A 4M6WA 1TUBA 1FTGA 5ALNA 3C39A 2WW8A 2UZ4A 4IJKA 3DLIA 3QPBA 5WRFA 4IQ0A 1ZP6A 6REQA 3AUTA 2WYIA 4MRSA 3UT6A 4AQ7A 1W48A 1G4AE 1T5HX 2PXXA 4BZWA 1R5JA 1WEKA 4UBLA 5K0TA 1YC2A 5MN6A 4FGKA 1L8AA 4AROA 2PKQP 1G6OA 2C04A 3JPWA 1DWQA 2DQYA 2FUG6 3AEKA 4LMBA 1S9DA 1QRTA 4P58A 4E5YA 5CDFE 1BDMA 4RKRA 1ISJA 5A5VA 3OX4A 1Y8RB 2WF9A 2FPPB 3D0KA 2PV0A 4CODB 1NXWA 4C2TA 1Y1KE 3DAPA 2OXTA 2V3VA 3D8UA 2H1SA 5KYUA 4YC7A 4JCOA 1F8XA 2DCUA 2UVDA 5I5GA 3EXHB 1SHKA 3O4HA 1T9GS 2HT6A 1VIVA 1YA4A 2L0XA 2Z9CA 3NDJA 1X3SA 4I99A 5AICA 3USCS 3WGZA 3DOOA 5JLAA 3AH8A 3LHDA 5ABPA 1HT0A 1YAJA 2FQQA 3B2QA 4G65A 1BU5A 5BVGB 1YOVA 3ZNOA 1T34A 4LMRA 1ISHA 1R50A 2BOVA 3A37A 3L93A 1UT6A 4W6ZA 3RVDA 3L5KA 1GZ7A 4JP5A 4L08A 4DA4A 4MLPA 3ZS9A 1I7PA 5DYNA 2X7HA 3W6UA 1G38A 5C81A 4QNMA 4HAUA 4D46A 2FX5A 2OZEA 4MUNA 2VSOA 2VRBA 2REOA 4UASA 1CEQA 4Y1GA 4Q3CA 5IKEA 2PWZA 5IEBA 1P1IA 1U4NA 3RROA 5IXJA 1H4SA 1XTIA 2PO7A 3LDAA 1I33A 4MV6A 1JDVA 2MYPA 3A1EA 3ZW9A 4BFCA 4JHLA 3V2GA 3VU0A 1PFWA 1CUHA 2X76A 1AE1A 4BWGA 3ICOA 3LUCA 3QGMA 4TXMA 2C1XA 4A8JC 2QTAA 3I5MA 4J90A 3UMMA 2RHOA 3OJWA 3DT9A 1ISIA 2C0CA 2J5QA 1GITA 1NLZA 1XQ1A 1M9NA 2CC2A 4PGGA 1PJ3A 2GEDA 5FV4A 2PMWB 2JGFA 2YTZA 4XH9B 2VN8A 3ZHZA 3MT9A 1JB9A 3OMLA 3GLFE 3L4BA 3SMQA 3QLEA 4RW0A 4F4JA 2QN2A 4DV7B 3AVTA 3WGTA 4RV4A 4IJQA 2YZGA 1X9IA 2FGKA 1P2FA 3R1IA 1N5LA 4RACA 3DYBA 2IPMA 3L4EA 4N5MA 3RK4A 4E51A 2K7ZA 1CUGA 3IAS1 4H17A 1D2HA 1V8PA 2FZVA 3DEYX 2QZPA 3LX6A 4M99A 3ZK8A 4EOGA 4PO8A 1S02A 1EFKA 1ZUNB 2VZEA 3EZ6A 3OQHA 2FJPA 3VNQA 4KVAA 4WA7A 2B4TO 4NECA 3PC8C 4EARA 2WWTA 3GEEA 1LXCA 1R10A 1YI0A 4BVHA 2OGTA 3DOJA 4QE3A 1FP7A 4B82A 2GTPA 2FMXA 3MJRA 1L7RA 2D7JA 4BLTA 2HREA 2QY9A 4CT0A 4CCWA 1O0SA 2WM8A 4BUJA 2VJBA 2A6PA 4G0MA 5AK4A 2JGNA 5AKHA 2ZKLA 1ORVA 5FTJA 5JO9A 2FN9A 4ZO7A 5KNBA 1L7XA 1I7LA 2Z9DA 2Q4BA 4BPBA 2J3HA 3VH4A 4NZNA 4MB2A 1T0JB 3HWX1 1Z7EA 1XJ5A 1DHRA 4JMPA 2PX4A 2EGUA 3PGKA 5EUQB 3ROMA 1I9GA 2R44A 2XKJE 2CKMA 1AZLA 3MD9A 4HR7A 2YH2A 2KYRA 2M6LA 3V5NA 5FDFA 4JR0A 2P4HX 1B43A 3A1DA 4GGPA 1AY0A 3D4IA 3ZY2A 1HMPA 1BHQ1 1U0TA 1Z22A 2DT8A 4NBRA 1GQYA 2BRUA 4L6CA 3UG7A 2MINB 2QUZA 2E55A 1NT4A 1OZAA 1BG6A 4IVRA 2YIJA 4TV9B 1FSZA 4BNDA 2XTZA 1PZEA 1OKKA 5FP0A 3TSYA 2R8RA 2O0HA 3TL6A 2R25B 4ESEA 4Z7QB 3L4JA 2F9LA 1YFZA 2YRWA 1KJ8A 4ZU1X 1NC3A 1BWPA 3VZQA 5ELMA 4MGYR 4HWTA 5KYTA 4NFHA 3HJFA 4XUDA 1TTPB 1Z5GA 5TT0A 3T3OA 4M9ZA 2A5GA 3EA5A 3F73A 4C2BA 4MEAA 1SBYA 1DAEA 2NSLA 3WIVA 3KWMA 2VYQA 3B1WA 5LA6A 1UEIA 5T3YA 5HEKA 3OQPA 4YALA 3E81A 4QQ8A 4RIHA 3L6CA 3W5VA 1SQSA 1BGXT 1KVUA 3QHPA 4AYXA 4B45A 4JX8A 4MR7A 3LK6A 2P91A 1T8WA 4JODA 4E09A 3G2KA 3HTXA 3N2IA 2P3OA 2HRDA 2ID8A 4C78A 2V7PA 2Q3MA 3EA4A 2P41A 5KYYA 5D51S 3WWCA 3M1YA 4M6WB 1JJAA 1TUBB 1RXWA 1SCDA 4YECA 1Q74A 1ZLXA 3FETA 5JROA 4MUBA 1XKLA 4N6GA 1E1CA 3SP1A 3ADBA 1CBUA 2XGOA 1O08A 4AWAA 1QG2A 4MVCA 2CE2X 2B83A 3FWZA 4HH1A 1R6VA 1QG0A 1UOEA 4UUNA 2NV0A 6REQB 3EFEA 2VF4X 4FYPA 3T9BA 2B61A 1QV9A 4BMZA 3PE3A 3EVFA 1U2ZA 4UE3S 1G19A 4JI4B 5BW6B 2RJOA 4BRWA 4YRPA 4FDMA 3AEKB 3EF3A 4KTTE 4E12A 4MMZB 1X8KA 4MQ6A 4F4HA 5LXTF 4ZOLF 1N6NA 3NBFA 4B4OA 4CTKA 4ZAWA 1KP2A 2EFCB 3IS3A 2OO7A 2GRUA 1ZJ5A 3GDFA 4QTUB 3UKDA 1RE0A 1Q0ZA 1Z0DA 2O1EA 2A5DA 1P31A 3LYUA 3NBQA 3QF7A 4YASA 3W5CA 3AKEA 1IBRA 1GY8A 3QYFA 1W46A 1RLTA 4NC9A 1O54A 2EIHA 1ZX1A 1CDDA 5LQDA 2R2AA 2VJPA 1SXJE 1TYDE 1IY9A 4R9UC 4B0OA 2Y05A 3ETLA 2I2DA 1QO9A 1YOVB 2G9QA 2IE0A 2ZYDA 3IC5A 3LPAA 2AR0A 2H2GA 4HLUA 2ZTHA 4QYSA 1CP3A 5F33A 5CA1A 3RTDA 1CNEA 2PZMA 