4DLXA

H-ras set 1 cacl2/dte, ordered off
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlxA00
2WKQA 1E4VA 5DH9A 2CHQA 2A9KA 5JWRA 3Q85A 2VSXA 1ZNZA 2X2EA 3QXHA 4DLXA 3WBJA 2QE7D 4XSGA 2GJ9A 2GETA 3IO5A 4RD1A 3OAAD 5E7MA 4NDZA 5EXXA 5AWFC 1R5OA 1KO1A 4BLOA 4NZYA 5FUYA 2BMEA 3LVQE 4DCSA 4XTRA 5JHHB 1AN0A 3SJAA 4E5UA 1G17A 1XZPA 4KCGA 4IOJA 3U3MA 3U3KA 3PXGA 3UMRA 3T61A 2C8VA 1X6VA 2PEZA 3B82A 3AUXA 4TL6A 4NCNA 3V00A 2AK3A 1E9DA 3CNLA 4PO8A 3EXAA 1G21E 3CF2A 3PUVA 4S35A 3UMFA 2XZOA 1Z0AA 4FMCF 4D4JA 4FMDB 2F7SA 1ZIPA 2OFOA 2WWIA 3GEIA 3HJNA 4HLUA 1W1WA 2OCPA 4E22A 1CR2A 2AXNA 4CW7A 1Z06A 1RVDA 3I3SR 1ZNXA 5AJYA 2OO7A 1R7RA 5DN6D 4LV8B 3B1ZA 2XITA 4W9MC 2NQ2C 2RGBA 3B9QA 1XB2A 4A0GA 1COWA 2QNRA 5GJBA 2H1LA 3L0OA 4URWR 3PEWA 3HPQA 2QN6A 3LRPA 4HAUA 5C1BA 4I1OA 4BLRA 4NE2A 1W2HA 1Z0DA 3BWDD 4KU4A 1XCMA 1T5IA 3SYNA 1M8PA 1U99A 2J0QA 4HZUA 3E5HA 4Z1MA 2ZI3A 5JBQA 3SQWA 1AGPA 3ETLA 3OIYA 3NIBA 1M7HA 3TH5A 1Z6TA 3NG1A 1S3SA 4A1FA 1XTSA 4B34A 4BRUA 1OIXA 1X1SA 2FEMA 3GFPA 2HLDA 1MOZA 2W0MA 1QVAA 2Z4RA 4ACAA 3M1IA 2KWIA 3BK7A 1N0VC 4D6PA 1DAGA 1E2KA 3DO6A 1JXOA 4ZKEA 2B6HA 2MMGA 4D25A 2PCLA 1A5TA 4NCJA 5D3MB 5FTMA 3CWZA 4LJAA 4ARZA 1DS6A 5JI3E 4DSNA 5DHAA 2JJ1A 1E99A 2YYZA 3AKEA 3IHWA 4XSHA 4E03A 221PA 2WSSA 3THXA 2IYRA 2HEIA 4HLQB 1XTKA 3B78A 1X8LA 3EIQA 3RWOA 3P26A 3GLIA 5L3SA 4Q66C 4U00A 1OFHA 1U9IC 2CK3D 2VP0A 2YC4C 2VO1A 4M8NE 1VHLA 3NH9A 4G3XA 1UFQA 2VP5A 3LVRE 2PMDA 3QY0A 2WIBA 3QG1A 4GI7A 5G41A 1QDEA 3QJYA 1Q21A 4A0FA 3RSLA 1KI1A 1E9CA 5HTKA 2NIPA 2ZAMA 4D4LA 3IHLA 4BFUA 2JCSA 2GXSA 1Q3HA 1YZGA 1XD9A 3E2IA 3NC1C 3V9PA 4DIEA 3QXXA 3NKVA 1E2LA 1KDTA 2ZRKA 4LV6A 1VDZA 5CJ2A 2H8KA 3IIJA 4C7OB 1NLFA 1AIPA 3GJ8A 2ZM5A 3QF4A 3X1XA 2HJGA 5FR2A 5LB2A 3L82B 4RZUA 4NU0A 3VR4A 1XMSA 3CONA 4QRHA 1ZAKA 1G291 4M1WA 3LW8A 5FL7A 4A8JB 2PJZA 4ZKDA 1DE0A 1OXUA 3T06B 1QF9A 4L15A 2AX4A 1HE8B 4DKXA 1EXMA 2BEKA 4UXHA 1E96A 3KJIA 4XVRA 5JMTA 3U7EB 3ZQ6A 4DLZA 4EJSB 3IEUA 3ZVMA 2G3YA 2ZJOA 3TSOA 4AY2A 2JIZA 4FIDA 4B75A 3BD9A 2ZVPX 4D81A 5TARA 4D80A 1A2BA 2W00A 1FL9A 3OFND 4C3ZA 1YVDA 2XZPA 2ZE5A 1UKVY 2OXRA 2ZUBA 4OK5A 4WZ6A 1D2EA 4OQMA 3HR8A 2QROA 2YWEA 1W4RA 1TQDA 2GJAA 4DJTA 1SULA 1R10A 2FFBA 2HDNB 1H8ED 2HUPA 2R9VA 3CRRA 4HLDA 4LX0A 2PJRA 1N6OA 1Q1ZA 1U0HC 2Y8EA 1E94E 1W48A 4NYJQ 2VIIA 4NKRA 4TN1A 2FG5A 3REGA 1HY3A 1GRNA 4PQFA 3I92A 5J4YA 2XGJA 3PENA 2PL3A 1YZTA 2ZITA 3SBDA 3U44A 2PH1A 1PLLA 1YZKA 2IF2A 2OBMA 4MYUA 3HPRA 1OV4A 2ZRBA 1M74A 1OYYA 3MJRA 3FKSD 3VTKA 2JLWA 2HXYA 2ZRAA 5IHPA 3PFIA 5EQTA 2OE2A 1KSFX 1OF1A 1XTJA 4IW3B 1E6CA 1KNXA 1Q1QA 3TVDA 4GOKA 1D2NA 2ZS8A 1EFRD 3W8RA 3WMFA 3SBEA 4HAXA 4A2QA 3F3YA 3SOPA 1II0A 1W4AA 1KAGA 3SJBA 1NVWQ 4CEIA 1E79A 2DWOA 4KITB 2IBMA 3MGCA 4TTRA 2GEVA 4B71A 4Q1AA 3M4YA 1G7CA 4AG5A 5TDHA 3K0SA 3KQNA 3U4QB 1Z0FA 1E1QA 3U3JA 4C0LA 2IHBA 5KSPA 2VSFA 2WOJA 4AG6A 1G3RA 1IHUA 1E98A 2OILA 3AM1A 3UG7A 2C78A 4RY2A 1K5GA 2XNDD 3DMDA 3PEUA 1SKQA 2ZI5A 3W3ZB 2QAGB 2OAP1 5FOXA 3A4MA 1DTSA 3R9WA 4PZZA 1P2VA 1TNDA 1W5SA 4AKEA 4KV9A 4NBSA 1YR8A 1ZUIA 3TUIC 4L8GA 2V1UA 5HZKA 4YONB 1JJ7A 4BFVA 2ZR7A 5JLJA 2XXAB 1IM2A 1XDBA 2V8OA 4LJ6A 4BGDA 2XNSA 1GAJA 4BWYA 1SXJD 2VHCA 3K8YA 5UKDA 4IDOA 2IW3A 2Q3HA 4YDHB 5KSYA 4YMTA 3WMEA 5AUNB 3H0KA 4N1AA 2UVQA 3QQ5A 4HUQA 2AD5A 4JT2A 1H8HA 2FSHA 5A5GA 3ZZ0A 2BKEA 2A5JA 2LWIA 5CB8A 1VCIA 2EFDB 3LFUA 3TVTA 2QT1A 5JI2E 1KO5A 4HB4A 2QG6A 2F9LA 5A0FA 3ICEA 4A36A 1N25A 1S9HA 4MGKR 4ON9A 2QTFA 1E2QA 3D7MA 3HP1A 4UQOA 2RGXA 4QGGA 3A1TA 3JZMA 1OPXA 3R7WB 2N1BA 3BFVA 4JMPA 1YZUA 4UNRA 3QKTA 4QNRA 3SHWA 4B32A 3S1AA 4ZI2A 1DEKA 1ZYUA 3WP0A 1FNNA 2CNWD 1LS1A 1US8A 2AKAB 3AKDA 3B6EA 1PZNA 5FUVA 3BJIC 2GILA 3IUYA 4Q4JA 4D0GA 2ZVQX 5FPKA 3IPYA 2ODNA 3MMPA 4TMWA 4C9BA 3GLGB 3ASYA 1KIMA 3R9IA 2Q3FA 2ONJA 1JNYA 4HI0E 1MH1A 1GZSA 1WF3A 5EE1A 5F9FA 3AVUA 5IF9A 1KDRA 2W2TA 2OLJA 4DT1B 5G3ZA 1BS1A 2F1IA 3THWA 3GFTA 5JRZA 2BWJA 4JKIA 5BQ5A 3KB2A 2F3RA 3U3RA 2ZRFA 3NBXX 4MRRA 4NPHA 2ZETA 3SJCA 3QG5A 1CULC 4OHVA 4BFSA 4AYXA 1G5PA 3TIFA 1VYVA 2VHUA 4MRSA 1NBMA 4EFNA 3GPLA 1XNJA 3KXLA 1QBKC 3T34A 2HLDD 2ZR0A 1LS6A 4OI0A 5GJWC 1NVXQ 4EFMA 1MO4A 3QKRA 3Q9LA 3ZD6A 1HEIA 2BV3A 1NVVR 2ZXUA 1U0JA 4TQ9A 1WQ1R 1W36C 2OLKA 4IDHA 4Z54A 2QA5A 1ODFA 5F9HA 2ZYTX 1CJMA 721PA 3OIWA 4TYNA 4MDFA 3NDBB 4DZZA 1YHNA 3WYGA 1MRSA 4MGZR 1OH6A 2A78A 2C96A 1OB5A 1E1RD 2BHRA 2ZJZA 2KB0A 3BFKA 3DDCA 1JQLB 1XU4A 1X8KA 3H86A 5L3QA 2QQEA 2P5TB 5A4JA 1WBDA 1NSTA 2NGRA 4FINA 1XXHE 5EXTA 5HE9A 2E87A 4LBZA 2BM1A 5SZIA 1QHHA 4FW9A 2QTHA 5K8UA 2A5YB 4Q21A 5EZ5A 2D7CA 2QP9X 2PZFA 4OHZA 3TRFA 2PMKA 3QBTA 2B21A 3A6PC 3CF0A 1P9NA 2DR3A 1KK1A 2AFHE 3K09C 1R2QA 3LXXA 1KMQA 1DPFA 1DBSA 2KSQA 5HKKA 5JZVA 4DCVA 4Q1FA 2ZIAA 1KJWA 4URYR 4X8OA 4JBWA 5G40A 4B6EA 1SVMA 2WKPA 1ZU4A 3KTAA 4Y0VA 4TMTA 5K8TA 3RRYA 4AWXA 4M9ZA 1XTIA 3QBVA 4XTCS 3KQKA 1Z6YA 5AUQA 1AZTA 4QBHA 2Q9AA 3JVVA 3TR0A 1U94A 4BQSA 3K9LA 4QFMA 3CX6A 2QMOA 3P32A 4CT4B 4LJ7A 2WMOB 1RJ9B 2CCJA 2FFAA 3NEYA 4QOSA 1NY5A 3UANA 3AVTA 521PA 4OI2A 2IWHA 