4DLOA

Crystal structure of the gain and hormr domains of brain angiogenesis inhibitor 3 (bai3)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
359
structure length
351
Chain Sequence
PAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLARMLAGDGMSQVTKTLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWARNSEDRVVIPKSIFTPVSSLDESSVFVLGAVLYKNLDLILPTLRNYTVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Brain-specific angiogenesis inhibitor 3
publication title A novel evolutionarily conserved domain of cell-adhesion GPCRs mediates autoproteolysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 106
structure length 351
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01825 GPS GPCR proteolysis site, GPS, motif
A PF02793 HRM Hormone receptor domain
A PF16489 GAIN GPCR-Autoproteolysis INducing (GAIN) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.610 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4dloA02
2.60.220.50 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 4dloA03
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 4dloA01
3N7RA 3EHSA 2XDGA 2JNCA 3EHTA 3H3GA 3L2JA 5II0A 3N7SA 4DLQA 4ZGMA 4HJ0A 3EHUA 4ERSA 3IOLA 2JNDA 4DLOA 3N7PA 2JODA 3C59A 2QKHA 4LF3C 1U34A 2L27A 3AQFB 3C4MA 3C5TA
chains in the Genus database with same CATH superfamily
4MLPA 1TJCA 4GA2A 2IOSA 3CHQA 3N7SA 4HOSA 1N52A 2J09A 2L9BA 3CKCA 3NBNB 1OY3D 4G2VA 1YCSB 4UQZA 1LD7A 3MZLB 4O1OA 3UM0A 5D0OD 1FVFA 2VGXA 4NIKA 5ENNA 3EU9A 1E7VA 3NZUA 4KVMA 3CK7A 3LDZA 2WMIB 4XZ4A 4OVVA 4CDNA 5KCMA 3LPZA 2MRIA 1OT8A 2LSUA 3ZPJA 1VDYA 3FU0A 5H7PA 3LY7A 2V4LA 3D9MA 1NL4A 5ENPD 3BU8A 2WMIA 1OWNA 3F59A 3SFXA 1BI7B 3EU5A 4ZFHA 3SBTB 4J8EA 3UI2A 5CEAA 2AVPA 3EHMA 2R03A 2P9PG 2YNQA 3ASNE 1GW6A 2KBXA 4BSZB 2PNNA 3UIOC 3U66A 4J6IA 3ZKJA 4WNFA 5FQ6A 5A6CA 4GAAA 1EF1C 3CEQA 4V3IA 3I5PA 5T8IA 2EIME 3S7BA 1FVHA 5KBAA 3C72A 3Q7AA 2L6JA 3CKBA 4D6CA 5CCMA 5G04C 4FA6A 1E8YA 2GRNB 4XKBA 1SZ9A 4U07A 2XPIA 3E37A 3Q78A 1IQUA 3U64A 3HXDA 2EIJE 1NZNA 1LF8A 4Z68A 2AW6A 3SY2A 4PUCA 2X03A 5KJNA 4ANXA 3E4BA 1WM5A 4N3BA 2OVBA 2BKKB 3IXEA 4YDWA 2CFUA 3B7BA 4KYOB 5CRVA 2HR2A 1AWCB 4FULA 4UQXA 2Y0BG 3ABLE 3Q79A 3H3GA 5JHBA 4LSZE 3CHPA 2VSYA 3QKYA 2R05A 5CBOA 3MJWA 3AAAC 1UN9A 2JODA 2WCOA 3CVYA 5LCWJ 3TWWA 4LNGA 4H7XA 1E8WA 5EN5D 1N9AA 5ANRA 3C5TA 3Q49B 3N7RA 3D9PA 1U3DA 1IQRA 2MOWA 2CFZA 3E32A 4HOUA 4DI3A 3LVRE 1DNPA 2P58C 3C3QA 3ZHEA 2WQ6A 4G24A 4F7AA 4JPSA 2WXRA 4BEPA 3ZGQA 3MKRA 5KJKA 5D66A 1H6KA 3WG7E 3QNKA 3EUVA 1EPUA 4TXPA 3TG4A 3RO2A 4C0EA 1N4QA 1U3CA 3ZRHA 3V31A 3U7VA 3PZ2A 4OVUA 4JC8A 4BTAA 1U2VG 3FUNA 4IN3B 1W3BA 5JJTA 4K0RA 3UT4A 4B0ZA 1E7UA 3KBUC 3RIBA 3FFLA 4L7TA 5T3RA 1QQEA 4H7YA 2JLBA 4KT6B 2JABA 1MQSA 2YQ8A 4C48B 3JUIA 3SO8A 3AS8A 2XZDG 1LXMA 1JWFA 3FUJA 3ZVVA 5AARA 3MGBA 1L5JA 2WXMA 1N0RA 5BXOA 5FQ4A 3U4TA 5CCLA 2ETBA 4HOQA 2XDGA 2MHKA 3VLDA 4CZ2D 2X6FA 4DX1A 3NQPA 4QQIA 3PEVB 1RW9A 4U96D 3F6QA 4G11A 3FU6A 1KT1A 3OXFA 4F53A 4GPMA 2KCKA 4A63B 4EZKA 3W9FA 3ONLA 2XQ0A 4E6HA 1NA3A 3L13A 2P9SG 4GZ6A 3RRNB 5IY5E 4J8YA 4CT0A 2LXMA 1SVXA 4CCAA 4GZDA 4CGWA 3E33A 2F0YA 2IF4A 3CSFA 4JL0A 4GZ3A 4IULA 3TXNA 1K1BA 3GZ2A 2RKKA 1TNZA 3L08A 3FUHA 3NOCD 4GA1A 2R59A 3ZIMA 3C4MA 4TXRA 4ACLA 1X81A 2XHEA 5J90A 2IONA 1KPSB 3LYAA 1NP7A 2PM6A 1F1SA 1HMUA 1V55E 1BI8B 3ZXPA 4HRNA 4L2LA 3QDNA 4K03A 2X3MA 2IU1A 5BXUA 3R9AB 3QR8A 3HXFA 4EBAA 3CGHA 1WAO1 4GTQA 1OJPA 2YINA 4BFRA 3BG1B 1HS6A 5AENA 1UN8A 1RWAA 1INZA 2FF4A 3FDHA 3NB2A 4ANUA 4LRZA 1OJMA 3N7PA 1HFAA 2DWZA 2J08A 4UQYA 3V2XA 2WXOA 5EDSA 4HOTA 5HI7A 3TL5A 4DRXE 5E75A 4K5AB 3ZYKA 3DSUA 1YYHA 5AYWD 1PAQA 4FJZA 2AWIA 3PZDA 4X8QA 3SZ7A 5T4YA 4JD2G 1TEZA 3FEYA 5D0QD 3KD7A 2GROB 4B93B 1QNFA 5B1AE 3I3NA 4J0UA 4DX7D 3X2QE 1TNUA 1YA0A 2R17C 1N7RA 1FCHA 2QFCA 4HS2A 2LAHA 5JJ7A 2C2LA 5FQ7A 4FADA 1RWCA 2HE0A 4ANVA 4ILHB 1UJJA 4EHMA 3Q75A 3S7DA 3UT7A 4OAUC 2XPZA 2BF0X 2F8XK 2GRPB 1X1HA 3QARA 4AVXA 4HVBA 3OXLA 2WXGA 2RFMA 2QZAA 3D3MA 1OWPA 4PH4B 4WUYA 5HS0A 4DUIA 3PZ3A 2BTDA 4APOA 1RZ4A 3PE3A 4F1SA 4HBDA 4BX9A 1AP7A 1XNFA 3UKRG 3ML8A 2DCPA 2GGFA 3UM1A 2BKGA 3FUIA 5BUZA 4HLEA 4CDRA 3PUJA 4GA0A 4GTPA 3MKQB 4UUCA 2IQCA 5FZQA 2ETCA 1JWGA 3OAWA 3FTZA 5HKPA 4GU5A 4I1OB 4MS6A 4A3VA 2P9NG 3MKQA 4L1BA 3IEGA 1SA5A 1D8EA 1UJKA 4ATGA 3L16A 4AIFA 4B8AA 5AN8A 3B7RL 5J08A 4U04A 5LCWC 4JZYA 4DLQA 2OEWA 4JA9A 3C3RA 2WVIA 2XRYA 3HVEB 3TWUA 1U34A 3EIJA 3IHVA 4PS8A 2WXFA 2LXLA 4I43A 2XCBA 3SHFA 3DPDA 1TYQG 3HVEA 4Q69A 1ZBPA 3LXUX 4EPZA 3SFZA 3DSVA 4ILIA 5JMND 1LXKA 4ZHBA 3EIQC 2IOLA 3BUAA 1MX2A 2DIWA 3RSEG 3MCXA 4HLLA 1SQMA 2FI7A 3AG1E 3CHSA 3FUDA 5DBKA 4CRWA 4LG6A 5E76A 4ACKA 4QFVA 1RWHA 3ABKE 3ZU7B 3I4GA 2C0MA 3OXGA 4GTMA 1N4PA 2DZNA 2B6CA 4YDOA 3S7FA 3UM2A 3CVWA 4KZCA 4HRLA 3CV0A 4IYPA 1O1TA 3PQIA 1KLXA 4GYYA 4OYSA 1S70B 2KATA 2DYRE 3D9IA 5FZSA 4RQIA 3FEXA 2PL2A 1K3ZD 1MYOA 2EINE 3PVLA 4L23A 4N3CA 1TNYA 3LY8A 2DVWA 3D9HA 3D9LA 3R9MA 2A5EA 3L6AA 5AIJA 2J4DA 4ZGMA 4HJ0A 1NFIE 5AQBA 3D9JA 4I1MA 2AXZA 1UOHA 2FBNA 4Q96A 3D9KA 3DXMG 4DJAA 3ZN3A 3SF4A 3CHOA 2X6JA 3ASFA 3D9NA 3FTSA 