4DLOA

Crystal structure of the gain and hormr domains of brain angiogenesis inhibitor 3 (bai3)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
359
structure length
351
Chain Sequence
PAPYEICPEDYLMSMVWKRTPAGDLAFNQCPLNATGTTSRRCSLSLHGVAFWEQPSFARCISNEYRHLQHSIKEHLARMLAGDGMSQVTKTLLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYIPASDGVQNFFQIVSNLLDEENKEKWEDAQQIYPGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFPMKGRKGMVDWARNSEDRVVIPKSIFTPVSSLDESSVFVLGAVLYKNLDLILPTLRNYTVINSKIIVVTIRPEPKTTDSFLEIELAHLANGTLNPYCVLWDDSESLGTWSTQGCKTVLTDASHTKCLCDRLSTFAILAQQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Brain-specific angiogenesis inhibitor 3
publication title A novel evolutionarily conserved domain of cell-adhesion GPCRs mediates autoproteolysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 106
structure length 351
sequence length 359
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01825 GPS GPCR proteolysis site, GPS, motif
A PF02793 HRM Hormone receptor domain
A PF16489 GAIN GPCR-Autoproteolysis INducing (GAIN) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.610 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4dloA02
2.60.220.50 Mainly Beta Sandwich Chondroitinase Ac; Chain A, domain 3 Chondroitinase Ac; Chain A, domain 3 4dloA03
4.10.1240.10 Few Secondary Structures Irregular Hormone receptor fold GPCR, family 2, extracellular hormone receptor domain 4dloA01
2JODA 5II0A 3IOLA 3C59A 4DLOA 1U34A 4HJ0A 3L2JA 2L27A 2JNDA 3N7SA 3EHSA 2JNCA 4ERSA 4ZGMA 3EHTA 4LF3C 4DLQA 2XDGA 3C4MA 3AQFB 3EHUA 3C5TA 2QKHA 3H3GA 3N7PA 3N7RA
chains in the Genus database with same CATH superfamily
4TXQA 1OUVA 3C3RA 4ZHBA 2XGMA 2RKKA 2Y69E 3UT8A 2BF0X 2ZXWE 5DIZA 3ABLE 4G11A 4XI9A 4AJWA 2IQCA 3J5PA 1UG3A 2IY0C 4L7TA 4LEUA 1MZCA 4PUCA 4Q94A 3CSTA 4OAVB 4JD2G 3O4ZA 2YHCA 4WNDA 2GRLA 1RZ4A 4HOSA 4NRHB 3L13A 3N71A 3P2BA 2RG8A 2L6BA 4XI0A 4D1JA 3G2TA 4CGVA 2HM8A 1E7VA 3PS6A 3MYVA 2OVBA 4GZ3A 3IOLA 2ONDA 2CFZA 1LD8A 4F3VA 1O5MA 3UM2A 1MX4A 1KT0A 1B89A 4JXTA 4UI9C 3PNTB 2P9KG 4GZCA 2JLBA 1OWLA 5CEAA 3DSSA 2OEWA 2GROB 3B7TA 3FTWA 4LNBA 4Q96A 1KLXA 3SY2A 4GZDA 5JMND 5AJDA 3UIPC 2Q1FA 2ZIRA 5CMWA 2P9NG 4UUCA 3KD7A 4TRQA 3CHMA 2JABA 3ASNE 4NURA 2PQNA 3CHSA 2KZTB 4IN3B 2X03A 3PZ1A 1INZA 4A3VA 3DXMG 3F59A 5KNHD 5BPPA 3SFYA 2KCVA 3ULEG 3TJPA 1Y6IA 5ARGA 3NOGD 3IEGA 4GYOA 1NZNA 4ABNA 5FWQA 3R9AB 2I1JA 1DCEA 5JJ7A 2J09A 3GZSA 2XZDG 2FULA 3W9FA 1H2VC 5HQ8A 2H6GA 2WXKA 3NZSA 2IU1A 5AN8A 3D9HA 1K8KG 2JNDA 4B89A 5LCWC 3P1UA 1WG0A 4LSZE 4D6CA 2KCKA 3Q4AB 1PC2A 3ZKJA 1YCSB 3R7RA 3FY4A 4A1SA 1D9SA 2EILE 2WQ6A 2I6HA 3CGHA 1MX6A 1JCQA 3RU0A 4GA2A 3LVRE 2XEHA 4LNUD 4DLOA 3CVXA 1N54A 2VGXA 3FUDA 3QC1A 4J8DA 1TN7A 5CERB 2B6CA 2WDAA 1SVXA 1OT8A 4DJAA 3UINC 3ZYLA 4BT8A 2JNCA 2XENA 3MZLB 1A17A 3I5PA 4HORA 3DSXA 1TN6A 4R7LA 2I2OA 1TNYA 2DZOA 3B13A 1QQEA 3TWXA 4GMLA 5BNWA 3UMVA 2AWIA 3FU3A 2HO1A 4GPKA 3E34A 1OWPA 4I17A 3DWLG 3IBEA 5JJ6A 2QKHA 4N5QA 2A5UA 4BSXA 4J6IA 3SF4A 5FIOA 2IEJA 3TWSA 3ZEFA 3AJIA 1LD7A 3SI5A 2DCPA 4HI9A 3FU5A 1JPLA 1O1TA 3FH8A 1V54E 4UWKA 3B7SA 2AXUA 3RK6A 4U95D 4HNAD 2WM9A 5E76A 3FUIA 1L5JA 3U4TA 2PQRA 2WXRA 4TUMA 4AVXA 4J8YA 3Q78A 4GTMA 2IO3C 3N7PA 4ILGA 4CRWA 3L2JA 4I2ZA 3I4GA 3SFZA 3S7JA 2BUGA 4J7WA 2CHXA 3UIOC 3FWVA 4I6GA 1K3ZD 1NA0A 4CEMA 3D9IA 2IFUA 1UN9A 4HLLA 4HOQA 4M7CA 2X6FA 4FADA 3UPVA 2J07A 2FO1E 2BRWA 3MV2B 3ML8A 3IXEA 5FQ6A 5A23A 5KJKA 1X1HA 5BW8C 1P5QA 3CVPA 5CEDB 3ZPJA 3PH0C 1U3DA 2IJGX 2R5SA 3S7FA 1MX2A 2BRPA 3FTUA 3CVUA 1LF8A 5ANLA 4JZYA 3RKVA 1S0PA 5ENTD 1N11A 1N7NA 4XE0A 1O1SA 1EF1C 5D2MC 5CRUA 4JHKA 1BPOA 3Q75A 4JB8P 3PE3A 1BI7B 3SZ7A 1WM5A 4A3TA 4ANWA 4GTQA 3AG4E 2XS8A 3EDTB 5G05J 5AAOA 2WMIB 3LY7A 4ME2A 4I6JA 3ASHA 4I1MA 4NQ0A 5D0QD 3PZDA 3FHEA 4ATZD 1ELKA 4CT0A 4J8FA 3URZA 4D6EA 3S7BA 4HOTA 2J4BA 2GW1A 3ML9A 2DYRE 1SA4A 2DYSE 5LFAA 3Q7AA 4TXRA 3JQ0A 1DCQA 3MA5A 5FQ8A 5ENQD 4XKCA 3FUNA 1JWGA 1LXMA 4YVQC 3JQ1A 1KT1A 4JHRA 2EIJE 1J0NA 3AG2E 1QYMA 3ASOE 1PY1A 3HVEB 4UQXA 4JEHA 2OV8A 1OJOA 3DSUA 2IOLA 4GZ6A 3L54A 3IHYA 5EIDA 4BY6A 3Q79A 4V3IA 3FULA 3LCAA 3GZ1A 3PQIA 3CK8A 2ZU6B 3CVVA 4XX5A 4G8LA 5LX8A 3PVLA 1QNFA 4A1GA 2CFUA 1DNPA 2NC9A 4LNGA 1HMWA 5BXOA 1FVHA 4J8EA 5EDSA 3OAWA 5KCMA 4FP7A 4CGWA 4HOUA 2WXPA 2MHKA 1HZ4A 1Z3XA 3FTXA 3VTXA 4MKTA 3ESLA 2GRRB 3JXIA 4C48B 3CQCB 3CIAA 4LCTA 5EILA 2F8XK 4O1OA 5IY5E 5KJNA 2VSYA 3D9NA 1X1IA 1MYOA 5II0A 5G55A 2IF4A 2FBNA 5HS0A 5KWDA 2BTDA 1V55E 1KPSB 3HIZA 1HG2A 5G04J 4CDNA 3CEQA 2KATA 3TAXA 1DC2A 3ZVVA 2BKKB 2GRMA 4PH4B 1TYQG 2J08A 3VLDA 3QK0A 3N7RA 4CZ2D 1HM2A 3HXEA 2P9LG 3SGHA 4YDWA 1NP7A 1TEZA 1MQSA 3L6AA 4XIFA 2X3MA 1SW6A 4B0ZA 3FTYA 3KSLA 2XPZA 5ENRD 2V5FA 3TWTA 4RLYA 5BV0A 5ARFA 3E30A 2PZIA 4D10C 4OVVA 3CQGB 3PRZA 5FINA 4XZ4A 1I8QA 4GB9A 2X6KA 1JCSA 2QYUA 3TWWA 4RG6A 1ZB1A 2Y4TA 5T8IA 2GRQB 3T8KA 2WMKA 2H6HA 3CV0A 3LJ3A 4RQIA 3V31A 3ZW3A 1HH8A 2XRZA 3EHMA 1EDUA 3EHRA 2LO6A 3CVNA 1MJ0A 1X81A 2BEDA 2P2CP 2R05A 4G8KA 2KZTA 4APFA 1IXVA 5HKPA 2OCCE 3LKUA 4AV7A 3Q47B 1N4SA 4K03A 4JW1A 1F9GA 4QQIA 4APOA 1AP7A 1QBQA 2H6IA 3E32A 1S64A 