4DLXA

H-ras set 1 cacl2/dte, ordered off
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlxA00
4EQ6A 2GEDA 2R6GA 5DISB 3TW8B 4DC9A 4NCIA 4ESVA 2QP9X 2Q3FA 2BM1A 4G01B 3QXSA 1OF1A 2A7QA 3WP1B 2AN9A 3ZDQA 3KB2A 2UZ3A 1FFHA 1E2QA 3SDZA 3CX6A 1FUKA 3BJIC 4FINA 4HLDA 2PJZA 3J81k 3ZGXA 4LBZA 4O0MA 1GL9B 2YV5A 5FL3A 1FNMA 2H18A 3FHOA 4L4UA 3SE0A 1N25A 1R8SA 4Z8YA 2YZ2A 1QHGA 3QUSA 1NN3A 2IYSA 1C9KA 4URUR 3GCGA 2QBYB 2HJGA 4ZI2A 3AH8A 1E2PA 1FNNA 3KQHA 1GKUB 2EFGA 1VECA 5KSPA 3HJNA 1XEWY 4AK9A 3SHFA 4Q7LA 1KTVA 2B92A 1JXOA 3TW4A 4BRWA 2W6IA 5IHPA 2PX0A 2Z43A 4EJSB 2ODWA 4BGDA 3GP8A 3BERA 1IN4A 1E9RA 2R62A 3P4XA 2QEQA 1QHHB 3R9WA 3QEOA 1QDEA 2XTZA 4CVNA 1LV7A 3NC1C 2ZSFA 4LOAA 5DLQC 2UZIR 1HT2E 3QE0A 4Q18A 2QZ4A 5SZKB 5BYJA 4PPGA 4IVRA 4D4LA 5EQTA 4W9MC 4TYYA 2IT1A 1X8JA 4DLXA 5BN4A 1NVVQ 3PJRA 4CEHB 2D62A 1KDPA 4IHQA 1OH7A 4A15A 3VR6A 3CRVA 4RD3A 1EG7A 1XXHB 4IDOA 1OV4A 4JSYA 5KHOC 5DI9A 3MUFA 1CXZA 1ZMXA 2WSSD 2QSYA 3K9LA 2D74A 4DB4A 2REOA 1CJVC 2OFXA 5KSYA 4QOSA 3WHKA 1FX0A 3LV8A 1D5CA 1T0HB 2ZQ5A 1OHHA 1HUQA 2QMEA 3RS2A 2VL7A 4MGYR 3V4RA 3PUXA 2ZETA 2ZRPA 4HZIA 4A0FA 3U3OA 4EUNA 1SKYB 3LBIA 4Q01A 3ADCA 1E2GA 1YZGA 4PSAA 2V54A 2PT5A 1ZUIA 4BQSA 4EIWA 1T3HA 3I5XA 1U94A 2ZRMA 2GAAA 1X86B 3THYB 2FA9A 2J7PA 4Y0VA 2FPLA 4ARZA 4B2PA 5GVSA 4R9UC 1ZAKA 2ORIA 2RGDA 4KFRA 1KZGB 6Q21A 4A8JA 3EPJA 4KYIB 2LKDA 2GJAA 1KJWA 1W4CA 4Q1EA 1JEEA 4AURA 2RAPA 4MGKR 5JWHA 2MMCA 1CIPA 1SVLA 3IUYA 1KI6A 4TYPA 2W58A 4WZ6A 5K8LA 2G77B 1E3MA 2YOFA 1F6BA 3KB1A 3VMFA 3TUZC 3WRYC 2QT1A 3CKLA 3GJ4A 3EZ7A 1N5LA 4X8HA 1KHTA 3S1AA 2NMVA 3AF2A 1YU9A 3KXKA 5B30A 2CE2X 5FPSA 5FL7A 1NBMD 3T15A 1QVRA 3KKPA 4HDCA 3WMGA 5L3SB 1YR7A 4GL2A 5ANRB 2BMDA 2GBLC 1XF9A 1Z47A 4FCWA 2ZS7A 1DVRA 4QJ4A 1ZCBA 2FJUA 2C98A 2VA8A 4XTCS 2PMKA 2J0UA 5HE9A 4Q1FA 1UBEA 5A5GA 2GF0A 3ZJYA 221PA 1FL9A 3M0EA 3MSXA 2TMKA 2R6FA 4OBEA 3SYKA 2O8FB 3DMNA 1US8B 2XNSA 3TH5A 3CRRA 1S9DA 4EQ6B 1DAFA 4YLGA 2KBEA 1OIWA 3Q7PA 4MUBA 1FP6A 4NDZA 3E70C 5CK5A 4B3FX 5AUOB 2P67A 3TQCA 1E0KA 1YR9A 4IOLA 4P4SA 3SBEA 2QPAA 1VG1A 1T0JB 2EFHB 3N70A 3BH7A 4Z1MA 1TQ6A 3LW8A 2ZI4A 2NO7A 1NY6A 5HKKD 1OH8A 4BECA 5IK2D 2VEDA 3EC1A 3DKVA 4G5GA 1FTNA 3VNVA 2REXB 4WOPA 1ZU4A 3PV0A 3KJHA 2UKDA 2ZE6A 4JLPA 1OJLA 1AGRA 1C1YA 1G64A 1X8LA 4HAWA 3GLIE 5K8IA 1W0JD 4M21A 1M8PA 4DDTA 3SFZA 4PHFA 5DYGA 3RSLA 4PO9A 3TMKA 1ZYUA 5CIQA 2GAOA 2YC2C 3UG7A 5AJWA 4DCTA 5EUQB 2ZANA 4KHZA 1ZIOA 5FI1B 421PA 1Q1ZA 1Z83A 4NKRA 3CX7A 4LX0A 3K09A 2ZYVX 2WJGA 4JYBA 4M9SA 1Z6XA 3QPVA 2IXFA 4JYCA 4JJKA 2DFTA 1VIYA 4PPNA 5FBQB 2X8AA 2ZPTX 2XSZD 1PLJA 1I4LD 2IUSA 3IBYA 4LYJA 1II0A 4LZZA 1EK0A 5IRCD 5LD2C 2OESA 1YZTA 3GJXC 3HR7A 1EFCA 4IOKA 4V0LA 4BFSA 3ZVNA 2PMDA 3AF4A 5B64A 2V8OA 4KU4A 4P4TA 3BB4A 2VIIA 4MITA 2G0TA 3B13B 1Z5ZA 4FMCF 3FB4A 4Q48A 4YMVA 2XXAA 4X8OA 3KKQA 4TLAA 2GEVA 2R8RA 4R2IA 2QAJA 4C0BA 2GKSA 4ITRC 1RFLA 1ZUHA 3R8CA 3DZDA 4D4KA 2H17A 4OI2A 1NRJB 1FX0B 2VHQA 2ZIAA 3Q5DA 2VSOA 1MABA 5AK0A 1KI1A 1XEXA 2HCJB 3IIKA 1LNZA 3K0FA 4FMDF 4V0OA 3SJZA 4MDEA 2WWXA 2QE7D 3ZVLA 2XEXA 2VSFA 2IL1A 3QY0A 4DLZA 3TAHA 1G7SA 2CMKA 3IHWA 4GZLA 4XWAA 2AL7A 4U02A 3GLIA 2JJ8A 2WAYA 5FUXA 4EKDA 4WZBE 2N42A 4FMBB 4RJLA 1QG4A 1XD8A 2VYFA 3WNBA 1Z3IX 4PTLA 1U8YA 1R0XA 3DM5A 5JS8A 4JVLA 1U2RA 1XX6A 3UMRA 1MKYA 1U0HC 5CK4A 4A8JB 2QU8A 1H8HA 2OBNA 2G1KA 1WE2A 1CR1A 2AKAB 2WMOB 3QENA 3AVQA 2Y8EA 3KZ1E 4Q4AA 3EIEA 4EFLA 1D8TA 121PA 1V43A 3OE7A 2XOKD 2RGAA 2DWPA 2VBCA 2J1LA 4M2LA 4MH0R 3HR8A 3UMSA 4DCNA 1TU4A 2YWFA 4TQUS 1H8ED 1A1VA 1E99A 2ASEA 1WDTA 3UANA 3OAAD 1JQLB 4A0RA 3OEED 2H57A 2IYZA 4GP6A 3U7EB 1Q1QA 3P27A 1HY3A 3BS4A 1XU4A 3WY9A 1Z2CA 1XJ0A 2GCPA 1Q0UA 3C14C 2PX3A 2Z4RA 3LWNA 1AZSC 1OYYA 2JAQA 4G5SA 4XVRA 4ZPXA 5JWRA 2IS6A 2QP4A 3FTQA 5G53C 1E2DA 4US1R 1J7KA 1CJKC 3FMFA 5HZKA 4TZ6A 2H16A 1FPMA 1S9HA 4HAYA 5FPTA 3IGFA 5AJYA 3UG6A 4AY2A 2FWRA 2IEYA 3WYAA 2HJVA 1ZCAA 2OUKA 2MMGA 2ZR7A 4I1UA 3P4YA 3SJAA 2PZFA 5L3VA 3UXMA 3AVTA 1DTSA 1LB1B 3L2OB 2ZJAA 1P9NA 3DKPA 5JZVA 1MT0A 3D8BA 2ZE7A 4P4SB 2OZEA 5DO9A 3WP0A 2P2LA 1T6NA 4OI0A 4JMPA 1NF3A 2BJWA 4DLTA 2R6CA 4E03A 1OH5A 2YOHA 2FOLA 2RGNA 3MMPA 5J4HA 5C1BA 4ZDKA 1F48A 1OW3B 5EUMA 4WAUA 1BIFA 4L9SA 1QBKC 1PUIA 4FI3C 4M1OA 1DEKA 3H1TA 3T06B 2QTHA 1G4UR 2EU8A 3C41J 2WICA 4RSGA 3L8YA 1UDWA 3C8UA 3OIUA 1UDXA 5HPYB 1Z0FA 4FD2A 4W5WA 3NH6A 3QPUA 4PPFA 2FE4A 5BN5A 2E1RA 1XCGB 2BVNA 2G9NA 4DVGA 1UAAA 4TMKA 1A2BA 5KDDA 1KSJA 2IYLD 4IXNA 4RZUA 2YYZA 3BK7A 1NNEA 5DN6A 1JALA 3AEZA 