1AS0A 2BM0A 4KAXA 1TF2A 4Q4AB 1ZM9A 121PA 3QPUA 2EW1A 1RRCA 1QHXA 1M6NA 4PSKA 1KSHA 2KE5A 4R2HA 4PPFA 1QHIA 1ZC4A 1R0XA 4PHGA 1DAIA 1NKSA 1OJLA 3B1XA 2CEAA 3K0FB 3OESA 2WV9A 2FZLA 3AP1A 1KTVA 1VKJA 4BASA 2H7VA 4YXWA 2CLDX 1E9RA 2P0EA 3H2YA 5FTKA 1QG2A 2HT6A 2J0UB 2R44A 3CNOA 4PC6A 1P2UA 1W36B 1JR3A 4CDGA 1GUAA 3SI7A 5K8LA 2UKDA 4RSGA 2F43B 3GD7A 4HB0A 4YMSA 2IC5A 3FTQA 3QI2A 4KXFB 4ZCMA 2RGNA 2EFGA 1P4SA 1KI6B 2OCYC 2BCJQ 5BW8A 4LJ9A 3FPAA 4D0LB 4JLAA 5EE9A 5HE8A 3EX7C 2DY1A 5C18A 1GP2A 1QHSA 5H8WA 1E2DA 4A6XA 3U7FB 4ILEA 3UPUA 4MGIR 2IEYA 4HAYA 4JLPA 2GRJA 4W7SA 1G7SA 3LNCA 3G82C 4NMMA 4YMUA 3EPKA 3BIFA 3Q72A 4AURA 1KO8A 1KKMA 1IXSB 3A4NA 3IQXA 1E4YA 2XXAA 2H57A 5J4KA 3NTUA 4E09A 2O5VA 4WIAA 4AIIA 1OIVA 4US0R 4AYWA 4GL2A 2B92A 2JEOA 2FMXA 3KL4A 1PVOA 5BN3A 2R6CA 4XWAA 2RGAA 4V0OA 2IK8A 2JLSA 1TQ6A 3DEFA 1Z8FA 2FOLA 3WRXC 4HDCA 2V6IA 4EQ6A 1NBME 1E2FA 1E9BA 1TQ4A 4EPYA 2IYZA 821PA 1E2GA 3C5CA 2XSZD 1KKLA 1ZD1A 4TQUS 5SZKB 1PV4A 2FFQA 2ANBA 1YKSA 3NWJA 3OF5A 1U90A 1AM4D 2QP4A 3G0HA 2HCBA 2BKUA 1NMXA 3PR1A 1DG1G 5FTJA 4EAQA 4BEBA 4Q9LA 2ODEA 3SN6A 3UG6A 4MYTA 1C9KA 3DHWC 4TL8A 3VQTA 4OKSA 2ASEA 5HZHA 2XOKA 1G8YA 3H1TA 4PX9A 5TV2A 4KFRA 1JPNA 3OEED 3CNNA 1EFHA 1F60A 1AZSC 1PLJA 3K53A 4FN5A 3ZZUA 1S8FA 1UBEA 1RYFA 3DPUA 1XXHA 3U44B 1WBBA 1VIYA 1GRQA 4Q19A 1SXJA 4G0NA 5DI3A 2ZEJA 3A58B 2CCGA 4OQNA 2AL7A 2BBTA 3K0CC 2V7QD 3KKQA 4QG7A 1OHHA 1JB1A 2ZSBA 4KVGA 1I2MA 4UJ3A 2J9RA 4A15A 2IS2A 2O8BB 3PITA 1AKYA 3AB3A 2YNMA 3U7GA 4N0EA 4FWTA 1CJUC 1U2RA 3I1FA 3CUEF 2P6RA 2DWPA 1S1MA 1OKKA 1NSFA 3AVOA 1XJQA 2QE7A 5DN6A 3SR0A 1XPRA 1PUJA 2P2LA 3WHKA 5CB6A 1JR3D 3UKDA 1P3JA 4TT3D 5HCNA 1DAFA 4EIWA 2REXB 3DZDA 4QBIA 4JL6A 1F48A 4L9SA 5JJKA 2GAAA 3EPLA 2WAYA 4I4LA 4M1YA 4M0LA 1W36D 4LBYA 3B1VA 1U81A 5CLQA 4EJSA 1IN8A 4O25A 4C2TA 4G1UC 1RRGA 4I81A 2QUZA 1XBTA 2IS1A 5L3RA 3LLUA 5IRCD 5EE3A 1GIAA 5SZHB 4DSOA 1N5KA 5LD2C 4O2LA 1JAHA 2B8TA 1YR9A 2OESA 2FH5B 3DVLA 1YJ5A 1KNQA 1T3HA 3SHFA 3B1YA 1RRFA 2E9SA 3AVWA 3ZJYA 3QVUA 4D0NA 4BLQA 1NRJB 4NCHA 3CRW1 3I5YA 2MSEB 2QZ4A 4OHYA 5C46F 3BB3A 3H84A 4BPBA 1IJEA 1GSIA 3X1DA 2YV5A 5DYGA 5J4VA 3HR7A 1GILA 4GRAA 4LC1A 4IJMA 1S3GA 5E7JA 1UEJA 4IFBA 2PLFA 1GTVA 5JFGA 1KOFA 4KO8A 3QENA 4GMDA 3SC3A 1J2JA 1ZM3A 1L2TA 2QU8A 3QF7A 1YZLA 1SVKA 5FBVB 2D62A 2P6UA 2LKCA 4PFSA 5FL3A 4M9QA 4KODA 5KDLA 1GWNA 2G1JA 3TQCA 4BE7B 2RGGA 4DDTA 5FOUA 5BXQC 4WXPA 2F1HA 1KMHA 1KI7A 3QEOA 4ESVA 1FMLA 2ZE7A 2DFNA 5FBWB 3SYKA 1LW7A 2X77A 1Z83A 4BZXA 3W6OA 2RCNA 1Q3TA 1KI8A 1H8EA 4Q01A 3SJZA 1HURA 1L7VC 4DC9A 4B44A 1ZJ6A 2CL6X 3P1JA 4EDHA 4PXAA 2ZRLA 1E2PA 3C8UA 3A1VA 2Z5FA 2OSBA 1VPLA 3EWSA 3THYA 5LD2B 1DVRA 1GVNB 3LW7A 3I73A 2ZS7A 2RGEA 1JEEA 4PQRA 4DDVA 2YC2C 3QXSA 5M04A 2IYTA 2Q3MA 1FP6A 3LDAA 3FFBA 5IK2A 3P20A 1G7TA 5CDFA 4F4CA 4QGHA 2VF8A 2IYXA 2W6ID 4IVQA 5GJVC 2IYWA 4LDJA 1H8HD 1RE0A 3D31A 3P27A 2PEYA 4G5SA 4Q02A 1P9RA 4TZ0A 3BH0A 4FMDF 1HV8A 1XMVA 1YRAA 2QT0A 2ZJ2A 2J41A 2XOKD 2V6JA 4QBFA 4A0HA 2GXUA 3I61A 1VIAA 2V9PA 4WZAE 1RZ3A 3FYHA 3VAAA 2ZE6A 2ZUCA 2OCAA 4TMZA 1SKYE 2OFXA 2CHVA 3SFZA 1OFUX 4BFZA 1CRQA 2VPPA 4PC2A 4BLSA 4LWZA 1KK0A 1JI0A 3NH6A 4DRZA 2GDJA 1B0UA 2DFTA 1U8ZA 3CZQA 3JZAA 2RGDA 5LB4A 1SXJE 3WY9A 3FHTA 2O8FA 1LF0A 2RH5A 2YHSA 2RGNC 5JEDA 4WA7A 4P32A 1A4RA 1Q44A 4MUBA 1OXVA 1F5NA 2PBRA 4V0NA 1UM8A 2ZYVX 1G20E 4ZCLA 5DE3A 1R6BX 4OI1A 3WYFA 4EPTA 3UMSA 1DAMA 3FMIA 1NNEA 4JYCA 1RJ9A 2GZAA 4US2R 4F91B 3T15A 2X8AA 2WPDD 3AGPA 3WNCA 1KI3A 2CJWA 1SGWA 5B30A 2QBYB 3PCRB 4AYTA 4C0AC 3NC0C 2XTMA 1XEWY 3RC8A 4US1R 3GJ3A 2XZLA 4LGMA 3SU8A 1BOFA 1E0KA 1P5ZB 3X1ZA 1DOAA 2ZRPA 4II7A 1NJFA 2C9OA 3W5JA 4QGAA 2C5LA 1YZQA 2WHXA 2UZ3A 3NDPA 2GXAA 1N5LA 1J90A 4PAMA 2DHRA 1IN4A 1GRRA 2AHOA 3TSWA 4BLPA 2VQSA 3PEYA 3LBIA 1EG7A 4GP6A 1GL9B 2WWHA 4PR0A 3ASZA 3CR8A 4QKQA 2JLZA 2ZRHA 1HH4A 1II8B 3L0PA 3KFVA 1G6OA 1IQPA 1W47A 2AN9A 3QKUA 1EFUA 2A3RA 4RFSB 1NMYA 1CF4A 3EAQA 5KNBA 4JYBA 4QNMA 3IBGA 4YXWD 2WJYA 2DCUA 3MRSA 1TTTA 1TUIA 3BAFA 3GLFE 1Z3IX 1RIFA 1NL3A 4QJ5A 2C77A 4D82A 3MWJA 2ZANA 3A1WA 2ZRNA 2MSDB 2ZI4A 2AD1A 4CIDA 1LNZA 2VHQA 4B3XA 4Q9HA 1Y63A 3K70B 3AUYA 1ETUA 2OG2A 2ERYA 5B64A 1GKUB 2D3WA 3FDIA 3GJ0A 4LJ8A 2OAQ1 2BVNA 2N46A 1CJVC 4DBLC 1Z22A 2IUSA 4HDOB 1XX6A 2CVFA 1RPZA 5KDOA 1N0UA 4P4SA 1E9EA 4PO1A 4TTQA 1SZPA 2LKDA 2HYDA 1R0WA 1Z07A 3CLVA 5EP1A 2CE2X 2FNAA 1RFLA 2DWQA 3UXMA 1G5TA 2NOAA 2I1QA 4Q7JB 3IIMA 1W5TA 3FHCB 3EZFA 1JALA 2ODWA 3TUZC 1GKYA 3EC1A 5AJZA 2F1JA 4BZQA 2AXPA 3RVBA 4F38A 4GZMA 4A8JA 1P6XA 1NP6A 1XFAA 3LBNA 4PANA 3FMOB 3GLGA 3UIEA 3AF4A 5FUXA 1KAOA 2O52A 4NP6A 1S2MA 4QHSA 1ZM7A 3K9HA 2VP4A 4NONA 3VR1A 5EE0A 5CITA 1S4QA 4PC1A 3RRMA 3DL0A 3IBYA 2FN4A 4GFDA 4D26A 1V43A 5IDVA 4MH0R 4DVGA 3ZH9B 2WWYA 3L8YA 4IDPA 4Q4HA 4PSVA 4JL8A 2HCJB 3TNFA 3C7KA 4KBGA 2OEPA 1G7RA 3LBHA 3CPHA 4IOLA 3B5JA 1HT2E 4Q47A 1KZ7B 1QHNA 1II8A 4OL0A 1ZNWA 3BERA 5KYKA 4AK9A 4BECA 1GM5A 2YINC 2ZRDA 5B57C 3IPXA 1OXTA 3KFXA 3THXB 4PPGA 4Q18A 1Z6GA 4JT4A 1RKBA 1R8SA 3NBZC 2VL7A 2QMHA 5JJLA 2QPOA 