4DLXA

H-ras set 1 cacl2/dte, ordered off
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords GTPase HRas
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlxA00
1WXQA 1Q1QA 2A5JA 4JSTA 4NONA 1CLUA 2VQSA 4BUJA 4PZLA 3ZD7A 5CYOA 4Z8YA 5TDHA 4BLPA 1YE8A 4AKHA 4PTLA 1SKQA 2GVDC 1H8EA 1DAFA 3AQ4A 1JQJC 2QORA 2KSQA 2VBCA 4RCZA 1S1CA 4NPHA 4D4LA 4DWJA 3ICEA 1Q1BA 1Z29A 2GCOB 3ADDA 4PQRA 1YHNA 1E9AA 1IY0A 4CZ2A 2D06A 3Q5DA 2HCJB 1FFHA 1TADA 4DSOA 3IIKA 5H1YA 3OZXA 1E6CA 4JT4A 3FHCB 4Q7MB 1NLZA 1VG9B 2IEZA 3TJZA 3WYFA 4D0LB 2JLZA 1ZC3A 2ZRLA 1A2KC 1KY3A 4UJ3A 5D3MB 4JVSB 4PAOA 4Q21A 2GXSA 4G5QA 1W5TA 1E0SA 1KO7A 4F91B 4W9MC 1E0AA 2IYLD 4Q4AA 2ZI9A 1D8TA 1XDBA 3UK6A 4DIEA 5IT5A 3V4RA 4ZDJA 3CNOA 5AUQA 2ZVPX 3I92A 1R5BA 2O8BA 4GMDA 4G01B 2IWRA 4XVQA 2CL6X 3PR1A 1ZM7A 3VU9B 1UDXA 2JLSA 1DAHA 3R9WA 1W36C 3IUYA 3O8BA 1GTVA 2AD1A 1OXSC 5DISB 2TMKA 2OV2A 4Z8XA 4W5WA 3KL4A 1BH2A 2F55A 2GJ9A 1US8A 2VTKA 4F93B 4RD3A 4AIIA 2QMEA 1OFHA 1NJGA 1ZMXA 1NRJB 5AJWA 2HUPA 4B71A 3UG7A 2JEOA 2UZIR 1R0XA 5DSZA 4C0KA 4LHVA 2DFKB 5KYKA 3PEUA 3HR7A 4EPRA 2ZSAA 4BRWA 2MSCB 1VCNA 4HAYA 2D4HA 3BBPA 1P4SA 1ZIPA 1XJ0A 1SXJB 2OXCA 3BJIC 1RYFA 2B7BA 5SZKB 2C03A 4LJ6A 4RFSA 3FMOB 3KJGA 4S2EA 4GP6A 4C7OB 1G3QA 3RRNA 2ZREA 1GILA 4TL7A 1C9KA 1D6JA 1XMJA 4GPTA 5JEEA 1SVKA 3AVPA 1KZGB 4IFBA 1T5IA 5FUVA 4A0GA 5A5GA 3GLIE 4NCKA 3U61B 3VNUA 2ODWA 4Y0AA 1G3MA 2V54A 3K0AA 4NMMA 1D2EA 1NNEA 2AD5A 4RVCA 1RJ9A 2YC2C 2F6RA 3LO5A 4IVRA 4D82A 3QVVA 3K0CC 1KK0A 4V0KA 2WKPA 3C5HA 5F9FA 4P4UA 4LPSA 2C78A 2GCPA 4TT3A 1NL3A 1OIVA 3WNCA 2JLWA 2IS1A 1DG1G 3HU3A 4KV9A 2QUZA 4LOAA 3PXGA 1CP2A 2WIAA 3OIWA 2BM1A 2G77B 4H9GA 5FTLA 5DHAA 2ONJA 2QAGB 1N5JA 4W5JA 1RW4A 2VF8A 5K8IA 1AS0A 1R0WA 5AR1A 4IDQA 5DYGA 4JSYA 5AUPB 3QPUA 4DLYA 4LYJA 2WJHA 4ZIRA 3KXIA 5IF9A 3ECCA 3N70A 4DBLC 4G3XA 5FTNA 5AWFC 2ZPTX 3W9YA 5DIFA 4JLVA 3GCGA 3U44B 1W2GA 3CF6R 2ZR7A 1GSIA 3MWYW 1JJVA 3PG5A 3CBQA 1E96A 1OFIA 1YRAA 3ADCA 3GLIB 2ZM5A 4JYCA 4EFMA 2GTPA 2ZROA 3FMFA 4EAQA 4OHWA 3QG1A 2UVQA 2UZ3A 3DVLA 4M1MA 2MSDB 2PMKA 3I32A 3EPHA 2WVJA 3QY0A 5CITA 1J99A 2BBTA 1XZPA 2H5EA 2QG6A 3UXMA 5B30A 2Z5FA 4IJMA 3AF0A 3B78A 1CS4C 2P5TB 3L2OB 1HQCA 5B58C 1GWNA 1EX7A 2BM0A 1YZTA 1AGRA 1S9HA 1N0UA 2OE2A 2AKAB 2ZJ8A 3QXSA 2P6UA 5FBWB 3W6PA 1J7KA 3RVBA 5JWOA 4BEBA 1NIJA 2W2VA 5EXXA 5JZVA 1W44A 1WBBA 1RE0A 821PA 1LVGA 1BS1A 2YKGA 1W4CA 4PHHA 2VHJA 3ETLA 3CNNA 4KSBA 3D31A 4JJKA 1ZM3A 2PJZA 4PSVA 3TW4A 3IHLA 3WRYC 2ZYUX 5E7IA 4LV8B 3PENA 4D81A 3OEHD 5JEDA 3VX4A 1GL6A 3A4MA 4M9QA 3KJIA 3B1ZA 1QHYA 3KQHA 4FMCF 3BRWD 1DS6A 3O8DA 1RZ3A 4Q03A 2WWGA 5J5CA 3BFXA 2D7CA 2IYRA 4BLTA 2BWJA 2ZR0A 1Q1ZA 1E9BA 4EQ6B 2N42A 4I81A 3BGWA 4V03A 1E69A 1SZPA 2QP9X 3B7GA 3RRMA 4OI0A 3VU9A 3DKVA 4D4MA 4YMSA 2G83A 2VYFA 2QM7A 3KQUA 1E79D 1EFRA 3NIBA 1AQUA 2FEOA 5EQTA 4BLQA 2NGRA 2F3RA 2GXUA 5G41A 4MKIA 4IOJA 1S1MA 2EYQA 2OSBA 1S4QA 2YWGA 4I4LA 3WHLA 4E22A 2AWOA 4TYNA 4MGKR 2QM8A 4B6EA 1W36D 2CK3A 4PPFA 2VF7A 2GZDA 3AH8A 3U3OA 2PCLA 5GJCA 3BB1A 4LJ7A 4V0NA 1COWD 5HR5A 3M0EA 5EE1A 5GJBA 5DH9A 4K46A 1WCV1 2HLDA 1P62B 3SHFA 4M1TA 2ODEA 4TQAA 3RHFA 1ANKA 2SHKA 3TR0A 3VR2A 3SBDA 3CZPA 5LD2B 3UPUA 2CXXA 4YMVA 3RS2A 3QEOA 3K70B 2W00A 3CRRA 3W8RA 4CW7A 5CM8B 3UATA 1KI1A 4KXFB 3ZGXA 5KO2A 4ZCLA 2GEDA 2OLKA 3I62A 1A5TA 4P4SA 4NKRA 4BGDA 5HE9A 4JIMA 5EE0A 2D7DA 2V6JA 1VYVA 4V02A 5AUOB 2HYIC 1E1QA 1XTKA 4GFDA 2CNWD 4TTPA 3ZS9A 1CEEA 1EGAA 1C1YA 2FNAA 1ZJ6A 1E32A 1JR3A 4ON9A 3SJCA 2HJVA 2I3BA 3WXMA 4CEHA 2OCPA 4URYR 4FCTA 3J81k 4JT2A 2J3EA 4PSKA 3EZ9A 4A6XA 2QRZA 2EWWA 4DEXA 2GXQA 2CJWA 4JLPA 1GP2A 1ODFA 1P3JA 3VAAA 4OHZA 4R2IA 2V3CC 3SU8A 5JCZA 2IXGA 2PEYA 4A4DA 3DOEA 1KI6B 2IYZA 5B2ZA 4IVPA 3DPUA 1NN3A 1VKJA 4KHZA 4TLCA 5B57C 5BN5A 4GBMA 1T0JB 3I8SA 2BOVA 2WJJA 1T5LA 1RPZA 1KMHB 3IBYA 3UWKA 2JLXA 1E2KA 2IS2A 1VIAA 4I1VA 4QOSA 5E3HA 3PEWA 4PPGA 4F4IA 4JVLA 2IHBA 5KOYA 1QZXA 2JIZD 2PZGA 3P27A 2FDCA 2D3WA 4PANA 1KI7A 2ZUBA 3Q5EA 1UPTA 1ONBA 4TYPA 4BFVA 3MJHA 2RB4A 2ZS7A 4ZDWA 1R4AA 1FPMA 1KSFX 3I73A 2ORIA 1AJEA 3QXXA 1IY2A 1Z08A 1QHIA 4G1UC 3OEEA 1YR7A 3RWMB 2CEAA 3ICQB 1KGDA 3RRYA 5CDFE 4PC3A 2J0SA 3AVTA 1NBMA 4HDCA 1E79A 2HDNB 2HV8A 2XTMA 3WRXC 5JI2E 4N0DA 3OHMA 2O8FA 5FI1B 4HATA 1LS6A 4FMDB 2HJGA 1CBUA 2W58A 5D3MA 4OQXA 1E9EA 2FN4A 4B32A 1WDTA 1IN8A 1W2HA 2BDTA 2G0NA 1NKSA 1G8YA 5CM9C 2QP3A 3GFTA 2HXSA 1KJYA 1SXJA 2JDIA 4MYCA 1E2GA 4Q4JA 3LLUA 3V9PA 3BS4A 3NEJA 4RZXA 3U7EB 2A9KA 3EC1A 2KBEA 3LNCA 4YDSA 1G291 4QNMA 5DE3A 3TSZA 4BLOA 3OEHA 4C9BA 3K09A 2WWYA 1VCIA 4HLUA 3CO5A 5JJLA 3VKHA 3FVQA 4QFMA 1H8HD 3O47A 4R98A 4GOJA 2FPKA 5HE8A 1A2BA 3E2IA 1KAOA 5JWRA 1M6NA 1Z06A 2WPDA 2V55B 2FV8A 4YXWD 2GK7A 2GK6A 1Z83A 1L2TA 2Z4SA 3GD7A 2AFHE 4IOLA 1OW3B 3FE2A 3T06B 4D25A 1S2MA 1YU9A 1WA5A 2GBLC 4EPTA 2ZJOA 4S35A 3ZVMA 2OBLA 5TY0A 4DB2A 2V4ZA 3QF4B 1SXJE 2XSZD 3TBKA 2WHXA 5B64A 2NO6A 2QU8A 4FMCB 1XEWY 2HCBA 2J0VA 4GZMA 4FIDA 4V0LA 4AD8A 1GRRA 1VG0B 4JL8A 4LBWA 3CZQA 4MGIR 4EKDA 1X6VA 1UADA 2GZHA 3CR7A 1MO4A 4JMPA 1DAIA 1B23P 1GG2A 