4NPAA 4P4TA 3VO2A 2NYRA 2IU6A 3NHUA 1JAIA 1QYVA 5KSWB 2ZW9A 2VJKA 1A9QA 1KH3A 4XTCS 3LF2A 5EL0A 3C5WP 2E3JA 4JR1A 1CRZA 1KIAA 4RK1A 4DA8A 1QPGA 1Z0ZA 1IBLB 2HHCA 5CVDA 2Q3EA 3CX4A 5AOVA 1Y4UA 1NMSA 1XEXA 3I4LA 5KKAA 1NDQA 1Q3KA 5IK2A 3BXOA 3U2QA 4C0XA 5I4CA 1LDEA 4PNEA 2C3UA 1H65A 3QPUA 2K2QB 5E7MA 1JW9B 4QTXA 4ENTA 5LKRA 4Z4QA 3UGTA 3O8OA 3Q7SA 5BQXA 2DETA 2QMQA 3F90A 5D3ZA 1AXGA 2I2WA 5HPYB 1PJ8A 1QYXA 1U80A 3MFQA 4R68A 4JB2A 1QVZA 4AXXA 4II2A 1R9GA 1S5PA 1XCBA 1IHUA 1MO5A 2PAFA 4HDCA 4WTOA 4AJ9A 3HUFA 3ASYA 3S2YA 2EKBA 5L3QA 1ZONA 3H2BA 1R8JA 2NUAA 2O5RA 5IYZF 1M2FA 3MHTA 2OCLA 1SVMA 3F67A 4N47A 1JEEA 1H6DA 4RF2A 1M73E 4KAAA 4XOIA 8GPBA 4OX9B 4ZI5A 3OPXA 5GGYA 5CITA 2AL7A 2R751 2XKBA 2M1ZA 5KTMA 5LQJA 5JS8A 1G64A 2OUIA 4DXDA 1GCUA 4DYVA 3CZQA 4PWZA 3M82A 4D25A 2E2WA 3Q6NA 5LQCA 5THXA 4MR9A 1O03A 2C9ZA 4Q4CA 1M10A 3IT1A 4BQPA 4CM8A 1UZNA 1R6AA 2IYSA 3PFKA 1N75A 4EBFA 2O8EA 2AIRA 3K4HA 3DD5A 3PVSA 3QELB 4IXMA 5FOTA 4F2PA 5ERYA 3VX4A 3GYBA 4PVDA 2AMYA 5J5VA 5KDOA 2WTNA 1V7ZA 3LQFA 1XZJA 3OLZA 3VJLA 2ASVA 4UPEA 3IVMA 4LPSA 5CM9C 3VZRA 4U7TB 2WA1A 2G71A 3HGMA 4MYCA 1YIAA 1SWWA 3D7RA 4CYMA 3HA3A 4JI6B 4BLSA 4QPPA 2RARA 3N2YA 2JK1A 5KOIA 2FRVA 2XOXA 2D62A 5EXSA 2AC7A 4S3MA 1QO0D 5HF9A 1ZG3A 4TRNA 3TGLA 1UJ5A 3HY6A 4KQ2A 4EO4A 1XVIA 2R62A 5B4UA 5AKJA 5K8LA 1F4VA 3F8SA 4MYUA 1SY7A 1MAUA 2Q3DA 1E2LA 2BI7A 2GPSA 2XYGA 2JJ1D 2W2PA 2GPNA 1E5XA 1VOTA 2EC5A 2XUKA 3HA7A 5DGHA 5HE9A 4BNDB 1DAHA 1KYXA 2PA3A 4OD0A 2VEOA 2CLFB 1YS7A 2FP4B 1I01A 3L8EA 4M83A 1YQQA 3DE1X 4PAOA 2GPJA 3KLNA 1SH7A 3BMNA 4DMGA 3E5RA 1OXSC 4MW6A 2QD4A 4X84A 4BV2A 2R6CA 5EZ6B 4CMGA 1GXSA 1U9ZA 4C1NA 3N0TA 1FX0A 1EXDA 1CUEA 2AR9A 3DKKA 5FOXA 3GJ6A 3R0QA 1EZZA 4PFQA 4PYKA 5JT1A 2QXYA 4MV0A 5REQA 3V6MA 5LA6B 2O19A 1TIPA 2BKLA 2PD3A 4HGRA 1NBOA 5FEMA 4HDKB 4BVGA 1BE1A 1JFLA 4PLFA 4CJXA 3AVWA 2HF2A 2HJHA 1XPOA 2G4CA 2E49A 4C07A 4L4XA 1MMFB 3TOXA 2Z4RA 3ESDA 2X0NA 3QFHA 4G0NA 4Q19A 4Q1AA 5DULA 1L5HA 1XWFA 2Z8XA 3RC7A 5IT4A 4EJMA 3TINA 1QCCA 4DTIA 4XQEA 1E1CB 1B73A 2FW7A 2P4QA 3K0EA 4HBGA 2XTNA 3C70A 1QIFA 5C9ZA 2UUBB 4GYWA 3OA0A 4BJ1A 5GIOE 3OCXA 3GPBA 2HGSA 1RBZA 1UKVY 5FHQA 3ZXUB 4DWWA 3PHGA 1FYEA 2NYAA 1KAEA 2RSLA 3Q85A 4ANFA 1VA4A 2QD1A 3WLHA 4BVFA 1T1RA 2A1UA 1SQFA 3BICA 3DHVA 1RDFA 3JVIA 4JC0A 1OBFO 2J3EA 2VXBA 4RA6A 4JC8A 2A9VA 3RU9A 3ETNA 4J7UA 1YQGA 4JA0A 1MGOA 2K87A 1IZ8A 1U8CB 1N5OX 4KB5A 3NHBA 4MAAA 1DWPA 4JUBA 3GGDA 4O5AA 4BIIA 2HHJA 4KDEA 1DV2A 1QQ7A 1RKQA 2IELA 2BEWA 2XMQA 4RK6A 4FW8A 5I48A 5AVUA 5BRNA 4OSEA 3FTPA 4WXMA 4FNOA 4EGCB 1RI5A 1RRFA 2XTAA 3QXJA 2RE8A 1PQ4A 4K2AA 4C2AA 1RM5A 4FTWA 3PX3A 2C4HA 1KORA 3D64A 3DOHA 3GK3A 4M9SA 5EUCA 4F8JA 1DJMA 4ND7A 1E3WA 3MWYW 2FLKA 3M4JA 3NNSA 2NTYC 4B3RB 4KODA 3QBDA 4ESOA 4N7JA 4MCAA 5CA1B 13PKA 1EK6A 3OM0A 5CH3A 3ZHUA 3PX2A 4O1MA 1FFAA 2ZI6A 1NUTA 3EMBA 2VPWA 3C43A 5IVIA 3HCPA 2XZPA 2I4LA 3V7FA 2XNKA 5AW7A 1VJTA 2AB0A 5E4FA 1Z06A 1K5HA 1XQ6A 3MT8A 2DECA 2QRJA 1M1YB 2C9OA 2ZSKA 2INGX 3ZDBA 4EK9A 1TRKA 2EHJA 2Q5LA 2HDHA 3ZZTA 2ORVA 2D4HA 4KG7A 1XEXB 3NHSA 1PX0A 2RJ3A 3PGLA 1I3OA 5F4ZA 1VG9B 1T3LA 3T3NA 2W98A 3OLYA 4Z5XA 5LQRA 2RHHA 3GLIB 1Y5RA 1QK3A 4OHXA 2YV5A 3LWNA 3ZDDA 2HWWA 1M2NA 3O8OB 3A11A 4PZEA 3VOBA 3VSBA 3DDWA 1Z6XA 4LYHA 1VDMA 1PTKA 4PG6A 3N07A 1PR4A 5HA5A 2NUTA 4C4YA 4DILA 4BGDA 4BE9A 1H2EA 3U5ZB 4FQ8A 3GVCA 4MIKA 4MWEA 2BTQA 3BSYA 1RYNA 3OZIA 1OXMA 5KDLA 3P19A 2IC5A 1X80B 2NXWA 4R71A 1T8UA 2HMAA 4F3CA 1US8A 4GWKA 1NMEA 2G72A 1U0HC 1XQYA 4WKCA 4CMJA 5L3QB 1PJSA 