4DLVA 1F6BA 3D8BA 3MUFA 1IBRA 3O47A 2FSGA 2O8EB 3C15C 2ZRJA 3QPWA 2Z4SA 1ZC3A 5KOYA 4UXJA 3L43A 2C03A 4GT1A 1ZU5A 1N3BA 2QAGA 3NBYC 1N6PA 2ZQ5A 3CR7A 4U02A 1P75A 4IFEA 2J0VA 1N6LA 1MABB 2G0TA 2GTPA 2WOOA 3KUDA 4UNSA 4TLCA 2H17A 4C2UA 3QXCA 3VNVA 4TLDA 3AF1A 2BMDA 4CVNA 1CBUA 4PPNA 1XTRA 3AVVA 4A82A 1FPMA 1VHTA 2FA9A 1OFTA 2IT1A 4IOKA 3R20A 1UPTA 4ZDJA 4JLBA 3WYAA 4DXAA 3CRQA 4RCYA 3RSOA 2NPFA 1IOZA 3TBKA 2WIAA 1XTQA 2PLRA 2IHYA 1XPOA 4B3GA 1T9HA 2WJJA 5DNYB 4Q7KA 4M9XA 4DDWA 1U8YA 2BCGY 1WE2A 3VR3A 5BWMA 1X3SA 2ORWA 4KFTA 3RS0A 4ASUD 3MAAC 5JEEA 3DMNA 2XB4A 4DWJA 1XJCA 1FTNA 2GZHA 1KI9A 1XCPA 1VYUA 2O8CB 2GJSA 2ZUDA 3CB4A 5EXSA 1JR6A 4WXRA 2DPXA 5KPJA 1Q57A 2CXXA 4TSFD 4PQYA 4B3DA 4U5XA 1E32A 1KSJA 2CNWA 3A36A 4BEJA 1P73A 1UAAA 4NTZA 4RJLA 2WSSD 1G8GA 3NBFA 4XOIA 2ATXA 1SVLA 1N2CE 3PVSA 1NMZA 1I4DD 1U9IA 4OI4A 4G5RA 4FWIB 2ZU0C 5L8VA 1RW4A 3GFOA 4AKIA 2JA1A 5C2JB 4UXIA 4P3YA 4TYYA 4BFWA 4TMXA 1E0AA 1UKZA 1P72A 2SHKA 1QHGA 1OH5A 5J4LA 4AKHA 1GFIA 4MYCA 5CK4A 2QP3A 3RAPR 3DZ8A 3GJXC 4CZ2A 3G5UA 1VG1A 1CS4C 3OIUA 4POAA 2C2HA 2XTNA 4OK3A 1XMIA 1ZIOA 2CCKA 3KUCA 2RGCA 5CLLA 3OHMA 3QE0A 1GKIA 4JL5A 1Z47A 1MV5A 1IN5A 5FOWA 2O8EA 2F3TA 1PUIA 2AFIE 2YJTD 1QVRA 4JJZA 3U7HB 3MWKA 3SYLA 4ZIRB 1NN0A 5TB5A 2JLRA 1S0UA 2R6FA 1P2SA 4RZ3A 4TTPA 2V4ZA 2VLIA 1D8TA 1GOTA 2PCJA 2Z0MA 3GP8A 4RD3A 5J40A 2RMKA 1RRPA 3PV0A 5JWHA 4TYQA 5F2EA 2ZRCA 4M1OA 2PZGA 4OYHA 3A1UA 1VYTA 4IXMA 3TLXA 2HT1A 4I99A 4EPRA 1NF3A 2IL1A 2GJ8A 4L16A 4Q4HB 2QSZA 1VG0B 4KJZA 3W3AA 4TLBA 3AH8A 3I4LA 4HAZA 2F43A 1E2HA 1CLUA 2IYUA 2DYKA 4URZR 1TEVA 2QORA 1HT1E 3HU1A 3AV0B 1F3OA 5GVSA 2DFLA 4JVMA 1UKYA 3PUYA 1K8RA 1NN3A 2QMEA 2CVHA 1SXJC 2FJUA 3N2EA 4MGYR 2IEZA 2YKGA 1NG9A 3DM9B 1AS3A 4DSTA 3X1YA 2REBA 3ZIAD 4TWZA 1VG8A 1I4LD 3LY5A 2BJVA 2OFWA 3CM0A 4LY6A 4M1MA 3RS2A 3TMKA 3WNBA 6Q21A 4DCNA 3FGNA 1CKEA 4TMVA 1PLKA 1J7KA 4YC7A 1KGDA 2JAQA 1EK0A 1FUUA 3AVPA 5GADl 4RZ2A 4QM6A 2WBLC 2Q21A 1Z6XA 4P4SB 1ZCAA 2PT7A 1W0JA 4HLUC 5CYOA 3Q8XB 2WJIA 3PUZA 1T91A 2E1RA 3SS8A 2EQBA 3BOSA 3ZZTA 2GHIA 1G16A 2PT5A 1IXRC 2P67A 1BYIA 1D5CA 2O8BA 3B9PA 1IAQA 1TADA 2OBNA 4MKIA 3X1WA 5JS8A 2GZDA 1UDWA 3LV8A 4CEHB 5DI9A 1KI2A 1I2DA 2VHTA 1OXXK 3LQRA 1M7GA 2H18A 1Q0UA 5GJCA 3T5DA 3RANA 1F2TB 1N5IA 1Q20A 2ZI6A 4ZDWA 3VNUA 4JLMA 2C9CA 1KY2A 4URUR 4ITRC 1CR0A 1OYWA 2J3EA 1KZGB 2FPLA 2JJ8A 4TT3A 421PA 4TSFA 3RDPA 3F5FA 4GOJA 2GCPA 3U60B 2YWHA 1RC8A 1P60A 3QIAA 2QM7A 3AF2A 3T1VA 2TMKA 5KDDA 1ZM4A 4LJ4A 1D9ZA 1G19A 3QKSB 4RFSA 3ICQB 3MCAA 3PQCA 4TL7A 4Q9IA 3RS5A 4C0BA 4K46A 3N70A 1LB1B 1HYQA 4C0HA 3CPJB 1FZQA 3R8CA 4J0QA 1GDDA 1LVGA 3CRMA 2ZJBA 2YWGA 5BYJA 1VECA 2ANCA 3W6NA 1F2TA 4NYIQ 4TMKA 5KU1A 1Z2CA 1GG2A 2MMCA 4N3NA 5DHFA 3IQWA 2QAGC 1F2UB 4XWOA 2C95A 3ZVNA 3RWMB 5FTNA 1TAGA 4LYJA 2WSMA 2X1VA 1M2OB 3K70C 4KHZA 4NYIR 4WW0A 4LPKA 2A2ZA 2VTKA 2J0SA 4HEJA 3MFYA 2HXSA 1ELOA 4H1UA 4Z8YA 2ZE8A 3ZVLA 2J46A 2ORVA 3MLEA 4PAOA 2EWVA 1ZD8A 2HF9A 5CIWA 2KBEA 2Z43A 3PUXA 4B3BA 2XJ4A 3U5ZB 2LCFA 3D3QA 4DLUA 2R6DA 2GF0A 3TE6A 4HAWA 5JWOA 5TMPA 2PZEA 3AP2A 4IEIA 4V0ME 3THOA 4HZIA 1E2EA 3GLHA 4HB2A 4O2RA 5AJVB 1KSGA 1XZQA 2YZ2A 5H70A 3WNDA 1OIWA 2BBWA 3GEHA 3SFVA 2B7BA 1EESA 1ZINA 3F0TA 4Q4JB 3GLIE 2FX3A 4B43A 1QHYA 1QRAA 1WA5A 2O8DB 1W0KA 4MUAA 1TPZA 2EVWX 4XD7A 1N6RA 2ZU6A 1H65A 1LFDB 2FU5C 2O8DA 1DELA 3PJRA 4M1SA 1NLZA 4KYIB 3HU2A 4JVNA 3IKJA 3VX4A 3SDZA 5CIQA 5G53C 4HSEA 3K0FA 4CRWB 1NG1A 1S96A 1AJEA 2L0XA 5AUOB 2IX3A 3GLHB 5E95A 4PAQA 3F8TA 3U6KA 1ESNA 2GWHA 2AK2A 2G83A 3RABA 3TJZA 1UDXA 3CKLA 1JECA 4RD2A 4TYWA 2QGZA 4TLEA 3W9YA 4Q4AA 4L4UA 2R65A 4EFLA 4EJSC 4GPTA 1Z2AA 4ZO4A 4PPQA 4XH9B 3K0AA 3KKNA 3ZLJA 3MD0A 1ZMXA 1CR1A 1P61B 3EASA 4C30A 3REFA 2KI5A 2NPIA 5EP3A 4RD6A 3OFNA 2BMFA 2R6AA 3HYRA 3BFXA 1NBMD 4NCIA 2JLXA 2JLVA 3WRYC 5EXPA 1E9FA 4KFUA 4YDSA 4F4IA 2CL0X 1D6JA 5L3VA 2V3CC 2DB3A 4FCTA 2QEQA 4V02A 1GNPA 1L8QA 5FOVA 1SVSA 1OHHD 4LHZA 3OAAA 3FKQA 3KTAB 2GAOA 2WWFA 3VR5A 4BFXA 1ZRHA 3OZXA 1E2MA 3C4JA 1G41A 1AS2A 4UJ5A 3UWOA 1KMHB 3CH5A 4DCUA 2WKRA 1BO6A 1O87A 1XF9A 4TLAA 3ND9A 4LYFA 3W8NA 3O8CA 2J7KA 3VKWA 3NVAA 1E2NA 3RS4A 4OQXA 2FEOA 1JAIA 3QKSA 3K70D 5KO2A 1CU1A 2ZI9A 4UNQA 2D2FA 2NO7A 2NO1A 2KJQA 1N5JA 1NJGA 1U8AA 1XMJA 3C41J 1ZP6A 5FPHA 5BYKA 1Z5ZA 5AUPB 4A8JC 2F6RA 5CJPA 4HUTA 1SQ5A 1G3UA 4KLZA 2O8CA 1R0ZA 4B6FA 2H92A 3QNUA 2FE4A 4RD0A 1NI3A 1Q1BA 1NVUQ 1Q22A 4JBXA 3KZ1E 4DEXA 3T12A 2AWOA 4DSUA 2ZSDA 1ZUNB 4MRNA 3LX5A 3OEEA 4G5GA 3CWQA 4P4TA 4YQFA 1EFCA 3VR2A 5F3WB 1HE1C 2J7PA 2V1XA 2ZR9A 3QKRB 5AJWA 2P3SA 2QY9A 4K8OA 4P0TA 1Z63A 4R9UC 2ORIA 2VP2A 3KQUA 1LTQA 3FB4A 2FSFA 1PJRA 1KJYA 4WZBE 2V7QA 1FQKA 4HDQB 4ACBA 1NIJA 1NVVQ 1T4GA 2GEDA 4OQLA 3GJ6A 2W6JA 5ELXA 4DB4A 2YWFA 4XVQA 5CK5A 3ZGXA 2JLYA 2PX0A 3A1SA 4OBEA 4B33A 1AKEA 3TAUA 4QHTA 4PHFA 2ERXA 2IUTA 1FUKA 1X1RA 4KFSA 1E2IA 1W44A 4RZXA 2JDIA 5KTYA 3OEHD 3AVYA 4LHWA 3CIOA 1OFIA 2QSYA 4JJKA 3VU9A 2VP9A 4TL9A 3KJEA 2VRWA 3DM5A 4Q1BA 4JSYA 3FMPB 2QM8A 2ZROA 4HLCA 1OH8A 4A2PA 4JLJA 4NHOA 4BLTA 4Q7LA 4QXAA 1K6MA 