4B34A 4DWJA 3EPLA 2ZITA 4Q1DA 5HCIA 821PA 4JLJA 2FH5B 3CWQA 3U7FB 4PHGA 4C0AC 4MKIA 3NIBA 4IOMA 1KJZA 1R8QA 3SQWA 3CRQA 2XZPA 2YWGA 3QOFA 3CH5A 1ZC3A 2WWIA 3C15C 5J4KA 3CH4B 3CZPA 2JIZD 1G1MA 3LLMA 3A1VA 1E0SA 4C0SA 3RABA 2JJ2A 3TR0A 621PA 3ZS9A 1DAHA 3ASYA 1ZU5A 2CNWA 4B44A 3FE2A 4PQYA 2Q3HA 2OILA 4TLCA 1SXJA 4YMSA 2J5XA 2ODEA 2B8WA 4H1UA 4LYHA 4M0LA 4DDVA 2C99A 4MUAA 1XEXB 3K0FB 1LVGA 1JBKA 5TARA 1XFAA 2C9YA 1TL7C 4HATA 4CEIA 4LDJA 2H92A 4TMTA 2CK3A 1FQJA 4B75A 1XTSA 4BZPA 1W36B 3GLIB 1Z0AA 1UEIA 1W49A 2IYRA 1ONBA 2O8BA 3QF4A 1NKSA 1ZIPA 2XTNA 1GNQA 2AXPA 2ZI7A 3A37A 3QVVA 2IWHA 3SI7A 3SS8A 2GXQA 4A8JC 2QP3A 3RVBA 2D3WA 3U61B 2QN6A 2V7QA 5F98A 4TWZA 3DHWC 4M8NE 2F9LA 4CEJA 1CR4A 4A0GA 2HUPA 1Z6TA 3KQNA 2O8EA 3HPRA 4UJ3A 2RGGA 2QA5A 4GP7A 1T3SA 3W6NA 2CXXA 2ZAOA 1AJEA 2RGBA 3A6PC 2C77A 3B1ZA 2FV8A 3DPUA 3OIVA 1NLYA 4OQFA 4BWYA 1ESMA 1TUEA 2CL6X 4HB4A 3A1WA 1J99A 1JAHA 4PXAA 2ZRKA 5C4MA 1RIFA 2ZRHA 2ZU0C 1DELA 1KK1A 1YZKA 4JLKA 3T34A 1F2TA 5KPJA 1R2QA 4DUGD 2RH5A 3I62A 2JDIA 2GETA 3CNNA 1ZD9A 2J0QA 3ZVMA 3K8YA 3R7WA 3EAQA 2XZLA 1NVUQ 1GOTA 4IDPA 4NYIR 4B76A 4B32A 3SNHA 2O8CA 2JJ1A 3ZQ6A 2WJJA 3HPQA 4LV6A 3SU8A 1E2NA 4LBVA 1TF5A 1SVSA 1JR3D 4FXPA 3LXRA 2BV3A 2FFAA 1DG1G 1NIJA 4BFVA 2F1IA 2I1VB 1I2MA 4URVR 4BFUA 5BWMA 2K5UA 3PCRB 3B60A 2CHVA 4LC0A 4CDGA 1L8QA 1Z0IA 2QMOA 4P31A 1W5SA 1GL7A 3VKHA 1WA5A 2ORWA 1T5IA 3LFUA 3LY5A 3HYRA 2F1RA 1AKYA 2B7CA 1VTKA 5LBIA 5UKDA 3CF0A 2QPTA 3U44A 2DYKA 1PLLA 1XD2A 4IKEA 3THXB 1ELOA 3PR1A 1W4AA 2W2XA 2CE7A 2WOOA 5BW8A 2ERXA 2DWOA 3I8SA 5LDDC 2OO7A 2ODBA 5K8TA 3OF5A 4A2QA 4DZZA 3Q7QA 3IPYA 5D3MA 4I81A 4DLYA 4MQBA 1OFHA 4B2LA 4DDUA 4QFMA 1IQPA 3E2IA 3H84A 1DARA 1RRFA 4E22A 1R7RA 1OXVA 4XSGA 4PZLA 5CDFE 3K09C 3GJ6A 2HXSA 2ZU6A 2EWWA 1O3YA 1BOFA 1YHNA 4M1KA 4B3XA 3LAWA 1MH1A 1TQDA 2QRNA 5KO2A 1P6XA 2QG6A 3DVLA 1LFDB 2ERYA 5JJKA 1G7CA 1W7AA 2CHQA 1N5IA 3ETLA 2DR3A 4DJTA 5TB5A 4FN5A 3WBKA 2V6JA 4BLSA 1II8B 2QPOA 4BZQA 4IVPA 1TU3A 2ZRCA 1QHIA 1XTQA 4JSTA 4PC7A 4QGHA 3UWOA 4UXIA 5C46F 2DPXA 3CPEA 1IHUA 2O5VA 2ZRIA 4MKGA 3G5UA 2OSBA 1DO0A 5KU1A 1CRQA 1X8KA 4OJKA 3OEHA 3FKSA 3SQXA 4HB3A 1IN6A 4LHWA 1HE8B 2GZAA 4TMVA 3T61A 1ZW6A 2GXAA 4ILEA 5SZHB 1Z8FA 4OK5A 4DLRA 1E2IA 4JL6A 3LVQE 1E2EA 2NO1A 3FYHA 1GNPA 4KYUA 4PQRA 3OFND 1TQ2A 4RD0A 4HDOB 3EWAA 1IY1A 2PZGA 2O8BB 3TR5A 1G3RA 1AS0A 3QF4B 2O8DA 3VR3A 3DOFA 3I3SR 1J8YF 5B58C 4HAZA 4JJZA 4CT4B 5CDFA 2GXSA 5FPKA 2ZYWX 4LJ8A 1CR0A 1G3IA 4CEJB 1FMJA 3EZ2A 3QG1A 3QBVA 4A6PA 1OFIA 2H1LA 3TSWA 3U3MA 3SOPA 3TVTA 2O8EB 4NYJQ 1Z0KA 2GK7A 1YZUA 2ZSEA 1TF2A 5EE3A 1UKYA 2D06A 5FPHA 2IX3A 2A3RA 3RHFA 4QNMA 4RVCA 5G3ZA 3PFIA 5FI0B 2R6DA 4Z51A 4FIDA 3NDBB 4QC2A 1NVVR 4OQLA 1IOZA 1KI4A 4RFVA 4C0QC 1WB9A 4TL7A 1JJ7A 3IHLA 1SHZA 1G21E 4UKDA 4DB2A 1UF9A 4BRUA 1CJMA 3ZIAD 2B7BA 4II7A 4G0NA 4TL6A 2PCJA 1HURA 2NG1A 4ZDWA 1XCMA 4PHHA 3SR0A 4OQMA 5L3QA 1SVKA 4LJ6A 2WHXA 4RKEA 3A4MA 2GJ9A 1HV8A 2O8CB 3AUYA 2QTVB 3TNFA 1I4TD 1MRNA 1WQ1R 1E79D 2IXGA 3QQ5A 5FTNA 2BC9A 2JCSA 5C4GB 2YKGA 2ODNA 2AFHE 1Z0DA 4IFBA 1GRQA 1IM2A 4LYAA 2O0HA 5B57C 5DYIA 3NH9A 721PA 1C4OA 4G3XA 3K70D 2QY9A 4ZIRA 3GMTA 4W5HA 3RS5A 4DLSA 3BH6A 4V0ME 4ERNA 2RGNC 3EWSA 2GTPA 3GJ7A 3T1VA 2JASA 2HCBA 2Q9CA 5KNDA 1CP2A 1VG8A 1NBME 2ZM5A 3U44B 2OCBA 3B1VA 4I1OA 4Q9IA 3RANA 4EPVA 1QHSA 3SJCA 4DLVA 4R7ZA 1G41A 5E7IA 3L0OA 1V5WA 3QXXA 1JEDA 2WSSA 2X2EA 4Q4JA 4W5JA 2H5EA 4BEBA 3T1TA 2G83A 1E2KA 2ZJBA 4JKYA 4JZKA 3A8TA 1E1RA 1E9AA 2I4IA 4RFSA 4TT3D 3H86A 3QKTA 4HUQA 4JT2A 5D3MB 4CZ2A 2ATVA 2HF9A 1T91A 4MKFA 3MAAC 5E7MA 2QMHA 1HTWA 1F2UA 1MR3F 1XTKA 3B1XA 3SJBA 2RGXA 2ANCA 4O3MA 3SEAA 4LC1A 4ACBA 4BPBA 1G6HA 1CS4C 1YJ5A 2R65A 3R20A 4NE2A 3NBZC 2GVZC 4HI0E 3RS3A 1G7TA 1Z6GA 1NI3A 5HR5A 4G5RA 4TLDA 4DHEA 5LD2B 5HTKA 1NKTA 3AKYA 4GMXA 3UIEA 1XTIA 2O0JA 3THOA 4OHZA 4B33A 1VHTA 1ETUA 1AKEA 4PSKA 1VCMA 2OG2A 2CVHA 1RRGA 4US2R 3SFVA 1N6HA 3T35A 2W0SA 2XNDD 3KQUA 4WXPA 3FPAA 5EXPA 2GNOA 2MSDB 3O8CA 1SXJC 4HB0A 2GK6A 4V0MA 1Q44A 1WMSA 2ZUDA 5L8VA 3B78A 4MRPA 1A4RA 1NBMA 2AWOA 5JEDA 2WM9B 4BEJA 3TSZA 3U4QA 2Z0MA 4C9BA 1DO2A 4OHVA 2NPFA 5HE8A 3QNUA 3ASZA 3GJ8A 1AQYA 2FN4A 3VHXA 2GJSA 4EFMA 3LX8A 1D9ZA 2NTYC 2GDJA 2P6RA 1NMYA 1RVDA 3IBGA 1KSFX 4HLUC 2O8DB 2HLDD 2VP6A 4FCVA 1M7BA 4PPQA 2FEMA 1R5NA 2FEOA 1JXMA 3LNCA 1MRSA 4A36A 1SVMA 1W0KA 1MOZA 1NIPA 1Q1BA 2V55B 4M9XA 1P9WA 3BAFA 1R5BA 4B35A 3C4JA 4ZV4A 4Q66C 4ZKEA 4B71A 1CLUA 2AD1A 2WJYA 4MRSA 4YXWD 1HYQA 1NLFA 1VG0B 1WRBA 4M1MA 4DCVA 2KE5A 