3U49A 1S3FA 4UHJA 4RHEA 3P9YA 1VJRA 1BJTA 3CSSA 3E70C 2NUAB 4ARIA 1TM1E 3B53X 2A94A 4ZZ0A 5IABA 2GA8A 2VEDA 1HYQA 4MVYA 5AQEA 1NF3A 3L8FA 4ILEA 4V0LA 3PDCA 4I8XA 4BZQA 2ZJAA 3OKFA 1R6DA 2VTBA 5DGTA 1OXTA 1NVBA 2IZ0A 4D9MA 2ZWMA 5E38A 4G4GA 3H65A 2QDKA 3A6LA 2GCIA 1MB0A 4BN0A 1U1CA 4GBED 2BFDA 3I52A 4LDAA 5SY4A 3IMEA 2Q0HA 5FJIA 4MR9B 3TAXA 1NI4B 1KI1A 5JBQA 1TFRA 3K96A 1GQFA 2OV4A 1ZICA 5BQOA 4CM8B 3W7VA 4OATA 5T67A 1SXJD 1ZM7A 5K6TA 5DN9A 2YW2A 3RUDA 2O8EB 3U1BA 2WHRA 1WDMA 2B1RA 2VP9A 4HXYA 4US1R 4IO0A 5TMDA 1TMKA 4K1XA 2HCRA 4PBSA 3N3AC 3UWMA 3QEAZ 3L49A 4Y9UA 2RBGA 5JD4A 2RCYA 4L9SA 5C1PA 5TPZA 3U44A 1S2MA 3DE5X 3IP8A 1KDZA 2CZCA 3E9YA 1BX3A 2WIFA 3RIHA 4CIWA 5J1SB 1U9IA 2RJNA 5DN6A 1QNFA 1V26A 1ZJWA 3AJAA 1VHJA 2H4WA 3PJRA 2C20A 1TADA 4GAEA 1BGVA 2QAGC 1JG7A 3GJ8A 2OCYC 3I6YA 1VLMA 3KWJA 4R2JA 4Q3DA 5HTKA 3U4QA 1KC1A 5KNCH 1DKRA 3DDNA 2AOTA 1MUUA 4BO6A 3IOMA 5EEHA 4B35A 1EVEA 2D2VA 1YL5A 4HH4A 5LMUB 5CLJA 3H7IA 1A9TA 1AQJA 4X1IA 5JISA 1DINA 4XI9A 1P4JA 3TIVA 2IS1A 1N5RA 1MABB 2F6RA 3DYVA 4DR2B 3TUZC 5BT9A 2PUBA 4J16A 4HNRA 4PHTA 3BMNB 4BO0A 2B69A 1R4MA 2XVMA 3W3AA 1J8FA 3LAWA 2OO3A 3KK0A 1GXSB 1L7NA 1FX0B 4EB8A 3C24A 2P4UA 2GILA 4MVJG 1G7SA 4WJZA 2BLLA 2EYQA 2QU8A 3N1UA 3PXCX 5REQB 1R18A 1V47A 3RE1A 1ABBA 521PA 1HKHA 4N76A 5AKLA 1UKBA 1AGRA 3ZKAA 4ERXA 4J4HA 3DEAA 2OFWA 4N3BA 5HILA 4KE7A 3BWCA 5DBEX 1GKKA 2C7VA 1IHXA 1Y48E 4BNZA 4M46A 3I0NA 1D4AA 4B8YA 4DIEA 1Q1QA 3IKVA 4UHHA 2N1BA 1VP9A 2AR7A 2CHGA 2V4MA 3CIOA 1POXA 1XLWA 2XDAA 2DM6A 2QNIA 3QSGA 3KRTA 3L8YA 1MN6A 2Z8YM 1PEKE 4XSVA 5L8VA 3L40A 4FFDA 1NULA 3A70A 4BNYA 1L8LA 1D6JA 3EULA 4CBVA 1V16A 1T9AA 4RTSA 2VKQA 1G3QA 1TA4A 2ZSDA 3EY9A 3PJGA 4FYHA 1R8YA 2A1UB 4LVUA 3KVRA 5EHZA 1G5PA 2BONA 1OFVA 2J08A 3AEYA 3BAZA 3P1JA 3KQQA 5DHRA 3I9LA 3QFRA 3S5JA 4YT8A 2DJ5A 2YS7A 3VDQA 2Y68A 3IQZA 1KK0A 5KQPA 1FUIA 1XVUA 2VPZA 2G5PA 3HGTA 4KAJA 4PXAA 4J3FA 1QTNA 2BFMA 1SUCA 3GLGE 2BHSA 3M70A 4IBOA 4G5OA 4JLDA 4NYMQ 4QUJA 4WZ6A 1LRJA 2DUJA 4FGSA 4Q9DA 4MMXB 3TZKA 2AJBA 4PX9A 3AJRA 2IEGA 4YP7A 5ES4B 1KYTA 2G7ZA 2P7IA 2JIZA 2BEWB 4NVRA 5I7FA 1T1EA 4Q1CA 1ZMOA 4ZU6X 5I7WA 1LK0A 5G2OA 5BT8A 4R41A 2NZ2A 2YCLA 3MMZA 2O06A 4LJRA 1QQAA 2P2DA 2RGAA 3IMCA 5AW4A 4KO8A 2ECPA 4DY6A 2OK8A 1E3WB 3ENZA 2PRIA 1HDOA 2CKDA 5CGQB 5DVZA 1HORA 1WE2A 4ROTA 4DIBA 2YC2C 2IW1A 4EWLA 1PJ4A 5D5QA 1XQWA 3LC2O 5KZMB 4DJDC 2H31A 2PRJA 4JB3A 1CF9A 2P30A 2B6HA 1XNQB 1T0HB 1GZDA 3Q8XB 4TX1A 4WKNA 5CT9A 1K88A 3VO9A 4DVGA 2O8FA 1GL9B 3BL5A 3JYQA 2QEQA 5FL7D 7REQA 4ZEOA 4Q39A 1W87A 2OBFA 1J5XA 5T5QA 5LJLA 2FWJA 3VR5H 2QR5A 1U2GC 1ZN9A 4YFVA 4E6PA 3RHFA 4F12A 5C8XA 4AO8A 1WSDA 1O4VA 2R47A 1PEYA 1JUDA 3ND6A 4B40A 1U31A 4CMAA 3FSEA 3RHZA 5ALWA 1KGSA 3ROFA 4DEVA 2NTVA 3O8CA 1EFRA 4YLGA 3K0CC 1WHTA 2VDUE 5AI8A 5LC1A 2NUTB 3TXXA 4HF7A 1O6CA 4RWZA 3QI7A 4IZHA 4RPHA 5IX8A 1ENOA 3CUSA 2BTQB 1MFZA 3EIUA 3LF1A 3HI4A 3OIYA 5KWIA 3NT4A 4JY7A 5M29A 3DF7A 3U1TA 2JAUA 4NCBA 3B6JA 3Q3GE 1AHPA 5AW5A 3K2IA 4RH0A 2YNMA 3WP1B 1BMQA 4O3MA 4MW4A 4R5HA 4NEGA 4RKQA 4CQMA 1KRXA 1DJPA 1AHNA 1NW4A 1S0UA 5KTNA 4XM2A 5I9IA 2PGIA 3SZLA 5KNCD 1W34A 4LJ4A 1TU3A 4WDQA 4ZPXA 5TQ2B 2ACWA 2HW8A 3GRPA 4XDYA 5EIBC 4U3JA 4WAUA 3VAZA 2P9FA 1ESEA 3QH4A 3QTLA 5DTRA 2VTBB 4WCDA 3CGWA 4B71A 2RAPA 2ZAGA 4G09A 2HFKA 4K03A 2ISCA 4L0QA 4F97A 4RCYA 1G98A 2GF0A 4U9UA 1OFIA 1KFJB 1WW2A 4M7RA 4O4JA 1BS2A 1Q7CA 2F48A 2XHEA 3TMYA 3IKLA 3W9UA 3NRJA 4DA6A 2YN2A 4EFMA 1GRVA 1WQ3A 4MVJE 3HXKA 3KKPA 4CM9D 2D1YA 4TMWA 1K0FA 5KCZA 5TIIA 4QAQA 