3RS3A 2HF8A 4V0MA 1SXJB 5DI3B 4B2PA 2VP6A 4DLRA 4O3MA 1NLYA 1FQJA 3GLHE 1G18A 1XD2B 1BMFA 4F93B 4ZPXA 3R7WA 4MA4A 3CRVA 3QPVA 4PO9A 2X2FA 4D2IA 3J81k 4MKFA 5FBRB 3CX8A 2H5EA 3U2QA 1FW6A 1T0JB 2EYQA 3K1JA 1NKTA 4QM7A 1OB2A 5FPYA 2JJ2D 1WXQA 3LQQA 4V0KA 2ODBA 1MR3F 2GCOA 4DLYA 5FTLA 2GCOB 4JSTA 2IA5A 1U0LA 3KX2A 3SE0A 2EFCB 5L3SB 4HUQB 4LUCA 4NYMR 4Q9JA 5FBLB 3GLIB 3B1WA 4M1TA 2GCNA 5FI0B 4B35A 3EW9A 3ZD7A 3PEVA 1XD2A 3NHAA 2W83A 2WM9B 4XWKA 2QENA 3E1SA 1OE0A 3LA6A 4NYMQ 4A4DA 4ZIRA 1T3LA 1KJZA 4RFVA 1MO3A 4W5WA 3L2OB 1XPUA 4C0JA 2WWGA 2ZSFA 4Z8XA 1OH7A 4ARZB 3N2IA 5CYPA 3SNHA 3TQFA 3AVXA 1ZNYA 5KPDA 1W4CA 1ESMA 1JQJC 1Z0IA 4C0QC 4NYJR 3VU9B 5FPSA 4LI0A 4ZDKA 4P4UA 1XD8A 5HCIA 3B2EA 1P7CA 5KNCA 5KNDA 1HTWA 2BIFA 2FPKA 2H16A 2MSCB 4DCTA 3U4QA 4JVLA 1SVWA 2QPTA 3HYTA 3TR5A 3W6PA 4Z51A 1WB9A 4GDFA 3VKHA 3MG9A 1P9WA 1Z29A 2NZJA 2ECKA 3KJHA 3WMGA 2IYSA 3IO3A 4HZUB 4CEIB 1OT3A 4IEEA 1ZD9A 1WMSA 3TUJC 1JPJA 1XP8A 2NTYC 4C0SA 1M1YE 5D3QA 4M2LA 4PC3A 4CYMA 3V4RA 2D74A 3QOFA 2GF9A 1X86B 4BFYA 3U6BA 3T1TA 2CBZA 3HU3A 4LCBA 4UNPA 3RLFA 3EZ9A 5DIFA 2AR7A 4HATA 3T5GA 3ND8A 3TSZA 4UNNA 2VSOA 2GK7A 1G64A 2YVUA 1GL7A 3W90A 1E1QD 4M4SA 5FUWA 4OHWA 2ZAOA 5JS7A 5AK0A 3IGFA 3RNLA 4IRUB 3K0CA 1R5BA 2ZYUX 4X8HA 2P65A 4YMVA 5B58C 4G5OA 4DLSA 1DAKA 3TGPA 4KBFA 4IOMA 5C4MA 3GJ5A 3FOZA 1FNMA 3AQ4A 1T8UA 2FF7A 3EIHA 2UZIR 4LYAA 3ZQJA 5LPNA 1XJ0A 4M53A 3AP3A 1AK2A 5FR1A 3IDQA 1SVOA 1K5DA 3GJ7A 1CEEA 1E1RA 1TUEA 3PG5A 3Q7QA 4OJKA 5EUMA 1EX7A 5EZ6B 5LDDC 1VG9B 2JLUA 1BMFD 4CEJA 1G3MA 1KDPA 4DDUA 3Q7PA 1TU4A 1M7BA 1KHTA 2Q9CA 4M21A 5HR5A 1AA9A 4PZLA 4Q03A 1B23P 2XAUA 2D4HA 3O8DA 3VHLB 4XD7D 1W0KD 3K09A 4URXR 3AF0A 1IN7A 4IKEA 1UBCA 1IONA 3IIKA 5SZJA 3RRZA 5BN4A 1WCV1 3VHXA 1A1VA 2HYIC 3V4FA 3BB4A 2IF0A 3SEAA 5DLQC 4BFTA 1WRBA 2G9NA 1XEXA 2HJVA 4YMWA 3OEHA 5TXGA 2O0HA 5J47A 1GITA 2QBYA 1DARA 4Q7MB 2CLSA 4V0LA 1T5LA 3A8TA 1DAEA 2D2EA 4GZLA 4GNKA 1P62B 4LV5B 3DKVA 4LJ5A 1J70A 2FDCA 1VCMA 1ZM2A 2N42A 4B3CA 1R5NA 2QAJA 4CEJB 2XSZA 4MKHA 2RAPA 3FVQA 4AC9A 5B2ZA 1W7AA 4EUNA 1SHZA 2QGNA 2XJ9A 1MO5A 1YQTA 4A0RA 2O8FB 1HUQA 3Q5DA 2XNDA 1T0HB 1ZUHA 2AKYA 3BGWA 1Z6AA 1CJTC 4QGFA 2CLCX 5FOSA 1DO2A 1JR3E 4FMBB 5L3QB 2J1LA 3TW8B 2GNOA 2FGJA 4NL4H 1SVIA 3I72A 2W2VA 3C14C 1J99A 2W6IA 4Q1EA 4FCVA 4F4JA 1VTKA 1VCNA 3TW4A 3ZDQA 1KK2A 4Q9KA 2VH5R 5EP2A 2R8RA 3ONWA 2GVZC 1Z0KA 1EFTA 2VYFA 2IXFA 2QPAA 1IXZA 3GJ4A 3EARA 5D3MA 3ZS8A 4BRWA 2F1RA 2O0JA 4OK6A 3VR6A 4KVAA 1L4YA 2G6BA 5FFMA 3KKOA 4C0KA 4W5JA 4MKGA 4OHXA 2BBSA 2K5UA 3KQLA 1X8JA 4JVSB 2EFHB 1G8PA 3B85A 3AF3A 3FE2A 2I1VB 2JLQA 2CMKA 1Z28A 2WMNB 3BH7A 3CZPA 3K9NA 1E3MA 2KBFA 2YOHA 3PUWA 3ZYCA 4B74A 2BBOA 4Q00A 4DLTA 1E9SA 5DO9A 4F7WA 4JLVA 5IT5A 3THYB 2B7CA 5DGXA 2PX3A 1TF7A 5K8IA 3CW2A 2V54A 2XX3A 1CR4A 1D2MA 1YE8A 4FD2A 4B48A 4JKYA 2GKSA 4Q5IA 5H1YA 5C4GB 3IEVA 3L8ZA 2DBYA 2GVDC 3ECCA 3NXSA 1CP2A 4FCWA 3AVQA 3U3OA 4L5BA 3T35A 5CDFE 1F2UA 1KDOA 1U98A 1US8B 5JRJA 3S1AB 2IYLD 3CBQA 2G77B 1D9XA 2OT3B 1E79D 4LRWA 3ADDA 3EZ6A 3RYTC 2RHDA 5DSZA 5H68A 1EWRA 3EWAA 3FFAA 2A5FA 4LHVA 4H9GA 4QBGB 4CT5A 2R62A 3OIVA 4TYPA 2NMVA 2ONKA 1QZXA 2J45A 4F92B 1UBFA 5G3YA 3DOEA 1IY0A 2JDID 2V55B 3KXKA 4AKGA 1XCGB 1OSNA 1FOEB 1V5WA 2B8WA 4X8MA 2C98A 3BH6A 4EKDA 2C9YA 2IYVA 2Q6TA 3I8SA 2OHFA 4DIDA 3KDSE 2WTUA 1MRNA 2REOA 2W6JD 3P4YA 1E69A 3E70C 4KI0A 4W5HA 2YOFA 1G4AE 5JJIA 3KQHA 2VBCA 2VA8A 4MRPA 1WP9A 4C4PA 3GEEA 2ZS9A 1BIFA 2D7DA 3VKGA 2GBLC 3VFDA 4CEHA 4NH0A 2JASA 1YR6A 1YZNA 1ZCBA 3HDTA 3QXJA 2FPMA 4ESHA 1CIPA 5HPYB 1J8MF 2QRZA 1W49A 3EZ2A 1EFRA 1S1CA 4IVRA 2JJ2A 1P2TA 3MJHA 2G0NA 4OJQA 3M6AA 3EA5A 1OKKD 3VMFA 1XEWX 4KSBA 2F9MA 2CJWB 2BC9A 1TU3A 2GJKA 4DEYA 2XTZA 5TVKA 3BS4A 3EC2A 3QEJA 2P5SA 3CH4B 4TQAA 1WDTA 3JVUA 4JBYA 4JLOA 4PZYA 2WPDA 4QL3A 1G5RA 3OE7A 3I8XA 3R9XA 3FMFA 4JLNA 4QHYA 2Q0HA 4MITA 4Q1CA 2Q9BA 3BXZA 1YR7A 2IS6A 1UJ2A 3NEJA 3LXRA 4LC0A 1R0YA 3LO5A 5JSZA 4ERNA 3BE4A 2CK3A 2OXCA 2XEXA 3QVVA 4P31A 5DISB 2ZRGA 4QJ3A 3O8RA 1JBKA 4M22A 3EPJA 4FMCB 4D4KA 1G1MA 3CX7A 3EG5A 3Q3JB 1BKDR 1GNRA 4IDQA 4LJYA 2OUKA 3UATA 1ZVQA 2O0KA 2OV2A 4JLKA 3LAWA 1XXHB 2IYYA 3T1OA 1LY1A 2JIZD 1MO6A 2CE7A 5FOTA 3QUSA 3MSXA 4GOXA 4KSCA 1NIPA 2WJGA 4PHHA 1DAHA 4RCZA 2RB4A 3RRNA 1G3QA 1EX6A 1COWD 3EA0A 1MT0A 5AR1A 2J5XA 4MDEA 4B2IA 4LZZA 2FSIA 3KJGA 4A6PA 4AI6A 1UKEA 1XEFA 1IJFA 2J7PD 3B13B 3CF6R 2G88A 1QG4A 3C16C 1CRPA 5FL7D 4LYHA 4A92A 4ZDIA 2P6NA 2QRNA 3I62A 1LF5A 4LBVA 4V03A 1Z0JA 5CM8B 1OXSC 4YLGA 1IY1A 2ZRIA 3GQBA 1UADA 1VMAA 2FGKA 3B7GA 4DB2A 4Q4LA 2IS4A 4I1UA 4X8LA 4LK2A 1FX0B 2CDNA 1JEDA 1G4UR 3TK1A 2RHMA 3RS7A 2JJ1D 2BOVA 4EQ6B 3SQXA 4LPSA 5EP4A 4U7DA 1AQYA 4S2EA 1KK3A 4ASUA 5IK2D 5JHGB 1A7JA 5BN5A 4TZ6A 2ZSAA 3LWNA 4Q48A 4LSGA 4FI3C 1C1YA 3IILA 3A37A 4QJ4A 2ZRMA 1TQ2A 2ZREA 1DG3A 5LBIA 3KXIA 2ATVA 3QF4B 3ADBA 3UK6A 2IUUA 3I5XA 1G9XA 3ZS9A 2ZTSA 4C7OA 3EPHA 5KUTA 2J59A 2NG1A 2QQ0A 2JGNA 4ZCIA 5J4HA 1LV7A 2FFHA 3K0AB 4DUGA 4A9AA 2CHGA 4MRVA 3GLGE 2BJWA 2VEDA 2IXGA 3FHOA 4B76A 5F98A 1OLOA 2NO6A 1ZBDA 