1ZM2A 3F5FA 5JSZB 3A1SA 5HKKA 1KO8A 2Z5FA 5H8WA 5IK2A 4GBMA 3B85A 3L8ZA 2IK8A 3AGQA 2QRZA 3UWKA 1KJYA 1O87A 2DFLA 2F1JA 2BBOA 3VFDA 5JBQA 3HU1A 5EP3A 2JLVA 1W0JA 1NSFA 4PO8A 3FFBA 5L3QB 1Q3HA 1XD9A 2EFEB 3NVAA 1N6NA 4PC1A 2WWGA 3EC2A 4ZKDA 4MA4A 3RNLA 2OBMA 1BKDR 1KI7A 1P75A 3KJGA 4O2LA 2J41A 1JB1A 3V4FA 1ZM4A 4Q9KA 5JFGA 1DBSA 3U7GA 2FMXA 2GZHA 3NKVA 4NBSA 4MYHA 1GSIA 3B2EA 4QGFA 2HDNB 3SN6A 4ZDIA 2PH1A 3WHLA 2V6IA 3KL4A 1U0LA 4HZUA 4LPKA 1YZNA 4TLEA 4AI6A 2IS2A 3K9HA 2FGKA 1L7VC 5FOUA 4OHYA 2FFBA 4KSBA 2QQEA 3BFKA 1OFUX 2XSZA 1EGAA 2X2FA 5JECA 4QBFA 1OLOA 2W83A 3R8FA 4C2UA 4NCNA 4ZIRB 5CB6A 4D80A 5F9HA 4M1WA 1QF9A 3DMDA 1G3MA 4A4DA 4EPYA 4JVMA 2W0MA 4QRHA 4EPTA 1R0WA 1U0JA 3JVUA 1SULA 5G3YA 4HEJA 3X1ZA 2OEPA 2I3BA 2A78A 4OI1A 2JLZA 4Q9HA 2XITA 3IO3A 1DAGA 4Q4JB 3VU9A 3T5GA 2QUZA 4S35A 2ZS9A 1Z0JA 2IYWA 2OM2A 2CCKA 4RFSB 5DNYB 4JLBA 1RKBA 4Y0AA 4XD7D 4BE7B 1F3OA 4JLOA 3P1JA 4JLAA 1ZD8A 4HUQB 4PANA 3AVVA 8OHMA 4MGIR 4M9QA 5J4YA 4KJZA 2J0SA 1X3SA 5GADl 4LWZA 2QE7A 4PQFA 4WIAA 1F2UB 1GL6A 1G5PA 4N0DA 4M1TA 3QKUA 3RAPR 1OKKD 4KFTA 2V1XA 5JS7A 1UKVY 1JAIA 1E4YA 4IDNA 3RWOA 3F8TA 3L0PA 3QBTA 3TAUA 2QM7A 1S0UA 4US0R 3GLFE 3VX4A 3B9PA 5TDHA 4XWKA 1GNRA 1QVAA 1R5OA 2IXEA 1IN8A 3BXZA 2D2EA 2VPPA 2ZI3A 2F1HA 1BMFD 3BOSA 3VAAA 4JL8A 4LRWA 2XOKA 3LO5A 1H65A 5FH9A 5JI2E 4D4JA 2H8KA 1Z28A 1H8EA 3CR7A 3CZQA 3OAAA 4XIGS 5M04A 1OXTA 1S96A 3OEEA 4DIEA 3QVUA 2C96A 2IUTA 2IUUA 4TTPA 2ZEJA 3U4QB 2REBA 5JHHB 4ARZB 2JLYA 1XDBA 4J0QA 3I1FA 1FUUA 3QXJA 2WWYA 4WBSA 5EXSA 1LTQA 2OXRA 1FW6A 1NN0A 2HT1A 1SVOA 4PZZA 3ADBA 3CNLA 5KNBA 1E1QD 4A82A 2DWQA 5FTMA 4GRAA 1P9RA 2AK3A 4B48A 1YZQA 1KAOA 1KI6B 5EXTA 2V1UA 3U6KA 5D3QA 1BH2A 2JGNA 3WYFA 5JJLA 4B3DA 4TL9A 4TTRA 4YMTA 4D25A 3P20A 3VQTA 2RCNA 2GCNA 3S1AB 4BFXA 4PZYA 4IVQA 2AHOA 3DO6A 1Y3AA 2G6BA 3GEEA 3UKDA 3GLFA 4GOKA 2Z83A 3EZ6A 1W47A 2KBFA 3TKLA 4BZXA 3K70C 4D81A 4L9WA 1TTTA 4KCGA 2FPKA 2NGRA 1M74A 4G1UC 5CB8A 4XVUA 3OZXA 2VHCA 4OL0A 4L8GA 4IOJA 3HWSA 1P2TA 1Q22A 1E9FA 1CR2A 2J0UB 4G5QA 4V03A 1S1CA 3KKMA 2GWHA 1KKMA 2XTMA 4LHXA 3TBKA 4I1VA 4BLTA 4DSUA 1W36D 4M1SA 1XWIA 2EFCB 2ZRGA 3TGPA 1NMZA 4RD2A 2F43A 3CNOA 1G291 4HUTA 4DCSA 1RE0A 3VR5A 4GSYA 1NMXA 2ZRFA 3GJ5A 3TVDA 5GJVC 2QAGA 1XPOA 3GLHE 4F4JA 3NHAA 2PCLA 2Q9AA 4RY2A 5FBVB 1NJFA 3PENA 2BMJA 3Q3JB 4UNQA 2A2ZA 4UQOA 2IHBA 3N5CA 1P5ZB 5CYOA 4MYUA 5KNCA 1NVWQ 1ZVQA 1SXJE 1RYHA 2A9KA 2ZI6A 4HZUB 3AVUA 3HP1A 4L15A 2EYUA 4B3BA 1ZNXA 1DADA 4DT1A 2KJQA 3VKWA 2HV8A 4TZ0A 1UPTA 2OHFA 5KDLA 2YJTD 3UPUA 4WXRA 5DH9A 2JLWA 3K1JA 4IDHA 1CF4A 1N6IA 4N1AA 1T5LA 2ZI9A 2FSFA 2VO1A 1BYUA 2JIZA 5J5CA 4H9GA 2PLRA 1L2TA 2C9OA 1TPZA 3RWMB 3V00A 3KFXA 3VU9B 2X77A 4MGZR 1KOFA 2B6HA 4MKHA 4PFSA 2OLJA 5BN3A 1W48A 1R0YA 1M7GA 1U9IC 2F3TA 4LJ5A 3VKGA 4K46A 4D4MA 4Q1BA 3PG5A 1JR3E 5FOXA 4AYTA 1XMVA 3H4MA 2QI9C 1W1WA 2EYQA 2J45A 3MG9A 4ZCMA 2YWEA 5BYKA 1IXSB 3IILA 2QSZA 2BEKA 4PAOA 4JBYA 4URZR 3ADKA 4CW7A 1E9DA 3K0CC 3IEVA 3LBHA 2BHRA 4UXHA 2I1QA 1G8FA 4M1YA 3BB3A 4ZDJA 3AVWA 2IWRA 4OI4A 3KUCA 4E07A 4P3YA 4TYQA 2XXAB 3GLHA 4QKQA 1KNXA 3MJHA 1A7JA 1CEEA 1TEXA 3TSOA 1U99A 2ZI5A 2IF2A 2P0EA 4DEXA 2GZDA 3EXAA 2WV9A 2FPMA 2CJWA 2A30A 3BH0A 3ICQB 4DBLC 1KI2A 3RLFA 1MABB 4OQNA 3FVQA 4R98A 2GESA 4GZMA 3ZVRA 4XSHA 1KO4A 1GTVA 2JLRA 2BMFA 4JIMA 4N0EA 4NCHA 4DDWA 2FSIA 4LBWA 5J4LA 1FZQA 1GKYA 2HF8A 5FOTA 4QBGB 3RC8A 1S3SA 3W9YA 3VR2A 5J47A 3FOZA 1IY2A 4L5BA 4OK3A 3I8XA 4OHWA 4TLBA 4DXAA 4B3CA 4R2HA 4DUGA 4BFWA 1EFUA 1U90A 5SZIA 4A92A 4HLUA 4DLUA 4F4IA 4B3GA 4EFNA 1NY5A 1XMSA 4PO1A 4URYR 2ZROA 1PZNA 2P5SA 4V02A 1RPZA 1K5DA 2KSQA 4QJ3A 1KI3A 1PLKA 1AA9A 1JR3A 4Q4AB 4DRZA 1E6CA 1N6KA 1RC8A 1SVWA 5E95A 3L82B 2XB2A 3PIRA 3RC3A 4MDFA 1OE0A 3TE6A 1LW7A 3I92A 1EFRD 4B2IA 3W6OA 2RGEA 3IKJA 5LB4A 3CPJB 1YRAA 4NCKA 1OXUA 2Q3MA 1N3BA 3I72A 1TEVA 1ZRHA 4PSVA 2G3YA 3TIFA 1E96A 3PUVA 4C4PA 3GLFB 1DAIA 3BD9A 1RZ3A 4YMWA 2VTKA 2BKUA 3FMPB 3K9NA 5FR1A 1E9EA 2A5DA 4TYWA 1P62B 2RMKA 4A9AA 2B21A 2CLSA 4JBXA 1Z22A 4EPWA 4UNPA 5TY0A 4JKIA 4TL8A 3QF7A 2ZSBA 1XBTA 1VIAA 1YRBA 2C78A 2JLXA 3U3RA 3EG5A 3IEUA 4IRUB 1E69A 5EXXA 4CIDA 4YQFA 1E9SA 1GWNA 2V9PA 2WAXA 2ZRDA 3EZ9A 1CJTC 2RHDA 1ZM9A 4TSFD 2F43B 3LQQA 5EP2A 3QKRA 2GF9A 2IF0A 1U81A 5HCNA 3GFTA 2CL0X 4E5UA 4AYWA 1RJ9A 2WIAA 5F3WB 1S3GA 2R44A 4NL4H 4Q5IA 3ND8A 5IT5A 4GFDA 3C5HA 1MO3A 5FBRB 1R4AA 3RRNA 3TRFA 3U3KA 3W3ZB 4AG6A 1P3JA 2PLFA 4IW3B 1KY2A 4DT1B 4JLNA 4RCYA 3B1YA 1VG9B 2RGCA 4C7OA 3KX2A 3KTAA 3QXHA 3SYLA 3CLVA 