4Z68A 3U64A 3T9KA 3D9OA 3QDNA 2FO7A 1NFIE 2L6JA 2EIKE 5FJYA 1H2UA 4DLQA 4OAUC 2LAHA 4D72A 3ZUVB 4U8VD 4N39A 3Q5MA 2WCOA 2ILRA 1E8ZA 5FZRA 4G2VA 3FEYA 4YDYA 5JA4D 4U0UA 2WQHA 5HRYA 4FHJA 5EYLA 2C2LA 1OCZE 3Q49B 1TNUA 1HMUA 5EYPF 3FU6A 2A4ZA 2X6HA 2RD0A 3EUVA 2XZTG 4WWPA 3S7DA 4K5CA 4RSYA 5BT1A 4CYMD 1X1JA 1O1RA 4FULA 2R59A 2L9BA 3B7RL 2PL2A 1N7PA 1YMPA 4BSZB 4U04A 3C5TA 5CCMA 3TL5A 1NA3A 4P29A 2VQ2A 4HRMB 4J0UA 4L23A 4CCAA 3BUAA 3D3MA 2LAIA 5E75A 3UKRG 3G2WA 3JXJA 4OVUA 3FUFA 5HI7A 4LG6A 1IQUA 2EIME 5G05C 1HU3A 3CKBA 3D9KA 5FZSA 1HM3A 2P9IG 4LUNU 2DIWA 1TNBA 2GGFA 1N94A 1K1AA 3ZU7B 2XCCA 3UM0A 1GW6A 3L82A 4MS6A 1BU9A 3RRUA 3G2VA 3U7VA 4ILIA 3CSFA 3ZXSA 3V2OA 2WXGA 2WXHA 3QNKA 1RWCA 3MKQB 3NQPA 1HN0A 3DPDA 3OXGA 4DX2A 4HBDA 3DEPA 2XQ0A 5AENA 2ETAA 4GTSA 1PAQA 4ACLA 3RRNB 3UT4A 3EHUA 4C9BB 5J90A 5CCLA 3G2SA 4FHKA 3CVYA 1Y8MA 4U96D 3FEXA 2WMNA 5ENPD 1EGUA 3X2QE 1HE8A 3FUKA 3GZ2A 2LSUA 3UX4A 2XDGA 2WXOA 1N7RA 2UWJG 3R7QA 2MYOA 3FH5A 1U34A 1XGWA 5KBAA 4HVBA 3JYSA 5JJTA 2KCLA 3TXNA 4DI3A 1HXIA 1IHBA 3VTYA 2OVFA 1ZU2A 3FUEA 3NOCD 4XEIG 4FLHA 3AU5A 4AIFA 5B1AE 4AXHA 3EU5A 4K5AB 2LUHA 3AU4A 2KM4A 5G04C 4EZJA 4I9CA 5AQBA 3EJNA 3SBTB 4DX1A 2B0OE 2DZNA 2XHEA 1H6KA 4HQDA 4F7AA 4GU5A 1LXKA 3BEEA 4TUUA 3IV0A 3FTZA 3DSVA 1A5EA 3OTNA 2VSXE 1UJKA 2F37A 4ATGA 3C4MA 1UW4B 2P9UG 3V30A 2L0IA 3TGOA 3CVWA 4EHMA 3L17A 3ZYMA 1HS6A 5M72A 1ZBPA 4HJ0A 3ZRHA 2WMIA 4GCNA 4N3BA 2VSOE 3BQOA 2EINE 3HG0D 5CMYA 2MRIA 2PM6A 2V4LA 4BT9A 2GRNB 4EECA 2FI7A 2UY1B 5AIJA 1TNZA 3APCA 3GYZA 3EHNA 1H0AA 3C3QA 3PEUB 3KBUC 3QARA 3PE4A 4BX9A 4EQFA 4U7EB 3AQFB 4BETA 3HVEA 3LY9A 4JA7A 4GA1A 2BRVX 4KBQA 1Z3YA 4F1SA 2KXRA 4DRXE 1OCOE 3FUHA 3WXXA 1J0MA 3NF1A 1W3YA 3F6QA 3KEAA 4GAAA 3AAAC 1RWAA 1YYHA 3MJWA 3LS8A 3HXDA 4BESA 4DX5D 2GRPB 3RIBA 4AEZC 3NZUA 3VLEA 5FT9A 2DWZA 4RVBA 1Z6TA 3APDA 5EN5D 4U63A 1LTXA 1SA5A 2YQ8A 4D6JA 1N0QA 3UQ3A 2RFMA 2VGEA 2WMGA 3SFXA 3EIJA 1D8EA 1K1BA 1X5BA 3HXCA 4GTRA 2ZGGA 4KZCA 3V79K 3UD2A 2QFCA 4M3OA 2QC9A 4WWNA 4IRUA 4Y6CA 2J49A 3TWVA 4PS7A 3MX3A 3T5VA 4DK5A 4UWHA 1RWGA 3E33A 3TG4A 2KBXA 2NSZA 4LF3C 2PM7A 4O60A 3RSEG 4GMJA 1TNOA 3BU8A 3APFA 3MCXA 1CB8A 3QB2A 4EBAG 4I1AA 4BTAA 5ITZF 1IQRA 3DXKG 1OJMA 4GPMA 3HXBA 4WNEA 4I43A 4DX6D 2CHZA 1NL4A 3L22A 4D6DA 4GZ5A 4WNFA 2CG3A 5LOZA 5CBOA 2ZGDA 4RG9A 4IULA 3U9WA 4HI8A 4WWOA 3WG7E 2WXLA 1D8DA 1E96B 3SHFA 3AG3E 3KEZA 1S70B 1U3CA 4CT4A 4JL0A 5FZQA 3QWPA 4D6IA 2PNNA 5EIBE 4D6FA 3PUJA 4PS3A 4L2LA 5A6CA 5T3RA 3O48A 1WY6A 3ZNGA 3FUMA 4HRNA 3E37A 1OXJA 5G2NA 3KS2A 2V8SE 1E8YA 3R9MA 4MLPA 2OEVA 4FLBA 4K0RA 1BD8A 1N95A 4JVSA 4H7YA 4UWGA 2VSNA 1HF8A 3PNLB 5AQAA 5EKQD 4C0MA 3ONKA 4L2YA 3C72A 4Y6WA 2NXPA 1KZPA 5BXUA 4CDMA 2VTBB 2X6IA 3NBNB 2HYZA 3L16A 3C3OA 4FJZA 4D6HA 3AS8A 1N4RA 3UM1A 1RW9A 1E8XA 1YA0A 4AY5A 3Q9NC 3KSQA 4GYYA 3DRAA 4G1TA 1TJFA 2WPVA 3HRAA 4JEUA 1E8WA 4U07A 1S63A 4HXIA 4I2WA 5KJMA 2WVIA 2E22A 5JHBA 2XRYA 1TR4A 1N4PA 4D71A 5ANRA 3ENEA 2I1KA 1FT2A 2WMHA 4ZFHA 1U2VG 3MEKA 2RFAA 1BLXB 1OWOA 3CVLA 4NACA 2H6FA 4DX7D 3B7BA 5B1BE 3UKUG 1VDYA 4BEPA 3KBTC 3ULYA 4DI4A 2XPYA 3I3NA 4LRZA 2WXIA 2AVPA 3RRMB 4KYOB 4G26A 4ANVA 3TWQA 3MGBA 3Q15A 4F53A 4UI9K 4JA9A 4W9RA 3ZHEB 4GCOA 2Q7FA 3LPZA 2E0IA 5C1DA 3AG1E 3PEVB 2L0TB 4FJYA 3D9MA 3U3WA 3ZGQA 2LXMA 4GA0A 3DPYA 2ZISA 4GYWA 4DUIA 3TWUA 4MBGA 3EHTA 2WMFA 3AS4A 5AQ7A 4GTVA 4A63B 2Y1LE 4UQZA 2AXZA 4KVMA 5BUZA 4JPSA 4PDXA 2P9PG 4BTBA 3PZ2A 3SBSA 4WUYA 2WXJA 1C82A 1SZAA 1LOHA 3ZYKA 2R17C 5C2YA 3MKQA 4ILHB 4G24A 1IKND 2R2LA 3W9GA 4EBAA 4YNDA 2F8YA 2QY7A 3RO2A 4TV3A 4AOFA 1N7OA 3B7UX 1HFAA 4JC8A 4U0ZA 3C59A 2DBAA 3CHOA 1HO8A 4A55A 2P58C 3UXGA 4B8CB 4AY6A 2V0PA 2HE0A 4D8OA 2V5QC 4G23A 3K9IA 1IYGA 2F0YA 2CHWA 2EQXA 2KXPC 1FCHA 1NI1A 2YHEA 3ONLA 3UT7A 3T8MA 3IHVA 1E90A 1OY3D 3ESKA 4NIKA 3ISMC 3UD1A 4ERSA 2VJ8A 1EYHA 5CBNA 2X6JA 3H3GA 4YDEA 3VLFA 3Q7FA 3UUXA 4AM9A 3JUIA 2NYJA 1OWNA 3FH7A 4N3CA 3PZ3A 4F1PA 2WB2A 3LYAA 4IYPA 1XNFA 5ENNA 4EZLA 3FUJA 3SNXA 4N2QA 2OOEA 4TXPA 2JODA 1H6PA 3JUEA 2Y0BG 1UJJA 2XGSA 3D9PA 2M63A 4HLEA 2LSVA 3IKOB 3LEWA 4WAFA 5ENOD 5CHEE 4X8QA 2WQ7A 3C5RA 2YNQA 3ABKE 5A7DB 2XEVA 3CLJA 1WAO1 3DSTA 3CVQA 4BERA 5CECB 2E24A 2C0MA 5BV1A 5FTPA 3TG5A 3TWRA 3ASDA 4E85A 4QFVA 4KT6B 5AARA 1N7QA 1F1SA 4ACKA 4B8AA 3SD5A 1FVFA 3CR3A 4KZ0A 4N3AA 2UY1A 5EX3A 3LY8A 3PUKA 2VGXB 4HRLA 3ZIMA 3CHRA 3S2AA 1OCCE 3UTMA 3LXUX 1FPPA 3EIQC 4GTPA 4UWFA 2LNIA 2L27A 3QWVA 4HS2A 1UOHA 3FP3A 4L1BA 5H7PA 3G2UA 1N9AA 3ZYQA 3ULQA 4GMRA 1N52A 3BG1B 3QJZA 1N4QA 3HXFA 4UWLA 1RWHA 2KXSA 2WXMA 2QYJA 4E6HA 1ELWA 4J8SA 4UI9J 4U0SA 2WMJA 4PS8A 5T4YA 1KZOA 1SZ9A 3Q73A 1TN8A 2WXQA 4ANUA 4JHJA 3HYMB 3B95A 2QZAA 4KMOA 3D9LA 3QKYA 4LERA 4KXKB 1JWFA 4O1PA 3LJNA 4H7XA 1Q2ZA 3CHQA 4GTTA 3RJVA 3ZXPA 4FA6A 4CDRA 3QWWA 3MV3B 2Y4UA 1MHQA 3ABME 4EZKA 3PREA 3ZFWA 2J4DA 2WXFA 1H2TC 5DBKA 4URKA 5D66A 4C0EA 4OYSA 4D6GA 3SQVA 4BWRA 5KJLA 2AW6A 4ZGMA 1WDYA 2E2EA 4DPRA 4B94A 5D0OD 3ASGA 1UN8A 1H6OA 3CKCA 1Z5SC 4YVOA 4G25A 3NAWA 4BFRA 4F6RD 3CK7A 1AWCB 2R02A 3CHPA 3EU9A 2JEKA 2XCBA 3DSWA 1HG5A 3AS5A 4HB5A 3JCKC 2ETBA 3BG0B 4Q69A 4KVOA 4WNGA 3PZ4A 1OJPA 2R03A 4I6EA 4AP2A 2XPIA 4I9EA 