4QRHA 1U9IA 4Q1CA 1X8JA 2FPLA 1OF1A 2GA8A 3Q7QA 4QBHA 2OBMA 1NN5A 2RGBA 2P0EA 2FG5A 4EFLA 1FW6A 1FMLA 1XEFA 2KBFA 4WIAA 4HB4A 3QF7A 4LHYA 1YZLA 1ZD9A 4NCJA 3EA5A 3WNBA 3A1SA 2LKDA 4IHQA 1Y63A 4Q9LA 4II7A 4FMBB 3GLHB 1U90A 2R6GA 3I4LA 1RVDA 2ZI3A 1AM4D 4Q19A 5KU1A 3QKTA 2OAP1 1DAMA 3HU2A 1Z0KA 4GNKA 2ZJBA 1G21E 4LSGA 2ZAMA 3KKMA 1P6XA 4MRRA 3SYKA 1X1SA 3QBVA 4NCIA 4H1UA 1ESMA 1G20E 2VP0A 3AF1A 4QGFA 5LPNA 2VRWA 3L0PA 4DT1B 2ZRPA 1KY2A 4KU4A 1EK0A 1IOZA 2RGAA 2PMDA 3B60A 4OHXA 4XVRA 4ACAA 5JMTA 4RZUA 1VYUA 1KSHA 4PQFA 3ZZTA 4JKYA 4TLEA 1II0A 1KO8A 1ZUIA 4MUAA 3V4FA 4CRWB 1G7TA 5DGXA 5BN3A 1E0JA 1BKDR 1IN4A 4NYJQ 1FQJA 3KB1A 4P3YA 4JBYA 2RMKA 2HXYA 5EUMA 3THOA 4CEIA 1G7RA 2J41A 4OYHA 3CF0A 2VLIA 1JEEA 3P4XA 1TU4A 2EFHB 3X1WA 2YVUA 1IXZA 5LD2C 4GDFA 1GVNB 4J0QA 3SJAA 4QKQA 4JLMA 4GSYA 3Q9LA 1P2SA 4HEJA 5FBLB 1JXOA 2FMXA 5HCIA 4KVGA 3GLFB 1OH6A 1LF0A 4D4JA 4Q9IA 1FQKA 1XU4A 4XD7D 3SJZA 2O52A 1L4UA 1QHSA 3UMRA 2HT6A 5G3ZA 3GQBA 2ODNA 3GLHE 1NMXA 3F0TA 1N3BA 4RY2A 3A37A 3CX7A 3QXJA 4A1FA 4IFEA 1E1RD 4NCNA 2WPDD 2RHMA 3IHWA 1D9ZA 1P9RA 1Q44A 1Z2CA 4KVAA 3QENA 1MO6A 1Q12A 1GFIA 3EX7C 6Q21A 4PAMA 3U7FB 1F6BA 2EFDB 3U7GA 3LBIA 4Q1DA 3RABA 1XWIA 3OAAD 1T8UA 4LY6A 3SI7A 3T5GA 5CB6A 1TEVA 2WAYA 2E1RA 2GZAA 2QP4A 5SZIA 3C8UA 2QI9C 3R9IA 1JPJA 1SULA 2FSFA 2W83A 3K0CA 5GJWC 3AGQA 5BXQC 3I1FA 4R71A 1F2UA 4IDNA 1E9FA 1OB2A 4RCYA 2ZUDA 2BKUA 2REOA 5JJIA 1VG8A 2GWHA 2GETA 2BV3A 5KHOC 4LV5B 1SVOA 5KSYA 4NU0A 1TTTA 2XB4A 2W6IA 1U0JA 4KSCA 5IDVA 1G18A 2A2ZA 2VHUA 2XZPA 3QI2A 4B47A 2P67A 1UBCA 2CE2X 1FOEB 1RC8A 1G4UR 1GRNA 3CUEF 4KITB 3ADKA 5CIWA 2V7QD 2WWIA 4UXJA 2CHVA 3ZQJA 3ZVNA 3VNVA 3NHBA 1P73A 1WBDA 5FUXA 3JVUA 2ZSEA 1XFAA 2H8KA 4KJZA 2XGJA 2REBA 1Y3AA 5CLQA 3K70D 1R5NA 1KO4A 3RC3A 1W7AA 2EQBA 1RIFA 3CRVA 3ZH9B 2NQ2C 3GEIA 4IDHA 4Q48A 4QNRA 4ZKEA 4YXWA 3K1JA 2PZFA 3FKSA 1II8A 2FSHA 1IJEA 4IVQA 2VHCA 5EE3A 4KAXA 4NYMR 4NL4H 4DEYA 1YZUA 2GJKA 3QXCA 3CONA 4QHTA 3LA6A 2Q3MA 1QHHA 1XEXB 1U98A 2H7VA 1T4GA 3T61A 1UEJA 4WZ6A 1GM5A 3OE7A 1G41A 2XJ9A 2J87A 2RHDA 3AKYA 2QPOA 1KOFA 2A3RA 1E3MA 4TTRA 3SC3A 4DLXA 2C5LA 2VSFA 2PX3A 1IY1A 3OIUA 5CJ2A 1OV4A 3QUSA 1N25A 4B75A 4FN5A 2GAOA 2QPAA 3CRMA 4B6FA 1BMFD 3EZ6A 4CYMA 3QSYA 3BERA 3R20A 4TT3D 1FP7A 5IRCD 3LQRA 4DCUA 2BJVA 1PLLA 2C77A 2WICA 3IKJA 2QROA 2MMGA 4MGYR 3TVTA 1AA9A 4N3NA 4LK2A 4C2TA 4L9WA 4JVNA 4F7WA 3NEYA 4RD1A 1XPUA 2ZE7A 1N6OA 4ABYA 2UKDA 5JECA 3U3RA 1R0YA 1SKYB 1XCGB 1Q0UA 4GI7A 2A30A 2H92A 4KBFA 5FPTA 1AQYA 4DRZA 2IYVA 1SHKA 3DMDA 3W8NA 1DOAA 1OSNA 1UKEA 4MKFA 3TE6A 4EJSA 4C0HA 3H0KA 3GLFA 1HEIA 4A2WA 4AG6A 2R65A 4KLNA 4B43A 3GP8A 2CLDX 5K8LA 4Q1BA 2DFLA 3AB3A 4PR0A 3B85A 3CWQA 4POAA 3LD9A 4A36A 1HURA 5TARA 5JFGA 1LF5A 1GL7A 1N5IA 2XOKD 4M1YA 1IAQA 4W5HA 2X8AA 3L0OA 3D6TB 4FD2A 3RS0A 3VX3A 5J4HA 3LH5A 4AY2A 5JHHB 3HPRA 4O2LA 2ZJZA 1E9RA 3I61A 5BWMA 4Q9JA 2DB3A 3TK1A 1F2TB 3AVYA 1ETUA 2JAQA 2QZ4A 2WAXA 2ZSDA 1CKEA 2XNDA 3WBKA 3LQQA 4BEJA 2HF9A 2OHFA 3RWOA 3V00A 1G16A 3BH7A 3OFND 4MYHA 2RCNA 2QTHA 1JAIA 4KYIB 5FBRB 3F3YA 3G82C 4BQSA 1P72A 2JLQA 1BYIA 1OFUX 2FU5C 4TMKA 1DBSA 4D4KA 1S9DA 3JZMA 4CIDA 3I3SR 2P3SA 2OT3B 3H84A 2X19A 1CU1A 1JPNA 1JBKA 4M8NE 2WM9B 4OI1A 1MR3F 3N5CA 1G4AE 2ZJ2A 2EWVA 2ZANA 3MG9A 4M1SA 4A8JC 3QPVA 2GJAA 3RDPA 4TMXA 3SR0A 4AKEA 4DLWA 3Q72A 1HV8A 3EZFA 2BC9A 1YR6A 4EIWA 1HTWA 2F1RA 4AG5A 1M7GA 3P4YA 1F2UB 2JJ2A 3D8BA 4ESVA 2R6DA 5C4MA 1ZU5A 3LVRE 3VR4A 1LB1B 2OLJA 2CJWB 2PL3A 2X1VA 4ZPXA 3BB4A 1IN6A 1OYWA 2BHRA 2WV9A 3ZZ0A 4QHYA 4YQFA 5EZ6B 1I2MA 4UNSA 2ZETA 2NO1A 3K9LA 1W5SA 5TV2A 4QXAA 2X2FA 4A82A 2GESA 3IO5A 4MGZR 2Q3HA 1FMJA 5L3VA 3GLFE 1S96A 1XZQA 3VR3A 3C41J 1HE1C 1CR1A 3IPXA 4M1OA 4RKEA 2AK2A 1GKUB 1KI2A 2FOLA 2D62A 4MH0R 2YOGA 2JLUA 3RANA 2FZLA 3NXSA 1VCOA 3B82A 1G8GA 3RS7A 3FHOA 4HLQB 4BLRA 1IXRC 2J45A 2QMUA 5FFMA 3T1TA 3FOZA 2WZQA 2IC5A 4C0BA 2DR3A 1BIFA 8OHMA 1EFTA 3PITA 5L3RA 1UBFA 3FFBA 2IT1A 5FH9A 4PO9A 4Q7JB 5HPYB 4B2PA 3PUYA 2PT7A 3QXHA 2XOKA 2AWNA 1KK1A 2ZU0C 2BMDA 2FEMA 4TYYA 1XCPA 2PLFA 3FFAA 1O87A 2QENA 5FUWA 1JJ7A 4TN1A 1KI8A 2QN6A 3AGPA 1PVOA 2WJVA 5BN4A 3R8FA 1G3RA 1T3HA 5EXSA 2QE7D 1YZKA 3FYHA 1P2UA 4GOKA 2D2EA 3TSOA 4EUNA 3CNLA 3CH5A 1NKTA 4FCWA 5HTKA 4IXMA 1ZNYA 4PC2A 2CL7X 1KZ7B 2QQ0A 1XEXA 4PC6A 2DBYA 3OFNA 1E99A 1E94E 4B3GA 2IYSA 4OK6A 2IL1A 5DI3A 5KNCA 5L3SB 5IK2D 2J9RA 4Q1AA 2F43B 2HF8A 2QGNA 3BIFA 2CE7A 5DHFA 4TQ9A 4TZ6A 4LJ8A 1ZCBA 3A58B 3IQWA 1MRNA 2IX3A 4BFWA 2GCNA 4EPWA 3U6BA 4OK5A 3W3ZB 4WZAE 2R6CA 1AZSC 3LV8A 4EPVA 2AFIE 2ZRBA 2VL7A 2OFXA 2FX3A 4URUR 3FDIA 2W6JD 4TQUS 1Z22A 3A1UA 3RS4A 1XF9A 3VFDA 2RKOA 1R10A 2O0HA 1YQTA 1Z0FA 1E2NA 4RZ2A 4JLNA 4LJ9A 2WSSD 3WMEA 2ZSBA 5DYIA 4RD6A 3U3KA 1KAGA 4Z1MD 1OHHA 1QF9A 2YOHA 1NY6A 4PO8A 4QBGB 4QG7A 1Z07A 3PIRA 3CPHA 2R6AA 2R62A 4KFSA 3FGNA 1XRJA 4IRUB 1US8B 4DLTA 3T1OA 2IUSA 3RAPR 2ZRFA 2P65A 1YZGA 2DWOA 4QM7A 1T6NA 3S1AA 2YNMA 4QJ3A 1DAKA 3H86A 3DM5A 1NG9A 4O3MA 2I4IA 2VSOA 1JXMA 3X1ZA 1N6LA 3TR5A 1P5ZB 4ZDIA 1CIPA 3QE0A 5GADl 3K9GA 3LVQE 4DLVA 1F48A 3N2EA 