4D0GA 1B23P 2VRWA 4B6FA 2YINC 3U60B 2DFNA 3PVSA 5CM9C 5C18A 3AP2A 5KOYA 1KK2A 3N2IA 3D31A 3CB4A 3PUWA 1NLZA 1Q20A 4QJ5A 2WSMA 2IYXA 1SKYE 3MJRA 4G5OA 2A5GA 4NYJR 1NG1A 2OV2A 1KYIA 1I2DA 2IEZA 2GCOA 3HU2A 3IO5A 3Q85A 4JBWA 3LW7A 4ASUD 3U2QA 3EASA 3VTKA 5EE9A 1ZM3A 2ZJYA 2RHMA 1W5TA 5AWFC 2NPIA 1T3LA 1ZM7A 2JJ1D 4YDSA 2W6JD 1I4DD 2OCPA 1D9XA 2O52A 2JA1A 2CL7X 1GRNA 1P7CA 2PT7A 4KVGA 3R9IA 4P33A 5DGXA 1G3QA 2P6UA 3I4LA 2C9CA 4H1VA 4DLWA 4BFTA 1ZBDA 4AYXA 1KZ7B 1XB2A 4EJSA 1WBBA 1P61B 1QRAA 2WWFA 4FMCB 4LJ9A 3O8RA 3OFNA 3A4LA 1DAMA 5DHFA 1N0UA 3LX5A 1NP6A 4QM7A 4KFUA 2HT6A 4QHYA 5AUPB 1X1SA 1ZJ6A 1VYVA 1ODFA 3O47A 4RZ2A 4CEHA 3PEUA 4FMDB 5TMPA 1N5KA 4CRWB 3ZLJA 4LJAA 1SXJB 3WNCA 5E3HA 2CJWB 3I5YA 2WOJA 3U6BA 3U5ZB 1E9CA 3AF3A 1N5JA 3JVVA 4CEIB 5JEEA 1KSHA 1ZP6A 4C2TA 1N6OA 5KDOA 1OXXK 2ZTSA 1LF0A 2JLSA 1Z6YA 2YHSA 4KBGA 4N3NA 3CRMA 3BFXA 4FCTA 1T9HA 5EE1A 3BRWD 2XJ4A 4UNNA 3ZIAA 5EJEA 4D2IA 3K0SA 2BEJA 4ON9A 1IONA 1KDRA 1S1MA 4ZCIA 2BWJA 1CRPA 4OK6A 1CKEA 2E87A 5J4VA 3H0KA 3KUDA 4JLDA 3FFAA 5GJWC 2ZREA 2GHIA 1E79A 1F5NA 3KDSE 1R0ZA 3LLUA 3QEJA 3QI2A 3T1QA 1EXMA 3W6PA 3FDIA 1LY1A 1G5TA 4U7DA 5JCZA 1TX4B 3Q8XB 4IDQA 5FBLB 3K0EA 1CTQA 4I4LA 5JCPA 1JPNA 3CR8A 3SC3A 3ZYCA 4RD6A 1OIVA 5TXGA 3HYTA 1LS1A 1DE0A 3AVYA 3TJZA 2YC4C 2IS1A 2KWIA 2NO0A 1F2TB 2FSGA 3FHCB 5EZ5A 4B6EA 2QORA 1FP7A 1IN7A 1W44A 3FGNA 1M6NA 5G41A 3R7WB 1E4VA 2ZR0A 1HQYE 4OJQA 4NYMQ 2OCAA 2WTUA 1P2UA 1WXQA 3B7GA 3PUZA 1AM4D 3AVXA 3KKOA 3AP3A 1GIAA 2ZS8A 1KNQA 4XH9B 3PEVA 1VHLA 4OQXA 2FZ4A 3KFVA 3ZH9B 4F91B 1FTSA 4TT3A 2Q0HA 1X6VA 2F55A 2FZLA 3K9GA 4TMXA 5IDVA 3KXIA 4LUCA 2QAGC 1BS1A 1J2JA 1E2FA 1KK3A 1G4AE 2ONKA 4V0KA 1II9A 2FX3A 1DS6A 3QKRB 2MSEB 1SZPA 3I73A 1US8A 2WPDD 3DOEA 3IPXA 4LYFA 1VCNA 1Z63A 2JEOA 4IXMA 2VF8A 1COWD 5H70A 1SQ5A 4NHOA 3C5CA 1U98A 4ESHA 4MRVA 1JR6A 2CVFA 4RCZA 1HT1E 4Q1CA 1KI8A 4GDFA 3QSYA 3X1DA 3IQXA 1XPRA 2BMEA 1XD2B 4C30A 4EAQA 4C7OB 2F7SA 3KTAB 3NXSA 4WA7A 1TADA 3REGA 1RRPA 4B43A 1GP2A 1EESA 2SHKA 1AK2A 4KI0A 5DHAA 2P65A 3TLXA 4K81B 3BWDD 2NZJA 1T8TA 1Z6AA 3LXXA 4Q21A 2XNDA 4QXAA 2OE2A 3N2EA 2VLIA 2L0XA 5KSOA 1Z29A 2GCOB 1U9IA 5DE3A 3RSOA 2OCYC 1JI0A 1Q21A 4JS0A 4LCBA 5FTKA 3X1WA 1OPXA 4LJ7A 5FFMA 2EWVA 4EDHA 1S4QA 5KPDA 2C5LA 2QNRA 4TYNA 3SZRA 5JRZA 5ELXA 3ND9A 3O8DA 2BDTA 2DFKB 3K0CA 1K6MA 2J9RA 3NTUA 1EWRA 2ANBA 3QIAA 5DSZA 4EPRA 4RD4A 3BBPA 4O25A 5B2ZA 3AB3A 3CF6R 4F4CA 1OYWA 3B82A 1J90A 3AF0A 1GITA 1AIPA 2HLDA 2O0KA 4L16A 2NZ8A 2GA8A 4F38A 2F9MA 5KSZA 3U7HB 5F9FA 2CHGA 1Q1EA 2WJHA 3RRMA 3SYNA 5GJBA 3WBJA 1DPFA 3W34A 1PVOA 2CEAA 3ADDA 3EIQA 2BOVA 4MRNA 3B9QA 4XTRA 2HEIA 4CYMA 4Q7JB 2WJIA 4C0JA 3IQWA 2FFQA 4RD1A 1G8PA 5CITA 1QG2A 1MO5A 4YDHB 3A1TA 3MLEA 4YXWA 1E1RD 1KK0A 1P2SA 2BCJQ 3FMIA 2W6ID 4HYYA 4QBIA 1GM5A 3W5JA 3DEFA 3EX7C 2ZRAA 1OT3A 1F60A 2ZJOA 1K5GA 3WMEA 3C7KA 4I1SA 2FF7A 4WW0A 1WP9A 1XPUA 3TUJC 4LJYA 2QENA 3NBXX 1UM8A 1UBGA 3AQ4A 2G88A 4TQ9A 1D2MA 1KO5A 4D82A 1JECA 1VMAA 1G3UA 2J59A 4BLRA 3CF2A 3M1IA 1P72A 2KI5A 3NEYA 5EP1A 1W4BA 1EWQA 4QGGA 3QKSA 3QJYA 3UK6A 2IYTA 3LBNA 2EW1A 1AS2A 1IBRA 1XEFA 2ZJZA 1EFTA 3DM9B 3EARA 1ZNYA 4HB2A 4JLVA 3SHWA 1OHHD 2GJ8A 4XVQA 1E94E 3K70B 1XEWX 2FSHA 4B74A 1KO1A 1KDTA 1ANKA 4QHTA 4Q03A 4TMZA 1Q3TA 4M4SA 3GEHA 2R2AA 1G8HA 3A1UA 3G82C 5LB2A 2ATXA 1JQJC 4MYCA 3LQRA 2N46A 4PC2A 1JNYA 4D6PA 2QGZA 2J7PD 3PXGA 4UJ5A 3RS7A 2NO6A 1NN5A 5AJVB 3FHTA 2VHJA 4LV5B 1MO4A 4XD7A 1T8UA 1KIMA 4Q9JA 4ZI3A 1GILA 3MGCA 4Q7MB 2IYQA 2C04A 3GQBA 3SBDA 2VQSA 1Z06A 1ZC4A 1VDZA 5FOWA 2GILA 4QGAA 4NP6A 1OKKA 5E7JA 5JHGB 1N6PA 1P2VA 1GDDA 1W0KD 2OBLA 3UMFA 1K8RA 1G5RA 1UFQA 3RDPA 3GJ3A 5JMTA 1OB5A 4CT5A 1Y63A 3AV0B 5FL7D 1M34E 1U8ZA 4KLNA 2AFIE 4AC9A 1E98A 2OFWA 5CYPA 3WXMA 1IY0A 2W00A 3RRYA 2XB4A 4LHYA 1ZNZA 1YZLA 1BMFA 4DSNA 2C95A 4AKHA 4NMMA 4P0TA 3LD9A 2YWHA 2FFHA 2FNAA 2XAUA 1M7HA 3EA5A 1KDOA 4QM6A 2XJ9A 4KSCA 5FTLA 4IEEA 1TNDA 1YQTA 2DCUA 3V9PA 1HEIA 3MWKA 2PEYA 3GLGE 2D2FA 5FOSA 4UNRA 1T4GA 2WIBA 4KXFB 2P5TB 1P4SA 2D7CA 2VSXA 2ZE5A 4POAA 4AWXA 3BC1A 4EJSC 4LK2A 3OESA 4AIIA 1AQUA 3A4NA 4URWR 3LDAA 2QM8A 1A82A 2A5FA 4OKSA 3W8NA 3ZQJA 2P3SA 1BO6A 1W4RA 4Z1MD 3Q72A 1HQCA 3W3AA 2Q21A 5CIWA 3B8HA 4D0NA 1E1QA 3CWZA 3L0SA 5EP4A 4Q4HA 2ZYTX 2BM0A 2GXUA 1OFTA 2QL6A 4HAVA 3C16C 5GVRA 5TV2A 2ZRJA 3GFOA 1D6JA 5K8UA 2HXYA 4TMWA 3R9XA 1FOEB 2EQBA 1IXRC 2PEZA 2J0VA 4GOJA 4LY6A 5CLLA 3RS4A 1PV4A 5AUQA 5AJZA 5EZ6B 1DAKA 4HSEA 1KI9A 5J40A 1U8AA 1OH6A 3KXLA 1XP8A 3GD7A 4M22A 3AKCA 1N0VC 4K8OA 