3N7SA 5LCWJ 3EHSA 5J08A 3D9JA 4UQYA 1OJNA 3QAQA 4FC8A 3FFLA 4ANXA 1EPUA 2A5EA 2FF4A 3FDHA 4FU3A 3L08A 1HX8A 4I1OB 4N5CA 4O6FA 2BKGA 2C0LA 3DBSA 5AYWD 2AXVA 3LDZA 1JUQA 2AJAA 4U8HA 1FT1A 4MRUA 4EPZA 3FTSA 2IOSA 3FTVA 4B93B 1QZ2A 3RO3A 2WMOA 4D1IA 5FQ7A 3OXLA 2XS1A 3C98A 2VTBA 1JCRA 3E4BA 2MOWA 5AQ9A 3UM3A 1BI8B 4HFGA 3Q9UC 2LXLA 2CG2A 5JHAA 3TXMA 4U8YD 2KC7A 1OCRE 2VYIA 3T5XA 5ENSD 4YDOA 2I9CA 2J9QA 4N2SA 2HR2A 1RW2A 3U66A 2YINA 1E7UA 3QOUA 2X38A 4K5BA 3L9TA 5KNGA 2FEZA 3RAUA 3ASFA 3MKRA 1OWMA 3NB2A 1N0RA 3PDNA 5AJLA 2ETCA 3ZN3A 4BX8A 4L9PA 5LP0A 3QR8A 1G3NB 1H19A 1ELRA 3KAEA 5CRVA 5EX0A 3UI2A 3CK9A 2IO2C 2J8SD 2V4HC 3OXFA 3FU0A 1IHGA 3LVQE 3DEOA 2IONA 5B3SE 2DVWA 1TJCA 2Y3AA 4XKBA 1DVPA 4GTOA 3V2XA 2P9SG 1W3BA 3ZHEA 2VGYA 3HDXA 3I4RB 1RWFA 3GW4A 3HHMA 3EHQA 2XGOA 3SO8A 1SQMA 5FQ4A 3J5QB 2WXNA 2XEEA
chains in the Genus database with same CATH topology
3ONLA 1OUVA 5FQ8A 3UT7A 4F7AA 4XKCA 4GU5A 3FUNA 3T8MA 2XGMA 3BEEA 3IHVA 1JWGA 1E90A 3UT8A 4YVQC 3JQ1A 1KT1A 2BF0X 4TUUA 3ESKA 3IV0A 3FTZA 4JHRA 3HVEB 1PY1A 4UQXA 3UD1A 3OTNA 4G11A 4JEHA 4XI9A 5DIZA 4ERSA 2VJ8A 1EYHA 2VSXE 1UJKA 4ATGA 2OV8A 4AJWA 2IQCA 3C4MA 2IOLA 1UG3A 1UW4B 4GZ6A 2X6JA 3H3GA 4L7TA 4LEUA 3L54A 2L0IA 3IHYA 3VLFA 3UUXA 4AM9A 4BY6A 3TGOA 3JUIA 3CVWA 4PUCA 3L17A 3CSTA 1HS6A 4Q94A 3ZYMA 4V3IA 5M72A 3FULA 3O4ZA 2YHCA 3LCAA 1ZBPA 1OWNA 4HJ0A 3FH7A 4WNDA 2GRLA 3GZ1A 3PQIA 4N3CA 3CK8A 2ZU6B 3CVVA 3ZRHA 4HOSA 4GCNA 4NRHB 4XX5A 2WB2A 4N3BA 2VSOE 5LX8A 3L13A 3N71A 3PVLA 3LYAA 3P2BA 2RG8A 1QNFA 4IYPA 4A1GA 1XNFA 5ENNA 4EZLA 3FUJA 2CFUA 4XI0A 1DNPA 2MRIA 5CMYA 3SNXA 2NC9A 2PM6A 2V4LA 3G2TA 4BT9A 4N2QA 4CGVA 1FVHA 2HM8A 4J8EA 5EDSA 1E7VA 2OOEA 3OAWA 5KCMA 3PS6A 2JODA 3MYVA 2OVBA 4FP7A 4GZ3A 4CGWA 3IOLA 4HOUA 2ONDA 2FI7A 2WXPA 4EECA 2CFZA 2MHKA 1HZ4A 2UY1B 1Z3XA 3FTXA 1UJJA 4F3VA 5AIJA 3VTXA 4MKTA 2XGSA 3D9PA 3APCA 3GYZA 2M63A 3EHNA 3ESLA 1H0AA 3PEUB 1KT0A 1B89A 2LSVA 4JXTA 4UI9C 3IKOB 3QARA 4HLEA 3KBUC 3CQCB 3PNTB 3LEWA 3CIAA 3PE4A 4GZCA 4LCTA 4WAFA 2JLBA 5CHEE 4BX9A 4EQFA 5KJNA 1OWLA 2VSYA 2WQ7A 3AQFB 3D9NA 3HVEA 3LY9A 4JA7A 4GA1A 2YNQA 4KBQA 5A7DB 1Z3YA 2XEVA 4F1SA 2KXRA 5II0A 5G55A 2IF4A 2FBNA 3CLJA 1WAO1 3B7TA 3FUHA 3WXXA 3FTWA 2BTDA 3NF1A 1KLXA 3CVQA 3HIZA 4Q96A 2C0MA 1HG2A 5G04J 4GZDA 4CDNA 5AJDA 5BV1A 3CEQA 4GAAA 5FTPA 3TG5A 2KATA 3TAXA 3ZVVA 3MJWA 5CMWA 2GRMA 3ASDA 4PH4B 3LS8A 3RIBA 4E85A 2J08A 3KD7A 4AEZC 3NZUA 3VLEA 4QFVA 3VLDA 5FT9A 3QK0A 3N7RA 4TRQA 4RVBA 1Z6TA 3CHMA 3APDA 4KT6B 4U63A 4NURA 2PQNA 3CHSA 2KZTB 3SGHA 4ACKA 4B8AA 2YQ8A 4IN3B 3SD5A 3UQ3A 1NP7A 3EIJA 1TEZA 1MQSA 3L6AA 4XIFA 2X3MA 1FVFA 4A3VA 1INZA 3CR3A 4B0ZA 1X5BA 3FTYA 2XPZA 4KZ0A 4N3AA 2UY1A 5EX3A 3F59A 2V5FA 3LY8A 3PUKA 2VGXB 4KZCA 3UD2A 2QFCA 4M3OA 4WWNA 3CHRA 3ZIMA 3S2AA 5BPPA 4IRUA 5BV0A 5ARFA 4Y6CA 2KCVA 3LXUX 2J49A 4PS7A 3EIQC 2PZIA 3MX3A 3TJPA 3T5VA 1Y6IA 4UWFA 4D10C 4OVVA 5ARGA 4DK5A 3IEGA 2LNIA 4GYOA 1NZNA 4UWHA 3CQGB 2L27A 3QWVA 4HS2A 5FWQA 3FP3A 3R9AB 4ABNA 3PRZA 3TG4A 4L1BA 2I1JA 4XZ4A 3G2UA 5JJ7A 2J09A 2NSZA 3GZSA 4GB9A 2X6KA 3ULQA 3ZYQA 4LF3C 1N52A 4RG6A 2FULA 2PM7A 3BG1B 4GMJA 1H2VC 2Y4TA 5T8IA 5HQ8A 3QJZA 3APFA 3MCXA 2WXKA 3QB2A 3CV0A 3LJ3A 3NZSA 2IU1A 4UWLA 4EBAG 3ZW3A 4I1AA 2WXMA 4BTAA 2KXSA 2JNDA 1IQRA 4B89A 1HH8A 1ELWA 4E6HA 4J8SA 2XRZA 5LCWC 3EHMA 4UI9J 1EDUA 3P1UA 4I43A 4U0SA 4WNEA 2CHZA 2LO6A 3CVNA 4PS8A 5T4YA 3L22A 4GZ5A 4WNFA 2CG3A 5LOZA 2KZTA 4APFA 2KCKA 3Q4AB 1PC2A 4CEMA 3R7RA 3FY4A 4A1SA 1SZ9A 2WXQA 2WQ6A 2I6HA 3LKUA 4AV7A 4ANUA 4JHJA 3HYMB 4RG9A 3CGHA 3Q47B 4IULA 3RU0A 3U9WA 4GA2A 3LVRE 4KMOA 3D9LA 3QKYA 4JW1A 4K03A 4WWOA 4DLOA 3CVXA 4LERA 4KXKB 1N54A 1JWFA 2VGXA 3FUDA 3QC1A 4H7XA 4J8DA 4APOA 2WXLA 3CHQA 4DJAA 3U64A 3ZYLA 4BT8A 3D9OA 3QDNA 2JNCA 2FO7A 3RJVA 1E96B 2L6JA 4FA6A 5FJYA 4CDRA 3QWWA 1H2UA 4DLQA 3MV3B 2Y4UA 3SHFA 4Q69A 3MZLB 1A17A 1MHQA 3KEZA 3I5PA 4HORA 2LAHA 4EZKA 3PREA 3ZFWA 2J4DA 4R7LA 1U3CA 4CT4A 4JL0A 2I2OA 2WXFA 1H2TC 5FZQA 3QWPA 4N39A 5DBKA 3Q5MA 3PUJA 3B13A 2ILRA 1E8ZA 1QQEA 4PS3A 5FZRA 4URKA 4G2VA 4GMLA 5BNWA 4L2LA 5A6CA 5T3RA 3FEYA 4C0EA 4OYSA 2AWIA 3UMVA 3FU3A 2HO1A 4GPKA 3O48A 1WY6A 4BWRA 3FUMA 5KJLA 2AW6A 4ZGMA 4U0UA 5G2NA 1OWPA 3KS2A 4I17A 2E2EA 2V8SE 2WQHA 4FHJA 3IBEA 4B94A 5JJ6A 4DPRA 1E8YA 5D0OD 2QKHA 4MLPA 3ASGA 2A5UA 4BSXA 1UN8A 4FLBA 4K0RA 4J6IA 2C2LA 3CKCA 3SF4A 3Q49B 4JVSA 4YVOA 4G25A 4H7YA 4UWGA 3FU6A 2A4ZA 2VSNA 1HF8A 2X6HA 3ZEFA 4BFRA 2RD0A 3PNLB 3CK7A 5EKQD 4WWPA 3S7DA 3CHPA 3ONKA 4L2YA 4RSYA 4Y6WA 4C0MA 2NXPA 5BT1A 2JEKA 2XCBA 3SI5A 4CDMA 2DCPA 3FU5A 4FULA 2R59A 1HG5A 3B7RL 2L9BA 1JPLA 2PL2A 3AS5A 2VTBB 2X6IA 3FH8A 2HYZA 4U04A 4UWKA 3C5TA 3L16A 5CCMA 3JCKC 3BG0B 3B7SA 1NA3A 4FJZA 4KVOA 3TL5A 4WNGA 4P29A 2VQ2A 4J0UA 4CCAA 3AS8A 4L23A 3D3MA 2LAIA 2AXUA 5E75A 3RK6A 4I6EA 3G2WA 2XPIA 4AP2A 4I9EA 4OVUA 1E8XA 1YA0A 2WM9A 4AY5A 5LCWJ 3FUFA 4GYYA 3EHSA 3N7SA 4G1TA 5J08A 1TJFA 2WPVA 5E76A 3FUIA 3D9JA 5HI7A 1L5JA 4JEUA 4UQYA 3U4TA 1E8WA 3QAQA 4U07A 1IQUA 4FC8A 2PQRA 3FFLA 4HXIA 4ANXA 4I2WA 5KJMA 1EPUA 2WVIA 2WXRA 2FF4A 2XRYA 5G05C 4AVXA 1HU3A 3CKBA 3D9KA 3FDHA 5FZSA 4LUNU 2DIWA 4FU3A 3N7PA 1H6KA 4ILGA 3L08A 