1YSCA 3WLRA 4X1OA 2YV4A 1Q15A 2M2IA 2Q1WA 3WDSA 3LW8A 4WBNF 4FUTA 1YQWA 1UBHS 5E4YA 4BNJA 3PNMA 4Q93A 4C0QC 5KBYA 1BH2A 4FMPA 1JQJC 4BNFA 2GUGA 2B98A 1K8YB 3LBAA 2IIVA 3U44B 2W6OA 1ZHFA 1ZKDA 2AC2A 3C5VA 1C9DB 1M34E 3FWHA 4EYSA 4H16A 3TXAA 1ZK2A 3QKTA 4HX2A 4OEHA 3FUWA 2I8CA 4QRHA 4RMHA 4MROA 5EEGA 3UQZA 3ICWA 3MPOA 1JKMA 3DQQA 2HFJA 1VP3A 1U8FO 3IP9A 1IC6A 3R6WA 4G07A 1TJ4A 1HY3A 4G25A 2AOTB 1KP3A 1P1JA 4HTFA 5DBGA 1WUJS 1D7AA 2VO1A 3V00A 4WMLA 4YH1A 4G86A 1E2MA 4QGSA 3PFNA 3RYCA 4X1IB 2Q5JA 3NT2A 3QVWA 4P22A 1ZGBA 5F76A 5AVJA 4F92B 2IOQA 3BB4A 4IJMA 5AUPB 1YE5A 4XB6B 3GX1A 1R4MB 3SEZA 5DLEA 3WYEA 1YZGA 3CKKA 2WVGA 3T1QA 3HJTA 3IIEA 4TKMA 4OUKX 1E9DA 4ZTBA 1TZMA 3P32A 2G0TA 1Q0RA 1WF6A 4A23A 2B20A 2Z5VA 4HNAA 1E0KA 2OZLA 3KSUA 3PRJA 1E8MA 2B4AA 2XNCA 2ZG6A 3HJRA 1KY3A 3NQ41 4F6LA 3G9XA 2IEYA 2E1PA 4YXWA 5AWFC 4WV3A 1DUVG 5BUZA 1N8SA 5FBLB 3Q6MA 4TN1A 1VSBA 3K70B 1IDN1 3QPAA 2VHVA 4FGLA 3ITKA 4U39A 4IGIA 2E37A 5CPFA 4Z99A 5BYJA 3ZV7A 4JHXA 4OHWA 3VDXA 5GVRA 3OMWA 1Z47A 2QZZA 5K0GA 1G3RA 4R7TA 2WWFA 4P31A 4PAWA 3FOAA 4LC9A 3GVIA 4UZFA 4AMBA 4FKBA 2C4KA 4TQAA 3ENVA 4QPDA 5LL6P 1TI7A 2XAUA 3V33A 3ROPA 3E1GA 4KYTA 1CP2A 4A8TA 2AFIE 1YRYE 4BO7A 1XQXA 2J6BA 3A4VA 2PLRA 3FKQA 3MGAA 4LHSA 1PJLA 5DX8A 2GK7A 3N8HA 4PHGA 3UENA 4D9EA 1GV1A 1G5IA 4LWPA 4E94A 1VKNA 3ZHQA 5AK3A 1TK9A 3EQ7A 3BK7A 3N39C 1L5RA 2J9GA 2ZRCA 4ND2A 1L8QA 1SU7A 3CFYA 4X3PA 5C7IO 4YMLA 1QK5A 3T52A 2OBYA 4BP9A 1S2DA 3AM3A 4DGQA 1RKBA 4WUTA 1CUYA 4DR6B 2RK3A 2HQBA 3G2LA 3PV0A 1CJUC 3QVXA 3RBAA 3X2EA 4PHHA 2PT6A 3LSTA 3M4NA 4JOQA 4NNOA 2EJUA 3VYVA 3E18A 4Q47A 2FSPA 1AKYA 1DC4A 1J9EA 1TIKA 1ZWKA 1RPZA 1PWYE 2ZU6A 3MLBA 2QRZA 4E7PA 2YXLA 5BPFA 1SCIA 5CVCA 3DZJA 3OJLA 5JS7A 3L4KA 2OP1A 4J1QA 2WAMA 3EVCA 1H05A 3N2EA 4GOKA 3NWPA 1ESCA 2VBFA 4D9GA 4Z9BA 5I4KA 1EWRA 1H8HA 2HIAA 1P0IA 2BUBA 3IVGA 1MW8X 2R6GA 1HYEA 4RHTA 4ZTUB 2YMLA 1E5VA 1JA9A 2O8NA 2R5FA 5I9NA 3BZUA 1UXJA 4WOBA 1NP3A 2HPZA 4Q7LA 1GSHA 1A76A 1ZVQA 5EXEA 2B25A 4BLOA 2DB3A 3KQVA 1BQ4A 5D3MB 1WKVA 4NPHA 5TV2A 2JF0A 1SXGA 3GPIA 3MJDA 1PDOA 2Z6UA 4KWIA 4RU1A 2GERA 4Z0TA 3C6XA 1YI8A 2B5OA 3KHSA 2IA5A 1U0OC 3TNLA 3LGXA 3QNWA 3U7JA 5LYJF 3C48A 2O8FB 5ECDA 3FWNA 1TVEA 1F2UA 3UHFA 4ETWA 3DM9B 1L7QA 2NSDA 2GNPA 3GLVA 4GMDA 1OAKA 4RE6A 1QYIA 1ZLYA 2IODA 2NQTA 3VOTA 4BEVA 1N0WA 2JG3A 3OE4A 3PHBE 4M36A 5B1HA 3ZLTA 1F12A 2F43A 2G9VA 2Y2UA 4O6VA 5FI5A 1QE5A 1ISRA 3LA6A 3N87A 1QB7A 1KJIA 5A2GA 1WHTB 2HA0A 2TYSB 4JEUA 5EZQA 2FVYA 5IKXA 3TIXB 3R5KA 2HAEA 3H7AA 3GJ3A 3AHGA 3NBUA 4KN5A 4LSMA 4RQTA 1G21A 2O2HA 3CN7A 4EY3A 5C1IA 4XIGS 1Z4PX 3R3UA 4ML3A 1WD7A 3NAQA 2XNSA 4CIDA 4ZYWA 4F7DA 3PQ3A 3RS3A 4B4WA 4C7OA 4A3SA 1QWSA 5F2OA 4E08A 2DLNA 2ZI5A 4AZ3A 4CQMB 1D2EA 3LJKA 3DQPA 1HPLA 4B74A 1DELA 1M1NA 2EJTA 3ABIA 2QWXA 3D6AA 4N40A 5KS2A 1GJRA 1Q2UA 5LZ2A 5KAPA 2C42A 4I5IA 3T6KA 3CX8A 3QUTA 4ZZ1A 4U3JB 1AZTA 2QLTA 5GZ3A 2A0UA 2PLNA 1E2NA 4MP8A 3TZLA 1XJ0A 4AP5A 4UM9B 2H1FA 2I7VA 1T3SA 4RDIA 3MBIA 5INTA 3UTCA 1OH5A 1TZJA 4O63O 4QXPA 1FMTA 2GJ9A 3BFXA 4K9DA 5JANA 4O4JB 2FXVA 5F1OA 3VUFA 1GLNA 4NICA 2VUUA 3HFSA 1L8XA 4I5DA 3L01A 4GF5A 3DOCA 3QRWA 3O8RA 2AFRA 1Y63A 2CK3A 1KZ7B 1Q22A 1JEDA 4N3NA 3NHFA 1U3VA 1E7SA 4WINA 1KR2A 1RWVA 3QFTA 2VYVD 3EOZA 4DMFA 1ULZA 1YE3A 1G20B 3Q2KA 3O75A 4Y1FA 4FONA 4J0GA 5HBRA 3A1TA 3LECA 1QX4A 1GHTA 5CX4A 2XMGA 2A3NA 5JDCA 2OZKA 5T4HA 2AW5A 1JEYA 4PSAA 4MYHA 5CBPA 1UXKA 1J97A 3ZWWA 4GSKA 4MI6A 1D09A 3GIWA 2OWDA 3BG5A 4BNWA 3L9XA 1Q6YA 2XCIA 3C5HA 2E4ZA 3U3OA 1LW6E 