2QQ0A 4KBFA 1OB2A 5FBWB 3L0IB 2RB4A 2X1VA 4O2RA 4OYHA 3ZD7A 2A5JA 2JLQA 2QGNA 2OAQ1 3QPWA 1TUIA 3T5DA 3KQKA 2QTFA 4I99A 2ZJ8A 4YC7A 4GPTA 1YE8A 4HLCA 1G20E 4KLZA 4JVNA 4D0LB 3RRZA 2GVDC 1KGDA 2DHRA 3NHBA 1GG2A 3P32A 2UVQA 5KUTA 3GLGA 4XWOA 3BB1A 4KAXA 4AKIA 1LS6A 2QMUA 1A5TA 2OXCA 3CONA 1SVIA 1TAGA 1P73A 1CU1A 1G9XA 3QKSB 4TN1A 1X1RA 4A0HA 2VP0A 4EPXA 2DY1A 3A36A 4ABYA 2ECKA 2IC5A 4QG7A 3B6EA 2NO9A 2VHUA 2AKYA 3VR1A 1MV5A 1VYTA 3AF1A 2Z4SA 4LV8B 4HLQB 4B73A 4YONB 3W8RA 1G7RA 1NJGA 1G6OA 3W5IA 3ONWA 3TK1A 4ZO4A 2J3EA 1WCV1 4RKFA 4JT4A 3MWYW 3EPHA 3UATA 5KYKA 2GJKA 5FOVA 4DKXA 2ZR9A 4PAMA 5A4JA 4LHZA 1UEJA 4GMDA 4DSOA 3RYTC 2N1BA 5DI3A 2ZUCA 1J8MF 1NL3A 1KAGA 4TTQA 5AJXA 4NCJA 1H8HD 2C8VA 4X8MA 1JPJA 3DZ8A 3F3YA 1GKIA 4NZYA 2QT0A 4CGZA 4LI0A 1QHNA 3CX8A 1XZPA 3HDTA 3OE7D 1UBFA 2WWWA 4QL3A 2XX3A 4Q47A 3ZS8A 3NBFA 1XJQA 1UBCA 2ZSDA 1XCPA 2OLKA 1CBUA 4KO8A 2XGJA 3T12A 4YMUA 2IYVA 1E9BA 1DAEA 2ZRNA 3AKEA 5H68A 1IJFA 3X1XA 2GRJA 3B5JA 2IBMA 1KKLA 1R10A 3CM0A 4HAUA 3THWA 2WKRA 1E2MA 1IXZA 1WF3A 2DBYA 2ZVQX 2WKQA 4BUJA 3PQCA 3D6TB 3F0TA 2CCJA 2VP9A 2LKCA 4IFEA 1IJEA 4Q9LA 3THXA 5BQ5A 4MRRA 4Q4LA 5FUYA 4BLOA 2JATA 2ZYUX 2NIPA 2VP2A 2CDNA 2Z6VA 1E0AA 3AUXA 4KVAA 2CCGA 3FKQA 4M9ZA 3WNDA 4FWTA 2WJVA 3CIOA 3NEJA 4A6XA 3WYGA 3K53A 3KJEA 2GEUA 4GI7A 1EFHA 2W2TA 3I32A 2AX4A 4W7SA 4AG5A 1RRCA 1QHXA 3MWJA 5FTJA 1SGWA 1XMIA 5EE5B 2ZXUA 4LHVA 4PHTA 5FUVA 1E2LA 3NG1A 4M53A 1EX6A 1OXSC 2FU5C 4NH0A 3K0AA 4LJ4A 4IJMA 4Q7KA 1SKQA 4KFSA 5KTYA 5BXQC 3EPKA 3EIHA 2AWNA 1II8A 4Q4HB 1KMHA 2VP4A 5JRJA 1N6RA 1AN0A 3Q5EA 5SZJA 1AS3A 3BE4A 1CULC 2ZVPX 3IIMA 1UJ2A 2A5YB 1EFRA 2RKOA 3OIYA 3HU3A 5TVKA 4JLMA 2ONJA 2BJVA 1YR8A 4DSTA 3PEYA 2IW3A 2G0NA 2R6AA 4IEIA 4NONA 1YVDA 4PC6A 5G40A 2ZE8A 2BBWA 5DN6D 3CUEF 1E0JA 1VCIA 4JL5A 2BKEA 2WMNB 3ICEA 4HAXA 3X2SA 1Z2AA 2Q9BA 3P26A 3TUIC 4E09A 2J7KA 1XNJA 2V3CC 4MYTA 5JI3E 1XJCA 3U3JA 2ZJ2A 4TSFA 1D2NA 3NWJA 3GLGB 1S8FA 4CF7A 2JLUA 1W2HA 2C2HA 1FQKA 1W2GA 1XZQA 3G0HA 4C0LA 4DCUA 2LCFA 5L3RA 2JJ2D 4LPSA 4QBHA 1N0WA 1N2CE 4WZAE 2ORVA 3CBQA 1ZD1A 1PUJA 2CNWD 1OSNA 3EA0A 1ZUNB 2G1JA 1SXJD 4PX9A 1G16A 2BCGY 3MWLA 1OIXA 3NDPA 1G17A 3DDCA 3B1WA 2PL3A 2WVJA 3D7MA 2F6RA 1GVNB 4V0NA 1GAJA 4GNKA 2R9VA 4KITB 4UNSA 3EW9A 3I61A 1RW4A 3DL0A 5EE0A 3GJ0A 1XTRA 2CK3D 2NQ2C 3LA6A 1JJVA 2Q6TA 4FW9A 4C0HA 2GBLA 3GPLA 3E5HA 1PJRA 1P60A 5FR2A 1KMQA 4Z54A 1G19A 2V4ZA 4P4UA 3REFA 1B0UA 4ASUA 4F92B 3PUYA 4U00A 2IHYA 1XRJA 2QAGB 3ZZUA 4F7WA 1GFIA 1UKZA 3MD0A 2WZQA 3CO5A 2V7QD 2YOGA 1R6BX 3CPHA 3AVPA 5FPYA 3AM1A 1NN1A 5DI3B 3JZMA 1GUAA 2W6JA 4S2EA 4Q1AA 2QROA 5JLJA 4WVFA 1VPLA 2IYYA 1XXHE 2ZRLA 3MFYA 3KJIA 2E9SA 3L43A 3O8BA 5GJCA 4QNRA 4Q02A 4C3ZA 1VCOA 3AP1A 4QHSA 1TQ4A 5CLQA 1E32A 1RYFA 4RZXA 4ACAA 3JZAA 3OHMA 3VNUA 2PZEA 1M1YE 4LGMA 1CJUC 3QG5A 1SHKA 2BBTA 3X1YA 3OIWA 3IIJA 2X19A 2VF7A 3A58B 1NVXQ 5P21A 3NBYC 3THWB 3ECCA 4BFZA 2YVUA 1G8YA 2JDID 5H1YA 5C2JB 1G18A 2AXNA 2BBSA 3LRPA 3H2YA 3FWYA 2QBYA 3AKDA 1TMKA 4Q00A 4C0KA 4NPHA 5IF9A 2BIFA 4U5XA 4BLQA 3Q9LA 4OHXA 1L4YA 1GZSA 2ZSAA 2AD5A 4JVSB 2FG5A 2WBLC 3RS0A 1FMLA 5DIFA 1D2EA 3ZD6A 2C03A 4BFYA 4PAQA 2D4HA 1QHHA 2VHTA 4NU0A 1E2HA 4A2PA 1NSTA 4F93B 3WMFA 1YKSA 4NYMR 4Q19A 4AKGA 5HZHA 2OAP1 4AD8A 1NG9A 3NC0C 4B47A 521PA 4URXR 1UKEA 2ZJ5A 3BFVA 3GLHB 5CJ2A 3VX3A 3PITA 2VP5A 4KV9A 1S2MA 3W90A 3K0AB 4FWIB 4BASA 3LH5A 3WRXC 1ZINA 2AR7A 2W2VA 3M4YA 1XXHA 1Q57A 4AKEA 4KODA 1TF7A 1KMHB 3T1OA 2DB3A 1Q12A 3TQFA 4R71A 1ESNA 4GT1A 4PC3A 1XMJA 5CJPA 1N6LA 4NYIQ 2PJRA 4LSGA 3PEWA 1VYUA 1HH4A 1KY3A 1E2JA 5JJIA 3MRSA 2CLCX 1GRRA 3E1SA 5JWOA 1ZNWA 1Z07A 2OFOA 3QXCA 4DEYA 2P6NA 1AZTA 3AGPA 4X8LA 1IN5A 4TQAA 4A2WA 1BYIA 1W46A 2CBZA 3D3QA 1KSGA 3ZZ0A 1J70A 3THYA 4UXJA 5AR1A 5FUWA 4Z8XA 1W36C 2J87A 2FGJA 4PR0A 5CM8B 5F2EA 1HE1C 3FMOB 2VH5R 1LF5A 2WKPA 3KQLA 2YNMA 5LPNA 2LWIA 1A2KC 3AVOA 3IDQA 3MCAA 1IAQA 3ZZTA 5A0FA 2ZRBA 3BGWA 1AGPA 1XTJA 2IS4A 1DOAA 2IA5A 2PBRA 3VHLB 4RZ3A 1QHYA 2WPDA 2CLDX 3BORA 2KB0A 2NOAA 1COWA 4XOIA 1M2OB 4P32A 3EZFA 1QZXA 4D26A 1L4UA 3OEHD 3FKSD 5AUNB 2EFDB 1MO6A 1WBDA 1EX7A 3VR4A 3GEIA 1KO7A 4XJXA 5E4FA 2F3RA 2ZAMA 2J46A 2IYUA 2AK2A 3M6AA 5L3SA 3GFPA 4ZCLA 4LBYA 4DIDA 1Z08A 4NTZA 5JSZA 2WWHA 2EVWX 2H7VA 3BIFA 2HYDA 2FDCA 3KKNA 3CRW1 1UADA 1G8GA 1VKJA 2ZUBA 2D7DA 1DG3A 4A1FA 1HA3A 4HDQB 2O8FA 3LVRE 3CW2A 2B8TA 4GOXA 4BLPA 2HYIC 1RJ9B 2MSCB 2OT3B 2XZOA 1YR6A
chains in the Genus database with same CATH superfamily