1FFHA 3P4XA 4KLNA 1ANKA 5ANRB 3RHFA 2D06A 1RYHA 1JJVA 2ZYWX 2WJHA 4GSYA 1KI6A 1E9AA 4ZV4A 5J5CA 4JIMA 3GLFB 5TY0A 4FXPA 3ADCA 4JS0A 1HQCA 2XB2A 4O0MA 5E3HA 3RC3A 4WOPA 2QL6A 3T1QA 5GVRA 5EJEA 1OW3B 2A30A 1BYUA 2VF7A 1R4AA 3AKCA 4GP7A 1O3YA 2ZJYA 2GA8A 3C5HA 1AGRA 4ABYA 3R8FA 2F55A 2Z6VA 1TF5A 3LD9A 2EYUA 4WVFA 5AJXA 4DHEA 1EWQA 4CF7A 2HV8A 4LOAA 4XIGS 3WHLA 2C04A 5DYIA 4BZPA 2QMUA 3KKMA 3EZ7A 3U61B 3WP1B 2W0SA 2CL7X 4PHTA 4UKDA 1YU9A 4I1VA 1HQYE 2QTVB 4H1VA 2NO9A 5KHOC 4G01B 3PIRA 1EGAA 3BORA 5P21A 1Z08A 2WZQA 2BMJA 1N6KA 3GMTA 3H4MA 2EWWA 4KYUA 2FWRA 2ZSEA 4OQFA 4PC7A 5JCZA 4WAUA 4WBSA 1MABA 1T8TA 5HKKD 3AEZA 1KI4A 1TMKA 1G8FA 4R7ZA 4R98A 1MKYA 4B3FX 3UWKA 4JLDA 4LHYA 2X19A 4GBMA 4P33A 3GCGA 2IWRA 3TAHA 2OM2A 1ZW6A 2YOGA 4LBWA 1DADA 2Z83A 4DUGD 4B73A 1XRJA 1N6IA 1HA3A 4RKFA 4K81B 3Q5EA 1J8YF 1UEIA 1E0JA 3EIEA 2GK6A 2J87A 1SKYB 3FKSA 5KSOA 2NO0A 3VX3A 3GLFA 1FP7A 2FV8A 3DKPA 1QHHB 2WWWA 3B8HA 4PSAA 5EE5B 1JXMA 2A5GA 4URVR 2W2XA 4XJXA 4B47A 2ZI7A 2NZ8A 2RKOA 2WJVA 2ZJ5A 4AD8A 3L0IB 4G5QA 1M34E 1CXZA 1A82A 3M0EA 8OHMA 3HWSA 2W58A 4Z1MD 2GBLA 2FZ4A 3LX8A 1E0SA 4Y0AA 1IN6A 3W5IA 1UBGA 2AWNA 4I1SA 1TX4B 5FBQB 1SHKA 3FWYA 3OE7D 3LH5A 1GL6A 1T3SA 1G6HA 2IXEA 1I4TD 1ONBA 4RD4A 4BUJA 2QI9C 2GXQA 3N5CA 4M1KA 2JATA 4HYYA 5FH9A 4A2WA 4RVCA 2A5DA 1T6NA 3BRWD 1CTQA 4GMXA 2VHJA 1BH2A 3MWYW 1N6HA 2OZEA 1UF9A 4N0DA 4HAVA 1FX0A 1CJKC 3BC1A 4IXNA 3O8BA 621PA 2OBLA 1VCOA 3CO5A 1L4UA 1NN1A 4LHXA 4R71A 1E2JA 3DOFA 1TL7C 4HB3A 3ZVRA 3A4LA 3THWB 2WWXA 4B2LA 3QSYA 4DT1A 2OCBA 1KO7A 4EPXA 2A7QA 1AQUA 4MQBA 5JCPA 2DFKB 2I3BA 1NN5A 4MYHA 3I32A 1W2GA 2ZPTX 3BBPA 2I4IA 1W0JD 3B60A 4R2IA 5FI1B 1S9DA 4M9SA 4QC2A 1R8QA 2EU8A 1YRBA 1W46A 2WICA 2J0UA 3LLMA 3X2SA 4EPWA 1Y3AA 3BB1A 3TKLA 2C99A 1FMJA 1XWIA 2ZJAA 3CPEA 3KB1A 1N6NA 2R6GA 4IDNA 4ZI3A 3ADKA 2R2AA 5E7IA 2WAXA 2BDTA 1Q1EA 1N0WA 1IY2A 2ZJ8A 1KY3A 2GESA 4L9WA 4DLWA 5E4FA 4EPVA 1G8HA 4XVUA 5EUQB 4CGZA 1DO0A 3SZRA 5JSZB 3ZIAA 1II9A 4E07A 3AKYA 2G1KA 1KO4A 1Q12A 2EFEB 4PTLA 3W34A 1GNQA 3WBKA 3K0EA 3D6TB 1NY6A 1KYIA 2BEJA 3AGQA 4JZKA 1C4OA 5KSZA 1W4BA 4RKEA 4Q1DA 3L0SA 1TEXA 1FTSA 4IHQA 3WXMA 3MWLA 3NHBA 5CM9C 5FPTA 3KKPA 2WVJA 3K9GA 4NCKA 1G3IA 4D4MA 4IVPA 5JECA 2IYQA 2GEUA 1A2KC 1XEXB
chains in the Genus database with same CATH superfamily
4F86A 1TVKB 1AQJA 4X7PA 2CHQA 2FW0A 3AX6A 1AUPA 1JMVA 3IQIX 5K0GA 2X2EA 4YCMA 1QF6A 3WBJA 3P0EA 3WC4A 1QG6A 2QE7D 3PDIA 1ZK4A 3WGMA 3RUAA 4TUYB 5E4YA 1ZGCA 4FJ0A 1R5OA 4TTSA 2AZDA 4WY8A 3C3CA 1EGMB 4NZYA 3C3YA 5FUYA 3O03A 2QUKA 3CNHA 3WIBA 4C5BA 4XTRA 3HCPA 5I3ZA 3NAMA 1AN0A 5TARA 2DY0A 4UU1A 2CDCA 4G67A 4KCGA 4D0SA 3AFIA 3PPYA 2QDXA 4DV4B 3RHTA 3BMCB 2PX6A 4D6YA 4GMKA 4EYOA 5D5PA 1XRRA 4DV3B 2GPWA 5KNBD 4PS1A 1ACJA 4DNFA 1X6VA 3COVA 1L9KA 2XLCA 4HY3A 3AUXA 2YCLA 2YFHA 4ZOEA 3AR7A 2W2LD 1QOZA 1E9DA 5K51A 2MOKA 3CNLA 1UR5A 3EXAA 1QQAA 3BGOS 1DKPA 1I3MA 2WC1A 2O19A 3RIYA 4LC9A 5JRJA 3SKXA 4FMCF 4CI9A 2FZEA 1KZHA 4HS9A 3S2ZA 3IBCA 3S70A 1H6DA 2O0MA 2Y2UA 4L7VA 4OAQA 1K0FA 1A9ZA 3SIRA 2IXDA 3ZV3A 4UTNA 1YAJA 3K0BA 4KN6A 1A69A 3I3SR 1FFCA 4C30A 3OJEA 4PZ9A 1WMEA 1YMUA 2OO7A 3FOFC 3ICWA 5HF5A 2XITA 4FYMA 3ZHSA 4F3RA 2RGBA 3R40A 3AIIA 2VDKB 1NNUA 3B9QA 3FUCA 1YACA 4IIXA 1KDZA 4BVAA 5CU7A 4G9EA 3PEWA 2BUCA 3EXHB 1W93A 4Y9UA 2G76A 1L7OA 2I66A 4PZAA 2J5QA 4GD3Q 1TC2A 5M2QA 4OHBA 3FGPA 3QVSA 3D5TA 2W11A 3CKYA 4BNKA 3DV0B 4YMLA 4W5QA 3DD5A 4HQ6A 2Q27A 1M8PA 1FVXA 4HZUA 1VC2A 3E5HA 3GV0A 1WW3A 2FI1A 5G0VA 4A2CA 3N2LA 2I3DA 1M7HA 2PSHA 1BGWA 3NIBA 2R6HA 3WK7A 2BTQA 1Q0SA 4A1FA 4ECEA 1GEGA 1BEUB 1ZICA 3A9SA 3GJYA 1D07A 4WLFA 1NTOA 4LHEA 3T3EA 3COJA 1MOZA 1OZAA 3PJFA 1L7DA 2HRQA 5A4DA 1XLUA 3M1IA 1UBHS 2GH1A 1N0VC 4EEKA 2RAVA 1I7PA 1NURA 1QK5A 1JXOA 2B6HA 1K9VF 2PCLA 1A5TA 3U9TA 3OFJA 4M0KA 5C4IA 3DT9A 1E1NA 1WPQA 3OMLA 4X1KB 5AKLA 4ARZA 4LJAA 3LPLA 4O4IB 2Y05A 4ZAVA 4DSNA 2EV9A 3G7UA 4I5FA 5DHAA 2HDHA 2H11A 4E0BA 1E99A 2YYZA 3AKEA 3OTHA 3IHWA 1EGQA 3IDZA 1OX5A 3R5FA 3TVYA 4P5PA 3A9RA 5TPZA 221PA 2WSSA 4PG8A 1N78A 3JV7A 4ZP1A 4D56A 1KJ8A 2A9PA 1WUYA 4F04A 2I91A 4MI1A 1L5RA 1X8LA 3GLIA 2ERCA 4U00A 2FQYA 4C78A 1EUZA 2NX2A 1N92A 2HM7A 4ZK6A 2FUEA 1JKMA 2WIBA 3QY0A 1EIWA 1J23A 3M5DA 2WFAA 1QDEA 1XDWA 1Z13A 2AYYA 4W6QA 4WL0A 1WUHS 3RRFA 1FXWF 1QFJA 2W6MA 2Y1EA 1NUPA 2NSDA 1F51E 3IAM1 5LP6A 4NEGA 5EYPA 1NNLA 4KH0A 4IZ6A 4DLKA 1YQUA 3FVVA 3NKVA 4NBWA 3KC2A 3MQ2A 3IIJA 4G4SP 1AIPA 4UCXA 2I34A 1Z2NX 1SQGA 3M7IA 1J39A 3OX4A 4CQMD 3ZVKA 5LB2A 4FWBA 3VR4A 4CMCA 4J7AA 5TNXA 2JFBA 1PD1A 3DNPA 4QRHA 3RSQA 4K8RB 2ZFUA 4MCIA 1WXWA 5HWSA 4L15A 5G0WA 2AX4A 4CDRA 1HE8B 2VQFB 1O2DA 2RHCA 1G0NA 5E6SA 3F49S 2B34A 4OA8A 4RS4A 1NJ6A 1VL6A 3KJIA 2SBTA 4XVRA 5JMTA 4M37A 4X1IB 3H3JA 4EJSB 3ZVMA 3VGPA 4FJ1A 4GQAA 1Y98A 4MOWA 3NZEA 4B75A 3D8RA 3CT4A 2ZVPX 1SHUX 3KT3A 1A5AB 3ID6C 4TLMB 2FX5A 3D2BA 1Y6FA 2ZE5A 1CUAA 4MV1A 2OXRA 2ZUBA 3VV2A 3DOIA 5KS2A 4J49A 5EJ2A 4C07A 4C4YA 1YJ8A 1C9NA 1NV8A 3ESBA 3PZBA 2YWEA 5D51S 4ZCQA 3L6BA 1DJMA 1W4RA 3HJAA 1TQDA 2GJAA 3H8SA 