1VHTA 2RGGA 3AUXA 3KXKA 3NC0C 2LKCA 4MITA 2JATA 3CH4B 5JLJA 3JZAA 3TH5A 1I4DD 1VTKA 2BJWA 4DUGD 1FUKA 3GLGB 3ZVLA 3H2YA 1DAGA 1KNQA 1N6IA 3T15A 1E4YA 1W4RA 3NH9A 1XXHA 2XZLA 3TUIC 1SGWA 1T3SA 1ZM2A 4HB0A 1JR6A 3IEUA 1OH5A 1TQ6A 1XX6A 4MRVA 5FBQB 3BE4A 1ZRHA 2B7CA 2FGKA 2J1LA 1M2OB 1AK2A 2BMEA 1PJRA 4GOXA 4PX9A 3HU1A 1MV5A 2DCUA 4KO8A 1E9SA 1PLJA 2ZVQX 3IIMA 2MSEB 3IPYA 3B5JA 1EFHA 2ZIAA 4OQNA 4IDPA 2WWWA 2J0QA 4FXPA 5SZHB 5TVKA 5JCPA 2EFGA 3BK7A 4YONB 3N2IA 2YHSA 2O0KA 3SDZA 1ELOA 1VIYA 5EXTA 3AVOA 4BFTA 4I99A 1TL7C 2FSIA 3NBYC 2ZYVX 2IYUA 1EX6A 1IONA 1M7HA 4Q01A 2REXB 4JLBA 5EJEA 4PPQA 4P4TA 3DOFA 1A7JA 4TLBA 2J0UB 4TLDA 2CDNA 1UFQA 3IIJA 3ONWA 4D0GA 1XPRA 4LCBA 3AKEA 5F2EA 1EXMA 5H70A 4R7ZA 3GLGA 2P6NA 2GHIA 3TQFA 3U44A 2NG1A 2XJ4A 3U4QA 5FPYA 1QHHB 3CPJB 1DTSA 4DDVA 5K8TA 3CKLA 2Z6VA 4BWYA 1U8AA 1EFUA 2G1JA 2PH1A 4Q5IA 5L3QA 1JR3E 1XTQA 2C2HA 5C18A 3K0FB 4A8JA 5TMPA 5BYJA 2VP4A 4MDFA 1ZM4A 2ZJAA 3AUYA 4I1SA 4L16A 3EWAA 5CK4A 4MQBA 4A0FA 3L0IB 1DPFA 1WP9A 3X1YA 3CB4A 5KPDA 1SXJD 2ZTSA 3U2QA 1W0JA 4XWAA 4URVR 3THYB 3KDSE 4KLZA 2QRNA 4DSUA 3FMIA 2FF7A 4G5RA 4IDOA 4RFVA 3UIEA 2QT0A 3AM1A 4B74A 3BORA 3ZLJA 3MWJA 1FTNA 5A4JA 4B76A 5AK0A 3NHAA 4GL2A 2IYXA 1ZD1A 2GF9A 5JWHA 4CEHB 5GJVC 5LDDC 2BVNA 4YMUA 1GITA 2QBYB 3FTQA 3BC1A 3F8TA 2F9LA 3U60B 2WJGA 4PSAA 1MH1A 2A5FA 4YDHB 1TPZA 3MLEA 2ZRCA 2GKSA 2G0TA 4BZXA 2R8RA 3SYLA 1Z47A 4ARZB 3GJ8A 1P9NA 1I4LD 2J46A 2OAQ1 2VHQA 3EARA 2H1LA 4L4UA 4Q4AB 3VKWA 3QBTA 2VP9A 1ZVQA 2IA5A 2O8DB 5J40A 3BB3A 3VMFA 3C5CA 2RH5A 3OEED 2NPFA 3B1YA 5GVRA 1ZNWA 1SVIA 4C0JA 4NYIR 1MO5A 4PXAA 1W0KA 3TGPA 5JS7A 3A4NA 3WHKA 1MOZA 1NN1A 4YMWA 3THXA 3CX6A 2GJ8A 2FSGA 2IBMA 4DCTA 4JLOA 1Z6TA 1GIAA 1XTSA 3Q3JB 1JAHA 4K8OA 4I1UA 1ZYUA 1FNNA 2ZJYA 3GJ0A 2WJYA 1E2PA 4BPBA 3THWB 2EFCB 1TUEA 3NDBB 2ZRAA 2V8OA 3U3MA 2Z4RA 4YMTA 5DNYB 3GPLA 3VKGA 2NO7A 1VG1A 3KKOA 3RLFA 1N5LA 4RFSB 3H4MA 3OIYA 1E2EA 2BEKA 1XD8A 3PEVA 3AP1A 121PA 1Z0AA 2NZ8A 4GMXA 2X2EA 3QVUA 4XJXA 3QKSB 1X8LA 3VTKA 2KI5A 1E0KA 1ESNA 2GAAA 4Q7KA 1R5OA 4E09A 1RRCA 1Z28A 2CLCX 1A82A 4ARZA 1E2FA 4P33A 2XSZA 3NBZC 4HUQA 4Z54A 4BE7B 5FR2A 1TNDA 4QBFA 4UNQA 3AF2A 4N0EA 2O8EA 1NBME 3SHWA 5M04A 1YRBA 2BBWA 5EP2A 3BOSA 1ZP6A 5ANRB 5CDFA 1AZTA 2IYTA 4GZLA 1AS2A 3W5IA 4HZUB 5FOXA 4UJ5A 621PA 3QEJA 1RJ9B 1K6MA 1CJUC 3QF4A 1V5WA 3ZQ6A 2NO9A 2BMJA 4ACBA 1WB9A 3S1AB 1CXZA 1ZNXA 1A1VA 1W0JD 3CF2A 2Q21A 3WMFA 2O8CB 2OESA 4IW3B 4Q47A 2IYYA 1S0UA 4PQYA 4U7DA 2ATVA 1Q22A 4RD0A 1U2RA 1U9IC 2ZRGA 2D74A 2RAPA 3RC8A 5EP1A 3PUVA 2W6JA 1AKYA 3L8YA 3TKLA 2JGNA 4HAZA 4ERNA 3QKSA 1XEWX 4NYIQ 1TF7A 4X8OA 3AVUA 2CBZA 1UKVY 1CJVC 1C4OA 4RD4A 4Z51A 1LV7A 4LPKA 2FWRA 4Q00A 4KBGA 1UBGA 3BH6A 3GLIA 2ANBA 3VR5A 5E7MA 1Q3TA 2CHQA 2VPPA 3AP3A 1OLOA 3ZVRA 1GL9B 4AKGA 2F3TA 3ZYCA 5J47A 2ATXA 2N46A 1XMIA 4ASUD 5UKDA 2J0UA 2C04A 3KJEA 1AS3A 1W47A 3Q85A 4B34A 5JRJA 1R8QA 2DWQA 4HB3A 3TLXA 4C4PA 2ZJ5A 2ZE8A 3TIFA 3QQ5A 4EPYA 1KHTA 4GT1A 4FINA 5EP3A 4US1R 3T5DA 4DVGA 2FFHA 2OEPA 4KFTA 4LUCA 5DN6D 4X8LA 4C0QC 3NTUA 3O8CA 3EXAA 1GNRA 2XEXA 2FE4A 2HYDA 4OQMA 4UXHA 2IYQA 3E1SA 2JIZA 3TMKA 3TW8B 2XB2A 2WWHA 2I1VB 5KNBA 2FA9A 4DLRA 1JNYA 3AF3A 1LW7A 4ESHA 4V0OA 4P0TA 2GF0A 1JR3D 3K53A 2F7SA 4ZKDA 2Q3FA 2F1JA 2WKQA 1E2HA 3THYA 3A6PC 3B8HA 4AYTA 2OUKA 3DMNA 3KQLA 3G5UA 5G53C 3QG5A 3EIQA 3K0AB 1WRBA 5AJYA 1I2DA 4D6PA 4MRPA 1DG3A 3B6EA 5CIQA 4A8JB 3EG5A 1KKLA 3M1IA 1NSFA 2EFEB 4G5GA 1X8KA 3KJHA 221PA 3IEVA 1KI4A 1SQ5A 1D5CA 2YWEA 2QSZA 3PQCA 1NSTA 1Z6AA 1W48A 2VSXA 4DDWA 3UG6A 1TX4B 4WOPA 5LB2A 2AL7A 4PC7A 4LRWA 1DADA 1ZNZA 2XXAA 1L7VC 1Q20A 1LY1A 2FH5B 3TVDA 4QJ4A 3W90A 5C1BA 2DY1A 3R7WA 2CHGA 1V43A 3VR1A 4BFUA 4LGMA 4R9UC 2OZEA 2ZE5A 3QNUA 4B3XA 3ND8A 4QJ5A 2C9CA 1ZCAA 5TB5A 1XXHB 1XTRA 4TSFA 2C98A 1GDDA 2FJUA 3MAAC 4IEEA 5FOSA 5F98A 3KFVA 2O8BB 2BEJA 3EPJA 2PBRA 1R8SA 2VHTA 1VHLA 4O25A 4WZBE 3PCRB 2GJSA 4D26A 1CJKC 2P2LA 4LBVA 2KWIA 2WIBA 2G88A 4LJ5A 4KFRA 2ASEA 1SVWA 1UBEA 1KYIA 4DJTA 4MKGA 1U81A 1W0KD 4E07A 3OIVA 1HH4A 2A5GA 2RGCA 2CK3D 3OESA 1OH8A 2W2TA 4PFSA 1MKYA 4PHTA 1NMYA 1O3YA 1U8ZA 2KB0A 3LY5A 2Q9CA 1BOFA 4TYWA 1R2QA 1S8FA 4HYYA 3REFA 1YR9A 1G5RA 5FOVA 4JLDA 1YKSA 4WVFA 4A9AA 4C0LA 1PLKA 4ZCMA 2QT1A 2YZ2A 1QHXA 2J59A 3X1XA 5JSZB 1E2LA 2DFNA 2RGNC 1ZM9A 5KDLA 1OH7A 5E7JA 1DE0A 2VP6A 4B44A 4LHXA 5L8VA 1FL9A 2PLRA 5BYKA 4ZDKA 5HZHA 4HAXA 4M2LA 5JJKA 1VYTA 2IYWA 4FW9A 4TMWA 2BCJQ 5G3YA 1II8B 5DI3B 3EPLA 2G6BA 3B1VA 3BH0A 1E2QA 5DN6A 3BD9A 2YJTD 2DWPA 3RRZA 1E2MA 5KDDA 2AXPA 4CEJB 2W2XA 3WP0A 1P75A 421PA 4E5UA 1UJ2A 4NH0A 2AN9A 3ASZA 1KSGA 1MO3A 4DLZA 2ZRIA 4O0MA 3FB4A 4Q66C 1YR8A 3AF4A 2CMKA 4PC1A 1RKBA 2A78A 5J4LA 2PZEA 2A7QA 3VQTA 4C7OA 2NO0A 3RS3A 1DARA 4Q4HA 4DCVA 4L5BA 1ZIOA 1HT1E 3FMPB 4AK9A 4ZCIA 2ZE6A 2KJQA 4QHSA 1UDWA 3KZ1E 2HEIA 3VR6A 4O2RA 4HZUA 1KDOA 2G9NA 3TAUA 3T12A 3SQWA 1DVRA 1RYHA 1F60A 3W34A 2OXRA 4P4SB 2IK8A 1Z3IX 3KUDA 4P31A 3MD0A 1UKZA 2AK3A 1BO6A 2A5DA 4DSTA 3A4LA 5K8UA 1SKYE 2JLYA 4TMVA 2CVFA 4JLKA 4BZPA 2FFBA 3GJ5A 3KQKA 4JLAA 1CRQA 