3I01A 2H59A 5DISB 2QPLA 3TW8B 4DC9A 2BLLA 2W2LA 2Q3FA 2BM1A 3RHTA 1X9IA 4E3WA 4F96A 3OIFA 3Q9NA 5CBPA 1NUHA 2NXEA 2XQIA 2A7QA 3QXSA 2FCRA 5GWXA 3M3PA 4HQNA 2Q4RA 3WGUA 5FB3A 3GLUA 3QMWA 3ZDQA 3D1JA 1FS5A 4RV5A 3GG9A 2O57A 2QXUA 3AR3A 1DRKA 3E22B 3QHPA 3S29A 2Y9MB 5DN9A 3SDZA 2PHZA 3BJIC 3O1LA 5HF5A 4HLDA 4C6RA 4OH7A 2FPGB 3VV2A 1RI4A 4LBZA 1XTZA 2GSWA 1XU7A 3IOBA 4KQMA 3PB3A 1Z6QA 2IPNA 3FHOA 3FPBA 3C97A 3ROQA 3TD9A 4JLUA 2YZ2A 1QHGA 3QUSA 4URUR 1C9KA 4KOAA 4RMIA 3GCGA 2YIDA 2QBYB 2HJGA 4G5OA 3OZAA 8ATCA 5F64A 1FNNA 4DMUB 5KNLA 2EFGA 2I3AA 3NB0A 5HKBA 5B7PA 4AK9A 3C5WP 4TN5A 5ALMA 1KTVA 1SFRA 3G5TA 2B92A 3LUBA 4I55F 2VWHA 4BRWA 5LP6A 2W6IA 1OFUA 4NU6A 4CM6A 1P4AA 5FD8A 2F8TA 2EIHA 1DRUA 2W4MA 2F8MA 3BERA 4TX1A 1ZBQA 1YCFA 5DBIA 3B2NA 2HHJA 1C3LA 2OMKA 3QEOA 4CM8B 5KOHA 4I1YA 3KJNA 2XTZA 2C1EA 1XROA 3MMXA 4ISBA 5DPMA 4CVNA 4LOAA 5DLQC 3QUCA 2RHLA 4AM8A 4Q18A 2K87A 3G6WA 3NIGB 2LCIA 4PQGA 3X0DA 3DEJA 1E4OA 1N3IA 1QOQB 3LZDA 2BEVB 3EUAA 4W9MC 4W5OA 4DLXA 5BN4A 2CV2A 3PJRA 5EZYA 3PJGA 5LYJA 3FCOA 5HUQA 4BFCA 4IHQA 4DWWA 2C82A 4QECA 2WILA 5LU9A 1COZA 2LV8A 3CRVA 1OH7A 1BD4A 1QQ7A 5A2GA 1Y80A 4LMBA 2NZYA 3U7RA 3E27A 4DYHA 2EBUA 3RIXA 2C8KA 4M8IA 5FUQA 5DI9A 1YMQA 2NP7A 1CXZA 1KL7A 2JNWA 3JALA 4IIXA 5AKIA 3OZ7A 1K86A 3TLAA 3Q11A 1X7ZA 4DB4A 2J09A 5K3BA 2VDPB 2MYTA 4TGLA 4KO2S 1G59A 2Q49A 3V8BA 4KBYA 1RJEA 1I7SB 1I5OA 1WJGA 1OWNA 2OHHA 1HUQA 4J16C 4OOFA 4RKWA 1B73A 5B55A 5BSMA 3INYA 3AINA 4R54A 4YI5A 2EJBA 3HWRA 3WK4A 1PFQA 5LZ5A 4ED9A 3VO1A 2P0YA 5ALLA 2ERCA 4RK5A 1WOMA 1SKYB 3LBIA 3LUJA 1IWPB 5ED0A 4GBJA 1E2GA 1YZGA 2RBKA 2FRDC 4PSAA 3ADCA 1BU5A 1YUBA 4YT4A 5K3FB 3ZXUB 1Y6JA 3WWPA 2GD0A 3DMHA 3I5XA 2YASA 3JYHA 1OQAA 1VIVA 1PR5A 5K0FA 4LZWA 4X6LA 3RTBA 4N41A 1M75A 1V8BA 5FV7A 2Q7DA 4ARZA 3HBJA 2HQBA 5GVSA 5LMCA 1NW9B 4WCVA 4JUAA 2ORIA 5ALHA 1ZLYA 4F3RA 3HJFA 4Y9SA 5C52B 2Z08A 1KZGB 1JT9A 2CXQA 6Q21A 4XM1A 5E1MA 5IWCA 4FZRA 5HM6A 1ACJA 4YNBA 2WIFA 3IQHX 1JEJA 1KJWA 4AURA 2GLTA 5EWLB 3TB4A 4MGKR 5JWHA 2MMCA 4QXRA 5EHGA 3PNKA 5ED4A 3IUYA 1E3MA 1YIAA 5K8LA 1Q0SA 3RVKA 1F6BA 3IXQA 3TRHA 5IYZF 1Q83A 1JKIA 1KQFA 1MIOB 2M2IA 1BWRA 4OHRA 2P9HA 2Z8YA 1KZ9A 3CKLA 1N5LA 3EZ7A 3GJ4A 3ILXA 4U2EA 2QTZA 4QQFA 1GD1O 3DBHA 2GEKA 1EK2A 3KXKA 5B30A 1GADO 1X1CA 3I0MA 4FYYA 3PEEA 5FL7A 4UULA 3KKPA 3KLPX 2FSVC 1BD3A 5KJEA 4L8FA 5ANRB 3BIOA 3U40A 1L7DA 3DZCA 1Y5RA 2Q5FA 4FCWA 2ZS7A 3JV7A 2QN8A 4OJYA 1TZCA 5G4LA 3A11A 3ZQUA 1ZCBA 4ALLA 3OCUA 3ZKWB 2AZTA 3M6IA 3PRYA 4XTCS 2R6JA 2EJVA 1SRQA 2D0PB 4Q1FA 1I1NA 1UBEA 1VHWA 2X0EA 1Z4PX 3N9IA 1K2WA 4KE7A 3ZJYA 3C7TA 1V41E 2H63A 2R6FA 3SYKA 4YAKA 1CDOA 1K5HA 1YOBA 4GW3A 4J7XA 2C5HA 3TH5A 2VF4X 4HGPA 2NT4A 3CRRA 1QYCA 2BFFA 3PC8C 1USVA 1PGPA 3MWDB 2XOXA 3Q7PA 4D9IA 4MUBA 4ZN6A 4JBLA 3A6LA 3ONVA 3PPXA 2QN7A 5AUOB 3P9PA 2Y6VA 2P67A 3SBEA 1K5PA 1OJ7A 3H3FA 1SC4A 4U7WA 2V7XA 2D1RA 3LUGA 3Q8WA 1U7PA 3QM1A 3R44A 2ZI4A 4DPLA 1WPRA 5FPQA 1NY6A 4K9LA 4GLBA 4V0SA 1KZ1A 3WL5A 5HKKD 4F3NA 5T4BA 3H11A 5KYUA 3UMMA 2ON6A 4Q37A 4RPKA 3KJHA 4BC1A 4EJFA 2BONA 2ZE6A 4JLPA 2P9YA 1BCRB 4KE6A 1AGRA 3LKBA 4HAWA 3ZDZB 5LOVB 2D2VA 2JIOA 3T9DA 3TE7A 4DCGA 1R1DA 3VUEA 3SFZA 5CEEA 3VNBA 1E1DA 3GROA 1EVJA 4PHFA 1PJSA 3OA0A 1QGYA 3AW8A 1LBEA 2X15A 4R81A 2DX7A 5ALTA 2GAOA 2JIBA 2PMBA 2VHZA 3C6KA 4D9MA 4ESOA 5AIBA 1IYZA 1RPTA 2X9NA 1K0FA 3HDGA 3LSTA 2WV7A 1T5DX 5TMBA 4LFBB 1TC2A 5J5VA 1HPLA 3FJYA 3O4HA 4AS2A 1O2DA 2ZB8A 2WJGA 3NDIA 1SOVA 1VL0A 1BHO1 1Z6XA 3D0KA 4N7BA 3BRCA 4JOBA 1RXVA 2DFTA 5DHTA 4N0MA 5FBQB 3U3ZA 2X8AA 3ZX4A 3QEBZ 2I1WA 2W9XA 5JSFA 4F2GA 3IBYA 1HEYA 1PRYA 5IRCD 3JAWB 4A23A 4KG7A 4JB3A 5C7OO 1NZDA 4CQLA 4KR0A 1CVLA 1NQXA 2CKDA 2Y1DA 3PGVA 4HWPA 4IOKA 4C2BA 5B64A 3ZVNA 2V8OA 3AL2A 3BB4A 4N8EA 4ZHQB 1W94A 1MHPA 1C2TA 4MMZB 4FMCF 4N6NA 5FNVB 3KKQA 3HDYA 5GZ3A 4OYYA 2FAXA 4D6YA 2X8JA 2QAJA 5A03A 3F67A 1TAUA 4CQMB 4G24A 2GKSA 1P5HA 3R8CA 5BSGA 1XWWA 4KPYA 4D4KA 2H17A 5M2QA 4YJ3F 1JIKA 1NRJB 1CVIA 3PZBA 5CURA 4AIRA 4H17A 1JG7A 4FJ2A 3UF0A 3KZMA 2BR5A 1JT2A 2HCJB 4FMDF 1FDVA 2Q6OA 4EB8A 1B42A 3M83A 5HG0A 2AF4C 3ZVLA 2I71A 2VSFA 2IL1A 2ZAGA 3W5JA 2HUNA 3TAHA 1E5QA 1H1DA 3N8HA 3PIDA 3NORA 3GLIA 1IRIA 5BMVF 4D99A 2WAYA 3IV9A 4LY3A 2WU4A 1RSZA 3CLRD 2D1SA 1B93A 3W2GA 3ETCA 1QNFA 2RI0A 4PLHA 1VYHA 4RJLA 1ZOOA 1VL5A 2WG0A 1XD8A 1YR3A 3IQGX 4CQNA 2VYFA 2OO3A 4BJ1A 3G0IA 1K75A 1KJQA 4A16A 4PCLA 2B4AA 2B36A 3HN7A 5CK4A 2QX9A 1R18A 1QIMA 1ZA2A 1ZGGA 1WE2A 4UAJA 1CR1A 1GFSA 2NU6A 4LNHA 4OO3A 4UUQA 5ALPA 2PUAA 3EIEA 1A77A 4KXVA 4NBRA 4HWOA 5I8ZA 