4HVLA 2FV8A 1XPRA 2HDNB 4ZN6A 4JBYA 1IG3A 4FLFA 5CA0F 4G9EA 4Q1EA 2ZFUA 4ZC1A 1RJ9B 3V1UA 5ED0A 1IOZA 4L3WA 2IS4A 4DNQA 1L7BA 3W6ZA 1WIWA 2X6TA 2GF2A 1DHTA 3AEUA 4L07A 4LFCB 3ZPXA 3RYCB 1I7SB 4JJGA 1PNRA 5A7HA 1R0YA 4AMVA 4NFYA 2H6EA 2X8JA 4IOLA 2RONA 1DE0A 1DB3A 1R5OA 1P0QA 3ROTA 2R6AA 3HABA 1Z3IX 3VR1A 3KOMA 3PF8A 2ZB4A 2FSVC 2PGOA 4X54A 1Y6QA 4LMPA 1UFVA 1ZBQA 1GL6A 2VTDA 1Z5UA 2V55B 3ANYB 3D1VA 1DMSA 1P5JA 1SMKA 3NM5A 4HNAB 2OZLB 2IZ5A 3Q0TA 1LH0A 2J1LA 5IYZB 3DBIA 4Y0AA 1EFTA 3K5PA 4GRIA 4YV1A 2R4UA 3BFKA 3QMPA 4BEBA 1S4QA 2QN7A 1IRIA 5IM4F 4M21A 1IPFA 5TARA 1C0IA 1LLCA 3G3EA 1H3NA 3RI3A 2R8YA 3WGHA 3S2IA 4HGOA 3VGJA 2PGXA 1H6BA 1KVSA 2VUIB 2XDQA 3LCRA 2R4TA 2J0VA 3LC7O 4K6GA 4DRYA 2AN4A 1K6JA 3VAYA 3HDHA 1V95A 3DYIA 3LOPA 2WB4A 3OT1A 3W5HA 1WQ1R 5DEIA 4KRYA 5DT2A 2HLNA 3D8HA 3JQPA 4NG4A 4Z8XA 1DVRA 4F04A 1P1CA 2Q6OA 2ZB3A 4QXQA 3U7EB 3VPDA 2B2NA 4R9SA 1Z6GA 2XB9A 121PA 1Z4JA 5F5XA 1VGVA 3X1XA 2CXUA 4X7RA 1ADJA 4I1VA 4ZCMA 3GLHE 5CXXA 2C8JA 3L06A 1DJOA 1YRLA 8LDHA 2VQ6A 3IP1A 3CX3A 3OSUA 3OE7D 4YMIA 3KZMA 4XVHA 3LKDA 1JL3A 1Z2AA 4KPGA 3WGQA 4CWAA 2FN4A 3LVRE 1NBMA 1CWUA 1KVRA 1JWAB 2JGDA 3FFXA 2WSLA 3KEQA 1P1BA 2Z04A 1KKUA 3GFGA 1CK4A 1QRSA 1FTWA 2D5LA 3FMIA 3AFNA 4H7PA 3PQDA 4WY8A 2NXNA 3ED5A 3JQ7A 1XTJA 2C2GA 3V4VB 3PJEA 4CL2A 4DZZA 1TD9A 4J8PA 4V24A 3V2HA 4AZSA 3CHYA 2WFZA 1KZ4A 4POAA 4OMDA 1G17A 3CUTA 1N92A 3FOBA 3IR5A 4OB6A 1F8GA 1Q7EA 4M1YA 2NTNA 2NX2A 1K7SN 1RWBA 1Y7PA 3FI9A 3M5CA 1ZD8A 3QQ5A 3RVLA 5JQWA 3DNFA 4HD8A 1PLLA 3GAMA 1X1CA 4IFEA 4UXHA 2SKCA 1P39A 2AVDA 2QRVA 2PGDA 2QN9A 1FQWA 2P1RA 1QLWA 3KZNA 3LO8A 4P1ZA 5B6IA 2BI8A 1RQ2A 2F3PA 3WDMA 2DHQA 3HKEA 1YIOA 1XZCA 3QUQA 1C14A 5TQVA 1T5IA 4NFLA 4C6TB 1PZHA 2J46A 2J9RA 3LX4A 4MV8A 3AP2A 2UXDB 1NLMA 3W5DA 1ADFA 2G77B 1XYVA 1ZVJA 4M2LA 2QM0A 3TTTA 4D9KA 3SS8A 1UZAA 4GD3Q 3ZE7A 5FUVA 4AZVA 3E58A 4YMUA 2F43B 5LOVA 5LBTA 4US2R 3VDMA 3KQSA 3T9FA 1GDTA 3FKSA 2DT5A 3GVPA 2NZXA 1NVTA 1O77A 2PGNA 3KZVA 4G1BA 1U81A 2B92A 3BE4A 3C6MA 4KSCA 5LM3A 1UKEA 4BU0A 4QT4A 1T0IA 1G21B 1DBIA 3A6FA 1CUZA 5JJBA 1B0PA 3HHEA 4I36A 3IUSA 5B7QA 3AF1A 2FP3A 3AVVA 2Q1TA 5LP6C 3ZX4A 3HL4A 3DPIA 2WMDA 5AVTA 1KARA 1QCYA 4NCIA 4AZ3B 1NWCA 4GRDA 4L7VA 1M1NB 2HM7A 3QLUC 4RS3A 2A5LA 4P34A 2IYQA 1S8FA 1YCGA 2PUVA 4G5YA 2QTRA 1ZIPA 2VF2A 3SCZA 4EW3A 1R6TA 1MX9A 1IQPA 3DH0A 1RPJA 4IL5A 4OHZA 3TR0A 2YVLA 4KE8A 4Z2YA 1XD8A 2FWIA 1U2DC 1QGUA 3GEBA 3UBMA 4EGJA 1KWGA 3FE2A 1E2UA 3PEEA 4G24A 3UJCA 2F62A 3OBBA 3WLFA 4UNRA 2EJBA 3E4CA 1RHRA 2Y6VA 1YE8A 2NZJA 3I2FA 2V1XA 4IHJA 1XZLA 4NDNE 5ALYA 1SM4A 1Y9EA 1A4XA 3BDVA 1LI4A 3TZEA 4KNYA 1QE3A 1N9KA 1E2QA 1NVGA 4JBHA 2YMPA 4CQLA 1NV8A 4FMDF 3GG9A 4M87A 5LBUA 2WDPA 3N2GA 3P9ZA 4ERNA 4HN9A 3WLSA 4C21A 1NL3A 2D8MA 3OUTA 4MJXA 3OZFA 1J90A 1SD1A 4XDZA 2OCBA 4YQZA 3HV2A 1II0A 4DBLE 2HT1A 1F3OA 4H7IA 1GPH1 1MOZA 1O94C 1TKAA 2LKCA 2IT1A 2Q29A 5CBPB 5AW9A 3V6LA 1KZ1A 5AHRA 2E6KA 1FSPA 1PD0A 1RVV1 3AJ9A 4KPYA 5F5NA 5JATA 1FC0A 1U6JA 4MQFB 4YCNA 3DHEA 1FNNA 4Q24A 3R7SA 4BC1A 3AUFA 3LPDA 3TS1A 3WK9A 3NS7A 3EDOA 4ZOBA 3RC1A 1CULC 2D4AA 1FFWA 4TV8A 2GBPA 1E6LA 2PH3A 2QU7A 3LC1O 1M8PA 1U1EA 3MWGA 3OKCA 5L6LB 4LF9B 3PLAE 2OFFA 4U0KA 2YZKA 3AEUB 4QT0A 4UVGA 4DCSA 5DCLA 4KUEA 2RI0A 2H2HA 4FZ5A 1NX6A 1E8DA 2X8JB 4BBJA 2HRCA 1PTJA 3ANSA 3GY0A 4F96A 4XRGA 2XPCA 1VCIA 2WMYA 3OESA 1GKIA 5TMPA 1KAHA 4C43A 1GSOA 2VP0A 1J0AA 1U02A 1YB5A 3L82B 4GKJB 3BB1A 5AOAA 3WAJA 2AXPA 1QS0A 3K9LA 3N8NA 1GNTA 3A4LA 3BJZA 2PKRA 5JRDS 5LUAA 1NQTA 1Z6ZA 2CL7X 2PUWA 