4R3UC 1WOMA 3PDUA 4QWWA 4RMNA 4XDYA 5JO9A 5LZ5A 2R9VA 2IV7A 4HLDA 5HM8A 5GIPE 1WG8A 2IOHA 1W48A 3KS9A 1NA5A 3WHPA 1HL7A 1NXQA 2VIIA 4NKRA 3REGA 4U0KA 4B3RB 1KEEA 2YIVX 1UWLA 5GY7A 2XAAA 4GGOA 1EEXB 4WNAA 1A9YA 3NIWA 3PENA 2YXDA 3TD2A 1L5YA 2ZITA 1W6RA 3HDVA 2PH1A 4MI9A 1YZKA 2IF2A 1VOTA 4KQ2A 3HPRA 2ZRBA 3AQIA 1M74A 3PX3A 3AYXB 3UFXB 3USCS 2XVXA 1DIHA 3KYIB 1NW6A 1D6SA 2HXYA 2ZRAA 3IUNA 3PFIA 4ZQFA 5AVRA 4EB6B 1TJ3A 1FDUA 1OF1A 5CVDA 4U2FA 4Z99A 1L7EA 3RQSA 5BR4A 4ZRDA 4DR7B 1JG6A 3D3KA 3QE4A 4LMAA 2F00A 1E6CA 1Q1QA 4CKWA 2RSLA 5KNLA 1P1BA 1DIRA 4HX2A 3PDHA 3SBEA 4HAXA 4A2QA 4Y7CA 4QNNA 2VDVE 2O3RA 3WIDA 2LGJA 1S7CA 1QV9A 1U7WA 1SEPA 2ODTX 3LUFA 1RZVA 3W9SA 2G82A 1ISPA 1RXSA 1HL3A 2ZQYA 1I13A 5JTTA 2GUWA 1E79A 1WQ4A 4ZXPA 2P9ZA 3FPGA 3MGCA 2VP3A 3STVA 5B3LA 3WQQA 1C3LA 3OX2A 1H9BA 3G0DA 2QQFA 3KYCA 3TQOA 4B71A 4GPEA 4AG5A 5KBYA 1VBKA 5DX8A 4IVNA 5TDHA 3K0SA 3KQNA 1KQPA 1PFUA 1YB6A 1ZMBA 4FGSA 4U39A 1V0JA 4HBGA 1M2HA 2G8NA 3IVXA 1W25A 4AG6A 5FBKA 1XAHA 2PKQO 2C78A 4RY2A 4UHBA 2XNDD 4V24A 4PV7A 3ZCVA 5BMOA 1WDMA 4ND2A 2QAGB 5AW9A 3R9WA 1DTSA 1CC1S 2WF7A 1W5SA 1U0SY 1YRHA 3I2IA 2QR5A 4KV9A 3O91A 1I7LA 1QLWA 1QUFA 4YONB 2C94A 2QG9A 2HCTA 2QWXA 2ZR7A 2XD4A 2C5FA 1NXOA 4H35A 3DMYA 3BFJA 4LJ6A 1PQPA 5FQNA 4BWYA 4C87A 4F4HA 2C0PA 2GN6A 4G56A 5KWSA 4TXMA 3N6RA 3FSGD 3IA7A 2X9QA 3LUPA 5UKDA 2X15A 4GLLA 4LIPD 3LM8A 1XNHA 4YMTA 4M8IA 3E2PA 1PGJA 2IU0A 3MIIA 3VDRA 3L7MA 2Z2XA 3ER8A 1YB5A 4HUQA 2CVOA 3V4LA 1GTJ1 1H8HA 1BTOA 3GARA 5AKKA 3WDSA 2A5JA 1JSRA 3I9NA 3GVCA 3KDAA 1VCIA 2EFDB 2ZK7A 5AXDA 5B55A 2QT1A 5C1IA 3VNRA 3SXUB 1KO5A 5IJ9B 5JI2E 2F9LA 1U31A 1RE1A 3LPNA 2Q6IA 5A0FA 4EGSA 1V71A 3ICEA 1N25A 3MRTA 1JUDA 5ALRA 3AR2A 3AL0C 1L5FA 4WESA 4RK4A 3HU5A 2HTFA 1CZLA 3KD3A 2PIDA 2I80A 4BNLA 4UNRA 3QKTA 4QNRA 2P35A 4D8TA 1DEKA 1J8QA 1ZYUA 2GB4A 3WP0A 1N2XA 3ODPA 1U8EA 2AKAB 2JHGA 3AKDA 5LYYA 1PZNA 4U8HA 1JQKA 5FUVA 3VR6H 4QU0A 4QUEA 3IUYA 4Q4JA 1ZNQO 1ID1A 1CVIA 4CV2A 2O54A 3IPYA 2ODNA 1H6AA 2W8BA 4OB7A 3HYNA 2GPNA 3ASYA 1L6IA 2P9HA 3P0RA 4AMBA 2ST1A 2LV8A 4IIJF 4OP3A 3R9IA 2Q3FA 4J1TA 3CLRD 1ZRNA 4OBXA 4HI0E 3IDSA 1DJPA 1GHTA 4MINA 3DDWA 3L0ZA 3AVUA 5F9FA 3DR5A 3EXG2 4O4LF 2QRMA 4O2AB 1KDRA 4W5OA 1PJZA 4MB0A 5G3ZA 1BS1A 2F1IA 3L18A 2XPCA 4F0JA 3DLHA 1WO8A 1I0IA 5I5GA 3U3RA 1P1CA 3D6FA 2C8KA 3O7WA 4ZT4A 3VBEA 5MN6A 3CF4G 4HWKA 1R9NA 4MMXB 2LUOA 2X9VA 3E0QA 1JFSA 3CGWA 3SS7X 2WFLA 1X7GA 4BFSA 4AYXA 2FE1A 3TIFA 1WB5A 2J5BA 2QZJA 2P9QA 1BHO1 1SB9A 2JFYA 3UXYA 2GM5A 4C1BA 1SNYA 2AOUA 1LS6A 1EUDA 1MO4A 3ZD6A 3B1KA 3ZG6A 2BV3A 5EPOA 5C9ZA 3BSYA 1WQ1R 3QFHA 4FFVA 3LE8A 3ZK7A 2OLKA 1RC1A 1XZIA 1YJAA 5C81A 5JXGA 4IDHA 4N6OA 2QA5A 1FDTA 2EX1A 4CKEA 2Y1XA 4B3MB 2PH3A 721PA 1JDNA 3PCXA 2G9VA 3D54D 4KDRA 5FHRA 1S2IA 1MOQA 1SN7A 1PFVA 4TYNA 3NDBB 1EB8A 1WVMA 4RX1A 4P7JA 5TLSA 3OF2A 3UK1A 2ZYAA 1KQGA 1M1NA 2EKQA 1EZZA 2C96A 2P5UA 1U1FA 1OB5A 2BHRA 5ED0A 3JQFA 3DDCA 4L5AA 1WPGA 2YN4A 4C14A 2XMDA 1X8KA 1EWYA 2QQEA 5A4JA 4M0UA 2NGRA 5B1YA 1XXHE 5EXTA 4RXMA 1R6DA 3JQFC 4LBZA 5SZIA 3R6DA 1RJWA 3JZDA 3JW8A 4DR4B 2D1FA 4RQBA 5K8UA 1XTVA 3ZHVA 2CFIA 4AMZA 2BKVA 1GPLA 4JIGA 2PZFA 3TRFA 2AQHA 4CCYB 1I2CA 4RWZA 5C7OO 1HKHA 2B21A 5F4ZA 3A3KA 1CUSA 3QBJA 2JLAA 5TEWA 1BW9B 1KK1A 3HCCA 2D0DA 3Q15C 3NBQA 3LXXA 1JWAB 1KMQA 1DPFA 2KSQA 1XCJA 1C81A 3GA7A 3W4KA 4F12A 1DQPA 4Q1FA 2ZIAA 3VPDA 2D5LA 5EKDA 1UKBA 1UXGA 1VL5A 4L3OA 4JBWA 4X8OA 5J1SB 3KZXA 2WKPA 3IUBA 2FN3A 2WG2A 3UUEA 1BCSA 4TMTA 1ETHA 2BFCB 1K08A 2FEAA 3IUJA 3OPNA 4GOOD 1ST2A 5ULLA 5K8TA 4AWXA 3ZJTA 1PNVA 1F8YA 4LDAA 4PRYA 5B7NA 3MB8A 3GGGA 3S4YA 1Z6YA 2PD4A 1J97A 4DCMA 5I7RA 3V1NA 2Y0BA 3RRJA 3Q2OA 3LG2A 2FWNA 4DGQA 3NJRA 2HREA 2PO5A 1U94A 4WN9B 1N3IA 2J9YB 4BQSA 5BMVB 2QM3A 5IKEA 1OBOA 2WHPB 3I9LA 2GRUA 4QFMA 2QMOA 4CIYA 3P2JA 4E13A 1PJ2A 4LJ7A 5CTAA 2WMOB 3D6VA 1VSVA 2FFAA 3NEYA 1NY5A 3O92A 3DWIA 4TKZA 4W8OA 521PA 4E4RA 2N47A 2IWHA 2BM0A 3V9AA 3NOQA 4DLBA 121PA 1JVSA 4ZARA 2DR0A 3QPUA 1NVKA 4G0ZA 4WERA 4B7AA 1V3QE 4Q7QA 3U4DA 2R60A 1QHXA 1BHQ1 1FFSA 1KSHA 1W0CA 4KZKA 4F56A 2V7TA 2YJ4A 3UCEA 2QPLA 3ROZA 1ZC4A 2XUDA 3RGGA 4YRBA 4RDCA 4BWGA 4DYDA 1ZKDA 2FUNB 3H2KA 4Z9BA 3TL3A 2AMLA 4E1AA 4RYLA 3MTBA 2G07A 3IURA 4PWYA 1TOAA 4I7EA 5LYJB 3FJYA 1EA7A 1X1DA 3AP1A 1VKJA 3LC2O 3KT0A 5DM4A 1RRMA 3FBTA 1WY5A 1NZFA 4L0QA 1QG2A 5SV2A 4GBGA 1LLFA 3C3JA 3QFFA 4O2BF 2DGDA 3ZWWA 1G6KA 3F4KA 1JR3A 3LKDA 3F5SA 1R5JA 1GUAA 4QUBA 3SI7A 4CDGA 5K8LA 1DT3A 1N9ZA 2F43B 1L7MA 4O4JA 4YO7A 2FPSA 1R6VA 2XDWA 1TA4A 3FTQA 3QI2A 5CXXA 4AMGA 1OASA 3ASVA 3NPAA 2PTHA 4DLPA 1HFWA 2WILA 1P4SA 2OCYC 5LXTF 4FFSA 1NV9A 1QAQA 2YV4A 4E4TA 3K2QA 3ERCA 1PCXA 2B4AA 4JLAA 3PGXA 3TOZA 3CLSD 4EHIA 4XR4A 3E7XA 4F7DA 3E3NA 4CM5A 3FTDA 1GP2A 3M1AA 3L79A 4M6WA 4UVHA 4PG6A 4GR4A 2Z6QA 4MGIR 3PWSA 1ZA2A 1IMJA 2JF0A 3TE7A 3G82C 3SF0A 5JQGA 1UODA 3O0DA 3B6JA 5DBGA 1Q7BA 2VDWA 3JX9A 3ZV4A 4AURA 4EQZA 3EPKA 1SC6A 2KX7A 4K0RA 1GAXA 4M49A 3R7BA 2QK4A 2HBQA 1IXSB 1MC5A 5B7QA 4NJEA 5J4KA 2GARA 3VVBA 4AS3A 3ANTA 2O05A 4F3CA 3GW8A 