1OJNA 4FC8A 3EHUA 2WQ7A 4GTOA 3ZFWA 3RU0A 4BY6A 2EQXA 2WPVA 1J0NA 4GZCA 3HIZA 1H19A 4DI4A 2L0IA 2KCVA 4MBGA 3PNLB 5FWQA 4D10C 2A4ZA 4ATZD 2WMKA 3LEWA 1A5EA 4A3TA 3FH5A 4I9EA 3ML9A 2XCCA 4MRUA 2HO1A 1N94A 2FO1E 1OCZE 4WWPA 2P9KG 3BQOA 3EJNA 1TN8A 1Z6TA 2WMHA 1IYGA 2M63A 4U8HA 4HI8A 2CHWA 2J9QA 4GZ5A 2RD0A 3HYMB 1BU9A 2H6HA 3AU5A 2JEKA 2QKHA 5CBNA 5AQ9A 2DYSE 1HF8A 4J8DA 5LX8A 3JXIA 5HQ8A 1LOHA 4G1TA 3Q15A 1IHGA 4UWFA 5ENQD 2Y1LE 4ABNA 1HH8A 2WMNA 3AS4A 3LKUA 3ZNGA 3PNTB 4IRUA 2XENA 5EIDA 3CVVA 3C3OA 3DSWA 3DEOA 2OV8A 4A1GA 4UWHA 5DIZA 3U3WA 4U8YD 3TWSA 1IXVA 2QYJA 3FU5A 1O5MA 1WY6A 1JCSA 2LAIA 4RG9A 4AY6A 3UD1A 4U7EB 2ZISA 2P9LG 2EIKE 4XX5A 4U0UA 2VTBB 2UWJG 3APDA 5CERB 3CK8A 2XRZA 4GMLA 4PDXA 2WXKA 1KT0A 2PM7A 2WXLA 2LUHA 2IY0C 2VTBA 1PY1A 4WAFA 3VLEA 5ENRD 4AEZC 3DSTA 3EDTB 1FT1A 5KJMA 3TJPA 1N4RA 3V79K 3EHTA 4M3OA 3CVXA 1X5BA 3PZ4A 1HG2A 2ZIRA 5ENSD 4A55A 1D8DA 4WWOA 2R2LA 2HM8A 4GCNA 3NZSA 2XPYA 3UKUG 4JVSA 4APFA 3TWVA 3FUKA 5FIOA 3JXJA 3RK6A 4BESA 3APCA 4M7CA 4HFGA 3R7RA 2XEEA 3MX3A 2VGYA 1D9SA 3ASDA 1O1RA 1S0PA 5EYLA 2P9IG 3I4RB 4JHRA 3ESKA 3Q9NC 4Y6CA 1UG3A 3B13A 2BRWA 1JPLA 4JEUA 1YMPA 2OCCE 2H6GA 3L9TA 5CMWA 1N4SA 1HN0A 5AJDA 1J0MA 2F37A 1S63A 4LF3C 4RSYA 2WMGA 2XGMA 3LVQE 4WNGA 3AG2E 3BG0B 3CQGB 4JA7A 2I1JA 3LJNA 3SFYA 4PS3A 4D6DA 3LY9A 3JQ0A 2XZTG 5EILA 3FTYA 3LS8A 3MV2B 2OOEA 1P5QA 1EGUA 3ZYLA 2BUGA 2V5QC 2LNIA 2LSVA 1TR4A 3EHSA 2J4BA 2AXVA 3UT8A 5ITZF 4ILGA 3ULYA 4O60A 3KSQA 3LCAA 4N39A 2Y3AA 1H6OA 3J5QB 1IKND 1HO8A 3W9GA 2E24A 5BV0A 1HXIA 3ABME 4GB9A 1C82A 3V2OA 5C2YA 3IV0A 1UW4B 2GRLA 1DVPA 3KEZA 3DSSA 3UTMA 2WXPA 5CECB 4D1IA 1LTXA 1SW6A 3AG3E 2QYUA 2KCLA 1OWMA 2IO2C 4I17A 3N71A 1N7OA 2WQHA 2RFAA 3ZEFA 2B0OE 3KEAA 4I9CA 2FO7A 2X6IA 4YNDA 4HQDA 3ONKA 1E8ZA 1HE8A 3APFA 4B8CB 2L0TB 4XI0A 3E30A 4EBAG 1IHBA 3Q4AB 5AQAA 3EHNA 1KZOA 5BV1A 4KMOA 4GCOA 3L17A 3UPVA 1N54A 4ERSA 3G2UA 4D6EA 2UY1B 4BETA 5FTPA 3CSTA 1MX6A 4EZJA 3FUMA 3VLFA 2E22A 3MV3B 3TXMA 3Q47B 2J8SD 3CLJA 1OWOA 4HXIA 2Y4TA 1EDUA 4KXKB 2KXRA 2QY7A 1Y8MA 3B7UX 3B7SA 3FP3A 5KNHD 4BSXA 4BERA 4CT4A 3TWQA 1Z3YA 2CHXA 4EZLA 1ELKA 4D6JA 3ULQA 5CEDB 4FLHA 3B95A 2VSNA 4U8VD 3E34A 4UI9J 4KVOA 3JYSA 3PRZA 2E2EA 5KNGA 3ZYMA 2Y69E 4UI9K 3SGHA 1QYMA 3FTXA 4R7LA 1QBQA 2KXPC 1N7NA 4U0SA 2I1KA 5CRUA 2R02A 1JCRA 2IFUA 5EYPF 2ONDA 2WMJA 4N2SA 4C9BB 3FULA 3V30A 4AV7A 4JB8P 4I6GA 3UIPC 3GZ1A 1ZU2A 4YDEA 2X6KA 2GRMA 2Y4UA 1TJFA 3HHMA 3P2BA 4WNDA 1E96B 5II0A 4XEIG 1H2VC 2Q7FA 3HXBA 2VGXB 1WDYA 4GTSA 4BWRA 2DBAA 4HRMB 1V54E 3QK0A 3CHRA 1N7QA 4GPKA 2V5FA 4N5CA 1DCEA 2NXPA 5KJLA 4DX2A 4RG6A 3OTNA 4UWKA 5BNWA 3AG4E 5CMYA 2F8YA 2WMFA 3CK9A 4HB5A 5CHEE 3ESLA 3TGOA 2P9UG 4DLOA 2VGEA 2ZGDA 3PZ1A 4TXQA 3SI5A 3O4ZA 2HYZA 3KS2A 5AQ7A 5G05J 4F3VA 4GTVA 3AQFB 3QOUA 2ZU6B 3DPYA 4NACA 2NSZA 3G2TA 5ARFA 1K8KG 5G2NA 3QJZA 4RLYA 1O1SA 2NYJA 5FZRA 3URZA 5AAOA 3ZUVB 3IHYA 3AS5A 2PQRA 1Q2ZA 3UMVA 4A1SA 4CDMA 3EHQA 4XKCA 5ARGA 2C0LA 2CHZA 2XGOA 4RVBA 4TV3A 4G8LA 4JHKA 4W9RA 3C5RA 2VSOE 4N5QA 3RJVA 3CVPA 2AXUA 5FJYA 3T8MA 4GYWA 2J49A 3PH0C 2A5UA 2R5SA 1ZB1A 2GRRB 2BEDA 3ENEA 2KM4A 1QZ2A 4FLBA 3TG5A 1DC2A 4YVOA 1WG0A 3CVQA 3C98A 4LCTA 2JNCA 4E85A 3DEPA 3L2JA 3NOGD 1JUQA 5FT9A 4NURA 1I8QA 4FJYA 3J5PA 2V0PA 3BEEA 3T8KA 1ELRA 3GYZA 2WMOA 4URKA 1HM3A 3FH7A 1OCCE 3QAQA 5ENOD 4DX5D 3ULEG 4ME2A 5LOZA 2QC9A 3CHMA 2VQ2A 2VYIA 2GRQB 1BPOA 4GTTA 4EQFA 4FP7A 4U95D 5JJ6A 3HXEA 4DPRA 3UINC 3G2VA 1E90A 1TNBA 2WXQA 5ENTD 2AJAA 5HRYA 2P2CP 1CB8A 1NA0A 4L2YA 3IBEA 4YDYA 3Q73A 5ANLA 3T9KA 4CGVA 3UX4A 4LUNU 3UUXA 5EX3A 1DCQA 4D8OA 2I9CA 3DBSA 4I6EA 4DK5A 3ZHEB 3S7JA 4EECA 3Q9UC 4GYOA 3RKVA 1OWLA 2XS1A 2FULA 3FH8A 2PZIA 1N0QA 4G26A 2MYOA 4XE0A 4BTBA 5EX0A 3JQ1A 3WXXA 3IOLA 1Z3XA 2WXHA 3ZW3A 3Q7FA 1W3YA 2ILRA 2KXSA 2L27A 4NRHB 5LFAA 3R7QA 3O48A 4I6JA 3B7TA 3ZYQA 3FU3A 3TWTA 4AJWA 4K5CA 4CYMD 4D1JA 4C0MA 3DRAA 4HORA 1MJ0A 3QWPA 3PE4A 3NAWA 3CVNA 2YHCA 3AJIA 1RWFA 1KZPA 4GMRA 4LEUA 4Q94A 1HU3A 5C1DA 4OAVB 2X6HA 4UWGA 3T5XA 2OVFA 2JNDA 3P1UA 1H2UA 1LD8A 3UM3A 3SQVA 5JA4D 2CG3A 3SBSA 1RW2A 2KZTB 4P29A 4GMJA 4WWNA 1HX8A 2WDAA 4ANWA 4U63A 3RO3A 4N3AA 1OCOE 3TWXA 4N2QA 3MA5A 5B1BE 2KZTA 3HDXA 3ZXSA 5KWDA 4DX6D 4UWLA 2L6BA 3KAEA 2NC9A 4LNBA 3L82A 3AU4A 5G04J 4GTRA 3CQCB 2H6IA 4O6FA 3CR3A 4XI9A 4FU3A 1HZ4A 4AM9A 3FUEA 1FPPA 3SNXA 3MYVA 4B89A 4BT8A 1F9GA 3FHEA 4LERA 5LP0A 1NI1A 4J7WA 3HXCA 2ZXWE 3QC1A 3G2SA 3RRMB 5BT1A 2OEVA 3Q5MA 5A23A 4JEHA 4O1PA 4AXHA 2YHEA 4G23A 1BLXB 1HMWA 3S2AA 4UI9C 3IKOB 3UQ3A 3KBTC 2IO3C 5G55A 3FTVA 5B3SE 3PS6A 2CG2A 1TN7A 3TWRA 3JCKC 3JUEA 3CVLA 4PS7A 5EKQD 3RAUA 3QWVA 5EIBE 2Q1FA 4HI9A 4JXTA 3NF1A 3VTXA 1X1IA 1OJOA 4D72A 1H0AA 4U0ZA 5FINA 4LNUD 2KC7A 3ASHA 2BRVX 5M72A 3ASGA 2WXIA 4D71A 4FHJA 2VJ8A 3K9IA 2ZGGA 4B94A 4AY5A 3FTWA 2BRPA 4WNEA 4J8SA 1MX4A 1K1AA 2IEJA 5AJLA 2I2OA 4Y6WA 5D2MC 1XGWA 1ELWA 1MHQA 1RWGA 4AOFA 4XIFA 3DSXA 1H2TC 3KSLA 4G8KA 4TUUA 3QWWA 3GW4A 1B89A 1A17A 1TNOA 1SZAA 3HG0D 3UD2A 3T5VA 3DWLG 3U9WA 4CEMA 2XGSA 3FY4A 2LO6A 3L54A 5G05C 4I2WA 3PUKA 1X1JA 2IJGX 2WXNA 4KZ0A 3L22A 4I2ZA 2X38A 3CVUA 2GW1A 2DZOA 2WM9A 1Z5SC 2H6FA 4KBQA 2FEZA 2VSXE 1EYHA 3UXGA 4G25A 3QB2A 4I1AA 1Y6IA 4BT9A 1MZCA 3SD5A 4JW1A 3GZSA 3ISMC 4F1PA 4HNAD 3PEUB 2XEHA 3VTYA 2XS8A 3ASOE 4TRQA 2E0IA 2J07A 1SA4A 1FT2A 4NQ0A 2UY1A 2WB2A 1S64A 4MKTA 3D9OA 1OUVA 3MEKA 1PC2A 1BD8A 1TN6A 3PREA 1H6PA 4D6HA 3EHRA 3C59A 4BX8A 3DXKG 3FWVA 5A7DB 4D6GA 4JHJA 2I6HA 4K5BA 1HG5A 4YVQC 3RRUA 4J8FA 5FQ8A 4D6IA 4L9PA 2XEVA 1E8XA 3PDNA 4D6FA 4TUMA 3G2WA 1HM2A 2V8SE 1OXJA 3LJ3A 1OCRE 4AP2A 2EILE 5BW8C 3HRAA 4FHKA 3FTUA 5BPPA 1G3NB 2PQNA 2ETAA 1JCQA 4F6RD 1N11A 2WXJA 2RG8A 3CIAA 2V4HC 5JHAA 1N95A 3TAXA 1N7PA 3FUFA