3R9KA 1ZC4A 1Q0HA 2BM0A 2JJ2A 2WMNB 2X0RA 3FWPA 3INGA 3VTFA 5AVSA 3W9YA 3VU9A 1F9EA 3K0FA 1SXHA 3SC4A 5CIWA 1TEXA 3M2TA 1ZINA 3SFVA 2FSUA 1Z88A 3UK7A 2PH7A 1E69A 4J0FA 5JWHA 1XXLA 2M32A 3REFA 4LWQA 2P3LA 3SLRA 2DPXA 5HKOA 1FEZA 2HDWA 2VAWA 3HKDA 5TS3A 1UBSB 3UGKA 4DXAA 3K8YA 5CDSA 3ZDFA 3H16A 6AT1A 2W43A 3KJHA 5HKLA 5FUQA 2WSSA 2XDQB 2AFHA 3BD8A 3CPSA 1UIMA 1G6HA 3B20A 1JTVA 5K09A 2P5UA 4F1JA 1L3CA 3OT1B 4CM5A 3FGNA 3I28A 5EA2A 5ICMA 2VUHB 1XCJA 2WKWA 3ZD8A 4PSDA 2FWNA 2AXNA 3H6KA 4RKYA 2W70A 3LX5A 3OUZA 3NCTA 2JGAA 3E2PA 2EATA 4F0JA 3PI7A 4FOTA 2FFAA 5IJAA 2VPXA 2PGAA 4ND8B 5AKYA 2WF7A 2GFQA 3FFTA 4ZTZB 4CIVA 1WDKA 3VFDA 3CUEF 2NADA 2ZJOA 3SHWA 2FR8C 3G5UA 2X19A 3CRW1 5AKZA 1O9HA 3GN2A 2J9ZB 3CY6A 5FH9A 1BQEA 4ZVVA 1Y1PA 3ANLA 2GASA 2IV3A 2CHVA 3M83A 5D00A 3G2MA 5ILOA 3Q8MA 4LQ4A 1XDZA 3BFJA 3GUUA 3OBIA 1OA0A 3VR0A 4OHOA 3F4KA 5JEEA 1CUUA 2AFVA 4YRFA 3VR2D 3I8XA 4KHZA 2AMFA 2UUPA 3Q8WA 4DLAA 1N1MA 4WCFC 5AFSA 2VAVA 2W58A 1W5EA 2ZRFA 3EZLA 4Q7MB 3VM6A 3TYXA 3WWPA 3DZFA 4HZIA 4F4IA 3WOHA 2QQ0A 5KSOA 1I2DA 4WL0A 4DV4B 2PWAA 2II6A 2ZPTX 4DNXA 2BHLA 3HJHA 4ZVRA 3NTXA 5T3UA 1P6XA 2QUKA 4A36A 1QHNA 4PYOA 1CFZA 4NU0A 4EABA 4LOHA 3OA2A 3F71A 2XT9A 2IYAA 2X3FA 3DMRA 1YO6A 1SAYA 1JJ7A 3D6JA 5EMLA 4WIAA 4CCAA 2NM0A 4TZTA 4CDNA 4DZTA 5IS2A 4EIWA 1RADA 3ROKA 2NLOA 4DDHA 4G5GA 1OE0A 1B15A 5F64A 5HOEA 4CF4A 4OMUA 1ESDA 1HTTA 1OF1A 1XZGA 1T2EA 2VT7A 4FXOA 1YMVA 4HVAA 4MV4A 5BMOA 5GV7A 3V1MA 1OT5A 1OYYA 4Q9KA 3WNDA 4ASUA 1H9AA 2GB4A 1KKLA 2L19A 3RUHA 3DLBA 4F60A 4CCYA 4M8IA 1CUJA 3IEXA 1JH8A 4OKSA 3DJYA 2CXRA 5H4GA 3HB1A 1DC6A 1ZK1A 3OU6A 5B58T 4E33A 4MIYA 2ADFA 4LRTB 2JCVA 2XF8A 2ZIWB 5C51B 1DFIA 1M2HA 2GO1A 3CUWA 1HLPA 1XC7A 2G8LA 3CT4A 4B84A 1F6WA 3AZOA 3RC9A 2WDZA 3OQNA 1XTPA 1C7QA 4TTPA 2IZZA 4FFRA 1UOQA 3O83A 2GZRA 4KXWA 2EZUA 4BAGA 2MSWA 5BV0A 1YUBA 4JJZA 5C52B 4A15A 3PNSA 3HYSA 3UFXB 2ZWAA 3PKIA 5CCXA 5I5EA 5LJIA 3RAJA 4AX4A 2CUNA 3PUIA 1Z2DA 4ILKA 1X39A 4YA6A 1QRAA 1NSFA 4RKWA 2NNWB 4ZQCB 5BOSA 3N8IA 1ZI6A 1CJBA 4X64B 1F0YA 1QGUB 1XZBA 3A1WA 4KVFA 3ZWQA 1X9HA 1MQ9A 2DE0X 2ZSHA 3RC2A 1JAXA 4IOMA 3V9AA 2XOKA 4PG8A 2BR5A 5BWMA 4LYFA 2PL3A 5F9HA 3CVOA 4IHJB 3BPSA 4Q4AA 5H0IA 3I9FA 1PO7A 1YHYA 5DLPA 2Q07A 1T9HA 4QVKA 2BM9A 1FJXA 1K7CA 1CJKC 4AJHA 1HDZA 2VK2A 1JR4A 3KL4A 2WM2A 1IZ7A 1KIMA 2XWJI 4N5NA 1IMOA 4YP1A 3UAOA 4B6OA 2VUTA 3L1KA 2D74A 3N2GB 1DGQA 5KTPA 1P61B 2VDKB 2ODAA 2XCLA 2J8ZA 3M81A 2G4LA 2IOFA 3Q5GA 4PO3X 4IDNA 4GHWA 5AO9A 3A4NA 5B1EA 3DFMA 4LJ7A 4PX5A 4WEQA 4B31A 5EJMA 4EG3A 1ZEMA 4D9HA 3VVCA 3HHPA 3OD5A 2BZ1A 4HX9A 1NXQA 3SS7X 4ZU3A 1V3UA 4XWWA 5ERGB 3LGAA 4FFPA 5TF4A 4CI0B 2BM1A 1ZQ9A 3MTEA 4TSFA 1YR9A 1I80A 3HUDA 5TGTA 4AJIA 1L5QA 2C9DA 4MWTA 3KB6A 1H3FA 2GN0A 2H29A 2YN0A 1Y1SA 5EP1A 1KC3A 1HZZA 1A8SA 2W6JA 2Y1EA 2QQEA 2WICA 3M7IA 4GG1A 3F74A 5FAXA 3WZMA 2DERA 1QUEA 2QX8A 3DTVD 1UPUA 3FN4A 3SVTA 4UM8B 1EGHA 2IQ5A 2BHNA 5C37A 4URZR 2PIAA 2NV2B 1G8AA 3EVEA 3PXDA 5KSZA 3GUCA 1XMVA 4M9CA 2HADA 3GGOA 4HQFA 3QY9A 4X41A 1Z4OA 1GDDA 3OEWA 1Z8DA 4X94A 4WUVA 5CLGA 4C0AC 4CM1A 2BGUA 1QS0B 4LNHA 5I3ZA 1YVRA 2ETVA 1NAIA 5A4AA 4JKOA 1QHFA 4WD3A 9LDTA 3VXKA 5IULC 3DUFA 1J20A 3VR4A 2B21A 3LFUA 5F7JA 3G0GA 3VU9B 4KC0A 3K0FB 4ZGGA 4NV0A 1XGKA 2D7DA 1KJWA 3U9TA 3SZRA 2XCRB 3D4BA 4CPDA 2R66A 4E22A 1GPJA 1GZ6A 1KYQA 2QSJA 4GUAA 1GYPA 4FN4A 4YRDA 3DF9A 5MGNA 1XAJA 2XXAB 3HKDB 4KNVA 4WX2B 5FBRB 1G0OA 2OOSA 2ZRDA 3LY5A 2YXNA 2AFHB 1BJKA 2C2WA 4PONA 5BN3A 3DBHA 4IDAA 2BY4A 4QJBA 3UGQA 4EX7A 5IAOA 2GKOA 