1CRWG 2G36A 3DCJA 4YYZA 4TM7A 121PA 3P7MA 3KPUA 2NTJA 1V43A 1PYOA 2RGAA 2XOKD 4D8VA 3UMSA 1F06A 3TD6A 2A0UA 2GM9A 1MIHA 3E18A 2NZWA 1T8RA 1LX6A 3GJRA 1RWOA 2YWFA 3PFGA 4ZOBA 1E99A 2ASEA 2FG6C 1JFVA 4QPDA 3UW1A 2HHHB 1J97A 5DM4A 3SZUA 2DHEA 2IYZA 3U7EB 3DHNA 1XA4A 1Q1QA 3P27A 4Z2AA 1N7IA 2RG7A 1KETA 4MS1B 1XT6A 2DZDA 2UVPA 3TLGB 3FJ1A 5K8VA 2NM0A 1MW9X 2QW8A 1LBHA 5EQFA 4CGYA 5I8PA 3IFSA 1Q0TA 3B6ZA 1V1MA 3ZWYA 2IDMA 3TSAA 3BJRA 1Z4QA 1GFZA 4XI9A 2ZSIA 3UC9A 1BZYA 3O7WA 2KQUA 2JAQA 4E32A 5JWRA 1EE1A 4XVRA 3RUFA 1A7UA 1PQUA 3DT6A 3R41A 2QP4A 1K7YA 2O8NA 3ZCRA 4F6CA 3H5WA 4EJ2A 5D86A 4US1R 4BMZA 3DVSX 3EVFA 1B3BA 1Z0UA 3FYTA 3W5BA 1RABA 1FPMA 1S9HA 3IQZA 3IEPA 3IGFA 5E6SA 3HSKA 4AY2A 2FWRA 1ZD4A 2IEYA 2RHCA 1EWYA 1QQ6A 4IINA 5ESRA 3SP1A 4Z4IA 3SJAA 4I1UA 2MMGA 2YYSA 3WISA 3N2GA 1KVUA 4Y8VA 1GZ3A 3UXMA 4N6OA 2PD3A 2ECFA 3OM8A 2O50A 3E53A 4ARAA 1Q2UA 3BE8A 3D8BA 3U31A 2ZE7A 4P4SB 4QBTA 3BHNA 4OJMX 3WP0A 5JBNA 4OI0A 4JJFA 3ISVA 4JMPA 3I9FA 2C4NA 3F6SA 4GLLA 5F4BA 4C20A 5HGXA 5LMUB 3H4IA 5C1BA 2PZKA 4ZDKA 1WW3A 2O0MA 4WAUA 2XADA 1BIFA 1UFRA 1W30A 2Q8PA 3FRHA 3IAS1 4FI3C 4INJA 5EY5B 5K0NA 3CINA 2E18A 4PZ9A 1XVAA 3C41J 5CHYA 5B53A 1PAUA 1UMDA 3C3JA 3JZFA 3HY3A 3L8YA 4DJJA 3OIUA 1UDXA 1OCEA 4YB8A 4ZA2A 3LLVA 1Z0FA 5HPYB 4W5WA 1SD5A 3NH6A 1FIUA 4LA4A 2COEA 5BN5A 1UMCA 2Q2OA 1QZZA 3TFOA 2JHCA 5G0UA 5EUCA 1JFFB 1EAMA 1XCGB 1VFPA 2G8LA 3OC0A 1TM5E 4I0WB 4TMKA 3SOZA 1AKTA 5KDDA 2CMFA 1UAAA 2Q3DA 3BK7A 3BZBA 4IG9A 5CP8A 5DN6A 5I6DA 2CV1A 1GZ5A 3E1KA 3F46A 2WZBA 5KNCD 2RDMA 2ZITA 3RAJA 1NVTA 2JGDB 3OU7A 1CETA 2W2QA 4NSNA 4INPA 2ID4A 2FH5B 5EMMA 3CWQA 2V58A 5FWYB 4PHGA 1BE1A 1LI4A 4IJWA 3UOGA 2NQTA 4L4RA 4X3OA 1CUSA 2O2DA 1Y3HA 2HIMA 2IP2A 2QM0A 2XF2A 1KEEB 3UM9A 2PX6A 1VA5A 3VJMA 3I37X 1E7SA 5BSEA 3M8KA 1R88A 3A6GA 2XBUA 1CQXA 1WXIA 3DC2A 3DL4A 2YWGA 1HZJA 2ISCA 3FNFA 1ISGA 3KDPA 4IICA 3TUZC 2WTNA 3UAOA 3VSCA 3FPGA 1G1MA 1IBCA 3A1VA 5I7RA 5LQUA 4QUKA 4GYKA 2C4UA 3UHOA 3WB0A 4L74A 3MOGA 3TI7A 2JJ2A 4P81A 1TM2A 621PA 1O58A 1M34B 4C7XA 4DYDA 3B6KA 1AO3A 4TLCA 2AA3A 3IL2A 3RUIA 3G2KA 3V2HA 3UAGA 4DDVA 1E1YA 4GH5A 4M0LA 3NV9A 2C99A 4MUAA 2WSBA 3UJPA 2ZIFA 3AUSA 1P3Y1 1UMKA 1RMQA 1LVGA 1XFAA 2C9YA 4YK7A 3BIJA 4TM8A 1U0FA 2PWBA 4LDJA 1QIIA 2HK6A 2H92A 3UK2A 1ZZEA 2CK3A 1WQ3A 1W36B 1Z0AA 1UEIA 4XPZA 1DKLA 1P77A 3DEIA 3H16A 5AHOA 1KR2A 3GNQA 2A35A 2H8GA 4J2OA 5ALEA 3QVVA 3QEMB 4G5FA 2PUFA 2QP3A 1EFVB 3RVBA 3SC2A 5ENVA 1FJGB 2GN0A 7AT1A 1E6EA 2PKWA 3CH7A 3UB4A 4M8NE 4E1BA 1NW7A 4DM7A 2VYNA 5K5EA 4PPYA 4A0GA 3UV6A 3L8CA 1Z6TA 3U09A 1TJNA 4RA9B 1IB6A 2O8EA 3HPRA 2RGGA 3HYNA 1D0IA 3W6NA 1HDGO 3VUFA 2ZAOA 3KPWA 1JP7A 1TT7A 3EXFB 3MGGA 3HGQA 3B1ZA 2FV8A 3EQ7A 1NLYA 5E9QA 2PMEA 1M0EA 2WYWA 4BVGA 2FSVA 4BWYA 1IEQA 1ESMA 4LOJA 4DG8A 4EG1A 3MHTA 4LRSB 4ND6A 1QO0D 1IOLA 4CNQA 2LTAA 3A6DA 4HXEB 1JAHA 4JZYA 4PXAA 1QK4A 4ZT3A 2W8BB 4RNDB 3U7QA 2TRSB 5C3MA 1KK1A 1DWQA 1QIGA 3ZOKA 2J3MA 3B3QA 4DUGD 3GIDA 2RH5A 5ALIA 1FUIA 3WLPA 1J8VA 3CNNA 3O6VA 5H4GA 5K7SA 1Y5LA 2EKLA 4ZEVA 1ZD5A 3ASVA 5D3ZA 1XRNA 3K8YA 4LNUA 3R7WA 1PZHA 1EK1A 1NVUQ 1GOTA 2BFPA 3FLMA 4IDPA 4P4LA 3W7BA 3SNHA 4B32A 1C7JA 2DOKA 2JJ1A 4RU1A 4JI6B 4LV6A 4I3FA 5FIUA 3RF7A 1GT91 3SU8A 1YFLA 4L73A 1K6IA 1TF5A 2FDRA 4XX0A 1M2VA 4Z1OA 3LOPA 1UZLA 2NQ8A 4ETIA 1YWGO 2B1QA 2OCXA 1JDBC 2XUKA 3HDHA 2BV3A 3H6GA 3KOMA 4FGSA 5GINE 4BFUA 1RJWA 3N74A 3ZV6A 2VQ3A 3GFQA 4Y2UA 5BWMA 4WZBB 1CUBA 2NWQA 4KPUA 1U65A 3KWJA 1XMPA 1TTHA 1EQUA 2ORWA 3FOFC 2EQAA 3LFUA 1J20A 3MJ4A 4R84A 3ZV3A 4C5CA 1ETHA 1AKYA 2Q5EA 3SX4A 2ISQA 2R6R1 1OZFA 2G76A 2DYKA 1PLLA 1MNQA 2PUTA 1I51A 3N2LA 3PR1A 3GFRA 4LXUA 4DCPA 1P8JA 4BEWA 3P0FA 5IJ9B 1PSZA 1DFGA 2X14A 2JK0A 3DDUA 5LDDC 4BJ5A 4EY6A 2BPOA 2I4TA 4EF4A 2NNLD 3LBFA 4F9FA 4NICA 1J07A 1E18A 2ODBA 1WSDA 4KE8A 4O5OA 4XGQA 3EQ2A 4A2QA 2E4YA 1REQB 2WTAA 4IZOA 3UKOA 5EJ9A 3I76A 2X0JA 3HKCA 4LOLA 5D3MA 4F4HA 1FFGA 2XVAA 1OFHA 4R9SA 3OLWA 1OXKB 4L0CA 4X3PA 1QPBA 3F3SA 1L7PA 1N9KA 4BQOA 1U8EA 4ESEA 1E8DA 2FXVA 1Z35A 1HDOA 1QP4A 2F62A 2OSVA 1TOAA 1RPAA 2AEJA 2XGGA 4NECA 1KEUA 3GJ6A 4YPVA 4PLVA 4R4JA 4JEUA 4MI3A 3VSBA 1UBMS 1VZ3A 1NMQA 2Q0SA 1BOFA 1YHNA 3GU3A 3D2LA 3PE3A 3LAWA 3A1FA 4I7EA 2QRNA 4DIUA 5JJKA 2QG6A 3U1BA 3ZH2A 4OFBA 3MVEA 1VBKA 3NHFA 1FYXA 4RQAA 4Q3OA 2OXIA 1UM9B 3GFSA 3CNBA 2V6JA 2CNDA 3ENQA 1XCBA 2JAHA 1ACLA 3JPWA 5F3DA 5A5DA 1X1QA 3DT9A 1Z4IA 3IMKA 2OQ2A 1ORWA 2PD6A 3R3WA 4EY8A 2PN1A 3F8WA 3M4ZA 4JSTA 4PC7A 1P0FA 2DPXA 3CPEA 2EL7A 3LGXA 2H1RA 