chains in the Genus database with same CATH topology
3QAQA 4MLPA 1TJCA 4GA2A 3EHTA 4ME2A 5LOZA 1YA0A 3CHMA 4M3OA 2VQ2A 2R17C 2IOSA 2VYIA 3CVXA 3CHQA 1FCHA 3N7SA 1X5BA 1HG2A 1BPOA 4HOSA 2QFCA 4HS2A 2LAHA 1N52A 4A55A 4EQFA 2J09A 2L9BA 3CKCA 4FP7A 5JJ6A 4DPRA 5JJ7A 3G2VA 4WWOA 1E90A 4G2VA 2HM8A 2C2LA 2WXQA 5FQ7A 4FADA 4GCNA 3NZSA 4UQZA 2XPYA 3MZLB 4ANVA 4ILHB 1UJJA 4JVSA 4APFA 5D0OD 1NA0A 4L2YA 3FUKA 1FVFA 3IBEA 2VGXA 5ENNA 3RK6A 3S7DA 1E7VA 3UT7A 5ANLA 3NZUA 4KVMA 3APCA 2XPZA 4HFGA 3CK7A 3LDZA 4CGVA 3R7RA 3UX4A 4XZ4A 4OVVA 4CDNA 4LUNU 3MX3A 5KCMA 3LPZA 2BF0X 2MRIA 2VGYA 3UUXA 5EX3A 2LSUA 3ZPJA 4D8OA 2I9CA 3DBSA 3ASDA 1VDYA 3FU0A 4I6EA 4DK5A 1S0PA 3ZHEB 3I4RB 3LY7A 3S7JA 3QARA 2V4LA 3D9MA 4AVXA 4HVBA 4JHRA 4EECA 3OXLA 3ESKA 4GYOA 4Y6CA 1OWNA 3RKVA 1OWLA 1UG3A 2WXGA 3F59A 2FULA 3B13A 3D3MA 1JPLA 2PZIA 3FH8A 4G26A 4JEUA 1OWPA 4XE0A 3SBTB 4PH4B 4WUYA 4BTBA 5EX0A 3JQ1A 3WXXA 3IOLA 4J8EA 1Z3XA 5CMWA 2BTDA 2WXHA 4APOA 3ZW3A 5AJDA 2AVPA 3EHMA 4LF3C 3PE3A 4RSYA 4F1SA 2ILRA 2KXSA 2L27A 2YNQA 4NRHB 5LFAA 1GW6A 3R7QA 2XGMA 4BX9A 3LVQE 3O48A 4WNGA 4I6JA 3B7TA 1XNFA 3BG0B 3CQGB 4JA7A 3ML8A 4J6IA 3ZYQA 3U66A 2DCPA 2I1JA 3FU3A 4AJWA 4WNFA 5FQ6A 5A6CA 4GAAA 2GGFA 4C0MA 4HORA 3FUIA 3QWPA 1EF1C 4PS3A 5BUZA 3PE4A 3CEQA 3CVNA 4V3IA 4HLEA 3LY9A 3I5PA 3JQ0A 5T8IA 3FTYA 3LS8A 2YHCA 4CDRA 3MV2B 2OOEA 3PUJA 4GA0A 4LEUA 1P5QA 3MKQB 3S7BA 1FVHA 4Q94A 2IQCA 3ZYLA 2BUGA 5FZQA 2LNIA 2L6JA 2LSVA 3EHSA 3CKBA 1JWGA 2J4BA 5CCMA 3OAWA 2AXVA 3FTZA 4GU5A 3UT8A 1HU3A 5C1DA 5G04C 2X6HA 4I1OB 4ILGA 4UWGA 4MS6A 4FA6A 4A3VA 3MKQA 1E8YA 4XKBA 3T5XA 2OVFA 2JNDA 3P1UA 1SZ9A 1H2UA 3LCAA 2Y3AA 4L1BA 4N39A 4U07A 3IEGA 2XPIA 1HO8A 2CG3A 3SBSA 5BV0A 1UJKA 4ATGA 2KZTB 4P29A 1IQUA 1HXIA 4GMJA 4WWNA 3U64A 1HX8A 3L16A 4GB9A 4AIFA 4B8AA 1NZNA 1LF8A 5C2YA 3IV0A 2AW6A 3B7RL 1UW4B 4U63A 4ANWA 5J08A 2GRLA 4U04A 1DVPA 4PUCA 3KEZA 3RO3A 4JZYA 5KJNA 5LCWC 4DLQA 4N3AA 2WXPA 4N2QA 4JA9A 3MA5A 4ANXA 3E4BA 2KZTA 3HDXA 3ZXSA 2WVIA 1WM5A 2XRYA 4N3BA 3HVEB 4UWLA 2KCLA 1OWMA 2OVBA 3KAEA 2CFUA 2NC9A 4I17A 4KYOB 3EIJA 3N71A 1U34A 3IHVA 4PS8A 3AU4A 2WQHA 2HR2A 5G04J 2WXFA 4I43A 4FULA 3CQCB 3ZEFA 2XCBA 4UQXA 3SHFA 4I9CA 2FO7A 3DPDA 3H3GA 2X6IA 5JHBA 4O6FA 4YNDA 3CHPA 3CR3A 4XI9A 3HVEA 4Q69A 4FU3A 1HZ4A 4AM9A 1ZBPA 3LXUX 3FUEA 3ONKA 2VSYA 3QKYA 4EPZA 1E8ZA 3SNXA 3SFZA 3MYVA 4B89A 1HE8A 3APFA 3MJWA 4BT8A 4ILIA 1UN9A 3FHEA 4B8CB 3EIQC 2L0TB 4LERA 2IOLA 4XI0A 5LP0A 2JODA 3CVYA 4EBAG 2DIWA 3MCXA 5LCWJ 3Q4AB 3EHNA 1SQMA 4H7XA 1E8WA 5BV1A 2FI7A 3CHSA 3FUDA 4KMOA 4GCOA 5DBKA 5ANRA 4CRWA 3C5TA 3QC1A 3L17A 3Q49B 3N7RA 3UPVA 5E76A 3D9PA 4ACKA 1U3DA 1IQRA 3G2SA 4QFVA 3RRMB 5BT1A 3I4GA 3Q5MA 2MOWA 5A23A 4JEHA 2CFZA 4HOUA 2C0MA 1N54A 3OXGA 4AXHA 2YHEA 4DI3A 4ERSA 3LVRE 4G23A 1DNPA 2P58C 3S2AA 3G2UA 4UI9C 3ZHEA 2UY1B 3IKOB 3S7FA 3CVWA 3UQ3A 3KBTC 5FTPA 3CSTA 4KZCA 2WQ6A 5G55A 3FTVA 3CV0A 4G24A 4IYPA 4EZJA 3PQIA 3FUMA 3PS6A 3VLFA 2CG2A 3MV3B 4F7AA 3TXMA 1KLXA 4GYYA 3Q47B 4OYSA 4JPSA 2WXRA 3CLJA 3ZGQA 1OWOA 3MKRA 5KJKA 4HXIA 2Y4TA 2KATA 3JCKC 3D9IA 1EDUA 4KXKB 3CVLA 2KXRA 5FZSA 4PS7A 5EKQD 1H6KA 2QY7A 1Y8MA 3B7UX 3B7SA 3QNKA 3FP3A 3QWVA 4BSXA 3FEXA 1EPUA 3TG4A 4C0EA 4JXTA 3RO2A 2PL2A 3NF1A 3VTXA 4CT4A 1U3CA 3ZRHA 1Z3YA 2CHXA 4EZLA 3PVLA 1ELKA 3ULQA 1H0AA 4N3CA 4L23A 4U0ZA 4FLHA 3LY8A 4OVUA 4JC8A 2VSNA 2KC7A 4BTAA 3ASHA 3D9LA 4UI9J 5M72A 3L6AA 5AIJA 3ASGA 2J4DA 2WXIA 4KVOA 4ZGMA 3FUNA 4HJ0A 4FHJA 3JYSA 2VJ8A 3PRZA 1W3BA 3D9JA 4IN3B 2E2EA 3ZYMA 5JJTA 4K0RA 4I1MA 2AXZA 3K9IA 3UT4A 4UI9K 3SGHA 1E7UA 2FBNA 4B0ZA 4Q96A 4B94A 3KBUC 3D9KA 3FTXA 4R7LA 3FTWA 3RIBA 3FFLA 4L7TA 4AY5A 5T3RA 1QQEA 4DJAA 4H7YA 2JLBA 4WNEA 4J8SA 4KT6B 4U0SA 2I1KA 1MQSA 5AJLA 2I2OA 2YQ8A 4Y6WA 3ZN3A 3SF4A 1XGWA 3JUIA 3CHOA 2X6JA 3ASFA 1ELWA 3D9NA 1MHQA 3FTSA 3AS8A 2IFUA 4FC8A 4AOFA 4XIFA 3EHUA 1H2TC 1JWFA 2ONDA 3FUJA 3ZFWA 3ZVVA 4TUUA 2WQ7A 3QWWA 3RU0A 3GW4A 1B89A 4BY6A 1A17A 1SZAA 3MGBA 4N2SA 1L5JA 4C9BB 3FULA 2EQXA 2WPVA 2WXMA 3UD2A 4GZCA 3HIZA 3T5VA 1H19A 5FQ4A 4AV7A 3U9WA 4I6GA 3U4TA 4CEMA 4DI4A 3GZ1A 5CCLA 2L0IA 1ZU2A 4HOQA 2X6KA 2XGSA 3FY4A 2GRMA 2Y4UA 1TJFA 2XDGA 2KCVA 2LO6A 3HHMA 3P2BA 4WNDA 1E96B 2MHKA 3PNLB 5II0A 3L54A 5FWQA 4D10C 5G05C 3VLDA 2A4ZA 1H2VC 2Q7FA 4I2WA 3PUKA 3LEWA 2IJGX 2VGXB 2WXNA 2X6FA 4A3TA 4KZ0A 3FH5A 3L22A 3NQPA 3PEVB 4I9EA 3ML9A 4I2ZA 2DBAA 4G11A 4BWRA 3FU6A 2XCCA 4MRUA 2HO1A 3QK0A 2X38A 1KT1A 3OXFA 3CHRA 4F53A 3CVUA 2KCKA 4GPKA 2V5FA 4N5CA 2GW1A 4EZKA 4WWPA 2NXPA 2WM9A 5KJLA 3ONLA 2XQ0A 3EJNA 