4K81B 1CTQA 3EWSA 2ZI5A 3PJRA 1JEDA 5JI3E 1HT2E 5JBQA 4TL6A 5DLQC 1AKEA 5E95A 1IJFA 3I8XA 4U02A 3B2EA 2WSMA 3T35A 4HAUA 1OJLA 3PV0A 1Z63A 3I72A 2RGDA 1MABB 1G17A 2BIFA 2QMOA 4JKIA 1KSJA 5LBIA 2EVWX 3HR8A 1J8MF 4NTZA 1OPXA 5EP4A 4DDTA 4LJ4A 1OIWA 3DDCA 2WWFA 4EFNA 4M22A 3LX8A 4C2UA 2XZOA 1ZAKA 3PVSA 4TMTA 1G9XA 1J8YF 1SVLA 4I1OA 4GRAA 1T9HA 5EE5B 5FPHA 1RFLA 5EE9A 3R9XA 2IUTA 1NVVR 2K5UA 3UMFA 2EYUA 5J4YA 4M1WA 4M9XA 3RNLA 2IW3A 1VPLA 4A2QA 2EW1A 2V9PA 2WTUA 1W46A 1E9CA 4MRNA 4B35A 1XD9A 4JLJA 4LC1A 2W0SA 1G7SA 1FTSA 2QTVB 4JL5A 4KFUA 2IXEA 1XD2B 3ZIAA 2XXAB 2VEDA 3TUJC 2ZRJA 3AVWA 2RGXA 5BW8A 3M4YA 2V7QA 3MFYA 3MUFA 2WJIA 1ZINA 1XB2A 4Q18A 2LCFA 1OXXK 5TXGA 4CVNA 4AURA 2CLSA 4F4JA 4HDQB 1IBRA 2CL0X 3W5JA 3H1TA 2YWFA 1UM8A 1XP8A 3B1WA 4YC7A 1N6HA 4OHYA 1KI6A 1OXVA 3SYNA 1T91A 1R7RA 4GP7A 4D2IA 3HPQA 3SNHA 1M74A 4BRUA 3B1XA 3KTAA 1NVWQ 4OJKA 1OXUA 2RGNA 3K0SA 1ZC4A 1GKIA 1HYQA 3HJNA 1KI3A 1MT0A 1FZQA 1P2TA 1A4RA 1KK2A 3OAAA 1IQPA 1QRAA 4Q7LA 2BBOA 2O8CA 1LTQA 3W6NA 1TF2A 1P60A 3OF5A 2EU8A 3K0FA 2P6RA 3JVVA 4BFYA 1RRFA 1OE0A 4QGAA 4UNPA 1DEKA 4BFXA 5C46F 4XOIA 3QIAA 1KDPA 3GJ6A 2OBNA 2H17A 4C3ZA 1EFRD 1YJ5A 3K9HA 5F9HA 1R0ZA 1OT3A 3DO6A 2ZR9A 3AVQA 1R6BX 3EASA 3SFVA 1CRPA 1K5DA 1WQ1R 4RJLA 5KSPA 4WBSA 1HUQA 2QMHA 5FUYA 1Z6GA 1SXJC 2ANCA 4NE2A 2ZITA 3CWZA 2GDJA 1UKYA 4LI0A 1ZUHA 1W1WA 1M1YE 2GEVA 3WNDA 3X1DA 1FUUA 1KJZA 2QE7A 1KNXA 2V1XA 2BKEA 3DL0A 4DIDA 1J70A 3LX5A 4DC9A 3ADBA 2B8TA 3C7KA 1N6PA 5EXPA 4HAWA 3AEZA 1CR0A 1XTIA 2QGZA 2ERYA 3LBHA 4UQOA 3GEHA 3MRSA 2IWHA 5ELXA 1G6HA 4HLDA 4NBSA 2OCBA 1E2JA 3KKNA 4NYMQ 3CLVA 2FGJA 4CF7A 2JJ1D 3NWJA 1G64A 1U8YA 2GBLA 3IDQA 4DCNA 4DCSA 1YVDA 1T0HB 1XMVA 5IHPA 4XD7A 3REGA 3ND9A 4FCVA 4M9ZA 4TL8A 2XAUA 3TAHA 5L3SA 3K8YA 2J7PD 2F43A 4MKHA 5KDOA 2YINC 3QPWA 4JJZA 4TSFD 3WYAA 4A0HA 3AKDA 3NBFA 4UNNA 1VMAA 1OIXA 5HZKA 2GNOA 4XIGS 4ZI3A 1NP6A 1G6OA 2AHOA 2DHRA 2C9YA 3B13B 4Q4LA 3P1JA 4UXIA 4D0NA 3OE7D 2O8EB 3LDAA 3GFOA 5FOUA 4A92A 4LC0A 4Q9KA 4DHEA 1NVXQ 1OXTA 4CGZA 4AC9A 2B6HA 5G40A 3UKDA 1E2IA 2OCYC 3VHLB 3ZJYA 3LXXA 3RYTC 1LS1A 2Y8EA 3DEFA 1CULC 4V0MA 2JLRA 2QAJA 2AXNA 3BWDD 3DZ8A 2FZ4A 4BFZA 4EJSC 1U0HC 3EW9A 4MRSA 3R7WB 1D2NA 1G3UA 3D3QA 5JHGB 4LYHA 1DO2A 1Z2AA 1OFTA 3DZDA 3KXLA 3MWLA 5EZ5A 3CPEA 4IKEA 2ORVA 2QQEA 3HP1A 4B2LA 4ITRC 1MABA 4YLGA 3SQXA 2CCJA 2FFQA 5CK5A 3IGFA 3MMPA 4OK3A 2WOJA 1G8FA 3UMSA 1OKKA 2OILA 1HY3A 4NCHA 2KE5A 1GRQA 2BBSA 2ORWA 4HI0E 1OB5A 4UNRA 3TUZC 1CJMA 3U5ZB 1CR2A 3NH6A 1JECA 1ZBDA 4X8MA 1RRPA 2OG2A 1ZUNB 4RKFA 2JASA 2RGEA 3LRPA 2AKYA 4C30A 1E1RA 1XNJA 3SE0A 3TQCA 2FFAA 2O8DA 4XSGA 4Y0VA 2X77A 3BFVA 4HLCA 3HDTA 3HYTA 3LW8A 1FX0A 4EPXA 4CEIB 4NZYA 1Q3HA 1VDZA 1SHZA 2YWHA 1Z0JA 3KX2A 1K5GA 3TNFA 2ZI4A 1G8HA 4ZV4A 4KCGA 2F1HA 3EIHA 3SN6A 4FWTA 1OHHD 2Z0MA 4DDUA 4RZ3A 4ZI2A 2XNSA 1S3GA 2JDID 4LYAA 5HKKA 2ZEJA 3LW7A 3KFXA 2DFTA 1QHNA 4IOKA 1KDRA 3NC1C 4OJQA 3KTAB 4MA4A 1KIMA 1P2VA 2C8VA 3FWYA 2ZQ5A 5EUQB 3THXB 2WSSA 4D80A 1SVSA 4FWIB 2Z43A 3PUXA 4KODA 4Z1MA 5C4GB 3RSOA 5AUNB 1F2TA 1Z6XA 2BMFA 4XH9B 2ZS9A 4M1KA 4HSEA 1UEIA 1W49A 1G19A 4TTQA 1TUIA 3ZD6A 3A1WA 4XSHA 1G5PA 3T34A 3SFZA 3DKPA 4HZIA 3RSLA 2W0MA 5HKKD 4M9SA 1FX0B 3GJ4A 3IILA 5D3QA 5A0FA 1E98A 5AJZA 2JJ8A 3PEYA 4KYUA 4OQLA 1GKYA 2ZRNA 4TZ0A 2GEUA 2DYKA 4URZR 2GXAA 4UKDA 3P20A 4URWR 4NYJR 4XVUA 1D9XA 4LV6A 4PZZA 3K70C 4EJSB 1P9WA 4OKSA 1N0VC 4JS0A 4IXNA 3FKSD 1Q57A 2ZSFA 1U0LA 2GVZC 4EQ6A 5FI0B 2XTNA 1RRGA 1UAAA 4Q4HB 1YZNA 2WKRA 3EAQA 5H68A 2R9VA 1AIPA 4TL9A 5H8WA 4R2HA 4DT1A 1E1QD 2JLVA 5JRZA 3GJ3A 3GLHA 4PO1A 4XTRA 521PA 2O8FB 1Q1EA 2HT1A 1F5NA 3RS5A 2VH5R 1Z0IA 2Q6TA 2J5XA 3IBGA 3EC2A 4M53A 3T1QA 1KKMA 1P7CA 4LZZA 1OKKD 1BYUA 2WMNB 1X3SA 4QBIA 3ZDQA 4Q9HA 4H1VA 3LFUA 5FPSA 1T8TA 2ZRDA 4DLSA 4US2R 5KSZA 5FBVB 2IS6A 2PT5A 1G5TA 1TEXA 1EWQA 1JI0A 3C4JA 3LLMA 4G0NA 3AP2A 2YOFA 3Q8XB 3ZZUA 4F4CA 4QM6A 1TMKA 2NIPA 3WP1B 1PUJA 3SBEA 1EESA 1IHUA 5KUTA 4IEIA 1N2CE 1K8RA 2W6ID 3T1VA 4DB4A 3C15C 1NIPA 5SZJA 4Q4JB 2Z83A 4WW0A 5J4KA 2IEYA 4RD2A 1KI9A 3C16C 3CR8A 3WBJA 2QBYA 4MYUA 2JA1A 1Q21A 4WAUA 3THWA 1XD2A 1XPOA 3QKRA 1U99A 1ZD8A 2HLDD 3FPAA 2IXFA 1FNMA 2F9MA 1TQDA 2YC4C 1QVRA 2OFOA 2O5VA 5JSZA 4E03A 5J4VA 2XITA 2JJ2D 2ZRMA 3MWKA 1PV4A 3L8ZA 4NP6A 2ZUCA 5CYPA 4ZIRB 1XMSA 3M6AA 2WOOA 3GJXC 4P32A 4V0ME 3A1TA 4TMZA 1KTVA 4CT4B 2I1QA 1G8PA 5KSOA 4M0LA 4LHWA 1TQ2A 2CVHA 5FL7D 3FHTA 4LBYA 3U3JA 1PZNA 4PHGA 3IQXA 2NOAA 2H16A 4F38A 2OCAA 4AKIA 2J7PA 2QTFA 5KPJA 4FI3C 1NLYA 2JJ1A 3ASYA 2BCGY 1AGPA 3LWNA 3NG1A 2CCGA 1L8QA 1QG4A 4B2IA 4N1AA 4A6PA 5GVSA 2PJRA 1J2JA 1E2DA 2YV5A 4BASA 2ZI7A 2PCJA 4Q1EA 3R8CA 5CB8A 5AJVB 1E9DA 3UWOA 2ZYWX 4LBZA 1G1MA 4B48A 3AKCA 4ZO4A 2YYZA 1NI3A 1EG7A 4DSNA 2N1BA 5CJPA 1XJQA 1I4TD 4Q1FA 4BECA 4C0SA 1II9A 1GAJA 4WXPA 2O0JA 5FL7A 1SVMA 4JYBA 4HUQB 4IOMA 2ZAOA 4G5OA 1NVVQ 2QAGC 4JZKA 3CRQA 3QOFA 2WWXA 2B92A 3KQNA 3PFIA 4AWXA 1NG1A 3HYRA 3SJBA 3U6KA 5BQ5A 1AN0A 3PUZA 5KNDA 5HCNA 1ZU4A 2G1KA 4LJAA 4L9SA 3NDPA 5F3WB 4XWKA 4JVMA 1WMSA 4U5XA 2V1UA 3G0HA 4LHZA 2IF0A 