5ANRA 4CRWA 1HX8A 2GGFA 3ENEA 2I1KA 4I1OB 4N5CA 4O6FA 3MEKA 3L2JA 2XCCA 5JHBA 1GW6A 1OWOA 2C0LA 4I2ZA 4MS6A 3DBSA 3CVLA 4NACA 5AYWD 3I4GA 2AXVA 3SFZA 3LDZA 3RRUA 3S7JA 2BUGA 3G2VA 1JUQA 4U8HA 4ILIA 3CSFA 1VDYA 4MRUA 3ZXSA 4EPZA 2CHXA 2WXGA 2WXHA 2IOSA 3FTSA 3QNKA 3KBTC 4DI4A 3FWVA 3FTVA 2XPYA 3I3NA 4I6GA 4LRZA 1QZ2A 3MKQB 2WXIA 3RO3A 1NA0A 2WMOA 3NQPA 2AVPA 3D9IA 2IFUA 3DPDA 3OXLA 4G26A 4KYOB 5FQ7A 3RRMB 4ANVA 3MGBA 3OXGA 3C98A 2VTBA 2XQ0A 3E4BA 3Q15A 4F53A 2MOWA 1UN9A 4UI9K 5AENA 4JA9A 4HFGA 4W9RA 4HOQA 1PAQA 2X6FA 4FADA 2CG2A 3UPVA 4ACLA 3ZHEB 2J07A 5JHAA 4GCOA 3MV2B 2Q7FA 3RRNB 3TXMA 2KC7A 3LPZA 3ML8A 2E0IA 5FQ6A 3UT4A 4C9BB 5A23A 5KJKA 2VYIA 5J90A 3EHUA 5C1DA 5BW8C 3T5XA 1P5QA 3CVPA 2I9CA 3ZPJA 3G2SA 3PH0C 4FHKA 5CCLA 3PEVB 3CVYA 1Y8MA 1U3DA 2IJGX 2L0TB 4FJYA 2J9QA 2R5SA 2WMNA 3FEXA 3S7FA 3D9MA 3U3WA 4N2SA 2HR2A 3ZGQA 1HE8A 3U66A 3FUKA 4GA0A 2YINA 1E7UA 3FTUA 2X38A 3QOUA 3CVUA 1LF8A 4GYWA 5ANLA 3GZ2A 2LSUA 4JZYA 2FEZA 3RKVA 1S0PA 3EHTA 3UX4A 2XDGA 3AS4A 2WXOA 3ASFA 3MKRA 1OWMA 4UQZA 2AXZA 4KVMA 5BUZA 4JPSA 4PDXA 4BTBA 2UWJG 3R7QA 3PDNA 4XE0A 3SBSA 5AJLA 4WUYA 2WXJA 3ZN3A 4BX8A 1EF1C 5LP0A 3FH5A 1U34A 3QR8A 4JHKA 1SZAA 1BPOA 3ZYKA 1XGWA 1H19A 4HVBA 2R17C 1ELRA 3JYSA 3PE3A 3SZ7A 5C2YA 3KAEA 3MKQA 1WM5A 4A3TA 4ANWA 5JJTA 4ILHB 2KCLA 5EX0A 3TXNA 4G24A 4DI3A 1HXIA 3CK9A 2OVFA 1ZU2A 3FUEA 3VTYA 3OXFA 3FU0A 1IHGA 3LVQE 4EBAA 3EDTB 4YNDA 2QY7A 5G05J 4FLHA 4TV3A 3RO2A 4AOFA 2IONA 3AU5A 4AIFA 3B7UX 1TJCA 1HFAA 2Y3AA 3LY7A 4JC8A 4U0ZA 4ME2A 4I6JA 3ASHA 4I1MA 4XKBA 1DVPA 3C59A 4AXHA 4NQ0A 2DBAA 5D0QD 1W3BA 3ZHEA 3CHOA 1HO8A 3PZDA 3FHEA 1ELKA 4A55A 4CT0A 2VGYA 3HDXA 3I4RB 3AU4A 2KM4A 2P58C 4J8FA 5G04C 3URZA 4EZJA 3GW4A 4B8CB 3S7BA 3HHMA 4AY6A 2V0PA 4HOTA 4I9CA 2J4BA 4D8OA 2GW1A 3ML9A 2XGOA 3EJNA 3SBTB 5LFAA 4G23A 1SQMA 3K9IA 1IYGA 2CHWA 2EQXA 5FQ4A 1FCHA 2WXNA 2YHEA 3JQ0A 3MA5A 2XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JOD A;  5II0 A;  3IOL A;  3C59 A;  4DLO A;  1U34 A;  4HJ0 A;  3L2J A;  2L27 A;  2JND A;  3N7S A;  3EHS A;  2JNC A;  4ERS A;  4ZGM A;  3EHT A;  4LF3 C;  4DLQ A;  2XDG A;  3C4M A;  3AQF B;  3EHU A;  3C5T A;  2QKH A;  3H3G A;  3N7P A;  3N7R A; 
#chains in the Genus database with same CATH topology
 4TXQ A;  1OUV A;  3C3R A;  4ZHB A;  2XGM A;  2RKK A;  2Y69 E;  3UT8 A;  2BF0 X;  2ZXW E;  5DIZ A;  3ABL E;  4G11 A;  4XI9 A;  4AJW A;  2IQC A;  3J5P A;  1UG3 A;  2IY0 C;  4L7T A;  4LEU A;  1MZC A;  4PUC A;  4Q94 A;  3CST A;  4OAV B;  4JD2 G;  3O4Z A;  2YHC A;  4WND A;  2GRL A;  1RZ4 A;  4HOS A;  4NRH B;  3L13 A;  3N71 A;  3P2B A;  2RG8 A;  2L6B A;  4XI0 A;  4D1J A;  3G2T A;  4CGV A;  2HM8 A;  1E7V A;  3PS6 A;  3MYV A;  2OVB A;  4GZ3 A;  3IOL A;  2OND A;  2CFZ A;  1LD8 A;  4F3V A;  1O5M A;  3UM2 A;  1MX4 A;  1KT0 A;  1B89 A;  4JXT A;  4UI9 C;  3PNT B;  2P9K G;  4GZC A;  2JLB A;  1OWL A;  5CEA A;  3DSS A;  2OEW A;  2GRO B;  3B7T A;  3FTW A;  4LNB A;  4Q96 A;  1KLX A;  3SY2 A;  4GZD A;  5JMN D;  5AJD A;  3UIP C;  2Q1F A;  2ZIR A;  5CMW A;  2P9N G;  4UUC A;  3KD7 A;  4TRQ A;  3CHM A;  2JAB A;  3ASN E;  4NUR A;  2PQN A;  3CHS A;  2KZT B;  4IN3 B;  2X03 A;  3PZ1 A;  1INZ A;  4A3V A;  3DXM G;  3F59 A;  5KNH D;  5BPP A;  3SFY A;  2KCV A;  3ULE G;  3TJP A;  1Y6I A;  5ARG A;  3NOG D;  3IEG A;  4GYO A;  1NZN A;  4ABN A;  5FWQ A;  3R9A B;  2I1J A;  1DCE A;  5JJ7 A;  2J09 A;  3GZS A;  2XZD G;  2FUL A;  3W9F A;  1H2V C;  5HQ8 A;  2H6G A;  2WXK A;  3NZS A;  2IU1 A;  5AN8 A;  3D9H A;  1K8K G;  2JND A;  4B89 A;  5LCW C;  3P1U A;  1WG0 A;  4LSZ E;  4D6C A;  2KCK A;  3Q4A B;  1PC2 A;  3ZKJ A;  1YCS B;  3R7R A;  3FY4 A;  4A1S A;  1D9S A;  2EIL E;  2WQ6 A;  2I6H A;  3CGH A;  1MX6 A;  1JCQ A;  3RU0 A;  4GA2 A;  3LVR E;  2XEH A;  4LNU D;  4DLO A;  3CVX A;  1N54 A;  2VGX A;  3FUD A;  3QC1 A;  4J8D A;  1TN7 A;  5CER B;  2B6C A;  2WDA A;  1SVX A;  1OT8 A;  4DJA A;  3UIN C;  3ZYL A;  4BT8 A;  2JNC A;  2XEN A;  3MZL B;  1A17 A;  3I5P A;  4HOR A;  3DSX A;  1TN6 A;  4R7L A;  2I2O A;  1TNY A;  2DZO A;  3B13 A;  1QQE A;  3TWX A;  4GML A;  5BNW A;  3UMV A;  2AWI A;  3FU3 A;  2HO1 A;  4GPK A;  3E34 A;  1OWP A;  4I17 A;  3DWL G;  3IBE A;  5JJ6 A;  2QKH A;  4N5Q A;  2A5U A;  4BSX A;  4J6I A;  3SF4 A;  5FIO A;  2IEJ A;  3TWS A;  3ZEF A;  3AJI A;  1LD7 A;  3SI5 A;  2DCP A;  4HI9 A;  3FU5 A;  1JPL A;  1O1T A;  3FH8 A;  1V54 E;  4UWK A;  3B7S A;  2AXU A;  3RK6 A;  4U95 D;  4HNA D;  2WM9 A;  5E76 A;  3FUI A;  1L5J A;  3U4T A;  2PQR A;  2WXR A;  4TUM A;  4AVX A;  4J8Y A;  3Q78 A;  4GTM A;  2IO3 C;  3N7P A;  4ILG A;  4CRW A;  3L2J A;  4I2Z A;  3I4G A;  3SFZ A;  3S7J A;  2BUG A;  4J7W A;  2CHX A;  3UIO C;  3FWV A;  4I6G A;  1K3Z D;  1NA0 A;  4CEM A;  3D9I A;  2IFU A;  1UN9 A;  4HLL A;  4HOQ A;  4M7C A;  2X6F A;  4FAD A;  3UPV A;  2J07 A;  2FO1 E;  2BRW A;  3MV2 B;  3ML8 A;  3IXE A;  5FQ6 A;  5A23 A;  5KJK A;  1X1H A;  5BW8 C;  1P5Q A;  3CVP A;  5CED B;  3ZPJ A;  3PH0 C;  1U3D A;  2IJG X;  2R5S A;  3S7F A;  1MX2 A;  2BRP A;  3FTU A;  3CVU A;  1LF8 A;  5ANL A;  4JZY A;  3RKV A;  1S0P A;  5ENT D;  1N11 A;  1N7N A;  4XE0 A;  