4N8SA 1NKSA 4EJ0A 5HWSA 1L8OA 5LZ9A 4IIYA 2J3LA 4GC9A 2P40A 5ANRB 4CL8A 1BKSB 1FXSA 4TYPA 5AI9A 5C8YF 2J3KA 3LC0A 1NWHA 3WK5A 421PA 1S8AA 3IUPA 3SQWA 4WBNB 1VHDA 1C50A 3EPRA 3QPVA 2DTEA 4CE6A 1IZ9A 1JMKC 5G40A 2H1OA 3ZGYA 2CFTA 1VFPA 1IQUA 3QXCA 4AWXA 4CEHB 1ODSA 4ENRA 2C7QA 1FLNA 2P2ZA 4XJXA 3RVBA 3QKSA 4MYSA 4EA8A 2I6FA 1KEKA 4HL6A 1SHLA 4A27A 4RJ2A 3IO3A 4ZCTA 3KOOA 4FZ3A 5E6RA 3SYMA 2HA6A 1TAUA 5FT9A 3WLKX 4EKEA 3FNBA 1ZSNA 4B5LA 3QVMA 1KRHA 2C2OA 2PRKA 3RJ9A 3ZV6A 5CLFA 3QPWA 3IXLA 4NV3A 1WXWA 1HLFA 2MSDB 3FB4A 5TSDA 3RIXA 2F67A 1YDMA 1ZGJA 2WJZB 2WJ3A 3ZS8A 2M9MA 2IGBA 3FTCA 4J43A 2KM1A 4BV9A 2JW5A 5CH5A 4CUJA 1JPJA 2EP5A 2VVTA 1A95A 5AI6A 1XI2A 3FF4A 3BWXA 2VF5X 3II6X 1BHSA 1FLVA 1LI7A 1M66A 3IVCA 3LVQE 1Y4SA 2VSXA 1L7VC 4KQGA 3R3VA 1OD6A 2C84A 4OM8A 3T5AA 1P1RA 3M1AA 3OD1A 3NALA 4ZO6A 2H1RA 3E61A 3U7QA 2BEKA 3A1VA 5K3AA 4TYQA 4CF7A 2GM4A 2ISQA 3EIEA 3MUOA 3ZU3A 1PBTA 2P8JA 2W2VA 3N0XA 3ZZ0A 4DVJA 1SVSA 5BSFA 2CXQA 4JYPA 3RWMB 3D6HA 4MWSA 2WEKA 4WFKA 1XMIA 2CVPA 2CB9A 1DV1A 4K26A 3R77A 3RASA 4CCYB 3T94A 1T8RA 3ZGOA 4MDFA 4QUBA 5KHLB 1DQNA 3GELA 4D8YA 1SWVA 2W6NA 2DUNA 1CLEA 2FWBA 4IO1A 2MOKA 4QG3A 4E21A 4MUYA 3IH5A 3TQIA 4XQGA 1HDEA 2R6FA 4N0DA 4EZBA 1GGNA 1VMIA 1Z5PA 4QSHA 2VNIA 4ZT7A 3E7DA 3QW4B 3MTQA 4PZ0A 1N5DA 2E4UA 4BFSA 4WN3A 1E2KA 3TOZA 4M55A 4TVSA 3DFZA 1AKEA 1C1HA 2VZ0A 4LXXA 1Z38A 3U80A 2IUTA 1K86A 1CY0A 1THZA 2BKUA 2CJXA 3INYA 1B26A 4O08A 4U6NA 5GADl 1H6CA 4I0WB 3JVUA 2Z1MA 1NDUA 4MLZA 3MWJA 4W5WA 2JJQA 2BDEA 3P4YA 1DC3A 4XUEA 4AICA 4AUKA 2D1FA 4V3CA 3TLEA 3EGVA 4AO6A 1DC5A 3TI7A 3OEHA 3FPAA 4K81B 3FUVA 5KO2A 3VJMA 1XZ8A 2HA4A 4GUDA 1CR1A 2FW8A 4FHZA 1YQ9A 1SUEA 1UBLS 4LE1A 4TS3A 1GWNA 1I0LA 4GX2A 4DQVA 4DUGD 2Z83A 3QVKA 4KYIB 1NMYA 2G5GX 3OJXA 4G4SO 4XB1A 3B3FA 3QVOA 1GNRA 2Q2OA 3CRZA 1N2CA 3UMBA 1VRWA 2EP8A 2HBQA 3OSZA 1NKTA 3KQMA 1ZA2A 3OFNA 4V0ME 5FXMA 3V8VA 4R98A 2WAOA 3DWFA 4DLTA 3SWWA 3I01M 2A57A 3T7SA 4DR1B 3WOVA 4MW0A 1Q0LA 4U7JA 3CCFA 3NHJA 2FH5B 3R3HA 5ADUS 2PCLA 2X1LA 1Y6JA 2C1EA 2RHWA 3ZU5A 5LYJB 1Q16A 1J4AA 4EITA 4ZHSA 1VE5A 3HC7A 3HVHA 3NFYA 2XUDA 3AJEA 2P0EA 4PTZA 2GA9A 2LDBA 5K0NA 1ETHA 2PGJA 2YIVX 2C7RA 5FBWB 3EEQA 4RSHA 4D3DA 3V1YA 2GF9A 5F1YA 1YA6A 4QU9A 4OP2A 2LNDA 3LXRA 3WB9A 5IANA 1RLJA 2EERA 1VLZA 3K1ZA 4MKRA 1O94D 3PUXA 2A5JA 5AHKA 3PVZA 4GZ6A 4G3XA 1AKQA 5JCOC 4B4KA 4N8EA 1SKYB 4RD3A 2Y8EA 3RRNA 5C4GB 1C3JA 4JN6B 4FYYA 2Q8PA 4N3AA 1EFCA 4CTMA 3EBLA 2VR1A 2GTHA 4ZZIA 3ND8A 4AC9A 3C6ZA 1TA0A 2GBFA 1IU9A 2BFBA 1VLQA 2H4XA 2OO5C 2R7KA 2RHCA 2WIJA 3ANNA 3K9WA 3KB8A 4MJLA 4W9NA 3DUFB 3DXFA 4DOMA 1E9BA 2BBOA 3L6RA 4H6WA 4KL8S 1I6KA 1WF3A 3K9GA 5JXJA 2WJAA 2BKAA 2VJMB 4LJ6A 2XTMA 1E4OA 3G1TA 5E9AA 5JAPA 4R4JA 3AZPA 3HYLA 4DMLA 2XODA 3CBQA 4UZEA 3SZOA 4EJ2A 1WEHA 4G01B 4GPBA 3DBHB 3RH0A 1XROA 2VDJA 4DLWA 2ZDHA 5IC5A 3HXLA 3VNBA 3W5UA 2I4NA 3GNTA 4Q5IA 3T06B 1NN3A 3UNXA 1MH9A 2XF2A 1DCFA 3HYTA 3D6UA 3NEPX 3WL6A 1FXWA 1N6LA 3H42B 2IP1A 2CMKA 3EWSA 3NKVA 4X63A 1JP7A 2XJ9A 1U65A 4FBLA 3I5YA 2SKEA 3SE0A 2CSXA 5G1NA 2FPRA 2JZNA 4BFTA 3KUKA 5T6MA 2C5HA 3RRZA 1IM2A 4ZHQA 2FFQA 3FI0A 3PSAA 3BQNB 3QKSB 4Z1MD 4G6ZA 5IH7A 5M5BA 2IYWA 3B6KA 4NR0A 2YFYA 2BMFA 2JFNA 4ECEA 1J7KA 5E6RB 3TRKA 3PNKA 4I2VA 3THXA 1R64A 2XVAA 4I7EA 3HNRA 3JRXA 2JLRA 1B3BA 5JD3A 2N42A 2A5FA 3AYZB 4J2TA 1KK3A 5CA0B 5D2CA 2J59A 1VIDA 4MO9A 2VDMB 2FETA 4FGWA 1ACLA 3DONA 4PN7A 4KPEC 1C7FA 1JAZA 1H5UA 2IHYA 4TQUS 1R3DA 5KHOC 3FOZA 1MT3A 2C58A 2CJYA 1TMOA 3D6MA 3ZV5A 4B7ZA 3M6MD 3I2YX 1IEVA 