4E6HA 4RG6A 3OTNA 1NA3A 3L13A 4GZ6A 4UWKA 5BNWA 1Z6TA 4KBQA 3RRNB 2FEZA 4CT0A 1IYGA 5CMYA 2M63A 2VSXE 4U8HA 1EYHA 3CK9A 2CHWA 4G25A 3QB2A 2J9QA 4GZDA 4GZ5A 4I1AA 5CHEE 4CCAA 2RD0A 3ESLA 4CGWA 3TGOA 3HYMB 2IF4A 3CSFA 4JL0A 1Y6IA 3AU5A 4DLOA 4BT9A 2JEKA 4GZ3A 4IULA 3TXNA 3GZ2A 3SD5A 3SI5A 3O4ZA 4JW1A 2HYZA 3KS2A 3GZSA 2QKHA 3L08A 3PEUB 5G05J 4F3VA 3AQFB 3FUHA 3QOUA 4GA1A 2R59A 2ZU6B 3VTYA 3ZIMA 3C4MA 4NACA 1HF8A 2NSZA 4J8DA 3G2TA 5ARFA 4ACLA 5LX8A 5G2NA 3QJZA 2XHEA 5J90A 5HQ8A 2IONA 4TRQA 2E0IA 2J07A 2WB2A 4NQ0A 2UY1A 3LYAA 1NP7A 4G1TA 3Q15A 2PM6A 5FZRA 3URZA 4MKTA 1IHGA 3D9OA 1OUVA 3MEKA 4UWFA 3IHYA 3AS5A 2PQRA 4ABNA 1PC2A 1HH8A 3UMVA 4A1SA 4CDMA 4L2LA 3PREA 4XKCA 2WMNA 5ARGA 3QDNA 4K03A 2C0LA 2CHZA 2XGOA 4RVBA 4TV3A 2X3MA 3C59A 2IU1A 3AS4A 4JHKA 4BX8A 3R9AB 3LKUA 3QR8A 3PNTB 4IRUA 4EBAA 4W9RA 3CGHA 3CVVA 2VSOE 1WAO1 3FWVA 5A7DB 3RJVA 3CVPA 2OV8A 2YINA 4BFRA 4A1GA 2AXUA 5FJYA 3BG1B 4JHJA 4UWHA 1HS6A 5DIZA 3U3WA 2I6HA 5AENA 1UN8A 1INZA 1HG5A 2FF4A 3FDHA 4YVQC 3T8MA 3RRUA 4J8FA 4GYWA 2J49A 3FU5A 3PH0C 5FQ8A 4ANUA 4LRZA 2A5UA 2R5SA 3N7PA 1HFAA 1WY6A 2XEVA 2J08A 1E8XA 3PDNA 2LAIA 4UQYA 4RG9A 4AY6A 3G2WA 3UD1A 3ENEA 2KM4A 2V8SE 4XX5A 1QZ2A 4FLBA 2WXOA 3LJ3A 4U0UA 2VTBB 5EDSA 3TG5A 4HOTA 4YVOA 5HI7A 3CVQA 3C98A 4LCTA 3TL5A 5E75A 2JNCA 2UWJG 3APDA 4E85A 4AP2A 3L2JA 3CK8A 3ZYKA 1JUQA 5BW8C 5FT9A 2XRZA 4NURA 5AYWD 4FHKA 1PAQA 3FTUA 5BPPA 4FJZA 4GMLA 2AWIA 3PZDA 3SZ7A 4PDXA 2WXKA 1KT0A 2PM7A 2WXLA 4FJYA 2PQNA 5T4YA 2V0PA 1TEZA 3BEEA 2VTBA 1PY1A 3FEYA 4WAFA 3VLEA 4AEZC 1ELRA 2WXJA 3GYZA 5D0QD 2RG8A 3CIAA 3EDTB 3KD7A 2WMOA 5JHAA 4URKA 1QNFA 3FH7A 3I3NA 5KJMA 3TJPA 3TAXA 4J0UA 3FUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7R A;  3EHS A;  2XDG A;  2JNC A;  3EHT A;  3H3G A;  3L2J A;  5II0 A;  3N7S A;  4DLQ A;  4ZGM A;  4HJ0 A;  3EHU A;  4ERS A;  3IOL A;  2JND A;  4DLO A;  3N7P A;  2JOD A;  3C59 A;  2QKH A;  4LF3 C;  1U34 A;  2L27 A;  3AQF B;  3C4M A;  3C5T A; 
#chains in the Genus database with same CATH topology
 4MLP A;  1TJC A;  4GA2 A;  2IOS A;  3CHQ A;  3N7S A;  4HOS A;  1N52 A;  2J09 A;  2L9B A;  3CKC A;  3NBN B;  1OY3 D;  4G2V A;  1YCS B;  4UQZ A;  1LD7 A;  3MZL B;  4O1O A;  3UM0 A;  5D0O D;  1FVF A;  2VGX A;  4NIK A;  5ENN A;  3EU9 A;  1E7V A;  3NZU A;  4KVM A;  3CK7 A;  3LDZ A;  2WMI B;  4XZ4 A;  4OVV A;  4CDN A;  5KCM A;  3LPZ A;  2MRI A;  1OT8 A;  2LSU A;  3ZPJ A;  1VDY A;  3FU0 A;  5H7P A;  3LY7 A;  2V4L A;  3D9M A;  1NL4 A;  5ENP D;  3BU8 A;  2WMI A;  1OWN A;  3F59 A;  3SFX A;  1BI7 B;  3EU5 A;  4ZFH A;  3SBT B;  4J8E A;  3UI2 A;  5CEA A;  2AVP A;  3EHM A;  2R03 A;  2P9P G;  2YNQ A;  3ASN E;  1GW6 A;  2KBX A;  4BSZ B;  2PNN A;  3UIO C;  3U66 A;  4J6I A;  3ZKJ A;  4WNF A;  5FQ6 A;  5A6C A;  4GAA A;  1EF1 C;  3CEQ A;  4V3I A;  3I5P A;  5T8I A;  2EIM E;  3S7B A;  1FVH A;  5KBA A;  3C72 A;  3Q7A A;  2L6J A;  3CKB A;  4D6C A;  5CCM A;  5G04 C;  4FA6 A;  1E8Y A;  2GRN B;  4XKB A;  1SZ9 A;  4U07 A;  2XPI A;  3E37 A;  3Q78 A;  1IQU A;  3U64 A;  3HXD A;  2EIJ E;  1NZN A;  1LF8 A;  4Z68 A;  2AW6 A;  3SY2 A;  4PUC A;  2X03 A;  5KJN A;  4ANX A;  3E4B A;  1WM5 A;  4N3B A;  2OVB A;  2BKK B;  3IXE A;  4YDW A;  2CFU A;  3B7B A;  4KYO B;  5CRV A;  2HR2 A;  1AWC B;  4FUL A;  4UQX A;  2Y0B G;  3ABL E;  3Q79 A;  3H3G A;  5JHB A;  4LSZ E;  3CHP A;  2VSY A;  3QKY A;  2R05 A;  5CBO A;  3MJW A;  3AAA C;  1UN9 A;  2JOD A;  2WCO A;  3CVY A;  5LCW J;  3TWW A;  4LNG A;  4H7X A;  1E8W A;  5EN5 D;  1N9A A;  5ANR A;  3C5T A;  3Q49 B;  3N7R A;  3D9P A;  1U3D A;  1IQR A;  2MOW A;  2CFZ A;  3E32 A;  4HOU A;  4DI3 A;  3LVR E;  1DNP A;  2P58 C;  3C3Q A;  3ZHE A;  2WQ6 A;  4G24 A;  4F7A A;  4JPS A;  2WXR A;  4BEP A;  3ZGQ A;  3MKR A;  5KJK A;  5D66 A;  1H6K A;  3WG7 E;  3QNK A;  3EUV A;  1EPU A;  4TXP A;  3TG4 A;  3RO2 A;  4C0E A;  1N4Q A;  1U3C A;  3ZRH A;  3V31 A;  3U7V A;  3PZ2 A;  4OVU A;  4JC8 A;  4BTA A;  1U2V G;  3FUN A;  4IN3 B;  1W3B A;  5JJT A;  4K0R A;  3UT4 A;  4B0Z A;  1E7U A;  3KBU C;  3RIB A;  3FFL A;  4L7T A;  5T3R A;  1QQE A;  4H7Y A;  2JLB A;  4KT6 B;  2JAB A;  1MQS A;  2YQ8 A;  4C48 B;  3JUI A;  3SO8 A;  3AS8 A;  2XZD G;  1LXM A;  1JWF A;  3FUJ A;  3ZVV A;  5AAR A;  3MGB A;  1L5J A;  2WXM A;  1N0R A;  5BXO A;  5FQ4 A;  3U4T A;  5CCL A;  2ETB A;  4HOQ A;  2XDG A;  2MHK A;  3VLD A;  4CZ2 D;  2X6F A;  4DX1 A;  3NQP A;  4QQI A;  3PEV B;  1RW9 A;  4U96 D;  3F6Q A;  4G11 A;  3FU6 A;  1KT1 A;  3OXF A;  4F53 A;  4GPM A;  2KCK A;  4A63 B;  4EZK A;  3W9F A;  3ONL A;  2XQ0 A;  4E6H A;  1NA3 A;  3L13 A;  2P9S G;  4GZ6 A;  3RRN B;  5IY5 E;  4J8Y A;  4CT0 A;  2LXM A;  1SVX A;  4CCA A;  4GZD A;  4CGW A;  3E33 A;  2F0Y A;  2IF4 A;  3CSF A;  4JL0 A;  4GZ3 A;  4IUL A;  3TXN A;  1K1B A;  3GZ2 A;  2RKK A;  1TNZ A;  3L08 A;  3FUH A;  3NOC D;  4GA1 A;  2R59 A;  3ZIM A;  3C4M A;  4TXR A;  4ACL A;  1X81 A;  2XHE A;  5J90 A;  2ION A;  1KPS B;  3LYA A;  1NP7 A;  2PM6 A;  1F1S A;  1HMU A;  1V55 E;  1BI8 B;  3ZXP A;  4HRN A;  4L2L A;  3QDN A;  4K03 A;  2X3M A;  2IU1 A;  5BXU A;  3R9A