2ZXUA 1E4VA 3SEAA 1Z0DA 2B21A 1NJFA 3DM9B 1WE2A 3QJYA 1QBKC 1CR4A 1NLFA 1X1RA 2QEQA 1DELA 5AJXA 2AR7A 2FPMA 2VO1A 1QVAA 1X86B 1DO0A 3TSWA 1F3OA 1G3IA 1QG2A 4US0R 4G5SA 4L15A 1KMHA 2ECKA 4HB2A 4TYQA 3B9QA 1KK3A 2GRJA 1TQ4A 3BXZA 1M7BA 3L82B 1CF4A 1J90A 4AYXA 2H57A 3MGCA 2WBLC 4LYFA 1JALA 1TF5A 2A5YB 1B0UA 4U00A 5E4FA 1CJTC 3PUWA 5FTKA 2B8WA 4WA7A 5FTJA 2XNDD 3TRFA 2F1IA 2OFWA 4A0RA 1U94A 2C96A 4NHOA 3GLGE 3LBNA 4EDHA 4A2PA 4XWOA 2P5SA 4CEJA 1UF9A 5P21A 1H8HA 1NVUQ 721PA 3EA0A 4X8HA 2ZI6A 1S3SA 1NF3A 2C95A 1LFDB 4XTCS 2NZJA 5DI9A 5FOTA 1XJCA 3MJRA 4JL6A 4PHFA 4W7SA 1GUAA 4DZZA 3GFPA 1W36B 1OYYA 2R2AA 3AV0B 2QY9A 3KKPA 2DPXA 1P61B 3Q7PA 4DUGA 3A36A 3MSXA 3X2SA 4MDEA 1PUIA 3P32A 5JS8A 3L0SA 1EFCA 2OO7A 3CW2A 1XBTA 4OL0A 5CLLA 4CDGA 1Z6YA 3WY9A 4ASUA 1NBMD 3KUCA 3B9PA 2C9OA 3EPKA 2NTYC 1IN7A 3BFKA 3CRW1 4OI4A 2ZRHA 4M21A 2GILA 3K09C 1W4BA 3W3AA 3IO3A 1JB1A 3WMGA 3CX8A 1N0WA 1D2MA 2ZYTX 5FR1A 1VCMA 4KI0A 2XTZA 1JQLB 1TU3A 4JBWA 1KMQA 1EWRA 2E87A 1XCMA 1XXHE 5FPKA 3ZS8A 2Q0HA 4M4SA 3U4QB 2JCSA 3F5FA 4B3FX 1GNPA 4B73A 4DXAA 2VP5A 4HDOB 4JBXA 1DAEA 2ERXA 4HUTA 2WMOB 3GEEA 4Q02A 3CIOA 1M34E 4OBEA 3SOPA 4DKXA 2OM2A 4PAQA 1WF3A 3P26A 1KO5A 4FMDF 2NMVA 5DO9A 4URXR 2VA8A 3NKVA 4B33A 1XTJA 1TAGA 5FTMA 1IXSB 1G7CA 4MUBA 2QA5A 2IF2A 5FL3A 3W6OA 1ZW6A 4LJYA 3HWSA 3EZ7A 4OI2A 3K0EA 2QAGA 5FOWA 2PEZA 3E5HA 3LAWA 3BAFA 3MCAA 4BZQA 3GMTA 1T3LA 1Z5ZA 1KJWA 1N5KA 2Q9AA 4AI6A 3E70C 4B3BA 2R6FA 5IK2A 1KDTA 1QDEA 2D2FA 2QSYA 2QL6A 2ONKA 3KKQA 2C99A 4QC2A 1KO1A 2VP2A 3I5XA 3L43A 2CCKA 3CM0A 3NBXX 3D7MA 3LXRA 4NDZA 5LB4A 3ZIAD 2NPIA 4QGHA 3SZRA 2J7KA 2PX0A 4TWZA 1VECA 4PZYA 3O8RA 1HA3A 4PPNA 2ZRKA 4OHVA 1FP6A 4LX0A 4QGGA 1GZSA 3AVVA 2QNRA 4CT5A 3QKUA 4WXRA 1NMZA 2IHYA 3DHWC 4F92B 2CNWA 4B3DA 3K9NA 1IM2A 3SS8A 4AYWA 4BLSA 4C0AC 2GCOA 1MRSA 1N6NA 2QPTA 3NVAA 3U7HB 4HLUC 1GOTA 1M8PA 1N6RA 5KTYA 4OQFA 2IS4A 3KB2A 4HAVA 4B3CA 1LNZA 1HQYE 3EZ2A 1YZQA 2ZU6A 1H8ED 2IUUA 1HE8B 4BFSA 1COWA 2H18A 1BMFA 2ZS8A 5C2JB 4LWZA 3UANA 2VIIA 2AX4A 4L8GA 1QHGA 4ILEA 2E9SA 1Z8FA 4MYTA 2LWIA 3I5YA 4QL3A 3EIEA 3A1VA 4LDJA 2G3YA 4RSGA 4A15A 1NY5A 2ODBA 2V6IA 3C14C 2Q9BA 3FKQA 3QKRB 1NN0A 3GJ7A 4DLUA 3WYGA 3AVXA 3A8TA 1H65A 1N6KA 1GNQA 3VHXA 1W4AA 2L0XA 1IN5A 1L4YA 2MMCA 4TLAA 2R44A 2XX3A 5L3QB
chains in the Genus database with same CATH superfamily
1I7NA 2FCAA 4OYRA 4JSTA 3RFCA 3VH3A 1DC3A 1U0NA 4BMSA 1ICIA 2VQSA 1K2VN 1Q92A 1U7PA 1UMCA 2YDXA 5CYOA 5I9BA 3TXYA 1YE8A 4BLPA 1TMYA 3KV3O 3HWX1 1P44A 1EQAA 2X3FA 1E62A 3HR4A 3MQ2A 1DAFA 2FWNA 3ZJ5A 2KSQA 1XQWA 4RCZA 2QDXA 4LG1A 1NFQA 2R47A 4NPHA 4BE9A 4D4LA 4F9GA 1Q1BA 1Z29A 2JGJA 4J0IA 2QMYA 4XCVA 1YHNA 1E9AA 5IJAA 3T7CA 4CZ2A 1ZHFA 2XMPA 2XODA 3H5VA 5LFAA 1FFHA 4J94A 2ZIGA 3R9XB 5H1YA 1AB6A 1FSPA 3PJDA 3VUEA 2E7ZA 4JT4A 4MPRA 1GTRA 3FHCB 3LL4A 1VG9B 3I2KA 3ITKA 4O3FA 4FJ2A 2UYCA 1QTQA 5LKRA 3U19A 3VPDA 3H5TA 2V6MA 2ZRLA 1A2KC 1ILEA 2C58A 4JVSB 3CVUA 4URFA 4FE4A 1QOZA 3UJCA 1Y34E 2GXSA 2R68A 2VUUA 4V0KA 3ZNOA 9MHTA 4C3OB 4ENVA 2R6R1 3IFSA 2GB4A 1PYDA 1Y1QA 1Y3FE 4DIEA 1JU3A 2Z4TA 1XMPA 3CB2A 1E3TA 3I92A 4G01B 4QXOA 4MEBA 2HJHA 2VRCA 3V8VA 2JLSA 2EF0A 3KR1A 2Z8YM 3GCDA 4QO8A 3SLKA 1GTVA 2AD1A 2HEGA 2RC6A 3LGSA 3SSNA 4S12A 1FTQA 4XWTA 3RBXA 7ABPA 3B20A 4IDGA 4W5WA 4BVFA 4RS4A 3KL4A 5CLHA 4E21A 4UM7A 2FPIA 2GJ9A 4ZVUA 4F4UA 1X8XA 4KG7A 4UBMA 1IPEA 4RD3A 3ZWMA 3KSBC 1W75A 5JG7A 1PGOA 1BMQA 1JXAA 1NJGA 1OFHA 2HQBA 1UK9A 5F5XA 1ODSA 2FEPA 4EJ6A 1R64A 3OTIA 1WEKA 2ENUA 3UW1A 1T6XA 1R0XA 3GPDG 5DSZA 5T67A 4B71A 4ZMRA 2NZUG 4KWEA 2QYOA 3Q87B 3FCXA 2DFKB 4FP9A 5PNTA 3V6LA 3UJPA 5KYKA 3CURA 3O4RA 3L04A 5ALTA 1U7XA 2EBWA 1MB4A 1N8TA 3NRCA 4CMIA 2D4HA 9ATCA 3BBPA 3T7SA 3L6UA 3AR9A 3ZLUA 4B7AA 4LMRA 9GPBA 3IAEA 1FU8A 2MWMA 3BJIC 1RYFA 2B7BA 5SZKB 2C03A 2N3ZA 1VLLA 8ATCA 3PJFA 1C80A 1T9KA 3E22A 3CINA 3IP9A 4OJMX 2OYSA 3AIMA 5MN6A 4BQOA 2A4KA 3AT1A 3EVBA 2I7XA 3AVPA 2HCTA 1T3GA 3AOEC 3FOCA 4D4IA 1YGPA 2DQZA 2JKZA 1NXOA 3VNUA 2D59A 4W1QA 2LGJA 1IXKA 1UAYA 3KEOA 2ODWA 4HGOA 2YWXA 3AUTA 4Y0AA 1F4PA 4GZ6A 4XR4A 2PV7A 2V54A 3F6BX 3K0AA 3ZWOA 4YRGA 5DBIA 1X1TA 3U9TA 1HM5A 2AD5A 3T4EA 3EQ7A 1RKQA 5EMLA 4RHUA 2BEWA 2F6RA 3CUYA 3DJYA 1K88A 3BMQA 2O2EA 3F97A 1E1DA 4P4UA 4RY8A 4AULA 2C78A 1XNRB 4TT3A 5KHLB 3KQYA 3EXHB 3D3EA 1Z4QA 1N9ZA 1T2NA 4NBVA 3EZYA 1IATA 1I9GA 3ZU3A 3AEKA 4F4HA 4Z3KA 3OIWA 4H9GA 3E82A 5DHAA 4AJEA 4YJKA 2ONJA 2QAGB 3ZJTA 1S2OA 1RW4A 1YUNA 2VF8A 1WW8A 1R0WA 1MW8X 2O8DA 4IDQA 2WAOA 1M34B 4QQ8A 5DYGA 5AUPB 1WM1A 5TF4A 3DYBA 1QTNA 4NF2A 2P4QA 1Y7HA 2IH5A 5KNLA 5H83A 4CDMA 1D1TA 2IPOA 1D6SA 1YVPA 1SB8A 2IYEA 4UD6A 1BU5A 4ZIRA 2C8LA 4YAFA 5ALNA 3PCTA 3G1WA 3N70A 1TAUA 3KLMX 2ZLBA 1OC4A 2Z04A 3G2HA 4IPTA 3U81A 4B80A 5LN1A 4JLVA 1YB1A 4C4OA 2AOWA 3JQCA 4JGBA 1J0DA 4LXHA 5JXGA 2BPOA 2GTHA 3DCIA 4GMFA 2NT3A 3H11B 2IQIA 3UMVA 3CBQA 1XDSA 4INAA 1QS0B 3PFCA 1OFIA 1NU6A 4NFHA 3R0QA 5HS4A 3ADCA 3HXQA 4EFMA 2GTPA 5HRAA 1ENZA 1MFZA 4GI1A 1H5NA 2EBUA 2V4UA 3FMFA 3GGGA 4OHWA 4EAQA 2UVQA 4G0YA 1NA5A 2J9FB 2Z57A 3QFRA 