1O1S A;  1EF1 C;  5D2M C;  5CRU A;  4JHK A;  1BPO A;  3Q75 A;  4JB8 P;  3PE3 A;  1BI7 B;  3SZ7 A;  1WM5 A;  4A3T A;  4ANW A;  4GTQ A;  3AG4 E;  2XS8 A;  3EDT B;  5G05 J;  5AAO A;  2WMI B;  3LY7 A;  4ME2 A;  4I6J A;  3ASH A;  4I1M A;  4NQ0 A;  5D0Q D;  3PZD A;  3FHE A;  4ATZ D;  1ELK A;  4CT0 A;  4J8F A;  3URZ A;  4D6E A;  3S7B A;  4HOT A;  2J4B A;  2GW1 A;  3ML9 A;  2DYR E;  1SA4 A;  2DYS E;  5LFA A;  3Q7A A;  4TXR A;  3JQ0 A;  1DCQ A;  3MA5 A;  5FQ8 A;  5ENQ D;  4XKC A;  3FUN A;  1JWG A;  1LXM A;  4YVQ C;  3JQ1 A;  1KT1 A;  4JHR A;  2EIJ E;  1J0N A;  3AG2 E;  1QYM A;  3ASO E;  1PY1 A;  3HVE B;  4UQX A;  4JEH A;  2OV8 A;  1OJO A;  3DSU A;  2IOL A;  4GZ6 A;  3L54 A;  3IHY A;  5EID A;  4BY6 A;  3Q79 A;  4V3I A;  3FUL A;  3LCA A;  3GZ1 A;  3PQI A;  3CK8 A;  2ZU6 B;  3CVV A;  4XX5 A;  4G8L A;  5LX8 A;  3PVL A;  1QNF A;  4A1G A;  2CFU A;  1DNP A;  2NC9 A;  4LNG A;  1HMW A;  5BXO A;  1FVH A;  4J8E A;  5EDS A;  3OAW A;  5KCM A;  4FP7 A;  4CGW A;  4HOU A;  2WXP A;  2MHK A;  1HZ4 A;  1Z3X A;  3FTX A;  3VTX A;  4MKT A;  3ESL A;  2GRR B;  3JXI A;  4C48 B;  3CQC B;  3CIA A;  4LCT A;  5EIL A;  2F8X K;  4O1O A;  5IY5 E;  5KJN A;  2VSY A;  3D9N A;  1X1I A;  1MYO A;  5II0 A;  5G55 A;  2IF4 A;  2FBN A;  5HS0 A;  5KWD A;  2BTD A;  1V55 E;  1KPS B;  3HIZ A;  1HG2 A;  5G04 J;  4CDN A;  3CEQ A;  2KAT A;  3TAX A;  1DC2 A;  3ZVV A;  2BKK B;  2GRM A;  4PH4 B;  1TYQ G;  2J08 A;  3VLD A;  3QK0 A;  3N7R A;  4CZ2 D;  1HM2 A;  3HXE A;  2P9L G;  3SGH A;  4YDW A;  1NP7 A;  1TEZ A;  1MQS A;  3L6A A;  4XIF A;  2X3M A;  1SW6 A;  4B0Z A;  3FTY A;  3KSL A;  2XPZ A;  5ENR D;  2V5F A;  3TWT A;  4RLY A;  5BV0 A;  5ARF A;  3E30 A;  2PZI A;  4D10 C;  4OVV A;  3CQG B;  3PRZ A;  5FIN A;  4XZ4 A;  1I8Q A;  4GB9 A;  2X6K A;  1JCS A;  2QYU A;  3TWW A;  4RG6 A;  1ZB1 A;  2Y4T A;  5T8I A;  2GRQ B;  3T8K A;  2WMK A;  2H6H A;  3CV0 A;  3LJ3 A;  4RQI A;  3V31 A;  3ZW3 A;  1HH8 A;  2XRZ A;  3EHM A;  1EDU A;  3EHR A;  2LO6 A;  3CVN A;  1MJ0 A;  1X81 A;  2BED A;  2P2C P;  2R05 A;  4G8K A;  2KZT A;  4APF A;  1IXV A;  5HKP A;  2OCC E;  3LKU A;  4AV7 A;  3Q47 B;  1N4S A;  4K03 A;  4JW1 A;  1F9G A;  4QQI A;  4APO A;  1AP7 A;  1QBQ A;  2H6I A;  3E32 A;  1S64 A;  4Z68 A;  3U64 A;  3T9K A;  3D9O A;  3QDN A;  2FO7 A;  1NFI E;  2L6J A;  2EIK E;  5FJY A;  1H2U A;  4DLQ A;  4OAU C;  2LAH A;  4D72 A;  3ZUV B;  4U8V D;  4N39 A;  3Q5M A;  2WCO A;  2ILR A;  1E8Z A;  5FZR A;  4G2V A;  3FEY A;  4YDY A;  5JA4 D;  4U0U A;  2WQH A;  5HRY A;  4FHJ A;  5EYL A;  2C2L A;  1OCZ E;  3Q49 B;  1TNU A;  1HMU A;  5EYP F;  3FU6 A;  2A4Z A;  2X6H A;  2RD0 A;  3EUV A;  2XZT G;  4WWP A;  3S7D A;  4K5C A;  4RSY A;  5BT1 A;  4CYM D;  1X1J A;  1O1R A;  4FUL A;  2R59 A;  2L9B A;  3B7R L;  2PL2 A;  1N7P A;  1YMP A;  4BSZ B;  4U04 A;  3C5T A;  5CCM A;  3TL5 A;  1NA3 A;  4P29 A;  2VQ2 A;  4HRM B;  4J0U A;  4L23 A;  4CCA A;  3BUA A;  3D3M A;  2LAI A;  5E75 A;  3UKR G;  3G2W A;  3JXJ A;  4OVU A;  3FUF A;  5HI7 A;  4LG6 A;  1IQU A;  2EIM E;  5G05 C;  1HU3 A;  3CKB A;  3D9K A;  5FZS A;  1HM3 A;  2P9I G;  4LUN U;  2DIW A;  1TNB A;  2GGF A;  1N94 A;  1K1A A;  3ZU7 B;  2XCC A;  3UM0 A;  1GW6 A;  3L82 A;  4MS6 A;  1BU9 A;  3RRU A;  3G2V A;  3U7V A;  4ILI A;  3CSF A;  3ZXS A;  3V2O A;  2WXG A;  2WXH A;  3QNK A;  1RWC A;  3MKQ B;  3NQP A;  1HN0 A;  3DPD A;  3OXG A;  4DX2 A;  4HBD A;  3DEP A;  2XQ0 A;  5AEN A;  2ETA A;  4GTS A;  1PAQ A;  4ACL A;  3RRN B;  3UT4 A;  3EHU A;  4C9B B;  5J90 A;  5CCL A;  3G2S A;  4FHK A;  3CVY A;  1Y8M A;  4U96 D;  3FEX A;  2WMN A;  5ENP D;  1EGU A;  3X2Q E;  1HE8 A;  3FUK A;  3GZ2 A;  2LSU A;  3UX4 A;  2XDG A;  2WXO A;  1N7R A;  2UWJ G;  3R7Q A;  2MYO A;  3FH5 A;  1U34 A;  1XGW A;  5KBA A;  4HVB A;  3JYS A;  5JJT A;  2KCL A;  3TXN A;  4DI3 A;  1HXI A;  1IHB A;  3VTY A;  2OVF A;  1ZU2 A;  3FUE A;  3NOC D;  4XEI G;  4FLH A;  3AU5 A;  4AIF A;  5B1A E;  4AXH A;  3EU5 A;  4K5A B;  2LUH A;  3AU4 A;  2KM4 A;  5G04 C;  4EZJ A;  4I9C A;  5AQB A;  3EJN A;  3SBT B;  4DX1 A;  2B0O E;  2DZN A;  2XHE A;  1H6K A;  4HQD A;  4F7A A;  4GU5 A;  1LXK A;  3BEE A;  4TUU A;  3IV0 A;  3FTZ A;  3DSV A;  1A5E A;  3OTN A;  2VSX E;  1UJK A;  2F37 A;  4ATG A;  3C4M A;  1UW4 B;  2P9U G;  3V30 A;  2L0I A;  3TGO A;  3CVW A;  4EHM A;  3L17 A;  3ZYM A;  1HS6 A;  5M72 A;  1ZBP A;  4HJ0 A;  3ZRH A;  2WMI A;  4GCN A;  4N3B A;  2VSO E;  3BQO A;  2EIN E;  3HG0 D;  5CMY A;  2MRI A;  2PM6 A;  2V4L A;  4BT9 A;  2GRN B;  4EEC A;  2FI7 A;  2UY1 B;  5AIJ A;  1TNZ A;  3APC A;  3GYZ A;  3EHN A;  1H0A A;  3C3Q A;  3PEU B;  3KBU C;  3QAR A;  3PE4 A;  4BX9 A;  4EQF A;  4U7E B;  3AQF B;  4BET A;  3HVE A;  3LY9 A;  4JA7 A;  4GA1 A;  2BRV X;  4KBQ A;  1Z3Y A;  4F1S A;  2KXR A;  4DRX E;  1OCO E;  3FUH A;  3WXX A;  1J0M A;  3NF1 A;  1W3Y A;  3F6Q A;  3KEA A;  4GAA A;  3AAA C;  1RWA A;  1YYH A;  3MJW A;  3LS8 A;  3HXD A;  4BES A;  4DX5 D;  2GRP B;  3RIB A;  4AEZ C;  3NZU A;  3VLE A;  5FT9 A;  2DWZ A;  4RVB A;  1Z6T A;  3APD A;  5EN5 D;  4U63 A;  1LTX A;  1SA5 A;  2YQ8 A;  4D6J A;  1N0Q A;  3UQ3 A;  2RFM A;  2VGE A;  