B;  3QR8 A;  3HXF A;  4EBA A;  3CGH A;  1WAO 1;  4GTQ A;  1OJP A;  2YIN A;  4BFR A;  3BG1 B;  1HS6 A;  5AEN A;  1UN8 A;  1RWA A;  1INZ A;  2FF4 A;  3FDH A;  3NB2 A;  4ANU A;  4LRZ A;  1OJM A;  3N7P A;  1HFA A;  2DWZ A;  2J08 A;  4UQY A;  3V2X A;  2WXO A;  5EDS A;  4HOT A;  5HI7 A;  3TL5 A;  4DRX E;  5E75 A;  4K5A B;  3ZYK A;  3DSU A;  1YYH A;  5AYW D;  1PAQ A;  4FJZ A;  2AWI A;  3PZD A;  4X8Q A;  3SZ7 A;  5T4Y A;  4JD2 G;  1TEZ A;  3FEY A;  5D0Q D;  3KD7 A;  2GRO B;  4B93 B;  1QNF A;  5B1A E;  3I3N A;  4J0U A;  4DX7 D;  3X2Q E;  1TNU A;  1YA0 A;  2R17 C;  1N7R A;  1FCH A;  2QFC A;  4HS2 A;  2LAH A;  5JJ7 A;  2C2L A;  5FQ7 A;  4FAD A;  1RWC A;  2HE0 A;  4ANV A;  4ILH B;  1UJJ A;  4EHM A;  3Q75 A;  3S7D A;  3UT7 A;  4OAU C;  2XPZ A;  2BF0 X;  2F8X K;  2GRP B;  1X1H A;  3QAR A;  4AVX A;  4HVB A;  3OXL A;  2WXG A;  2RFM A;  2QZA A;  3D3M A;  1OWP A;  4PH4 B;  4WUY A;  5HS0 A;  4DUI A;  3PZ3 A;  2BTD A;  4APO A;  1RZ4 A;  3PE3 A;  4F1S A;  4HBD A;  4BX9 A;  1AP7 A;  1XNF A;  3UKR G;  3ML8 A;  2DCP A;  2GGF A;  3UM1 A;  2BKG A;  3FUI A;  5BUZ A;  4HLE A;  4CDR A;  3PUJ A;  4GA0 A;  4GTP A;  3MKQ B;  4UUC A;  2IQC A;  5FZQ A;  2ETC A;  1JWG A;  3OAW A;  3FTZ A;  5HKP A;  4GU5 A;  4I1O B;  4MS6 A;  4A3V A;  2P9N G;  3MKQ A;  4L1B A;  3IEG A;  1SA5 A;  1D8E A;  1UJK A;  4ATG A;  3L16 A;  4AIF A;  4B8A A;  5AN8 A;  3B7R L;  5J08 A;  4U04 A;  5LCW C;  4JZY A;  4DLQ A;  2OEW A;  4JA9 A;  3C3R A;  2WVI A;  2XRY A;  3HVE B;  3TWU A;  1U34 A;  3EIJ A;  3IHV A;  4PS8 A;  2WXF A;  2LXL A;  4I43 A;  2XCB A;  3SHF A;  3DPD A;  1TYQ G;  3HVE A;  4Q69 A;  1ZBP A;  3LXU X;  4EPZ A;  3SFZ A;  3DSV A;  4ILI A;  5JMN D;  1LXK A;  4ZHB A;  3EIQ C;  2IOL A;  3BUA A;  1MX2 A;  2DIW A;  3RSE G;  3MCX A;  4HLL A;  1SQM A;  2FI7 A;  3AG1 E;  3CHS A;  3FUD A;  5DBK A;  4CRW A;  4LG6 A;  5E76 A;  4ACK A;  4QFV A;  1RWH A;  3ABK E;  3ZU7 B;  3I4G A;  2C0M A;  3OXG A;  4GTM A;  1N4P A;  2DZN A;  2B6C A;  4YDO A;  3S7F A;  3UM2 A;  3CVW A;  4KZC A;  4HRL A;  3CV0 A;  4IYP A;  1O1T A;  3PQI A;  1KLX A;  4GYY A;  4OYS A;  1S70 B;  2KAT A;  2DYR E;  3D9I A;  5FZS A;  4RQI A;  3FEX A;  2PL2 A;  1K3Z D;  1MYO A;  2EIN E;  3PVL A;  4L23 A;  4N3C A;  1TNY A;  3LY8 A;  2DVW A;  3D9H A;  3D9L A;  3R9M A;  2A5E A;  3L6A A;  5AIJ A;  2J4D A;  4ZGM A;  4HJ0 A;  1NFI E;  5AQB A;  3D9J A;  4I1M A;  2AXZ A;  1UOH A;  2FBN A;  4Q96 A;  3D9K A;  3DXM G;  4DJA A;  3ZN3 A;  3SF4 A;  3CHO A;  2X6J A;  3ASF A;  3D9N A;  3FTS A;  1OJN A;  4FC8 A;  3EHU A;  2WQ7 A;  4GTO A;  3ZFW A;  3RU0 A;  4BY6 A;  2EQX A;  2WPV A;  1J0N A;  4GZC A;  3HIZ A;  1H19 A;  4DI4 A;  2L0I A;  2KCV A;  4MBG A;  3PNL B;  5FWQ A;  4D10 C;  2A4Z A;  4ATZ D;  2WMK A;  3LEW A;  1A5E A;  4A3T A;  3FH5 A;  4I9E A;  3ML9 A;  2XCC A;  4MRU A;  2HO1 A;  1N94 A;  2FO1 E;  1OCZ E;  4WWP A;  2P9K G;  3BQO A;  3EJN A;  1TN8 A;  1Z6T A;  2WMH A;  1IYG A;  2M63 A;  4U8H A;  4HI8 A;  2CHW A;  2J9Q A;  4GZ5 A;  2RD0 A;  3HYM B;  1BU9 A;  2H6H A;  3AU5 A;  2JEK A;  2QKH A;  5CBN A;  5AQ9 A;  2DYS E;  1HF8 A;  4J8D A;  5LX8 A;  3JXI A;  5HQ8 A;  1LOH A;  4G1T A;  3Q15 A;  1IHG A;  4UWF A;  5ENQ D;  2Y1L E;  4ABN A;  1HH8 A;  2WMN A;  3AS4 A;  3LKU A;  3ZNG A;  3PNT B;  4IRU A;  2XEN A;  5EID A;  3CVV A;  3C3O A;  3DSW A;  3DEO A;  2OV8 A;  4A1G A;  4UWH A;  5DIZ A;  3U3W A;  4U8Y D;  3TWS A;  1IXV A;  2QYJ A;  3FU5 A;  1O5M A;  1WY6 A;  1JCS A;  2LAI A;  4RG9 A;  4AY6 A;  3UD1 A;  4U7E B;  2ZIS A;  2P9L G;  2EIK E;  4XX5 A;  4U0U A;  2VTB B;  2UWJ G;  3APD A;  5CER B;  3CK8 A;  2XRZ A;  4GML A;  4PDX A;  2WXK A;  1KT0 A;  2PM7 A;  2WXL A;  2LUH A;  2IY0 C;  2VTB A;  1PY1 A;  4WAF A;  3VLE A;  5ENR D;  4AEZ C;  3DST A;  3EDT B;  1FT1 A;  5KJM A;  3TJP A;  1N4R A;  3V79 K;  3EHT A;  4M3O A;  3CVX A;  1X5B A;  3PZ4 A;  1HG2 A;  2ZIR A;  5ENS D;  4A55 A;  1D8D A;  4WWO A;  2R2L A;  2HM8 A;  4GCN A;  3NZS A;  2XPY A;  3UKU G;  4JVS A;  4APF A;  3TWV A;  3FUK A;  5FIO A;  3JXJ A;  3RK6 A;  4BES A;  3APC A;  4M7C A;  4HFG A;  3R7R A;  2XEE A;  3MX3 A;  2VGY A;  1D9S A;  3ASD A;  1O1R A;  1S0P A;  5EYL A;  2P9I G;  3I4R B;  4JHR A;  3ESK A;  3Q9N C;  4Y6C A;  1UG3 A;  3B13 A;  2BRW A;  1JPL A;  4JEU A;  1YMP A;  2OCC E;  2H6G A;  3L9T A;  5CMW A;  1N4S A;  1HN0 A;  5AJD A;  1J0M A;  2F37 A;  1S63 A;  4LF3 C;  4RSY A;  2WMG A;  2XGM A;  3LVQ E;  4WNG A;  3AG2 E;  3BG0 B;  3CQG B;  4JA7 A;  2I1J A;  3LJN A;  3SFY A;  4PS3 A;  4D6D A;  3LY9 A;  3JQ0 A;  2XZT G;  5EIL A;  3FTY A;  3LS8 A;  3MV2 B;  2OOE A;  1P5Q A;  1EGU A;  3ZYL A;  2BUG A;  2V5Q C;  2LNI A;  2LSV A;  1TR4 A;  3EHS A;  2J4B A;  2AXV A;  3UT8 A;  5ITZ F;  4ILG A;  3ULY A;  4O60 A;  3KSQ A;  3LCA A;  4N39 A;  2Y3A A;  1H6O A;  3J5Q B;  1IKN D;  1HO8 A;  3W9G A;  2E24 A;  5BV0 A;  1HXI A;  3ABM E;  4GB9 A;  1C82 A;  3V2O A;  5C2Y A;  3IV0 A;  1UW4 B;  2GRL A;  1DVP A;  3KEZ A;  3DSS A;  3UTM A;  2WXP A;  5CEC B;  4D1I A;  1LTX A;  1SW6 A;  3AG3 E;  2QYU A;  2KCL A;  1OWM A;  2IO2 C;  4I17 