1CQZA 2DPMA 2ZT5A 2Z2YA 5CX4A 3LTNC 3PBKA 1KP2A 3FXAA 4XWAA 3LZ6A 1HOTA 1WSAA 4HDCA 1O0SA 2V6IA 1NBME 2A9QA 2QMQA 1E9BA 5C51B 1MX5A 1QONA 1NQXA 3QY9A 3Q1LA 2HHLA 2XSZD 1ZFNA 4FZJA 1ZD1A 3WLRA 4TQUS 5DTRA 2OP0A 4FFMA 1EFPB 4DBVO 1J9GA 3EWIA 3WGTA 3OF5A 1WSDA 4HWTA 1QRRA 1Y4SA 3NT4A 1W4ZA 1ESZA 1NMXA 2DOKA 5DSTA 1Y3FE 2EZTA 4YAOA 5FTJA 2GGSA 3LMKA 2YHBA 3GX1A 1GR1A 1KETA 4OO3A 1X0VA 1XWFA 2R79A 2ODEA 4QOIA 5ELMA 1JDBC 3C8ZA 5FWXA 5C5IA 2EP7A 3L8CA 3EZYA 1N3YA 2M9MA 4TL8A 1HFJA 3VQTA 4HJRA 1IAVA 1XCOA 2ASEA 4NNPA 3MWEA 3RIMA 1RP1A 4LK3A 1JPNA 1ZIDA 2HDWA 3EMDA 4FR5A 4OVKA 4E6PA 3ED1A 4ZVVA 4Y7DA 2IGTA 3PHJA 1JKIA 5JMOA 4GM0A 1NXXA 4NFLA 3U44B 4QLAA 1QFXA 1VIYA 4TT8A 5LZ7A 4ZHQB 4ETNA 3PGKA 1QYDA 4RE5A 4IGFA 3PE6A 5FWYA 1GGMA 3T3OA 4R5MA 3L0YA 2M2IA 3CLUD 4ZO7A 5LYJA 4OQNA 2BBTA 2YWJA 1D2AA 1RACA 1IOWA 2V7QD 3HHPA 3KKQA 4QG7A 4OGWA 3OJLA 3SSMA 2O5EA 2ZSBA 5HKOA 2FK7A 3ESAA 1QTIA 4UJ3A 4D43A 6LDHA 5JSHA 2O8BB 3JQCA 2ZRQA 1JXAA 5C8ZA 1AKYA 1KL7A 1T8RA 2Z58A 3H0CA 2JHAA 1B15A 3MWFA 5EMNA 1SCQA 5LQUA 1GZ5A 1NSFA 3R7SA 2FHSA 5DN6A 4WK0B 1KFJB 3V4SA 4GQBA 5BSVA 1PUJA 2P2LA 3QELA 2JD2A 4BNNA 1KQ3A 2BZSA 1P3JA 5HCNA 4M83A 1DAFA 2A58A 3LHDA 4BXOB 3R74A 2BSXA 1MTOA 4QBIA 1IC6A 3HCFA 2CMDA 4IINA 2LW7A 1LDEA 3I1IA 1BRMA 4M0LA 3SSAA 2HQOA 3B1VA 3E9EA 5L40A 4O25A 4EFDA 3FOAA 2AOXA 2C3UA 4S04A 2NZUG 1RRGA 4S1OA 2A35A 2QUZA 3X44A 1RAHA 1KYQA 1QRUA 2AOVA 4CPDA 3L9XA 5JZSA 1GIAA 5AM1A 1JB9A 1K4MA 1W88A 4DSOA 1NFQA 1PG5A 2ZIGA 3GJSA 1CZKA 2JGDB 1YR3A 1SOVA 4O2LA 5AW4A 1YR9A 5ALTA 2OESA 3U37A 4RK7A 5HJEA 3DVLA 2JLBA 1C0KA 2B4TO 2J33A 1T3HA 1AUXA 5I4KA 3AVWA 4TXHA 2NYVA 3B6MA 4NCHA 2H9AA 4OHYA 4YGYA 4OOFA 5C46F 2JAHA 2EW2A 2E2WA 1IJEA 1T13A 4MVXA 3VU1A 1ZHHA 1E5DA 4IJMA 1S3GA 4QO8A 1QRTA 3RVMA 2FUCA 2FPPA 4KLCA 5FNVA 4IFBA 3FDZB 3SD7A 2Y1WA 4D98A 4EHHA 2BGGA 4PX2A 4JQSA 4AM8A 3BMXA 5FWNA 5HBRA 4KO8A 4OG2A 4CNBA 2QLNA 1UQRA 3R0JA 1ZM3A 3WL8A 3WVNA 5FUQA 3QF7A 4CLDA 3U7JA 1E64A 1ZSYA 2O7RA 3HRKA 4XYLA 3OCJA 3HZRA 4L4RA 4M9QA 4DXHA 1NUUA 5KDLA 3O1JC 3ZJUA 4BLVA 1X94A 4UQLA 3BE8A 1GWNA 1QJCA 4BMOB 4MEBA 5KQPA 3Q7SA 1Q1GA 2OO3A 4WXPA 2F1HA 2XQVA 3QEOA 1NPYA 2H3EA 5TF0A 3DTNA 1GNVA 1RIIA 2XDQA 3SYKA 3GBVA 5BNZA 5CDTA 2ZJFA 4RXTA 3R6GA 3F3MA 1PQWA 1R4MA 4C7KA 1B3BA 2DTEA 4Q3KA 5L7WA 4WOCA 3AR5A 3HK2A 2RCNA 4Q01A 1JJBA 2PUVA 4EVQA 4DC9A 3OZWA 2CL6X 2NXEA 2MYTA 1EDEA 4PXAA 1HE3A 1O5TA 1E2PA 1KVTA 1M3SA 2IP1A 2DM6A 1X7YB 2QMZA 4HPXB 4XUGB 5DHUA 3T5CA 2Z5FA 3PQ3A 1H2XA 3ZXYA 4B6PA 1VPLA 5KQLA 3UJ6A 4YT2A 4UUQA 2VTDA 1DC3A 1DVRA 3D8TA 3DCNA 2AG8A 3EQ8A 3IKMB 5TPZD 4BMCA 3I73A 2ZS7A 2RGEA 1JEEA 4PQRA 1F9EA 3U19A 1Y8RA 4H15A 3IRVA 3SX2A 3QXSA 2PZMA 2R5WA 2IYTA 4S1TA 2Q3MA 1HGXA 2CNLA 3AONB 3M9WA 1YJQA 1AMNA 2YXBA 4WV3A 4MWCA 5CDFA 4BYGA 4JYZA 3CEAA 2IYXA 3U4CA 2R8YA 1OGIA 1R3UA 4MV5A 4YGXB 1CUVA 3EXHA 4Z4EA 1L8LA 3BQNB 2IYWA 1XTPA 2VPIA 4PCAA 3OLYA 3D31A 4FLFA 3JQPA 1O94A 1TRKA 1ECJA 2P9TA 2Y76A 3ITDA 4Q02A 4RL6A 3QLJA 2W8BB 4D5GA 1U2ZA 1E89A 3QU5A 2PX2A 1JMYA 1YRAA 4P82A 1ITZA 1IHPA 4L8WB 5LUBA 4Z53A 3UWDA 2Y3IA 3MTQA 2TRSB 3OZIA 2V6JA 5FFNA 4YRIA 2PWPA 1QQ5A 2X2PA 4M88A 4IS2A 3ER6A 3IVMA 1ECPA 3FYHA 1RQXA 3UAWA 2OORA 5J43A 4YCLA 3JSAA 3RS9A 1W9MA 3SK0A 1RZRD 1PYGA 4DDMA 4WKOA 2VPPA 4LWZA 4MVJG 1SB8A 4RK1A 2HBYA 2WMYA 2A4MA 3GEGA 3R3WA 5EJFA 4BC1A 2C8JA 2GDJA 2DFTA 5EMMA 4BB5A 3JZAA 4CHTA 3FHTA 3K92A 3S55A 3ZHUA 1A4RA 1Q44A 4RELA 4KJXA 4QPJC 3GAMA 1QDUA 3D5EA 1T4CA 4ZI7A 1G20E 3LQYA 2HO4A 1BJKA 3QWBA 1Z4QA 4G5XA 4KN5A 3LYUA 1MD9A 3FMIA 4F45A 2EERA 1RJ9A 4F91B 1W5EA 3OJXA 3T15A 3T3MB 5A1JA 4N5NA 5BV8A 3M9LA 2V7BA 3AGPA 3HXLA 3O31A 3VO1A 3MINB 3MTIA 3PUIA 3HKEA 5LA6B 5K3EA 2FMHA 2OO5A 4I9GA 4S0ZA 1TD1A 2R25B 4NBUA 3MNFA 3ONEA 4G2TA 1CDDA 1EXNA 4IIBA 3NC0C 3QJGA 4MWTA 2GHRA 4LJKA 2XTMA 1T2UA 5JVDA 4US1R 3RC8A 3OG9A 5BW5A 1E18A 1V26A 1B8NA 1E0KA 1VZ2A 3IRUA 2FSVC 4B46A 4EO9A 4YRAA 4UDOA 2VTBB 1B76A 1RM4A 3IMKA 3TDKA 1W19A 3GPCA 2VVTA 5EKTA 2OZPA 3ACCA 3NDPA 1N5LA 4C2AA 1J90A 4PAMA 2PRZA 4OY3A 4JC0A 4Y1GA 1ZR2A 1QKIA 2WZDA 1GL9B 2IHUA 2WWHA 4J1TC 1PT6A 4MKZA 1GARA 1PW7A 1W76A 3CR8A 4QKQA 1Z56C 2ZRHA 1GN8A 1HH4A 1OI7A 3L0PA 3P9IA 4JJ6A 3KFVA 2BTEA 3CUKA 1A2OA 1X3LA 5FYQA 2GEFA 5JLAA 2ZJ6A 3N2YA 3I2YX 1SRQA 1SZCA 1RWVA 2LVBA 4HS4A 5KNBA 1FP2A 4QNMA 1EPUA 4AUKA 3M1YA 4P0QB 1U80A 3SP1A 4X5OA 4OQQA 1JGTA 2WJYA 1RJEA 3O6VA 5ALYA 5IARA 4BVJA 4YXWD 4HNVA 3MRSA 3Q5GA 4M8LA 3SWWA 1TUIA 4QYMA 3GLFE 1Z3IX 1PQ4A 1ULHA 4HDMA 4Q3OA 3I6IA 3VPSA 5K4GA 2C77A 1NWCA 2V59A 2PMBA 5I7WA 1BNCA 2GN8A 4GM1A 1IHXA 2OZLA 3MWJA 2F62A 2QW8A 3OJFA 4MIEA 2ZZMA 4Y2RA 5I7OA 1BDHA 1LNZA 2CL5A 1YMVA 3SDBA 4A27A 1BHJA 4CTKA 1Y63A 4JR2A 2O1EA 5B6JA 4RY0A 1N4AA 1RVV1 2OG2A 1XVAA 1ZESA 4S1PA 3RK1A 5ECGC 5B64A 3GMDA 3T0IA 1T5DX 4LJ8A 4C89A 2OD9A 5A05A 2QLMA 1DRVA 5BR7A 1NRWA 2N46A 3WK9A 3ER9A 2B2CA 4DBLC 2IUSA 3KSBC 1CW2B 3K8ZA 2PJDA 1Z5VA 1CT9A 1E9EA 1Q0HA 1QYVA 1WCIB 4KXQA 2LKDA 5HZMA 2Q9UA 3L7DA 3MJDA 1YI0A 5MGNA 4O8CA 1A8UA 3CLVA 4NJMB 5G0UA 3N0RA 2FNAA 