4Q15A 2PMKA 5F9MA 4U7TB 1NC3A 3ZV5A 3ER9A 3EPHA 5CJJA 3QY0A 5CITA 3BKXA 5E38A 3ABSB 2QG6A 3OMXA 4GX5A 4ZV9A 3TCXB 4UEQA 1NUPA 5B30A 3BWBA 2A1UA 3ZC3A 2QJTA 1SKUA 3QPCA 5HZGA 2OY0A 2P5TB 4HG2A 2J67A 2J8ZA 2G9RA 1Y80A 4EUHA 1JKJA 2YWBA 3T3NA 1CJSA 2OE2A 1R12A 1BX3A 1XA0A 2P6UA 3VNSA 1GTL1 4MDYA 3P0RA 4GQIA 1RLIA 5AOVA 1M3SA 5GAJA 3VKVA 5JWOA 1RZUA 1JA0A 1NIJA 5JZVA 1WBBA 1RE0A 1BS1A 3PC3A 4PHHA 3OUTA 2VHJA 4O59O 3BGDA 3S27A 3OVMA 1ZM3A 4XA8A 1QIIA 2EJTA 5LNK1 4P1ZA 4U7HA 4UEJA 4Z0TA 2WT9A 2ZTMA 3HDYA 1YAHA 1XQ9A 2M6RA 4GM0A 3KT6A 5JEDA 2P41A 1H5QA 2Q2QA 2I99A 2D7JA 2R2GA 2QF7A 3B1ZA 3WFJA 1XVIA 1F6DA 2FLKA 3O26A 4FMCF 2Y1DA 3QKWA 3MT0A 1TZCA 2KQUA 4Q03A 1Q6ZA 1R8XA 3BFXA 2CDCA 2IYRA 2BWJA 8MHTA 3ZLTA 3IMFA 1BDMA 2OTCA 2PWYA 4G8DA 4I81A 3BGWA 5AVWA 1D2CA 3TNLA 1L4MA 2QP9X 2QI9F 3DKVA 5KKNB 2G83A 5IKOA 2VYFA 2XMBA 4Y2JA 5LQNA 1HR0B 1E79D 1SIOA 4I55A 4KUGA 2ZJ0A 2NUPA 3V8RA 5EQTA 2FEOA 3LTEA 4YRRA 1J1UA 1QTRA 2GZ1A 1FYXA 2MSWA 2QLNA 4J4HA 3C74A 5AW4A 1P45A 1S1MA 4HFJA 4AIRA 1S4QA 2QIOA 2I33A 5L3ZA 4C6TA 1IG0A 1VBNA 2ODPA 4B6EA 1W36D 2GZDA 3H3FA 4RSRA 2PCLA 3QEMA 5PGMA 1XELA 2XGMA 4Z9AA 5IVHA 1PR2A 1AB5A 1COWD 4YV1A 5K2OA 1X2BA 4GZ5A 3M0EA 3O3NB 2ERCA 5DH9A 5GJBA 2HF7A 3ZV4A 3Q8KA 1RYNA 1WXXA 1G9SA 2VA9A 1XMQB 2WAMA 1FSGA 2XUIA 4NX2A 4CQLA 5HUHA 3VR2A 3UYKA 3CZPA 3UPUA 2CXXA 2G8NA 4MI1A 4H60A 4M3NA 3K70B 2I9PA 2RBEA 1J8QA 2R1TA 2OHOA 1A98A 2XCLA 3B6KA 3VPXA 2NP7A 5CM8B 3UATA 1KI1A 5KO2A 4ZCLA 2OLKA 4KQEA 4R0VA 3UFXB 3I9NA 4FU0A 4NLLA 2OORA 3OM0A 3DW3X 2XUDA 1N5RA 4Y1EA 1ADCA 5EE0A 2D7DA 4JLWA 1YKFA 3AESB 5GWXA 3ZCSA 5AESA 1ZRSA 4P5PA 4ETMA 1YAJA 3KFLA 2YFHA 1T1JA 1SCJA 1WXWA 3SXUB 1AKVA 5AHOA 2CNWD 2OL4A 1LXCA 4I1YA 5D8DA 1FZTA 1YJXA 2BFFA 1EGAA 5B5SA 3OURA 4TV8B 1R3UA 5JD6A 2I3BA 1EBFA 4KQ9A 4FFRA 3I1JA 1EUYA 3GGCA 2Y66A 1H23A 4WBXC 4PSKA 3BSFA 3EZ9A 1ZH6A 2CYBA 2V6BA 3JASB 3LOQA 3N8IA 4BRZA 2V7TA 1JJIA 1F8GA 2JF0A 2DUMA 2XNJA 3KJZA 4R8KA 3WDKA 5IAOA 1P3JA 1N33B 1KP3A 4OHZA 3UAGA 4EABA 4NXMB 4R2IA 2XE6A 2IXGA 3EF0A 2ECQA 4CHTA 1Z33A 4EUEA 4A4DA 1HDRA 1KI6B 3O38A 4UU1A 4LZWA 2R3SA 1IHDA 2RHCA 3DT9A 3QU5A 1TM3E 1XL0A 4KXNA 3ZCUA 3WGUA 2XRZA 1KYWA 3DPUA 3FPJA 3OCUA 2VHEA 2ID7A 4RYLA 1L4NA 3HNRA 5D2CA 5JY1A 4TLCA 4TLMB 4DR7B 1MHTA 2XMRA 3CJTA 5BN5A 2Y1KA 4D8WA 1NYRA 4GPZA 2DFVA 3I8SA 4QEDA 3M1YA 4CKBB 3IAAA 4Y2HA 4LHEA 3GLKA 3IBYA 3CISA 3UWKA 3AZPA 3ESRA 5TQ0B 2IOQA 2W43A 3F67A 3GGPA 3QI7A 4I1VA 2NNWB 3W6UA 3PEWA 1FDUA 5KOYA 2QKYA 2A14A 5K0NA 1QZXA 2ZT6A 2JIZD 1DQYA 2PZGA 3HKBA 4CF5A 5LQAA 1NE7A 3MJVA 5LXTB 3K9FC 3ZWPA 3Q5EA 3VSAA 2FPGA 1ONBA 3DMTC 3WO1A 4BFVA 4GS5A 3E61A 1T8PA 2BFFB 2XB8A 3TIIA 1KFEB 3DO5A 1JE1A 4MRMA 4IL5A 1O6BA 3FHJA 4Q93A 3F2IA 1YR7A 4B40A 1KGDA 2AVNA 2RH8A 4OY3A 2VJBA 2D0PB 1A7UA 2HA7A 3NBKA 5CNJA 1NBMA 3W3AD 2J0SA 3HACA 1LBEA 2HV8A 3AVTA 1JZQA 4XOUA 2OB1A 1VE6A 4F1WA 2PFSA 4HBZA 2G06A 4HATA 3S99A 3O0DA 1F0NA 3L7BA 1CUXA 2HJGA 1SXHA 4GICA 2OXTA 1EM8A 2X4GA 1WDTA 1EKXA 3VTZA 2G0NA 1UOEA 1D04A 1DUSA 1JLLB 1U63A 2HXSA 1SXJA 1ULUA 1A9TA 1E2GA 3JQRA 4S1NA 4GUDA 3UCFA 1ARZA 4DJ5X 3NEJA 4MI3A 3VVLA 4CV3A 2RE8A 4YIKA 2KBEA 2JIRA 1G291 1X80A 3M7IA 3OJFA 3SZGA 2GHQA 1JL3A 4GPIB 4GYKA 1WW3A 5TMEA 1QOQB 3RSFA 4C9BA 1BA2A 4QX6A 3VR0A 1VCIA 2Y1LA 4HLUA 3ZCRA 4WPGA 2EERA 5K2MA 4QFMA 5JJLA 1H8HD 2V8BA 4R98A 1U02A 2J3MA 2QE6A 4GOJA 2Q2WA 2YJZA 1ZH4A 3LHFA 5C3MA 2DG2A 3PKJA 1EM6A 4LYEA 1M6NA 1VMIA 4OXIA 2ZCJA 3KVRA 4IMIB 5ITZB 4HRXA 1EA5A 2FV8A 1NPYA 1VKHA 1WHSA 1YMQA 2DQYA 2GK7A 2IE8A 2P90A 3HC7A 4KN9S 4U9IS 1L2TA 1N5OX 1PT9A 4MUYA 4HVCA 3RVNA 5K6AA 2BFMA 4G37A 2RHLA 3FE2A 2YV3A 4IOLA 1YU9A 3DBVO 1D4OA 1VMEA 2O9JA 4UPEA 4W5NA 1HT0A 2PA0A 2OBLA 3KWMA 5TY0A 3TIGA 2V4ZA 1I3LA 4XJVA 1CY1A 1I6KA 3DV0A 5MHTA 2NO6A 2QU8A 1SUIA 3T0GA 1CQIB 4FMCB 3QRWA 2J0VA 4V0SA 2A84A 4FIDA 2B37A 2ZB4A 3PHLA 4V0LA 5CYGA 4FI3F 4JL8A 1FFWA 4UCWA 4LBWA 1FCJA 3HB4X 5BW5A 1Y33E 3T3OA 2Z56A 1ODLA 3C8DA 3VSDA 4FONA 3W6ZA 1RJWA 1H6CA 1OBFO 3VSCA 4B7ZA 5IH3A 4JR1A 3ZIUA 1X8JA 3IQDB 2R7NA 3N6XA 1OF1A 2GA8A 3ZWBA 3TL3A 4L5IA 1NN5A 3KWLA 1TCVA 3A3KA 4IY1A 4MMXB 1WXDA 1FMLA 3MJSA 1YFKA 3MYRA 3OG9A 4RL4A 2R00C 3E8MA 1UQTA 2WYHA 5AJTA 4OQZA 2A0WA 3B12A 1ZK2A 5K6AC 1IM5A 2GN4A 2HO4A 2Z3ZA 3A1SA 2PD6A 3DS8A 4ND5A 4P9NA 4BO9A 3W1VA 4II7A 4LA4A 2F9FA 3GARA 2ZJ7A 1E7SA 1M34A 5KC8A 1H5UA 2LVBA 3SS9X 1DWOA 1WY5A 3GHHA 4JAVC 1P33A 3UNXA 4CDNA 1AM4D 4Q19A 3NLLA 4YI5A 3CUUA 5AM5A 2CD7A 2ZJBA 2F67A 3VPAA 4DS3A 1SIUA 3HKEA 3SYKA 4YXFA 5HCUA 4H1UA 1AK1A 1ESMA 3AF1A 3QHQA 5LPNA 1RABA 2QX7A 5G0TA 1UPAA 1DEXA 3EHDA 4DT1B 3P4UA 2ZRPA 3FYUA 2RGAA 1IOZA 3GF4A 4ZREA 1BE0A 1MAAA 2PMDA 3NNDA 3B60A 4OHXA 2CLOB 3LX4A 3WQRA 4ACAA 2IPAB 2B4QA 1E1NA 3DEAA 1T4MA 3MUOA 4RXTA 4IP0A 1CY8A 1NYLA 5G2OA 5JMTA 2HMYB 1II0A 1ZUIA 2ZTLA 5IM4A 3WL7A 1G7TA 1C9YA 1UZNA 1XA3A 3P5SA 1PWXA 1E5DA 2CZGA 1A04A 1ISMA 2G72A 3KB1A 2AZMA 3QVGA 1ZA1A 1IU9A 2Q8QA 1CIJA 3QM1A 3CF0A 2VLIA 1D3AA 2A4MA 3P0FA 4MWZA 3H9QA 4BNHA 2EFHB 1ZHHA 5EKDA 1HDCA 4J0QA 5T5QA 1NW4A 3SJAA 1GGEA 5HW0A 