A;  3N71 A;  1N7O A;  2WQH A;  2RFA A;  3ZEF A;  2B0O E;  3KEA A;  4I9C A;  2FO7 A;  2X6I A;  4YND A;  4HQD A;  3ONK A;  1E8Z A;  1HE8 A;  3APF A;  4B8C B;  2L0T B;  4XI0 A;  3E30 A;  4EBA G;  1IHB A;  3Q4A B;  5AQA A;  3EHN A;  1KZO A;  5BV1 A;  4KMO A;  4GCO A;  3L17 A;  3UPV A;  1N54 A;  4ERS A;  3G2U A;  4D6E A;  2UY1 B;  4BET A;  5FTP A;  3CST A;  1MX6 A;  4EZJ A;  3FUM A;  3VLF A;  2E22 A;  3MV3 B;  3TXM A;  3Q47 B;  2J8S D;  3CLJ A;  1OWO A;  4HXI A;  2Y4T A;  1EDU A;  4KXK B;  2KXR A;  2QY7 A;  1Y8M A;  3B7U X;  3B7S A;  3FP3 A;  5KNH D;  4BSX A;  4BER A;  4CT4 A;  3TWQ A;  1Z3Y A;  2CHX A;  4EZL A;  1ELK A;  4D6J A;  3ULQ A;  5CED B;  4FLH A;  3B95 A;  2VSN A;  4U8V D;  3E34 A;  4UI9 J;  4KVO A;  3JYS A;  3PRZ A;  2E2E A;  5KNG A;  3ZYM A;  2Y69 E;  4UI9 K;  3SGH A;  1QYM A;  3FTX A;  4R7L A;  1QBQ A;  2KXP C;  1N7N A;  4U0S A;  2I1K A;  5CRU A;  2R02 A;  1JCR A;  2IFU A;  5EYP F;  2OND A;  2WMJ A;  4N2S A;  4C9B B;  3FUL A;  3V30 A;  4AV7 A;  4JB8 P;  4I6G A;  3UIP C;  3GZ1 A;  1ZU2 A;  4YDE A;  2X6K A;  2GRM A;  2Y4U A;  1TJF A;  3HHM A;  3P2B A;  4WND A;  1E96 B;  5II0 A;  4XEI G;  1H2V C;  2Q7F A;  3HXB A;  2VGX B;  1WDY A;  4GTS A;  4BWR A;  2DBA A;  4HRM B;  1V54 E;  3QK0 A;  3CHR A;  1N7Q A;  4GPK A;  2V5F A;  4N5C A;  1DCE A;  2NXP A;  5KJL A;  4DX2 A;  4RG6 A;  3OTN A;  4UWK A;  5BNW A;  3AG4 E;  5CMY A;  2F8Y A;  2WMF A;  3CK9 A;  4HB5 A;  5CHE E;  3ESL A;  3TGO A;  2P9U G;  4DLO A;  2VGE A;  2ZGD A;  3PZ1 A;  4TXQ A;  3SI5 A;  3O4Z A;  2HYZ A;  3KS2 A;  5AQ7 A;  5G05 J;  4F3V A;  4GTV A;  3AQF B;  3QOU A;  2ZU6 B;  3DPY A;  4NAC A;  2NSZ A;  3G2T A;  5ARF A;  1K8K G;  5G2N A;  3QJZ A;  4RLY A;  1O1S A;  2NYJ A;  5FZR A;  3URZ A;  5AAO A;  3ZUV B;  3IHY A;  3AS5 A;  2PQR A;  1Q2Z A;  3UMV A;  4A1S A;  4CDM A;  3EHQ A;  4XKC A;  5ARG A;  2C0L A;  2CHZ A;  2XGO A;  4RVB A;  4TV3 A;  4G8L A;  4JHK A;  4W9R A;  3C5R A;  2VSO E;  4N5Q A;  3RJV A;  3CVP A;  2AXU A;  5FJY A;  3T8M A;  4GYW A;  2J49 A;  3PH0 C;  2A5U A;  2R5S A;  1ZB1 A;  2GRR B;  2BED A;  3ENE A;  2KM4 A;  1QZ2 A;  4FLB A;  3TG5 A;  1DC2 A;  4YVO A;  1WG0 A;  3CVQ A;  3C98 A;  4LCT A;  2JNC A;  4E85 A;  3DEP A;  3L2J A;  3NOG D;  1JUQ A;  5FT9 A;  4NUR A;  1I8Q A;  4FJY A;  3J5P A;  2V0P A;  3BEE A;  3T8K A;  1ELR A;  3GYZ A;  2WMO A;  4URK A;  1HM3 A;  3FH7 A;  1OCC E;  3QAQ A;  5ENO D;  4DX5 D;  3ULE G;  4ME2 A;  5LOZ A;  2QC9 A;  3CHM A;  2VQ2 A;  2VYI A;  2GRQ B;  1BPO A;  4GTT A;  4EQF A;  4FP7 A;  4U95 D;  5JJ6 A;  3HXE A;  4DPR A;  3UIN C;  3G2V A;  1E90 A;  1TNB A;  2WXQ A;  5ENT D;  2AJA A;  5HRY A;  2P2C P;  1CB8 A;  1NA0 A;  4L2Y A;  3IBE A;  4YDY A;  3Q73 A;  5ANL A;  3T9K A;  4CGV A;  3UX4 A;  4LUN U;  3UUX A;  5EX3 A;  1DCQ A;  4D8O A;  2I9C A;  3DBS A;  4I6E A;  4DK5 A;  3ZHE B;  3S7J A;  4EEC A;  3Q9U C;  4GYO A;  3RKV A;  1OWL A;  2XS1 A;  2FUL A;  3FH8 A;  2PZI A;  1N0Q A;  4G26 A;  2MYO A;  4XE0 A;  4BTB A;  5EX0 A;  3JQ1 A;  3WXX A;  3IOL A;  1Z3X A;  2WXH A;  3ZW3 A;  3Q7F A;  1W3Y A;  2ILR A;  2KXS A;  2L27 A;  4NRH B;  5LFA A;  3R7Q A;  3O48 A;  4I6J A;  3B7T A;  3ZYQ A;  3FU3 A;  3TWT A;  4AJW A;  4K5C A;  4CYM D;  4D1J A;  4C0M A;  3DRA A;  4HOR A;  1MJ0 A;  3QWP A;  3PE4 A;  3NAW A;  3CVN A;  2YHC A;  3AJI A;  1RWF A;  1KZP A;  4GMR A;  4LEU A;  4Q94 A;  1HU3 A;  5C1D A;  4OAV B;  2X6H A;  4UWG A;  3T5X A;  2OVF A;  2JND A;  3P1U A;  1H2U A;  1LD8 A;  3UM3 A;  3SQV A;  5JA4 D;  2CG3 A;  3SBS A;  1RW2 A;  2KZT B;  4P29 A;  4GMJ A;  4WWN A;  1HX8 A;  2WDA A;  4ANW A;  4U63 A;  3RO3 A;  4N3A A;  1OCO E;  3TWX A;  4N2Q A;  3MA5 A;  5B1B E;  2KZT A;  3HDX A;  3ZXS A;  5KWD A;  4DX6 D;  4UWL A;  2L6B A;  3KAE A;  2NC9 A;  4LNB A;  3L82 A;  3AU4 A;  5G04 J;  4GTR A;  3CQC B;  2H6I A;  4O6F A;  3CR3 A;  4XI9 A;  4FU3 A;  1HZ4 A;  4AM9 A;  3FUE A;  1FPP A;  3SNX A;  3MYV A;  4B89 A;  4BT8 A;  1F9G A;  3FHE A;  4LER A;  5LP0 A;  1NI1 A;  4J7W A;  3HXC A;  2ZXW E;  3QC1 A;  3G2S A;  3RRM B;  5BT1 A;  2OEV A;  3Q5M A;  5A23 A;  4JEH A;  4O1P A;  4AXH A;  2YHE A;  4G23 A;  1BLX B;  1HMW A;  3S2A A;  4UI9 C;  3IKO B;  3UQ3 A;  3KBT C;  2IO3 C;  5G55 A;  3FTV A;  5B3S E;  3PS6 A;  2CG2 A;  1TN7 A;  3TWR A;  3JCK C;  3JUE A;  3CVL A;  4PS7 A;  5EKQ D;  3RAU A;  3QWV A;  5EIB E;  2Q1F A;  4HI9 A;  4JXT A;  3NF1 A;  3VTX A;  1X1I A;  1OJO A;  4D72 A;  1H0A A;  4U0Z A;  5FIN A;  4LNU D;  2KC7 A;  3ASH A;  2BRV X;  5M72 A;  3ASG A;  2WXI A;  4D71 A;  4FHJ A;  2VJ8 A;  3K9I A;  2ZGG A;  4B94 A;  4AY5 A;  3FTW A;  2BRP A;  4WNE A;  4J8S A;  1MX4 A;  1K1A A;  2IEJ A;  5AJL A;  2I2O A;  4Y6W A;  5D2M C;  1XGW A;  1ELW A;  1MHQ A;  1RWG A;  4AOF A;  4XIF A;  3DSX A;  1H2T C;  3KSL A;  4G8K A;  4TUU A;  3QWW A;  3GW4 A;  1B89 A;  1A17 A;  1TNO A;  1SZA A;  3HG0 D;  3UD2 A;  3T5V A;  3DWL G;  3U9W A;  4CEM A;  2XGS A;  3FY4 A;  2LO6 A;  3L54 A;  5G05 C;  4I2W A;  3PUK A;  1X1J A;  2IJG X;  2WXN A;  4KZ0 A;  3L22 A;  4I2Z A;  2X38 A;  3CVU A;  2GW1 A;  2DZO A;  2WM9 A;  1Z5S C;  2H6F A;  4KBQ A;  2FEZ A;  2VSX E;  1EYH A;  3UXG A;  4G25 A;  3QB2 A;  4I1A A;  1Y6I A;  4BT9 A;  1MZC A;  3SD5 A;  4JW1 A;  3GZS A;  3ISM C;  4F1P A;  4HNA D;  3PEU B;  2XEH A;  3VTY A;  2XS8 A;  3ASO E;  4TRQ A;  2E0I A;  2J07 A;  1SA4 A;  1FT2 A;  4NQ0 A;  2UY1 A;  2WB2 A;  1S64 A;  4MKT A;  3D9O A;  1OUV A;  3MEK A;  1PC2 A;  1BD8 A;  1TN6 A;  3PRE A;  1H6P A;  4D6H A;  3EHR A;  3C59 A;  4BX8 A;  3DXK G;  3FWV A;  5A7D B;  4D6G A;  4JHJ A;  2I6H A;  4K5B A;  1HG5 A;  4YVQ C;  3RRU A;  4J8F A;  5FQ8 A;  4D6I A;  4L9P A;  2XEV A;  1E8X A;  3PDN A;  4D6F A;  4TUM A;  3G2W A;  1HM2 A;  2V8S E;  1OXJ A;  3LJ3 A;  1OCR E;  4AP2 A;  2EIL E;  5BW8 C;  3HRA A;  4FHK A;  3FTU A;  5BPP A;  1G3N B;  2PQN A;  2ETA A;  1JCQ A;  4F6R D;  1N11 A;  2WXJ A;  2RG8 A;  3CIA A;  2V4H C;  5JHA A;  1N95 A;  3TAX A;  1N7P A;  3FUF A; 
#chains in the Genus database with same CATH homology
 3QAQ A;  4MLP A;  1TJC A;  4GA2 A;  3EHT A;  4ME2 A;  5LOZ A;  1YA0 A;  3CHM A;  4M3O A;  2VQ2 A;  2R17 C;  2IOS A;  2VYI A;  3CVX A;  3CHQ A;  1FCH A;  3N7S A;  1X5B A;  1HG2 A;  1BPO A;  4HOS A;  2QFC A;  4HS2 A;  2LAH A;  1N52 A;  4A55 A;  4EQF A;  2J09 A;  2L9B A;  3CKC A;  4FP7 A;  5JJ6 A;  4DPR A;  5JJ7 A;  3G2V A;  4WWO A;  1E90 A;  4G2V A;  2HM8 A;  2C2L A;  2WXQ A;  5FQ7 A;  4FAD A;  4GCN A;  3NZS A;  4UQZ A;  2XPY A;  3MZL B;  4ANV A;  4ILH B;  1UJJ A;  4JVS A;  4APF A;  5D0O D;  1NA0 A;  4L2Y A;  3FUK A;  1FVF A;  3IBE A;  2VGX A;  5ENN A;  3RK6 A;  3S7D A;  1E7V A;  3UT7 A;  5ANL A;  3NZU A;  4KVM A;  3APC A;  2XPZ A;  4HFG A;  3CK7 A;  3LDZ A;  4CGV A;  3R7R A;  3UX4 A;  4XZ4 A;  4OVV A;  4CDN A;  4LUN U;  3MX3 A;  5KCM A;  3LPZ A;  2BF0 X;  2MRI A;  2VGY A;  3UUX A;  5EX3 A;  2LSU A;  3ZPJ A;  4D8O A;  2I9C A;  3DBS A;  3ASD A;  1VDY A;  3FU0 A;  4I6E A;  4DK5 A;  1S0P A;  3ZHE B;  3I4R B;  3LY7 A;  3S7J A;  3QAR A;  2V4L A;  3D9M A;  4AVX A;  4HVB A;  4JHR A;  4EEC A;  3OXL A;  3ESK A;  4GYO A;  4Y6C A;  1OWN A;  3RKV A;  1OWL A;  1UG3 A;  2WXG A;  3F59 A;  2FUL A;  3B13 A;  3D3M A;  1JPL A;  2PZI A;  3FH8 A;  4G26 A;  4JEU A;  1OWP A;  4XE0 A;  3SBT B;  4PH4 B;  4WUY A;  4BTB A;  5EX0 A;  3JQ1 A;  3WXX A;  3IOL A;  4J8E A;  1Z3X A;  5CMW A;  2BTD A;  2WXH A;  4APO A;  3ZW3 A;  5AJD A;  2AVP A;  3EHM A;  4LF3 C;  3PE3 A;  4RSY A;  4F1S A;  2ILR A;  2KXS A;  2L27 A;  2YNQ A;  4NRH B;  5LFA A;  1GW6 A;  3R7Q A;  2XGM A;  4BX9 A;  3LVQ E;  3O48 A;  4WNG A;  4I6J A;  3B7T A;  1XNF A;  3BG0 B;  3CQG B;  4JA7 A;  3ML8 A;  4J6I A;  3ZYQ A;  3U66 A;  2DCP A;  2I1J A;  3FU3 A;  4AJW A;  4WNF A;  5FQ6 A;  5A6C A;  4GAA A;  2GGF A;  4C0M A;  4HOR A;  3FUI A;  3QWP A;  1EF1 C;  4PS3 A;  5BUZ A;  3PE4 A;  3CEQ A;  3CVN A;  4V3I A;  4HLE A;  3LY9 A;  3I5P A;  3JQ0 A;  5T8I A;  3FTY A;  3LS8 A;  2YHC A;  4CDR A;  3MV2 B;  2OOE A;  3PUJ A;  4GA0 A;  4LEU A;  1P5Q A;  3MKQ B;  3S7B A;  1FVH A;  4Q94 A;  2IQC A;  3ZYL A;  2BUG A;  5FZQ A;  2LNI A;  2L6J A;  2LSV A;  3EHS A;  3CKB A;  1JWG A;  2J4B A;  5CCM A;  3OAW A;  2AXV A;  3FTZ A;  4GU5 A;  3UT8 A;  1HU3 A;  5C1D A;  5G04 C;  2X6H A;  4I1O B;  4ILG A;  4UWG A;  4MS6 A;  4FA6 A;  4A3V A;  3MKQ A;  1E8Y A;  4XKB A;  3T5X A;  2OVF A;  2JND A;  3P1U A;  1SZ9 A;  1H2U A;  3LCA A;  2Y3A A;  4L1B A;  4N39 A;  4U07 A;  3IEG A;  2XPI A;  1HO8 A;  2CG3 A;  3SBS A;  5BV0 A;  1UJK A;  4ATG A;  2KZT B;  4P29 A;  1IQU A;  1HXI A;  4GMJ A;  4WWN A;  3U64 A;  1HX8 A;  3L16 A;  4GB9 A;  4AIF A;  4B8A A;  1NZN A;  1LF8 A;  5C2Y A;  3IV0 A;  2AW6 A;  3B7R L;  1UW4 B;  4U63 A;  4ANW A;  5J08 A;  2GRL A;  4U04 A;  1DVP A;  4PUC A;  3KEZ A;  3RO3 A;  4JZY A;  5KJN A;  5LCW C;  4DLQ A;  4N3A A;  2WXP A;  4N2Q A;  4JA9 A;  3MA5 A;  4ANX A;  3E4B A;  2KZT A;  3HDX A;  3ZXS A;  2WVI A;  1WM5 A;  2XRY A;  4N3B A;  3HVE B;  4UWL A;  2KCL A;  1OWM A;  2OVB A;  3KAE A;  2CFU A;  2NC9 A;  4I17 A;  4KYO B;  3EIJ A;  3N71 A;  1U34 A;  3IHV A;  4PS8 A;  3AU4 A;  2WQH A;  2HR2 A;  5G04 J;  2WXF A;  4I43 A;  4FUL A;  3CQC B;  3ZEF A;  2XCB A;  4UQX A;  3SHF A;  4I9C A;  2FO7 A;  3DPD A;  3H3G A;  2X6I A;  5JHB A;  4O6F A;  4YND A;  3CHP A;  3CR3 A;  4XI9 A;  3HVE A;  4Q69 A;  4FU3 A;  1HZ4 A;  4AM9 A;  1ZBP A;  3LXU X;  3FUE A;  3ONK A;  2VSY A;  3QKY A;  4EPZ A;  1E8Z A;  3SNX A;  3SFZ A;  3MYV A;  4B89 A;  1HE8 A;  3APF A;  3MJW A;  4BT8 A;  4ILI A;  1UN9 A;  3FHE A;  4B8C B;  3EIQ C;  2L0T B;  4LER A;  2IOL A;  4XI0 A;  5LP0 A;  2JOD A;  3CVY A;  4EBA G;  2DIW A;  3MCX A;  5LCW J;  3Q4A B;  3EHN A;  1SQM A;  4H7X A;  1E8W A;  5BV1 A;  2FI7 A;  3CHS A;  3FUD A;  4KMO A;  4GCO A;  5DBK A;  5ANR A;  4CRW A;  3C5T A;  3QC1 A;  3L17 A;  3Q49 B;  3N7R A;  3UPV A;  5E76 A;  3D9P A;  4ACK A;  1U3D A;  1IQR A;  3G2S A;  4QFV A;  3RRM B;  5BT1 A;  3I4G A;  3Q5M A;  2MOW A;  5A23 A;  4JEH A;  2CFZ A;  4HOU A;  2C0M A;  1N54 A;  3OXG A;  4AXH A;  2YHE A;  4DI3 A;  4ERS A;  3LVR E;  4G23 A;  1DNP A;  2P58 C;  3S2A A;  3G2U A;  4UI9 C;  3ZHE A;  2UY1 B;  3IKO B;  