1SOWA 1Z5UA 4EY4A 4ZD6A 4R40A 4MYDA 5TGDA 3HFGA 2E82A 4XX0B 5AOBA 2IH2A 3M6VA 3H0EA 3HJRA 3QU7A 4FDMA 5EFZA 1VZ3A 3FHCB 4CLRB 1WTAA 5WRFA 4DR6B 2ODWA 4F5EA 1LPMA 2IPXA 5HW0A 1LK5A 3BZWA 2AXPA 4BZQA 2X9LA 1B2RA 2PVSA 1TM1E 4HMOA 2Z3VA 3QPAA 4QHTA 2QMYA 4A8JA 1XR3A 1NP6A 1XFAA 3FMOB 2WFMA 1A7UA 1QYXA 3T5TA 1Z35A 1V2GA 1J2TA 4Q9NA 5KNDD 3SVZA 2WT8A 3USZA 3L02A 5FI3A 4NS4A 1Z73A 4EKGA 1FSSA 2SCUB 4NP6A 1N5MA 4RPGA 5F9MA 3GH3A 3QX3A 2VP4A 2XCTB 2MYUA 4PBSA 1QTQA 1S4QA 4B5KA 4IJWA 5DK4A 3FYDA 3AEQA 2HKIA 3CBGA 4N7BA 2RBEA 2Y0DA 1YTLA 2DAPA 2XNHA 5IDVA 5AK5A 2AHRA 4MH0R 3U62A 3L77A 4K6OA 4HDKB 4DVGA 3EXEA 1N34B 5AKHA 3ML1A 2PYIA 4JL8A 4KE9A 3C7KA 1WV1A 4FGUA 4KBGA 4JBHA 4EF4A 3SICE 3ZR4B 1CSEE 4E33A 5B7PA 1EVZA 3B5JA 3T4EA 3OJCA 3HWRA 1KZ7B 4CTMA 3I9FA 1II8A 4PNHA 1GZVA 1BZYA 2XQJA 2Z9CA 3BERA 3H3XA 1G9TA 4XQGA 3W1EA 4AK9A 4BECA 1OI2A 1NULA 5HMMA 3OKPA 3IPXA 4B4OA 1ZN8A 3E6AA 3M4XA 1C8BA 1Q14A 4C6TB 2FMUA 4IHJB 1AKTA 2D2VA 2OWEA 4L73A 5AM2A 5JCOC 1ONPA 5GM1A 2ATCA 2G7ZA 4K9SA 3K0KA 5LQSA 3IVGA 3SXJA 1IBRA 3O47A 2O8EB 2M6RA 1KHHA 2JGFA 4HEQA 4X1KA 5F51A 3T7RA 5A5FA 4GT1A 4FNOA 5KOYA 2FKAA 1OYOA 3CZRA 2EF1A 2CXNA 5IHXA 2RK3A 4U02A 1ADBA 1HTBA 5EY5B 5JAZA 1YS4A 2GD2A 3ODGA 4CQNA 2PA3A 2GTPA 5K0CA 3QLTA 4H0FA 1JEAA 2X7XA 1ZZEA 1S2OA 4BVGA 3MTEA 2VRBA 3DTVB 4J1NA 3AF1A 2BMDA 3I52A 3PYLA 1CBUA 5FP0A 2CB0A 1GQSA 3UEOA 4UE6A 4AT1A 3BTVA 1VHTA 5CURA 4JI5B 3VRHA 1OFTA 1D4ZA 2ZSHA 3R20A 1UPTA 2DVMA 2H0RA 2FCAA 2BDEA 2YYSA 3EFEA 2DQ4A 3KAQA 4UM9B 1PBTA 3EYWA 3IFSA 2NPFA 3M89A 2HL6A 3H9QA 3II6X 2WZBA 3A3OA 3FJOA 2F4VB 3ESDA 3DLCA 4ZT6A 2A88A 5GQSA 1ZRSA 4HNAA 4M9XA 1T9KA 3WLQA 2DKNA 1JH8A 1MW8X 1WE2A 2GQ0A 5K0JA 4TS3A 2YMMA 5BWMA 3K73O 5ITWA 3RS0A 3Q8WA 4H7JA 3S3TA 4J0IA 3LJKA 4NENB 4DWJA 4R41A 3A1DA 1L4MA 1QTRA 2VK1A 3MC1A 3G17A 1XCPA 2J3DA 1HYBA 2JHPA 3BMQB 4ZAZA 5JTUA 2GJSA 4FOOA 2DPXA 2A3NA 4FI3F 2Q7OE 5KPJA 2IYEA 1PR2A 5M3BA 1JPUA 2YZMA 1U1EA 3Q40A 4OH7A 4BNTA 3PT9A 4U5XA 3KEOA 1KSJA 2C97A 4KRXA 3IXLA 1P73A 2FZWA 3OF3A 4GR9A 5B6PA 1WULS 1DKUA 3MBIA 3CSSA 3NBFA 4XOIA 3SJUA 3G8CA 5B2FA 1SVLA 4OI4A 5BV7A 1I4DD 4YUZA 4EP1A 3E3LA 2NSLA 4AKIA 1OFGA 2JA1A 2J9XB 2XXJA 3T9BA 1NW8A 1D3AA 1IEWA 4UXIA 2FSUA 1GO2A 4F97A 3A6ZA 4TYYA 3JWJA 2FLKA 1NONA 4QUDA 3EJ6A 4TMXA 5BVHB 1UKZA 2E21A 2SHKA 5GWXA 1I3CA 1QHGA 3DF7A 2AW5A 3D8UA 4X93A 4C4SA 4K88A 4ENVA 3AO0B 3FZNA 3Q7TA 2UVPB 2HEGA 5JDCC 5FULA 1MA0A 2XB8A 4LWOA 4IDFA 4NCAA 1H3EA 1AGYA 4EOGA 3HL0A 3OMWA 4POAA 4D92A 4GOND 3I1YA 3OICA 3QWFA 1JG2A 4CLEA 2NVBA 3OHMA 3RUPA 2AZMA 1OUMA 1MDFA 1QMPA 1Z47A 2QX6A 2P77A 3F5MA 4P2BA 5FA6A 5FOWA 4R9VA 3QMMA 2RBGA 2X1MA 4E5PA 3MWKA 3LU1A 1IWOA 1NN0A 2DCMA 5CDUA 1BH6A 2TMGA 2VN8A 3VKUA 1DQNA 2R6FA 4TTPA 2XKKA 1KOGA 2V4ZA 4RPJA 1GOTA 1LK7A 1NBIA 4Z4GA 4WCFA 1GRVA 4RD3A 4WXYB 1RRPA 3PV0A 3NJ4A 4L22A 1T2CA 2FZ5A 1JKJA 1QUEA 2PKQP 4M1OA 2A1TR 1KP3A 4XLZA 2WRZA 3RIXA 3VU8A 2V98A 4IXMA 2HT1A 5KTOA 1CQJA 5JRDS 2KLHA 3O3NB 3UJBA 1NR5A 1DOHA 3QVGA 4GG1A 3W2HA 2Q4EA 3ZHCA 4DAOA 1XNQB 4OV6B 2JBWA 3E2MA 4L16A 5CHEA 2MU1A 1NVDA 1VG0B 2GBPA 2F3PA 1L1EA 3RFVA 3LOQA 3AH8A 4ZZ0A 2UXCB 4DHWA 3FROA 3B48A 1CLUA 4BGIA 4MYSA 3DMHA 4OOEA 2JJYA 1A8IA 1JAYA 2WSLA 6NULA 1HT1E 1PGQA 1CQXA 1X80B 2C4MA 1F3OA 2IKQA 3UPDA 2W2KA 2H2WA 6ADHA 1E1YA 1GLNA 1EI9A 2QXUA 3KCNA 1OAOC 3FYTA 5K0TA 4GPIB 2OC4A 5DP1A 1OTHA 5A03A 4A73A 4HC4A 5DIZA 4ZI5A 1H2YA 1KZ1A 3LS2A 3R5XA 2PQ0A 3DM9B 2WYWA 1AS3A 1Z12A 1CNFA 3EVNA 4NBVA 3ZIAD 4TWZA 2COUA 1JEQA 1RHQA 1TLFA 4UBMA 4XCVA 1I4LD 3ZWOA 1C7FA 3LY5A 4M1MA 1NDQA 1IMOA 4HQFA 4LY6A 4MLPA 1DV1A 5FYDA 3WNBA 3ZBTA 2I54A 1SBHA 4X7RA 1PLKA 3PQ5A 4P3XA 4NULA 3LRXA 4QDUA 2I3GA 3BKXA 3HCWA 1IH8A 4PYNA 1J7KA 2ZB2A 4YC7A 3T52A 4KFCA 3L7NA 2YTZA 3LXMA 4GVLA 5E9JA 3LQ1A 1KGDA 2JAQA 1EK0A 3RIHA 2PBFA 2FDXA 4MUYA 4RQUA 4EG6A 4F5ZA 3TI7A 1YUNA 3CMMA 4FIZA 3DWEX 3OX3A 4JP1A 1EGHA 1W0JA 3EGCA 3PUZA 1T91A 2D2IA 5E6UB 1KORA 3SS8A 3WZMA 5KYKA 3BWXA 2C2GA 1T24A 3AJDA 1KH3A 2P67A 3DAGA 1YCFA 2OFFA 3B9PA 4H4DA 4D3DA 1TADA 2OBNA 3PUKA 3X1WA 5IWCA 4QAQA 1UDWA 1T2FA 3LV8A 4JMLA 4CEHB 2X22A 1L5WA 1W75A 1CWUA 2RH4A 2VPYA 4JLSA 3PL1A 2X8BA 1LWOA 3VUFA 2GEJA 2H18A 2CNOA 2RHRA 1R50A 3RANA 2A4KA 2GK3A 3QX7A 4MHTA 2OHXA 1WMAA 2QUAA 3DUFB 5HKLA 3V2GA 3VO2A 5CBPA 2C9CA 1KY2A 4URUR 5FEMA 3WNQA 4ITRC 2C7RA 1CR0A 1ZJJA 4RF4A 2EARA 1UWVA 4Y6RA 1KZGB 4OJNA 1AA6A 2WQZA 3H9BA 3FBWA 4P8RA 3TSYA 4AZWA 3AWIA 4L8YA 2GCPA 4WNYA 3QUQA 4NBKA 4X85A 4LS3A 4YROA 2LDBA 1I4EB 4Y3UA 3IP3A 3QPBA 3FM9A 1X7DA 3D1LA 3T1VA 2TMKA 1OX6A 4LJ4A 2JH8A 3EFBA 3KYJB 3PQCA 3P9SA 1Y1QA 4K46A 3N70A 3N8DA 1STOA 3AHCA 4I50B 2WSBA 3OT5A 3CRMA 4RMHA 5C1PA 5JD6A 1M2EA 3M5CA 1S4MA 2YWGA 4FHDA 2ANCA 4C4OA 3P2MA 3W6NA 1JQ5A 3LDFA 1R0RE 3QE3A 1RT9A 3QVLA 1Z2CA 4NYIQ 3RR2A 5J2UF 4RENA 1RI5A 3E48A 4RAOA 4XWYA 4E1BA 1OI4A 2C95A 5JAQA 1KJIA 1E3QA 3G2MA 4YYZA 4MS1B 3ORRA 5FTNA 4CG2A 2NUAA 3KOUA 1M2OB 2CF6A 3TLZA 4KHZA 1E6KA 3ROXA 1Y5MA 1Z82A 2PK3A 2VTKA 2C5GA 3FNBA 3MFYA 1ELOA 4H1UA 4Z8YA 2X4GA 1M66A 4JVOA