3EEBA 2Z5GA 1PR0A 3LWBA 3HFGA 4ZCQA 3W8DA 3AHCA 1Y8QA 4CVNA 4YRZA 3G79A 4ZAZA 4I1RA 1JFSA 2IE8A 2ZYVX 2I9PA 4WZBA 2W2LD 2YWGA 3ABSB 3DZ8A 1GFSA 2CHFA 3OT4A 1JHQA 4GU5A 4D4MA 1GM5A 3FTEA 2ODPA 3WRVA 1XEFA 1YDEA 2CNWD 3HZZA 2WYHA 5AK5A 4ENUA 2WPDD 1S2IA 2UAGA 4KK3A 2ZUDA 4HI0E 4OL0A 4WH0A 3ILVA 2OVBA 3U7QB 1T24A 2YWCA 2Z58A 4IEFB 5DSTA 1EWVA 4D8VA 3Q3IA 3S2SA 1QJ4A 3K8QA 3V8EA 4DDVA 1Y1TA 3EC1A 1R9MA 3A26A 4K9OA 4TKVA 4QZVA 3OURA 1NFFA 2JFQA 5C5EA 3IT2A 2X4DA 1T8SA 3G5AA 2YYZA 2QLFA 1CRWG 1LK5A 4HG2A 4HRAA 3STUA 5AUNB 2DEUA 4Y98A 1WBBA 1KYIA 4KI7A 4CV2A 3SE7A 2OQ2A 5SYAA 4MJ3A 4B5KA 1RP7A 4JI5B 1LS1A 4MDEA 2HK9A 1NJFA 1U5CA 2GR9A 3HN6A 1X0XA 2X5OA 2YN4A 1E5LA 4JU8A 4NYIR 1CIVA 4CR8A 1NPTO 3U3ZA 4AKEA 4YV0A 3O7MA 4RSRA 3D8TA 4JLBA 1C9KA 1I2BA 2WKPA 3OWXA 4RENA 1QZXA 4EI2A 2OXFA 3OF5A 5IEJA 1UBCA 3LQQA 2ZIEA 4O4HA 1B7GO 5GJWC 4NOLA 3TTSA 1NP7A 1FSSA 1U5AA 4GMGA 1C4KA 5I7AA 5ICSA 5BR8B 2H5EA 2WYOA 4IGKA 3B85A 1R5BA 4WHMA 3PQ8A 4OLFA 3ULKA 3P7MA 5COQA 4LYEA 4DDUA 3MYYA 4BX2A 1OWNA 3CYFA 4GIBA 1GA6A 1NXTA 3KQUA 1SHTX 4DQKA 4ZP1A 4NCJA 4PO9A 3MSXA 2Y2VA 2GM5A 3TTWA 3U9LA 4DLLA 2C96A 1XP8A 3U3JA 1NLYA 2QPOA 2W2MA 2PPLA 1RBYA 2XH8A 1G4HA 2ZZNA 3UAVA 3WGUA 1H85A 3F9IA 4KXQA 1UZUA 3C8ZA 3KR2A 3PC8A 1WCYA 2JH9A 4L4YA 3G1WA 5K03A 4O0MA 3SDZA 2Z08A 1H9CA 2QUAA 4DEXA 4EUFA 3HCBA 5GY7A 3NIGB 3GEIA 2O5CA 1JT9A 4JD5A 1GTRA 4I5GA 3AFMA 2IUSA 4EEZA 1JSXA 5B53A 3N8DA 1ZO8A 4I4NA 4UTZA 3ECCA 4JENA 1RHQA 2B5WA 1O95C 1OT3A 1VRCA 5HRUA 4TXHA 2VK1A 4A92A 1YRWA 3N3BC 1LVGA 2AQKA 4WSOA 2WVJA 4CFZA 4I8DA 1J70A 2PANA 3Q12A 3VR6A 3EPJA 1GG5A 2HNAA 1BE0A 1QF7A 4C0BA 4H0NA 4MUGA 3UW3A 3VSAA 2WB2A 3GP3A 1HL3A 4NJMA 3I72A 4EHDA 5B12A 2POQX 5L4SA 2JD2A 1GQOA 3ZYZA 1FA9A 2BF4A 5EP3A 2NO6A 1YR1A 2CHUA 3QVVA 1Z36A 3I0MA 2R1UA 2WZCA 5IG2A 4DXHA 2OPHA 5EE9A 5A9SB 1L7PA 2B8JA 2PJRA 1D2RA 1GFWA 1XL0A 2ZAOA 3LHSA 3NXKA 3PC2A 4I55A 1WXHA 4UTNA 4YJ3A 3OOHA 2HIGA 4DLPA 4F5YA 4IF6A 4KCGA 4DPLA 1SUAA 2R86A 2X15A 1EESA 3I6BA 1G5FA 4L75A 5K8JB 1QE0A 5K51A 4B9EA 4OBBA 4Y2UA 4EG6A 1A5AB 1COWA 1VG8A 2GEFA 2PMBA 3GDGA 3UJHA 5HG0A 1LUAA 1OWOA 5KWVA 1NXXA 4JP1A 3GEGA 3WSWA 5JVDF 4HYYA 3W6PA 4G5QA 3O4VA 1X74A 4P0TA 3AIMA 2WU3A 5JPIA 3CVJA 4GR9A 2QTNA 4K9RA 7YASA 1V7QA 1WY5A 5H02A 4LTMA 2DR3A 4FMBB 3WGGA 1AQ6A 1I51A 3AW8A 1CKEA 3BIJA 3KPJA 3H4TA 1OROA 2QSUA 3TCXB 5B5SA 1FFSA 3FDJA 2VOEA 4R3NA 4RABA 5FLYA 4IJWA 1H93A 1OPRA 2QR3A 3T1NA 2ZBDA 3CG0A 1WB9A 4QJ5A 2ZT6A 2YJ4A 4FMDB 3NATA 2FDCA 4PIMA 2OG2A 4LK2A 4WKPA 1CF4A 3AGPA 4AN4A 4V2IA 1S89A 1KTIA 3H9JA 4G8JA 4BVLA 1QHGA 3KJIA 4AG3A 2GDZA 3H2YA 4U4AA 3RREA 4ZHQB 3M6UA 3ILHA 3UZUA 2D2EA 3LL4A 5C1BA 4AL4A 4Y6OA 1SCAA 2ZUFA 2WJ4A 2VP6A 4IIJF 3VMMA 3A1CA 2H1CA 4QARA 1PWHA 1TC2A 5JHGB 4YGYA 1IB0A 1GYRA 2WD8A 3THXB 2IF0A 1RQPA 1AUQA 1C8BA 3VHLB 1U2EA 4YUXA 2DFTA 3RRJA 1WHSA 5CFRA 4ZQEA 5CCDA 1T0UA 3EFBA 3ZVLA 1OB2A 3CIFA 4PQGA 1F1BA 3SM3A 2B30A 4ZAYA 2QJTA 2YV2A 3I8OA 3KXIA 1OYWA 2JAPA 3DZIA 3PQ5A 3FLAA 1JHRA 2WABA 4EFKA 5DYYA 1GT91 5FPPA 3SKXA 3ZHYA 3KCQA 4BMCA 1P7VA 3H11A 2EFDB 4WZBB 2GXUA 1A9YA 3L4BC 4FLEA 2QJWA 1ZJJA 2IK8A 5KYXA 5LDDC 2O07A 4V0OA 1TO6A 1YR3A 1RRVA 2C5EA 5EJ6A 9ABPA 2WP8J 4L57A 4MXDA 3PL1A 1XKTA 3QYAA 2JGRA 3OX1A 5HQJA 5A71A 2DH6A 4A9AA 4BMVA 3WGOA 3DO5A 4NI5A 4Z9FA 3RM3A 5G53C 3LZDA 2YJZA 2LDXA 3MMSA 4WK0B 4TKVB 1D6SA 2O6LA 2XEXA 3DV9A 4FR5A 1KMQA 4IDPA 3KLPX 4U2DA 4YT5A 3ZWCA 1DIRA 2GKGA 1TK3A 4JC5A 1EGQA 3H5NA 3DOFA 3JALA 2IOYA 2JDIA 4K6MA 3HBFA 2R68A 1QRUA 1D2GA 1EQAA 4PZLA 4QAS