4GSYA 4QTXA 4NHEA 1NKVA 2JCBA 4MRAA 3LBYA 4CG3A 1JXOA 4CQJA 3UTCA 1YCGA 3C6YA 3GLFB 1J00A 2X0KA 4OXQA 1FNDA 1LF0A 4UVEA 3A04A 1XU4A 4XD7D 2FW6A 1ORDA 4D4JA 5FWNA 1S89A 4RPJA 2WINI 1H0HA 1YR3A 3II6X 4IICA 3ISTA 3UUEA 1ODJA 3C70A 2BFEA 5IKMA 2AG0A 1EFPA 3IOMA 4IHAA 3EGDA 1N3BA 1U7WA 4H6VA 1YDWA 3QXJA 4D9MA 4IFEA 3OJLA 4D7AA 4RJTA 1GAWA 2HSDA 2PL9A 2WPDD 2RI6A 4PLPA 5HQJA 2X40A 5BMVB 3G2QA 1P9RA 1X0XA 4RE6A 1Z2CA 3R7AA 4CM3A 4KVAA 5CTJA 2CB0A 5DN9A 3ZI0A 3U7GA 4UAJA 3MUEA 1EJ2A 3RABA 4LY6A 3AWIA 3OLXA 3TQRA 1PW5A 3EZLA 4O1IA 3NPAA 2WAYA 3WNZA 1UM9B 2Z6AA 1XLTC 2A0XA 4JUDX 1EGVB 5JH7F 1KY4A 2QI9C 4X60A 4H4EA 1QRRA 5ICMA 3K0CA 2WWTA 3AIIA 3LHDA 1Q0ZA 1PAUA 5JR3A 2CV0A 1RLTA 2VWGA 2AN5A 4FFBB 4Y2QA 1MOQA 1V4NA 1F2UA 2X7JA 1BE8A 2PKCA 2WTBA 4DQVA 4EBBA 2JKYA 4ZGBA 1NZFA 2V7WA 3PEEA 4AJPA 2BKUA 2FWMX 2REOA 5JJIA 1SU6A 4FT4A 2WZBA 2B1JA 1FA9A 1Q1NA 1XYYA 2AGVA 3HSKA 1KR5A 4O4HB 3KJQA 5FO1A 3R9KA 3TSCA 1TTTA 1P17A 1R6UA 2W6IA 3WL3A 1JE0A 1U0JA 4UDYX 3QI2A 5JBNA 5M5BA 4JB2A 4AP9A 1FOEB 3EVDA 2NSLA 2Q3CA 3K9BA 4TXJA 1MTZA 4Y6SA 5K51A 1NDQA 5CIWA 5JJCA 3ZQJA 2CHVA 4JQCA 1DC8A 3NHBA 5FUXA 3ZGYA 3JVUA 3S2FA 1UFRA 5EZYB 4PY2A 2OV4A 5ILGA 1LBQA 4EMSA 2L17A 2REBA 2YNMD 4CLRB 1VXRA 1UIRA 4QYXA 1C1DA 1UPFA 1MNQA 1R5NA 3GA7A 3QU4A 5FWYA 3ANNA 2QX6A 2PWPA 2IY7A 1Z4OA 3KQWA 4RLSA 2NQ2C 4Q48A 1TUGA 4UTZA 3DFUA 1A69A 3L8MA 4QOGA 5D3KA 1MAVA 2CJPA 2XQIA 5JVDB 2A94A 3FH0A 2ZUUA 1YVEI 1H2WA 3S68A 1AMNA 5EJAA 3GRUA 1DIAA 4DEYA 4IZHA 5FWXB 4D9NA 2C9BA 4CM9A 2FMHA 5T8KA 3ZXIA 3LA6A 4M49A 3M9LA 5KU7A 1WB6A 3FTFA 1BD4A 2ZYAA 4RWZA 4E5UA 2HTFA 1LGYA 3CLRD 1IXYA 1P9LA 3S5UA 3MTQA 4MYSA 1TRHA 3F7OA 4XARA 1X39A 1YB6A 2YW2A 3AKYA 1BCRA 4DEVA 1VPDA 1C41A 3A2LA 3EMBA 5FEUA 2C5LA 2QXYA 1WMFA 4OXXA 1OV4A 4GSKA 4IS3A 1VPTA 5D85A 3PCXA 5G0WA 3CRMA 3AOEA 5FNZA 1GZ5A 1MORA 3CLUD 4CYMA 3QSYA 3BERA 1SXQA 1FP7A 1ZGCA 2AG8A 2X8JB 2Z2YA 3LC7O 5IRCD 1UBHS 4U5QA 4DCUA 2HK8A 4GQBA 2YIJA 1N32B 2G1AA 1K8ZB 1VFNA 2UZ0A 3OM9A 4I9HA 3UHJA 5J43A 1AA9A 2OV6A 2YV2A 1QANA 4F7WA 4ILKA 1F7VA 3BIOA 4JC5A 1C7RA 1RDFA 2FLVA 1R0YA 3LRXA 1PSWA 2AUMA 1XCGB 1EK6A 4QECA 3ETNA 3RQSA 3DBIA 4QSMA 2AXEA 2A30A 2WSLA 4BGUA 1A72A 1WCWA 2UXCB 3WO0A 4U39A 3F8SA 4C29A 4WQMA 1RE1A 2QOEA 2GHRA 4MKFA 1C4WA 1LK5A 5LIRA 4O5AA 3A05A 4NPCA 5LKAA 4IAOA 4ZOLF 4ZP1A 1TVEA 4KLNA 3CCFA 4XM1A 5H16A 3SHOA 3SYRA 4EB6A 4QDUA 2QTNA 5FEMA 3TTTA 2F62A 2XNHA 3K2EA 3QYAA 3U39A 4UHEA 4EY7A 2Q29A 3EHEA 5BVGA 5CFQA 4QWMA 3PXBA 3SF0A 1P77A 1UDBA 3DE1X 1KJIA 5JFGA 2C7OA 4G67A 1BDHA 2FR1A 3RTDA 2PZJA 3TTVA 1ZL0A 4W5HA 3RUEA 1OPRA 3L0OA 1YVRA 5GONF 3VX3A 5J4HA 1PDVA 1LW6E 1H6BA 3V8MA 3BMCA 3L7DA 4QDXA 5JHHB 3O8NA 1FS4A 2BHNA 3VJMA 2VZ8A 4G85A 3A6EA 4K6OA 1V5IA 3LZ6A 4Q9JA 2DB3A 4Y9DA 1CNEA 4G0OA 4XQ0A 4QWWA 5ERYA 3WBKA 3N75A 4A03A 1I6WA 1NV9A 2HF9A 2IZ7A 3LQQA 3K7EA 5CA0A 5C8VA 2O8VA 2XCUA 2Q2NA 4C87A 1J06A 4H0NA 2AZXA 2AQIA 5FBRB 4G23A 1WZEA 3H7AA 1Y98A 5IAJA 1WUHS 5JDCA 2FU5C 4TMKA 3WL8A 1S9DA 1U31A 3JZMA 4R9SA 5NULA 4I4CA 2F1OA 2VXCA 2IDMA 2NT4A 2OT3B 5HDQA 1J0CA 2QR2A 1V3VA 1HKUA 1C7ZA 1JPNA 1JBKA 2CL5A 2GPAA 3TOSA 5EUBA 4BTEA 4A8JC 4MIKA 3OP1A 4C3VA 2GJAA 9ABPA 2BFWA 4AKEA 5A06A 1YZFA 3NJ4A 5L6LB 2BC9A 3DL7A 4K6KA 4Q6WA 4YP7A 4LXXA 3VNAA 4ALNA 1F6WA 2DT5A 2ZFUA 2F1RA 3AY3A 5JOQA 2JJ2A 2Y71A 4B9EA 2C2OA 3D8BA 2EC5A 4RPIA 4BNXA 3ESAA 4KWTA 3TRIA 3O6VA 1PUXA 2CHUA 3WLNA 1TK3A 4ZPXA 1BGVA 2WABA 1OYWA 2I4OA 4IKOA 5C7OO 2ZETA 2YIDA 5TV2A 4RDIA 3Q7TA 4QICA 1FJXA 1PZGA 4QUKA 4LVUA 2UVDA 3G9XA 2Q3HA 3WLLA 3OECA 4B0OA 3MINA 3U26A 4J90A 1PZFA 2PUHA 4ZYWA 2ISQA 1QGZA 1GCIA 1MPXA 5BNIA 4M1OA 3T38A 4OBBA 1GKUB 1KI2A 2FOLA 2D62A 2GEFA 3Q0EA 3DUFB 3EE6A 4IM7A 4Q3KA 4AUKA 2FZLA 1DKUA 1PFKA 1OX4B 5CXXA 3IUNA 1G8GA 1NVEA 3B5EA 3FHOA 4HLQB 3KT8A 4I66A 4MB6A 4P8RA 1HQDA 4ABTA 1KQPA 4HVAA 3KOUA 1KGSA 3AEQB 5AP9A 4FDMA 5IYZF 1IPHA 5JCJD 4IILA 4LZNA 3HSYA 1J8DA 1XQ6A 3JQAB 4OFBA 3O8LA 4FDUA 4PO9A 4Q7JB 2PT7A 3AO0B 3QXHA 2Q27A 1Z4NA 2XOKA 2AWNA 3DMFA 2FEMA 2PLFA 2R8ZA 5CNKA 4CG1A 1W5FA 3RYCB 2QENA 3VHRA 1QYIA 1QBGA 4TN1A 3RS9A 2QN6A 1E6LA 2HDHA 3AGPA 3FUTA 3RSCA 3H05A 3BKWA 3OU6A 1O77A 1W85A 3FBWA 4FZ5A 4YMHA 3E3MA 5E9JA 4GOKA 3KJNA 1P7YA 1ZS9A 1ZDMA 5KVSA 2E4VA 4FCWA 3O8QA 3CU5A 4ERXA 4EI7A 1XA4A 3VJLA 4PC2A 2Q1UA 2QRQA 1X2EA 2OOKA 1XEXA 2Z2IA 3MLBA 5KOHA 3PWTA 1QUFA 2ORYA 1UC9A 2Z9DA 1ENYA 1SHUX 1X80B 4OK6A 4FIZA 1C7EA 1BFKA 2VZ9A 1Z62A 2FQ1A 3QFTA 3Q9NA 1VBKA 3GRYA 2BTOA 3GROA 1NASA 4XEUA 5IPFA 1JLLA 1U04A 4TXMA 1VJTA 1Q0RA 3DCYA 3LWDA 3GJRA 3SM9A 1ZCBA 1B8UA 1OAOC 3PFKA 2IX3A 4I4IA 4BFWA 2GNPA 1N2HA 4DV0B 1P1CA 4EJFA 1VYHA 2WD8A 4UHHA 3R76A 1U7UA 2OG1A 2RI1A 2UDPA 3I1IA 4L5CA 4WZAE 3QOWA 1QZ3A 3VKHA 3R5TA 4DOMA 4OXRA 4C1NA 4EPVA 1YGYA 2AFIE 2PWAA 3BN3A 4OXKA 2H29A 1YDEA 1WUYA 1LBHA 1SELA 3WB9A 2W6JD 4CTMA 3A1UA 3RYFA 1MJGA 2XMCA 5DWDA 1IRIA 1R10A 5M3BA 2IELA 1HE5A 5EPUA 3MD9A 5E9AA 4FUQA 1NXSA 4JLNA 3HXTA 1MZPA 1QK3A 1GADO 1N77A 4OGFA 1KIFA 3WMEA 5BR8B 5ALWA 4F8YA 3MMXA 4ZQIA 3AU9A 1OTHA 5JYDA 4QVGA 4YFVA 