3S7F A;  3CVW A;  3UQ3 A;  3KBT C;  5FTP A;  3CST A;  4KZC A;  2WQ6 A;  5G55 A;  3FTV A;  3CV0 A;  4G24 A;  4IYP A;  4EZJ A;  3PQI A;  3FUM A;  3PS6 A;  3VLF A;  2CG2 A;  3MV3 B;  4F7A A;  3TXM A;  1KLX A;  4GYY A;  3Q47 B;  4OYS A;  4JPS A;  2WXR A;  3CLJ A;  3ZGQ A;  1OWO A;  3MKR A;  5KJK A;  4HXI A;  2Y4T A;  2KAT A;  3JCK C;  3D9I A;  1EDU A;  4KXK B;  3CVL A;  2KXR A;  5FZS A;  4PS7 A;  5EKQ D;  1H6K A;  2QY7 A;  1Y8M A;  3B7U X;  3B7S A;  3QNK A;  3FP3 A;  3QWV A;  4BSX A;  3FEX A;  1EPU A;  3TG4 A;  4C0E A;  4JXT A;  3RO2 A;  2PL2 A;  3NF1 A;  3VTX A;  4CT4 A;  1U3C A;  3ZRH A;  1Z3Y A;  2CHX A;  4EZL A;  3PVL A;  1ELK A;  3ULQ A;  1H0A A;  4N3C A;  4L23 A;  4U0Z A;  4FLH A;  3LY8 A;  4OVU A;  4JC8 A;  2VSN A;  2KC7 A;  4BTA A;  3ASH A;  3D9L A;  4UI9 J;  5M72 A;  3L6A A;  5AIJ A;  3ASG A;  2J4D A;  2WXI A;  4KVO A;  4ZGM A;  3FUN A;  4HJ0 A;  4FHJ A;  3JYS A;  2VJ8 A;  3PRZ A;  1W3B A;  3D9J A;  4IN3 B;  2E2E A;  3ZYM A;  5JJT A;  4K0R A;  4I1M A;  2AXZ A;  3K9I A;  3UT4 A;  4UI9 K;  3SGH A;  1E7U A;  2FBN A;  4B0Z A;  4Q96 A;  4B94 A;  3KBU C;  3D9K A;  3FTX A;  4R7L A;  3FTW A;  3RIB A;  3FFL A;  4L7T A;  4AY5 A;  5T3R A;  1QQE A;  4DJA A;  4H7Y A;  2JLB A;  4WNE A;  4J8S A;  4KT6 B;  4U0S A;  2I1K A;  1MQS A;  5AJL A;  2I2O A;  2YQ8 A;  4Y6W A;  3ZN3 A;  3SF4 A;  1XGW A;  3JUI A;  3CHO A;  2X6J A;  3ASF A;  1ELW A;  3D9N A;  1MHQ A;  3FTS A;  3AS8 A;  2IFU A;  4FC8 A;  4AOF A;  4XIF A;  3EHU A;  1H2T C;  1JWF A;  2OND A;  3FUJ A;  3ZFW A;  3ZVV A;  4TUU A;  2WQ7 A;  3QWW A;  3RU0 A;  3GW4 A;  1B89 A;  4BY6 A;  1A17 A;  1SZA A;  3MGB A;  4N2S A;  1L5J A;  4C9B B;  3FUL A;  2EQX A;  2WPV A;  2WXM A;  3UD2 A;  4GZC A;  3HIZ A;  3T5V A;  1H19 A;  5FQ4 A;  4AV7 A;  3U9W A;  4I6G A;  3U4T A;  4CEM A;  4DI4 A;  3GZ1 A;  5CCL A;  2L0I A;  1ZU2 A;  4HOQ A;  2X6K A;  2XGS A;  3FY4 A;  2GRM A;  2Y4U A;  1TJF A;  2XDG A;  2KCV A;  2LO6 A;  3HHM A;  3P2B A;  4WND A;  1E96 B;  2MHK A;  3PNL B;  5II0 A;  3L54 A;  5FWQ A;  4D10 C;  5G05 C;  3VLD A;  2A4Z A;  1H2V C;  2Q7F A;  4I2W A;  3PUK A;  3LEW A;  2IJG X;  2VGX B;  2WXN A;  2X6F A;  4A3T A;  4KZ0 A;  3FH5 A;  3L22 A;  3NQP A;  3PEV B;  4I9E A;  3ML9 A;  4I2Z A;  2DBA A;  4G11 A;  4BWR A;  3FU6 A;  2XCC A;  4MRU A;  2HO1 A;  3QK0 A;  2X38 A;  1KT1 A;  3OXF A;  3CHR A;  4F53 A;  3CVU A;  2KCK A;  4GPK A;  2V5F A;  4N5C A;  2GW1 A;  4EZK A;  4WWP A;  2NXP A;  2WM9 A;  5KJL A;  3ONL A;  2XQ0 A;  3EJN A;  4E6H A;  4RG6 A;  3OTN A;  1NA3 A;  3L13 A;  4GZ6 A;  4UWK A;  5BNW A;  1Z6T A;  4KBQ A;  3RRN B;  2FEZ A;  4CT0 A;  1IYG A;  5CMY A;  2M63 A;  2VSX E;  4U8H A;  1EYH A;  3CK9 A;  2CHW A;  4G25 A;  3QB2 A;  2J9Q A;  4GZD A;  4GZ5 A;  4I1A A;  5CHE E;  4CCA A;  2RD0 A;  3ESL A;  4CGW A;  3TGO A;  3HYM B;  2IF4 A;  3CSF A;  4JL0 A;  1Y6I A;  3AU5 A;  4DLO A;  4BT9 A;  2JEK A;  4GZ3 A;  4IUL A;  3TXN A;  3GZ2 A;  3SD5 A;  3SI5 A;  3O4Z A;  4JW1 A;  2HYZ A;  3KS2 A;  3GZS A;  2QKH A;  3L08 A;  3PEU B;  5G05 J;  4F3V A;  3AQF B;  3FUH A;  3QOU A;  4GA1 A;  2R59 A;  2ZU6 B;  3VTY A;  3ZIM A;  3C4M A;  4NAC A;  1HF8 A;  2NSZ A;  4J8D A;  3G2T A;  5ARF A;  4ACL A;  5LX8 A;  5G2N A;  3QJZ A;  2XHE A;  5J90 A;  5HQ8 A;  2ION A;  4TRQ A;  2E0I A;  2J07 A;  2WB2 A;  4NQ0 A;  2UY1 A;  3LYA A;  1NP7 A;  4G1T A;  3Q15 A;  2PM6 A;  5FZR A;  3URZ A;  4MKT A;  1IHG A;  3D9O A;  1OUV A;  3MEK A;  4UWF A;  3IHY A;  3AS5 A;  2PQR A;  4ABN A;  1PC2 A;  1HH8 A;  3UMV A;  4A1S A;  4CDM A;  4L2L A;  3PRE A;  4XKC A;  2WMN A;  5ARG A;  3QDN A;  4K03 A;  2C0L A;  2CHZ A;  2XGO A;  4RVB A;  4TV3 A;  2X3M A;  3C59 A;  2IU1 A;  3AS4 A;  4JHK A;  4BX8 A;  3R9A B;  3LKU A;  3QR8 A;  3PNT B;  4IRU A;  4EBA A;  4W9R A;  3CGH A;  3CVV A;  2VSO E;  1WAO 1;  3FWV A;  5A7D B;  3RJV A;  3CVP A;  2OV8 A;  2YIN A;  4BFR A;  4A1G A;  2AXU A;  5FJY A;  3BG1 B;  4JHJ A;  4UWH A;  1HS6 A;  5DIZ A;  3U3W A;  2I6H A;  5AEN A;  1UN8 A;  1INZ A;  1HG5 A;  2FF4 A;  3FDH A;  4YVQ C;  3T8M A;  3RRU A;  4J8F A;  4GYW A;  2J49 A;  3FU5 A;  3PH0 C;  5FQ8 A;  4ANU A;  4LRZ A;  2A5U A;  2R5S A;  3N7P A;  1HFA A;  1WY6 A;  2XEV A;  2J08 A;  1E8X A;  3PDN A;  2LAI A;  4UQY A;  4RG9 A;  4AY6 A;  3G2W A;  3UD1 A;  3ENE A;  2KM4 A;  2V8S E;  4XX5 A;  1QZ2 A;  4FLB A;  2WXO A;  3LJ3 A;  4U0U A;  2VTB B;  5EDS A;  3TG5 A;  4HOT A;  4YVO A;  5HI7 A;  3CVQ A;  3C98 A;  4LCT A;  3TL5 A;  5E75 A;  2JNC A;  2UWJ G;  3APD A;  4E85 A;  4AP2 A;  3L2J A;  3CK8 A;  3ZYK A;  1JUQ A;  5BW8 C;  5FT9 A;  2XRZ A;  4NUR A;  5AYW D;  4FHK A;  1PAQ A;  3FTU A;  5BPP A;  4FJZ A;  4GML A;  2AWI A;  3PZD A;  3SZ7 A;  4PDX A;  2WXK A;  1KT0 A;  2PM7 A;  2WXL A;  4FJY A;  2PQN A;  5T4Y A;  2V0P A;  1TEZ A;  3BEE A;  2VTB A;  1PY1 A;  3FEY A;  4WAF A;  3VLE A;  4AEZ C;  1ELR A;  2WXJ A;  3GYZ A;  5D0Q D;  2RG8 A;  3CIA A;  3EDT B;  3KD7 A;  2WMO A;  5JHA A;  4URK A;  1QNF A;  3FH7 A;  3I3N A;  5KJM A;  3TJP A;  3TAX A;  4J0U A;  3FUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...