2WMG A;  3SFX A;  3EIJ A;  1D8E A;  1K1B A;  1X5B A;  3HXC A;  4GTR A;  2ZGG A;  4KZC A;  3V79 K;  3UD2 A;  2QFC A;  4M3O A;  2QC9 A;  4WWN A;  4IRU A;  4Y6C A;  2J49 A;  3TWV A;  4PS7 A;  3MX3 A;  3T5V A;  4DK5 A;  4UWH A;  1RWG A;  3E33 A;  3TG4 A;  2KBX A;  2NSZ A;  4LF3 C;  2PM7 A;  4O60 A;  3RSE G;  4GMJ A;  1TNO A;  3BU8 A;  3APF A;  3MCX A;  1CB8 A;  3QB2 A;  4EBA G;  4I1A A;  4BTA A;  5ITZ F;  1IQR A;  3DXK G;  1OJM A;  4GPM A;  3HXB A;  4WNE A;  4I43 A;  4DX6 D;  2CHZ A;  1NL4 A;  3L22 A;  4D6D A;  4GZ5 A;  4WNF A;  2CG3 A;  5LOZ A;  5CBO A;  2ZGD A;  4RG9 A;  4IUL A;  3U9W A;  4HI8 A;  4WWO A;  3WG7 E;  2WXL A;  1D8D A;  1E96 B;  3SHF A;  3AG3 E;  3KEZ A;  1S70 B;  1U3C A;  4CT4 A;  4JL0 A;  5FZQ A;  3QWP A;  4D6I A;  2PNN A;  5EIB E;  4D6F A;  3PUJ A;  4PS3 A;  4L2L A;  5A6C A;  5T3R A;  3O48 A;  1WY6 A;  3ZNG A;  3FUM A;  4HRN A;  3E37 A;  1OXJ A;  5G2N A;  3KS2 A;  2V8S E;  1E8Y A;  3R9M A;  4MLP A;  2OEV A;  4FLB A;  4K0R A;  1BD8 A;  1N95 A;  4JVS A;  4H7Y A;  4UWG A;  2VSN A;  1HF8 A;  3PNL B;  5AQA A;  5EKQ D;  4C0M A;  3ONK A;  4L2Y A;  3C72 A;  4Y6W A;  2NXP A;  1KZP A;  5BXU A;  4CDM A;  2VTB B;  2X6I A;  3NBN B;  2HYZ A;  3L16 A;  3C3O A;  4FJZ A;  4D6H A;  3AS8 A;  1N4R A;  3UM1 A;  1RW9 A;  1E8X A;  1YA0 A;  4AY5 A;  3Q9N C;  3KSQ A;  4GYY A;  3DRA A;  4G1T A;  1TJF A;  2WPV A;  3HRA A;  4JEU A;  1E8W A;  4U07 A;  1S63 A;  4HXI A;  4I2W A;  5KJM A;  2WVI A;  2E22 A;  5JHB A;  2XRY A;  1TR4 A;  1N4P A;  4D71 A;  5ANR A;  3ENE A;  2I1K A;  1FT2 A;  2WMH A;  4ZFH A;  1U2V G;  3MEK A;  2RFA A;  1BLX B;  1OWO A;  3CVL A;  4NAC A;  2H6F A;  4DX7 D;  3B7B A;  5B1B E;  3UKU G;  1VDY A;  4BEP A;  3KBT C;  3ULY A;  4DI4 A;  2XPY A;  3I3N A;  4LRZ A;  2WXI A;  2AVP A;  3RRM B;  4KYO B;  4G26 A;  4ANV A;  3TWQ A;  3MGB A;  3Q15 A;  4F53 A;  4UI9 K;  4JA9 A;  4W9R A;  3ZHE B;  4GCO A;  2Q7F A;  3LPZ A;  2E0I A;  5C1D A;  3AG1 E;  3PEV B;  2L0T B;  4FJY A;  3D9M A;  3U3W A;  3ZGQ A;  2LXM A;  4GA0 A;  3DPY A;  2ZIS A;  4GYW A;  4DUI A;  3TWU A;  4MBG A;  3EHT A;  2WMF A;  3AS4 A;  5AQ7 A;  4GTV A;  4A63 B;  2Y1L E;  4UQZ A;  2AXZ A;  4KVM A;  5BUZ A;  4JPS A;  4PDX A;  2P9P G;  4BTB A;  3PZ2 A;  3SBS A;  4WUY A;  2WXJ A;  1C82 A;  1SZA A;  1LOH A;  3ZYK A;  2R17 C;  5C2Y A;  3MKQ A;  4ILH B;  4G24 A;  1IKN D;  2R2L A;  3W9G A;  4EBA A;  4YND A;  2F8Y A;  2QY7 A;  3RO2 A;  4TV3 A;  4AOF A;  1N7O A;  3B7U X;  1HFA A;  4JC8 A;  4U0Z A;  3C59 A;  2DBA A;  3CHO A;  1HO8 A;  4A55 A;  2P58 C;  3UXG A;  4B8C B;  4AY6 A;  2V0P A;  2HE0 A;  4D8O A;  2V5Q C;  4G23 A;  3K9I A;  1IYG A;  2F0Y A;  2CHW A;  2EQX A;  2KXP C;  1FCH A;  1NI1 A;  2YHE A;  3ONL A;  3UT7 A;  3T8M A;  3IHV A;  1E90 A;  1OY3 D;  3ESK A;  4NIK A;  3ISM C;  3UD1 A;  4ERS A;  2VJ8 A;  1EYH A;  5CBN A;  2X6J A;  3H3G A;  4YDE A;  3VLF A;  3Q7F A;  3UUX A;  4AM9 A;  3JUI A;  2NYJ A;  1OWN A;  3FH7 A;  4N3C A;  3PZ3 A;  4F1P A;  2WB2 A;  3LYA A;  4IYP A;  1XNF A;  5ENN A;  4EZL A;  3FUJ A;  3SNX A;  4N2Q A;  2OOE A;  4TXP A;  2JOD A;  1H6P A;  3JUE A;  2Y0B G;  1UJJ A;  2XGS A;  3D9P A;  2M63 A;  4HLE A;  2LSV A;  3IKO B;  3LEW A;  4WAF A;  5ENO D;  5CHE E;  4X8Q A;  2WQ7 A;  3C5R A;  2YNQ A;  3ABK E;  5A7D B;  2XEV A;  3CLJ A;  1WAO 1;  3DST A;  3CVQ A;  4BER A;  5CEC B;  2E24 A;  2C0M A;  5BV1 A;  5FTP A;  3TG5 A;  3TWR A;  3ASD A;  4E85 A;  4QFV A;  4KT6 B;  5AAR A;  1N7Q A;  1F1S A;  4ACK A;  4B8A A;  3SD5 A;  1FVF A;  3CR3 A;  4KZ0 A;  4N3A A;  2UY1 A;  5EX3 A;  3LY8 A;  3PUK A;  2VGX B;  4HRL A;  3ZIM A;  3CHR A;  3S2A A;  1OCC E;  3UTM A;  3LXU X;  1FPP A;  3EIQ C;  4GTP A;  4UWF A;  2LNI A;  2L27 A;  3QWV A;  4HS2 A;  1UOH A;  3FP3 A;  4L1B A;  5H7P A;  3G2U A;  1N9A A;  3ZYQ A;  3ULQ A;  4GMR A;  1N52 A;  3BG1 B;  3QJZ A;  1N4Q A;  3HXF A;  4UWL A;  1RWH A;  2KXS A;  2WXM A;  2QYJ A;  4E6H A;  1ELW A;  4J8S A;  4UI9 J;  4U0S A;  2WMJ A;  4PS8 A;  5T4Y A;  1KZO A;  1SZ9 A;  3Q73 A;  1TN8 A;  2WXQ A;  4ANU A;  4JHJ A;  3HYM B;  3B95 A;  2QZA A;  4KMO A;  3D9L A;  3QKY A;  4LER A;  4KXK B;  1JWF A;  4O1P A;  3LJN A;  4H7X A;  1Q2Z A;  3CHQ A;  4GTT A;  3RJV A;  3ZXP A;  4FA6 A;  4CDR A;  3QWW A;  3MV3 B;  2Y4U A;  1MHQ A;  3ABM E;  4EZK A;  3PRE A;  3ZFW A;  2J4D A;  2WXF A;  1H2T C;  5DBK A;  4URK A;  5D66 A;  4C0E A;  4OYS A;  4D6G A;  3SQV A;  4BWR A;  5KJL A;  2AW6 A;  4ZGM A;  1WDY A;  2E2E A;  4DPR A;  4B94 A;  5D0O D;  3ASG A;  1UN8 A;  1H6O A;  3CKC A;  1Z5S C;  4YVO A;  4G25 A;  3NAW A;  4BFR A;  4F6R D;  3CK7 A;  1AWC B;  2R02 A;  3CHP A;  3EU9 A;  2JEK A;  2XCB A;  3DSW A;  1HG5 A;  3AS5 A;  4HB5 A;  3JCK C;  2ETB A;  3BG0 B;  4Q69 A;  4KVO A;  4WNG A;  3PZ4 A;  1OJP A;  2R03 A;  4I6E A;  4AP2 A;  2XPI A;  4I9E A;  3N7S A;  5LCW J;  3EHS A;  5J08 A;  3D9J A;  4UQY A;  1OJN A;  3QAQ A;  4FC8 A;  3FFL A;  4ANX A;  1EPU A;  2A5E A;  2FF4 A;  3FDH A;  4FU3 A;  3L08 A;  1HX8 A;  4I1O B;  4N5C A;  4O6F A;  2BKG A;  2C0L A;  3DBS A;  5AYW D;  2AXV A;  3LDZ A;  1JUQ A;  2AJA A;  4U8H A;  1FT1 A;  4MRU A;  4EPZ A;  3FTS A;  2IOS A;  3FTV A;  4B93 B;  1QZ2 A;  3RO3 A;  2WMO A;  4D1I A;  5FQ7 A;  3OXL A;  2XS1 A;  3C98 A;  2VTB A;  1JCR A;  3E4B A;  2MOW A;  5AQ9 A;  3UM3 A;  1BI8 B;  4HFG A;  3Q9U C;  2LXL A;  2CG2 A;  5JHA A;  3TXM A;  4U8Y D;  2KC7 A;  1OCR E;  2VYI A;  3T5X A;  5ENS D;  4YDO A;  2I9C A;  2J9Q A;  4N2S A;  2HR2 A;  1RW2 A;  3U66 A;  2YIN A;  1E7U A;  3QOU A;  2X38 A;  4K5B A;  3L9T A;  5KNG A;  2FEZ A;  3RAU A;  3ASF A;  3MKR A;  1OWM A;  3NB2 A;  1N0R A;  3PDN A;  5AJL A;  2ETC A;  3ZN3 A;  4BX8 A;  4L9P A;  5LP0 A;  3QR8 A;  1G3N B;  1H19 A;  1ELR A;  3KAE A;  5CRV A;  5EX0 A;  3UI2 A;  3CK9 A;  2IO2 C;  2J8S D;  2V4H C;  3OXF A;  3FU0 A;  1IHG A;  3LVQ E;  3DEO A;  2ION A;  5B3S E;  2DVW A;  1TJC A;  2Y3A A;  4XKB A;  1DVP A;  4GTO A;  3V2X A;  2P9S G;  1W3B A;  3ZHE A;  2VGY A;  3HDX A;  3I4R B;  1RWF A;  3GW4 A;  3HHM A;  3EHQ A;  2XGO A;  3SO8 A;  1SQM A;  5FQ4 A;  3J5Q B;  2WXN A;  2XEE A; 
#chains in the Genus database with same CATH homology
 3ONL A;  1OUV A;  5FQ8 A;  3UT7 A;  4F7A A;  4XKC A;  4GU5 A;  3FUN A;  3T8M A;  2XGM A;  3BEE A;  3IHV A;  1JWG A;  1E90 A;  3UT8 A;  4YVQ C;  3JQ1 A;  1KT1 A;  2BF0 X;  4TUU A;  3ESK A;  3IV0 A;  3FTZ A;  4JHR A;  3HVE B;  1PY1 A;  4UQX A;  3UD1 A;  3OTN A;  4G11 A;  4JEH A;  4XI9 A;  5DIZ A;  4ERS A;  2VJ8 A;  1EYH A;  2VSX E;  1UJK A;  4ATG A;  2OV8 A;  4AJW A;  2IQC A;  3C4M A;  2IOL A;  1UG3 A;  1UW4 B;  4GZ6 A;  2X6J A;  3H3G A;  4L7T A;  4LEU A;  3L54 A;  2L0I A;  3IHY A;  3VLF A;  3UUX A;  4AM9 A;  4BY6 A;  3TGO A;  3JUI A;  3CVW A;  4PUC A;  3L17 A;  3CST A;  1HS6 A;  4Q94 A;  3ZYM A;  4V3I A;  5M72 A;  3FUL A;  3O4Z A;  2YHC A;  3LCA A;  1ZBP A;  1OWN A;  4HJ0 A;  3FH7 A;  4WND A;  2GRL A;  3GZ1 A;  3PQI A;  4N3C A;  3CK8 A;  2ZU6 B;  3CVV A;  3ZRH A;  4HOS A;  4GCN A;  4NRH B;  4XX5 A;  2WB2 A;  4N3B A;  2VSO E;  5LX8 A;  3L13 A;  3N71 A;  3PVL A;  3LYA A;  3P2B A;  2RG8 A;  1QNF A;  4IYP A;  4A1G A;  1XNF A;  5ENN A;  4EZL A;  3FUJ A;  2CFU A;  4XI0 A;  1DNP A;  2MRI A;  5CMY A;  3SNX A;  2NC9 A;  2PM6 A;  2V4L A;  3G2T A;  4BT9 A;  4N2Q A;  4CGV A;  1FVH A;  2HM8 A;  4J8E A;  5EDS A;  1E7V A;  2OOE A;  3OAW A;  5KCM A;  3PS6 A;  2JOD A;  3MYV A;  2OVB A;  4FP7 A;  4GZ3 A;  4CGW A;  3IOL A;  4HOU A;  2OND A;  2FI7 A;  2WXP A;  4EEC A;  2CFZ A;  2MHK A;  1HZ4 A;  2UY1 B;  1Z3X A;  3FTX A;  1UJJ A;  4F3V A;  5AIJ A;  3VTX A;  4MKT A;  2XGS A;  3D9P A;  3APC A;  3GYZ A;  2M63 A;  3EHN A;  3ESL A;  1H0A A;  3PEU B;  1KT0 A;  1B89 A;  2LSV A;  4JXT A;  4UI9 C;  3IKO B;  3QAR A;  4HLE A;  3KBU C;  3CQC B;  3PNT B;  3LEW A;  3CIA A;  3PE4 A;  4GZC A;  4LCT A;  4WAF A;  2JLB A;  5CHE E;  4BX9 A;  4EQF A;  5KJN A;  1OWL A;  2VSY A;  2WQ7 A;  3AQF B;  3D9N A;  3HVE A;  3LY9 A;  4JA7 A;  4GA1 A;  2YNQ A;  4KBQ A;  5A7D B;  1Z3Y A;  2XEV A;  4F1S A;  2KXR A;  5II0 A;  5G55 A;  2IF4 A;  2FBN A;  3CLJ A;  1WAO 1;  3B7T A;  3FUH A;  3WXX A;  3FTW A;  2BTD A;  3NF1 A;  1KLX A;  3CVQ A;  3HIZ A;  4Q96 A;  2C0M A;  1HG2 A;  5G04 J;  4GZD A;  4CDN A;  5AJD A;  5BV1 A;  3CEQ A;  4GAA A;  5FTP A;  3TG5 A;  2KAT A;  3TAX A;  3ZVV A;  3MJW A;  5CMW A;  2GRM A;  3ASD A;  4PH4 B;  3LS8 A;  3RIB A;  4E85 A;  2J08 A;  3KD7 A;  4AEZ C;  3NZU A;  3VLE A;  4QFV A;  3VLD A;  5FT9 A;  3QK0 A;  3N7R A;  4TRQ A;  4RVB A;  1Z6T A;  3CHM A;  3APD A;  4KT6 B;  4U63 A;  4NUR A;  2PQN A;  3CHS A;  2KZT B;  3SGH A;  4ACK A;  4B8A A;  2YQ8 A;  4IN3 B;  3SD5 A;  3UQ3 A;  1NP7 A;  3EIJ A;  1TEZ A;  1MQS A;  3L6A A;  4XIF A;  2X3M A;  1FVF A;  4A3V A;  1INZ A;  3CR3 A;  4B0Z A;  1X5B A;  3FTY A;  2XPZ A;  4KZ0 A;  4N3A A;  2UY1 A;  5EX3 A;  3F59 A;  2V5F A;  3LY8 A;  3PUK A;  2VGX B;  4KZC A;  3UD2 A;  2QFC A;  4M3O A;  4WWN A;  3CHR A;  3ZIM A;  3S2A A;  5BPP A;  4IRU A;  5BV0 A;  5ARF A;  4Y6C A;  2KCV A;  3LXU X;  2J49 A;  4PS7 A;  3EIQ C;  2PZI A;  3MX3 A;  3TJP A;  3T5V A;  1Y6I A;  4UWF A;  4D10 C;  4OVV A;  5ARG A;  4DK5 A;  3IEG A;  2LNI A;  4GYO A;  1NZN A;  4UWH A;  3CQG B;  2L27 A;  3QWV A;  4HS2 A;  5FWQ A;  3FP3 A;  3R9A B;  4ABN A;  3PRZ A;  3TG4 A;  4L1B A;  2I1J A;  4XZ4 A;  3G2U A;  5JJ7 A;  2J09 A;  2NSZ A;  3GZS A;  4GB9 A;  2X6K A;  3ULQ A;  3ZYQ A;  4LF3 C;  1N52 A;  4RG6 A;  2FUL A;  2PM7 A;  3BG1 B;  4GMJ A;  1H2V C;  2Y4T A;  5T8I A;  5HQ8 A;  3QJZ A;  3APF A;  3MCX A;  2WXK A;  3QB2 A;  3CV0 A;  3LJ3 A;  3NZS A;  2IU1 A;  4UWL A;  4EBA G;  3ZW3 A;  4I1A A;  2WXM A;  4BTA A;  2KXS A;  2JND A;  1IQR A;  4B89 A;  1HH8 A;  1ELW A;  4E6H A;  4J8S A;  2XRZ A;  5LCW C;  3EHM A;  4UI9 J;  1EDU A;  3P1U A;  4I43 A;  4U0S A;  4WNE A;  2CHZ A;  2LO6 A;  3CVN A;  4PS8 A;  5T4Y A;  3L22 A;  4GZ5 A;  4WNF A;  2CG3 A;  5LOZ A;  2KZT A;  4APF A;  2KCK A;  3Q4A B;  1PC2 A;  4CEM A;  3R7R A;  3FY4 A;  4A1S A;  1SZ9 A;  2WXQ A;  2WQ6 A;  2I6H A;  3LKU A;  4AV7 A;  4ANU A;  4JHJ A;  3HYM B;  4RG9 A;  3CGH A;  3Q47 B;  4IUL A;  3RU0 A;  3U9W A;  4GA2 A;  3LVR E;  4KMO A;  3D9L A;  3QKY A;  4JW1 A;  4K03 A;  4WWO A;  4DLO A;  3CVX A;  4LER A;  4KXK B;  1N54 