1SFRA 1PV2A 2F3PA 1NY6A 3EN0A 3SEFA 4EHNA 1HDOA 1MIOB 2CV1A 1G5HA 1R6TA 3CPHA 4KFSA 4HWKA 3ICVA 1ZIDA 4IRUB 1KJNA 1QQ5A 1E3IA 3RIYA 1XTUA 5DMHA 5CFLA 4ZXFA 1E6UA 5HVNA 1YZGA 2DWOA 3FZNA 4JJ4A 3USZA 4NNJA 2FMIA 2QVCA 3LT4A 3I05A 3QFFA 1TIPA 3NOVA 4BO7A 4OMUA 1EMDA 2O4UX 3ZHTA 3RK1A 3QYFA 1BKSB 2GPSA 1EE9A 5C5IA 2I4IA 1QH8B 4DYVA 4AKTA 1JXMA 5FI3A 3HA2A 1P5ZB 4MV6A 4O4LB 4PLZA 5K0CA 2R8XA 3I04M 4UTRA 2DERA 3KUXA 4MUGA 4WKPA 4DLVA 4C89A 1GTJ1 1SG6A 3L7OA 3N2EA 4KGVA 3JWEA 4MR7A 4HNUA 3KXKA 5C7IO 4JUCA 2JATA 3JZAA 1Z5UA 3G5LA 1QV6A 4DUGD 2Q49A 1SU7A 4ZT6A 3ELUA 1NW6A 4JJ8A 1N6IA 1YFLA 2WVGA 1G4HA 3H2HA 3HI4A 1JDVA 4ZCSA 1H2FA 3WIOA 3D6MA 3KYBA 1A8IA 1T3SA 3GK3A 3TLKA 3WQSB 5JD5A 3TB4A 3N2GA 4YUXA 4PYNA 2NZYA 3BE4A 4J03A 1ISIA 1ZRHA 3DDOA 2J1LA 4FS8A 4Y6QA 3LDGA 1GXSB 1AK2A 2PRIA 3N8NA 4PX9A 2E4WA 4M99A 4P3OA 1V8OA 2YMQA 2YXNA 4Z4GA 4BBZA 3JSXA 5JNWA 4HMPA 1JIXA 1L7RA 1L7OA 5JNLA 4G84A 3B5JA 1EFHA 4PRYA 1VKRA 4MW6A 4BEWA 2AG6A 3BGOS 4UAGA 3D9QX 3BK7A 2OMKA 3FCCA 4BJ1A 3N2IA 3VDNB 1VIYA 1JMKC 2B5OA 3H5OA 3ADOA 3IC5A 1VIVA 4UUAA 1P3Y1 4R2JA 3ZHUA 4BFTA 4K05A 1TL7C 2FSIA 1UIMA 3NBYC 5CIYA 1EX6A 1AY0A 2D5CA 1EFVA 1JDPA 3PXCX 3QJ5A 4YJ3F 1X3LA 1OU0A 4Q01A 2EKLA 5EJEA 2J9XB 4KBYA 4QPNA 1IQUA 5U9CA 4CCYA 5TT0A 1VJGA 2G7MC 4NPAA 4TLDA 2JAPA 5F2NA 2CDNA 2QM0A 3BD8A 3ONWA 5B1SA 4L5AA 1XPRA 2ZJFA 2L18A 1MB2A 5F2EA 1OVMA 1WSAA 3MZ0A 4LRTB 4YYZA 3I53A 3WKEA 3H9CA 2P6NA 1EP2B 1KFCB 2XJ4A 4TMFA 3N7TA 1B74A 2HU7A 3JVIA 3LQ4A 2IZ6A 3CPJB 4L07A 2FXVA 3CKLA 3O84A 4BWYA 3H11A 3ZKWB 3T7TA 2H54A 4RIEA 4Q5IA 2G1JA 1JR3E 2D1RA 4F0JA 1GQFA 3UYLA 1BN6A 4G1MB 1TZKA 5BYJA 4RM3A 2WQ6A 1GNLA 3FNGA 5B36A 4MVJA 3L93A 3PB3A 3UB4A 3RSZA 2ZSIA 1NUTA 3CIFA 3EWAA 4I1SA 4HQ0A 4MQBA 2V7BA 1EIZA 5IABA 1DPFA 2QAIA 3JVEA 5E8JA 4C7XA 1DAPA 3N3AC 4BNTA 4XWAA 4PQGA 4URVR 4F60A 5HG0A 6ADHA 2IUYA 1V3UA 1YVUA 3FMIA 2UZ1B 3MMNA 3MB5A 4LZLA 1QNLA 1U2QA 3CMCO 2X9GA 1SG0A 1IJBA 1P3DA 1BGXT 3DBRA 3GBPA 4DFDA 1U5AA 1YRQA 4ALJA 1YQQA 3PFBA 3RJ9A 2E4AA 2IYXA 2I6SA 2GF9A 2IZZA 2WRZA 2O2IA 3EVFA 4ND4A 4ZVQA 2Q0QA 3SM3A 3HZOA 4CEHB 4LJLA 1THGA 3D8RA 4ZHSA 1H1LB 3IA7A 4QO7A 2WWVD 2BVNA 1GITA 2HMUA 1U0OC 2PGJA 2QBYB 3VH1A 3U62A 2OO5A 4LVCA 5ICFA 4PSAA 1MH1A 1ADGA 1UWKA 4BCDA 3REOA 4B09A 4X92A 5DHQA 1O1YA 1NGSA 3NETA 2G0TA 1GTZA 1OFVA 1U80A 1QIEA 2X14A 4YH1A 1P9NA 2J46A 2AXQA 2PGAA 4YAOA 3BILA 2OHXA 2GK4A 3S2UA 5CX4A 4JHLA 3EXFA 3TIVA 1MX3A 5IANA 4KV7A 4BMDA 4OOEA 1BVRA 2VG8A 3V1UA 4MIYA 1W1UA 1WTAA 3A4YA 2D13A 3C5CA 3ZDYB 3DE4X 4IGEA 5CH5A 2RH5A 3GZNA 4RVOA 2JFQA 2I6XA 2C8KA 1SVIA 1TTPB 1J07A 4NYIR 1RCUA 3TQQA 2ZIZA 2HOQA 4PXAA 3WRVA 1BE6A 4RA6B 2HQRA 2PKEA 5G1PA 3EUWA 5JS7A 2OHHA 3RUAA 3D5QA 3DCJA 4AZSA 1NN1A 3THXA 2AMJA 3BWMA 3CX6A 3OPXA 4DIOA 2FSGA 3LIIA 4BX2A 3ENKA 2GLXA 4MCIA 4RXUA 3GJ0A 4LI3X 5LQKA 3TXAA 1IOVA 2WJYA 4C6TB 1KWKA 1L3CA 2EFCB 2Q4RA 2ZRAA 4MGEA 2VF4X 4YMTA 4OX9B 4B3FX 1J0AA 2NN3C 5C1PA 1VG1A 3KKOA 2H2DA 1H2BA 4RH0A 1UMDA 3LWBA 1N5LA 3OZWA 3PPVA 3OIYA 4RS3A 2BEKA 1NBAA 4IYRA 4MQEA 3ZU4A 3AP1A 2HIGA 1Z0AA 5AM4A 3ZBTA 1WSWA 3R0IA 1XR3A 4YVFA 3T3DA 4F72A 3AJDA 1AD2A 1TAQA 2UAGA 3DFZA 1ESNA 5DNEA 4DMKA 2GAAA 1U1GA 3K6KA 4YROA 3X43A 3QOXA 2GD0A 3C3YA 4YRCA 3SEZA 3HFGA 1O0BA 1A82A 3H04A 3IT2A 2SKDA 4P22A 4QUDA 2W98A 4HUQA 4HFMA 3G0OA 1NXQA 5ARDA 1Y8CA 3WWEA 4GWGA 2NU6B 3D2CA 4UBOA 3UT5A 2F48A 4HP8A 3PR2B 4QFCA 2NSYA 4QBFA 4RF4A 4UNQA 4BVKA 3DYVA 3IX7A 5DVZA 4R01A 4CR6A 1RP1A 2FUKA 5EP2A 3BMQB 4R5MA 1ZP6A 5ANRB 5BQPA 5CDFA 4GZLA 1QK4A 1I7LA 4HZUB 2O2HA 3QEJA 2R84A 1RJ9B 1LDMA 1JVBA 4D8XA 3R1IA 3LOPA 3G49A 4BN0A 4OBXA 3W8DA 2BMJA 3E9ZA 4ACBA 3S1AB 1QYXA 4FYXA 1ZNXA 3SVTA 1W0JD 3WMFA 1CZKA 1YQWA 1N2CA 1ZOLA 4G26A 3MCUA 4PQYA 3AG6A 2JFYA 5CT5A 4HO1X 3BXPA 2VUHB 4TTAA 1HK7A 3VI4B 2FQWA 3A9SA 4D3XA 3TX2A 4WJLA 3ROQA 4BV2A 5A4AA 4AXXA 1EUDB 3LKDA 2WF6A 1Q16A 4OBWA 1EK1A 1R9NA 2VQ3A 1OX6A 2W2PA 3EG9B 1ODKA 4FHZA 1M2JA 3TKLA 1NBEA 3QKSA 3TQTA 3UJ6A 4D9KA 3PNBA 4O0LA 2BTEA 3BIXA 3C1OA 3ZX5A 2BLNA 4FYIA 4TWBA 4Z51A 1TJYA 2VAXA 4LPKA 1YZHA 2FWRA 4Q00A 3ZZNA 3LPMA 4KBGA 4NBLA 4XGNA 5L53A 3BH6A 5TQ2A 3L6DA 2OKGA 1D2AA 4KO3S 1Q3TA 3ZDBA 2BE9A 2P9YA 2XVMA 3E8SA 1GL9B 3K9WA 3R0XA 3KD2A 3ZVRA 5JFTA 2F3TA 1OA0A 2D1FA 3RRXA 2XCTB 5J47A 1L5WA 1SU8A 2N46A 1BW9B 1B2LA 4DWWA 4ZTUB 3JZDA 3G17A 5JRJA 3IESA 2P1ZA 3ROKA 2CVZA 1R8QA 2GA9A 3L06A 1YDFA 3TLXA 2WYIA 3QQ5A 1P18A 1C3VA 3BFJA 4EPYA 1UC8A 4GT1A 3OFKA 4PQEA 1FTYA 5EP3A 4US1R 3T5DA 1Q7TA 1ORIA 2OEPA 2YBEA 1FB5A 4LUCA 5DN6D 5AW1A 4WKGA 1LPAB 3VC7A 3CEJA 1QIDA 1Z39A 4RESA 1R8JA 2FE4A 4OQMA 3ZNQA 1JFTA 4YRBA 2IYQA 3GEPA 2JIZA 2XB2A 2OM6A 2WWHA 4F6LA 2HNBA 5KNBA 3VH2A 4ZZ0A 1P1KA 3ENZA 4MVJD 4YI3A 3FG9A 4P0TA 1GN9A 3L0CA 4GWLA 3K53A 3N74A 5F3DA 3BXHA 2WKQA 1E2HA 3K3PA 3V4OA 3B8HA 5MDHA 1H9AA 1NE2A 3PTAA 3CF4G 5HZMA 1K89A 2PS9A 2W2KA 3QG5A 5G53C 3EIQA 5AJYA 2PV0A 2D5LA 1I2DA 2PUCA 4RH1A 1E5QA 4MRPA 3NTQA 4I9FA 2BFCA 3D5TA 1M72A 4HDNA 2EFEB 2FX5A 2O2JA 5H9VA 4FJ0A 3D54D 1I1NA 3KV1A 1F06A 2YZ7A 5F3RA 3IEVA 2QTCA 3R74A