A;  1JWF A;  2VGX A;  3FUD A;  3QC1 A;  4H7X A;  4J8D A;  4APO A;  2WXL A;  3CHQ A;  4DJA A;  3U64 A;  3ZYL A;  4BT8 A;  3D9O A;  3QDN A;  2JNC A;  2FO7 A;  3RJV A;  1E96 B;  2L6J A;  4FA6 A;  5FJY A;  4CDR A;  3QWW A;  1H2U A;  4DLQ A;  3MV3 B;  2Y4U A;  3SHF A;  4Q69 A;  3MZL B;  1A17 A;  1MHQ A;  3KEZ A;  3I5P A;  4HOR A;  2LAH A;  4EZK A;  3PRE A;  3ZFW A;  2J4D A;  4R7L A;  1U3C A;  4CT4 A;  4JL0 A;  2I2O A;  2WXF A;  1H2T C;  5FZQ A;  3QWP A;  4N39 A;  5DBK A;  3Q5M A;  3PUJ A;  3B13 A;  2ILR A;  1E8Z A;  1QQE A;  4PS3 A;  5FZR A;  4URK A;  4G2V A;  4GML A;  5BNW A;  4L2L A;  5A6C A;  5T3R A;  3FEY A;  4C0E A;  4OYS A;  2AWI A;  3UMV A;  3FU3 A;  2HO1 A;  4GPK A;  3O48 A;  1WY6 A;  4BWR A;  3FUM A;  5KJL A;  2AW6 A;  4ZGM A;  4U0U A;  5G2N A;  1OWP A;  3KS2 A;  4I17 A;  2E2E A;  2V8S E;  2WQH A;  4FHJ A;  3IBE A;  4B94 A;  5JJ6 A;  4DPR A;  1E8Y A;  5D0O D;  2QKH A;  4MLP A;  3ASG A;  2A5U A;  4BSX A;  1UN8 A;  4FLB A;  4K0R A;  4J6I A;  2C2L A;  3CKC A;  3SF4 A;  3Q49 B;  4JVS A;  4YVO A;  4G25 A;  4H7Y A;  4UWG A;  3FU6 A;  2A4Z A;  2VSN A;  1HF8 A;  2X6H A;  3ZEF A;  4BFR A;  2RD0 A;  3PNL B;  3CK7 A;  5EKQ D;  4WWP A;  3S7D A;  3CHP A;  3ONK A;  4L2Y A;  4RSY A;  4Y6W A;  4C0M A;  2NXP A;  5BT1 A;  2JEK A;  2XCB A;  3SI5 A;  4CDM A;  2DCP A;  3FU5 A;  4FUL A;  2R59 A;  1HG5 A;  3B7R L;  2L9B A;  1JPL A;  2PL2 A;  3AS5 A;  2VTB B;  2X6I A;  3FH8 A;  2HYZ A;  4U04 A;  4UWK A;  3C5T A;  3L16 A;  5CCM A;  3JCK C;  3BG0 B;  3B7S A;  1NA3 A;  4FJZ A;  4KVO A;  3TL5 A;  4WNG A;  4P29 A;  2VQ2 A;  4J0U A;  4CCA A;  3AS8 A;  4L23 A;  3D3M A;  2LAI A;  2AXU A;  5E75 A;  3RK6 A;  4I6E A;  3G2W A;  2XPI A;  4AP2 A;  4I9E A;  4OVU A;  1E8X A;  1YA0 A;  2WM9 A;  4AY5 A;  5LCW J;  3FUF A;  4GYY A;  3EHS A;  3N7S A;  4G1T A;  5J08 A;  1TJF A;  2WPV A;  5E76 A;  3FUI A;  3D9J A;  5HI7 A;  1L5J A;  4JEU A;  4UQY A;  3U4T A;  1E8W A;  3QAQ A;  4U07 A;  1IQU A;  4FC8 A;  2PQR A;  3FFL A;  4HXI A;  4ANX A;  4I2W A;  5KJM A;  1EPU A;  2WVI A;  2WXR A;  2FF4 A;  2XRY A;  5G05 C;  4AVX A;  1HU3 A;  3CKB A;  3D9K A;  3FDH A;  5FZS A;  4LUN U;  2DIW A;  4FU3 A;  3N7P A;  1H6K A;  4ILG A;  3L08 A;  5ANR A;  4CRW A;  1HX8 A;  2GGF A;  3ENE A;  2I1K A;  4I1O B;  4N5C A;  4O6F A;  3MEK A;  3L2J A;  2XCC A;  5JHB A;  1GW6 A;  1OWO A;  2C0L A;  4I2Z A;  4MS6 A;  3DBS A;  3CVL A;  4NAC A;  5AYW D;  3I4G A;  2AXV A;  3SFZ A;  3LDZ A;  3RRU A;  3S7J A;  2BUG A;  3G2V A;  1JUQ A;  4U8H A;  4ILI A;  3CSF A;  1VDY A;  4MRU A;  3ZXS A;  4EPZ A;  2CHX A;  2WXG A;  2WXH A;  2IOS A;  3FTS A;  3QNK A;  3KBT C;  4DI4 A;  3FWV A;  3FTV A;  2XPY A;  3I3N A;  4I6G A;  4LRZ A;  1QZ2 A;  3MKQ B;  2WXI A;  3RO3 A;  1NA0 A;  2WMO A;  3NQP A;  2AVP A;  3D9I A;  2IFU A;  3DPD A;  3OXL A;  4G26 A;  4KYO B;  5FQ7 A;  3RRM B;  4ANV A;  3MGB A;  3OXG A;  3C98 A;  2VTB A;  2XQ0 A;  3E4B A;  3Q15 A;  4F53 A;  2MOW A;  1UN9 A;  4UI9 K;  5AEN A;  4JA9 A;  4HFG A;  4W9R A;  4HOQ A;  1PAQ A;  2X6F A;  4FAD A;  2CG2 A;  3UPV A;  4ACL A;  3ZHE B;  2J07 A;  5JHA A;  4GCO A;  3MV2 B;  2Q7F A;  3RRN B;  3TXM A;  2KC7 A;  3LPZ A;  3ML8 A;  2E0I A;  5FQ6 A;  3UT4 A;  4C9B B;  5A23 A;  5KJK A;  2VYI A;  5J90 A;  3EHU A;  5C1D A;  5BW8 C;  3T5X A;  1P5Q A;  3CVP A;  2I9C A;  3ZPJ A;  3G2S A;  3PH0 C;  4FHK A;  5CCL A;  3PEV B;  3CVY A;  1Y8M A;  1U3D A;  2IJG X;  2L0T B;  4FJY A;  2J9Q A;  2R5S A;  2WMN A;  3FEX A;  3S7F A;  3D9M A;  3U3W A;  4N2S A;  2HR2 A;  3ZGQ A;  1HE8 A;  3U66 A;  3FUK A;  4GA0 A;  2YIN A;  1E7U A;  3FTU A;  2X38 A;  3QOU A;  3CVU A;  1LF8 A;  4GYW A;  5ANL A;  3GZ2 A;  2LSU A;  4JZY A;  2FEZ A;  3RKV A;  1S0P A;  3EHT A;  3UX4 A;  2XDG A;  3AS4 A;  2WXO A;  3ASF A;  3MKR A;  1OWM A;  4UQZ A;  2AXZ A;  4KVM A;  5BUZ A;  4JPS A;  4PDX A;  4BTB A;  2UWJ G;  3R7Q A;  3PDN A;  4XE0 A;  3SBS A;  5AJL A;  4WUY A;  2WXJ A;  3ZN3 A;  4BX8 A;  1EF1 C;  5LP0 A;  3FH5 A;  1U34 A;  3QR8 A;  4JHK A;  1SZA A;  1BPO A;  3ZYK A;  1XGW A;  1H19 A;  4HVB A;  2R17 C;  1ELR A;  3JYS A;  3PE3 A;  3SZ7 A;  5C2Y A;  3KAE A;  3MKQ A;  1WM5 A;  4A3T A;  4ANW A;  5JJT A;  4ILH B;  2KCL A;  5EX0 A;  3TXN A;  4G24 A;  4DI3 A;  1HXI A;  3CK9 A;  2OVF A;  1ZU2 A;  3FUE A;  3VTY A;  3OXF A;  3FU0 A;  1IHG A;  3LVQ E;  4EBA A;  3EDT B;  4YND A;  2QY7 A;  5G05 J;  4FLH A;  4TV3 A;  3RO2 A;  4AOF A;  2ION A;  3AU5 A;  4AIF A;  3B7U X;  1TJC A;  1HFA A;  2Y3A A;  3LY7 A;  4JC8 A;  4U0Z A;  4ME2 A;  4I6J A;  3ASH A;  4I1M A;  4XKB A;  1DVP A;  3C59 A;  4AXH A;  4NQ0 A;  2DBA A;  5D0Q D;  1W3B A;  3ZHE A;  3CHO A;  1HO8 A;  3PZD A;  3FHE A;  1ELK A;  4A55 A;  4CT0 A;  2VGY A;  3HDX A;  3I4R B;  3AU4 A;  2KM4 A;  2P58 C;  4J8F A;  5G04 C;  3URZ A;  4EZJ A;  3GW4 A;  4B8C B;  3S7B A;  3HHM A;  4AY6 A;  2V0P A;  4HOT A;  4I9C A;  2J4B A;  4D8O A;  2GW1 A;  3ML9 A;  2XGO A;  3EJN A;  3SBT B;  5LFA A;  4G23 A;  1SQM A;  3K9I A;  1IYG A;  2CHW A;  2EQX A;  5FQ4 A;  1FCH A;  2WXN A;  2YHE A;  3JQ0 A;  3MA5 A;  2XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...