2ZGVA 4HMQA 1YF3A 2OC4A 3PIIA 4WVLA 4MKGA 2GD6A 3RODA 4WXHA 2OSBA 3LO8A 1X8KA 3NBAA 1CEYA 2O06A 3DLIA 5EXEA 3VI3B 2P1DA 1B16A 4WH0A 5TRTA 1QGAA 4Z4QA 1ZOPA 3I05A 4ZYZA 3ZNQA 5BXYA 4HTAA 4ETNA 1IN6A 4CMGA 4LHWA 3EDMA 2BGRA 2GZAA 2NXCA 3N75A 1KMNA 2I55A 4ILEA 2BGJA 1YQQA 1Z8FA 1P7YA 3LDUA 3PRKE 4P3KA 3UMCA 1E2IA 2P7IA 2TYSB 3WMXA 3LVQE 4MA5A 1CPYA 4MJ7A 1OLUB 4QDZA 3UJCA 3LC7O 4DNPA 1K0UA 4UEWA 1IY1A 1IHYA 4B6JA 1SUAA 1V8ZA 3QF4B 4J0FA 3BGSA 4PYKA 3HRHA 1UDCA 3B89A 4M46A 4EQZA 4JJZA 4ND3A 4REMA 1EHCA 2GXSA 1OU0A 1N2GA 4CKCB 2P6OA 3M2PA 3OIDA 3TR6A 2ZYWX 3L7AA 3NRCA 1QWOA 4CEJB 4MSUA 5AM3A 2HBZA 5ARDA 1G2OA 3IT0A 1OFIA 3EK2A 4G8CA 3NDRA 2H1LA 3QY9A 4J1NA 2H51A 2VRBA 4GPBA 4L8LA 1VSBA 3DF7A 3QPBA 5U4XA 3SOPA 5E1OA 1RAHA 3DP7A 3KL2A 3L1HA 4FYWA 4DEVA 1NM5C 2YFQA 5MDHA 1VI2A 1UKYA 2D06A 4X60A 1YHYA 2A3RA 2FSPA 3BZUA 4XVHA 3TVYA 4HQKA 4QNMA 2IFTA 1F8XA 5G3ZA 3UJAA 1J23A 1AHPA 2Y1WA 3FROA 3NP7A 3VR4H 5M34A 4O4HA 4OQLA 4J03A 3S8YA 1OVMA 1WB9A 1JLHA 4HRXA 4OQQA 2HA5A 4TL7A 5IDXA 1JIJA 4AN1A 1SHZA 1K8YB 4UKDA 1SWWA 4BRUA 1D1SA 4LRUA 5L7YA 2IY9A 4II7A 3GYBA 2O4UX 3P2IA 4ENTA 3DCNA 4OFZA 1EBUA 1HURA 2IRWA 5I3ZA 4CTJA 3G8YA 3W6UA 1XQYA 1UK9A 4OQMA 4LJ6A 1IM5A 1XZIA 2PNFA 3PX2A 1B26A 2GPTA 3R0QA 5BN1A 4DNFA 3RASA 4DA0A 4NBNA 3VR0A 1EPUA 2JJYA 3DE0X 2AB0A 3S99A 1K66A 3TNFA 1I3CA 2P6MA 3QQ5A 1L1FA 4HNUA 1W8DA 1GPMA 4KOEC 4YIKA 2BC9A 2JCSA 1QWSA 2FI1A 3LOUA 3NPAA 4ZVTA 3BJEA 4BQRA 4ALIA 1QE5A 1IM2A 1DIRA 1HSOA 2O0HA 2R00C 4JEIA 2PSDA 5DYIA 5BYBA 5U4QA 1JSLA 4QUJA 721PA 2GBCA 2ZDQA 1JVSA 4G3XA 3D1VA 1VHDA 3K1ZA 4IY1A 2Q29A 3D7LA 3GMTA 1ISHA 3MCUA 1I5RA 4W5HA 1N3LA 4UPVA 1ZK4A 2Q1YA 4DBLE 3N0RA 2PUWA 4R9NA 1FTWA 1PR6A 5LJLA 2FG7C 2TMDA 5KKCA 4WZAB 2A9PA 2Q9CA 5KNDA 4H1HA 5ALUA 3USCS 1JZSA 3TTYA 1A3CA 3B1VA 4FQ8A 1I2BA 4ZT7A 2WAAA 1FFDA 1QHSA 3RANA 3V7FA 1G41A 4DLVA 3L0OA 3ZWQA 1QC5A 5KHLB 1JEDA 4XX1A 1WF6A 4BEBA 2WTMA 2H5EA 2O0LA 4FGLA 4AJOA 1C7IA 1JL3A 2WUVA 5GV8A 2D1QA 4JYAB 4E4TA 3VO8A 1YK1A 4Y2VA 1J8FA 1I0ZA 5J2TF 4TT3D 4LQCA 4EVSA 4DV5B 2LD4A 3PGJA 1VZ2A 4HUQA 4JT2A 3ZVKA 4DV6B 2PS0A 2ET6A 5KU7A 1T91A 1Q0HA 1I7PA 3ANLA 4L5AA 2RHOA 4MUFA 1N5MA 1HTWA 3DAGA 1XTKA 4PX3A 2GZMA 2RGXA 2ANCA 1Z62A 2B0CA 3COVA 1J1ZA 1P2GA 3SEAA 4UTRA 4E1AA 4BPBA 1EIWA 3O8QB 1G6HA 1BDJA 1YJ5A 3PXAA 3R20A 1YV9A 2NU9A 2XT0A 3IAXA 4NE2A 4IWNA 3TFQA 2GVZC 3GFFA 4BO9A 3L79A 2HAEA 2C0PA 3MJVA 4G5RA 4DHEA 4ZYXA 4RF4A 5LD2B 3PLAE 4EG6A 3G2JA 2IH2A 5TS2A 3EPRA 10MHA 2OCLA 5AW0A 5IT0A 4BO7A 1ZMBA 4M9UA 3KUKA 2WE8A 3QFHA 4QT4A 5IDWA 1DC3A 2OG2A 1A9XA 2CVHA 2PWZA 3OWOA 4JX8A 5CA0A 4UC0A 4ATNA 3SFVA 1N6HA 4ENWA 2GTHA 3T35A 2CFOA 3KQUA 4PICA 1E5VA 4AMYA 3OY2A 3LY9A 2UAGA 4KV7A 5HZMA 4RSMA 2UUOA 3Q2IA 3U62A 4HB0A 2C84A 4BJ6A 5EIOA 4B0PA 1FFAA 1JVNA 1IIRA 4GZ5A 4RQUA 3PL1A 1QKKA 2WTBA 1OBCA 3B78A 1O0SA 1JG3A 2JH3A 2WF9A 2WM9B 3GRYA 3JQ7A 4BEJA 3TSZA 4F9TA 3UFXA 1DO2A 4X1OA 1G8JA 3DH0A 3SF8B 1I9GA 4OHVA 2NPFA 4PN3A 4JR1A 4O4JF 4BRZA 5K0BA 3AW9A 1GRVA 3FTEA 1AQYA 1GCGA 1TKAA 2XY4A 4KQ6A 4UASA 1H1LB 3ED5A 3H05A 3R3JA 3OU2A 5KYWB 2P6RA 1RVDA 4HLUC 1IM8A 3VDQA 1YFKA 5ALDA 2K7ZA 3COPA 5TJHA 4FCVA 2JLCA 4OB6A 1NNI1 4R3UC 4LWPA 2AZDA 3F4LA 1E66A 2C7VA 3PDIB 4PPQA 2FEMA 2QR3A 3GDFA 2FEOA 1MG5A 1L1RA 3O26A 2YBEA 1MRSA 3HJCA 4AZ0A 4ROSA 1ECLA 4HNHA 2COUA 1V9SA 3ET5A 2M32A 5C1OA 5AW7A 1EEHA 4TYMA 1JLLA 3MCVA 1JHZA 4CQMD 4ZEOA 3FDFA 1GLGA 1LI5A 4J9UE 5LDGA 1VG0B 4BMCA 5AKXA 4NCBA 3A1SA 4I4TA 4A91A 3EXEA 1KO8A 2Z5FA 3UAXA 5C51B 1KQ3A 4BMVA 1IBLB 1ECPA 3B85A 3A7DA 4ND1A 4PEVA 1M6VB 2NUPB 5LZ4A 4L7QA 2BFMA 2DFVA 3V2GA 1KJYA 3RYCB 1K97A 3HU1A 1WWKA 3AHDA 2JLVA 1A9OA 1Y9JA 3U9SA 1NSFA 1QNLA 1WNTA 4PO8A 2OXTA 5KUTA 1Q3HA 2IHUA 3B52X 1Z25A 4OQZA 1OLSA 4JGIA 3KJGA 5LQMA 1UT8A 2HWWA 4D57A 1PFVA 2ALJA 3ZIDA 1HXHA 1FLNA 2J41A 2YWBA 3BMCB 1ZM4A 3FCSB 5AHKA 3TTVA 5JFGA 3TLBA 2FMXA 2GZHA 1A4XA 3VZSA 1IXYA 4KK3A 1GZHB 3DF9A 1ZJZA 1I7NA 1N7GA 3B2EA 3FXAA 4K03A 4Z86A 4YRJA 3SQDA 3ZHYA 2HSWA 3KL4A 2J6BA 2BGIA 4R8RA 1P91A 2IYEA 4J6FA 3V7WA 4JI1B 4EFDA 4AI6A 1OAKA 3K9HA 2FGKA 5CJJA 2C3PA 5DCYA 2WWVD 4MWBA 4OHYA 2FFBA 2PUEA 3RT1A 1EGAA 5JECA 4KX5A 1OLOA 1C9YA 2PZJA 1KF0A 5DX0A 2VN8A 4KUEA 4NCNA 5C31A 5CB6A 4D80A 1Y42X 4HGOA 1QF9A 3DMDA 1SOMA 4QULA 3GDOA 3BHIA 3DMGA 2C07A 4QYXA 4QRHA 1EUCB 4KO1S 3O4FA 3NRJA 5G3YA 5IWAB 4DY4A 3PZRA 1NFQA 2OEPA 4UE6A 3ERCA 5TF4A 2JLZA 4M9RA 1EQAA 2XITA 3FKJA 3GZTB 3IO3A 4Q4JB 1NRWA 4MWOA 1D4ZA 4UVGA 3JQEA 2CCKA 1G5IA 3WLRA 4JLBA 1YC5A 1RKBA 4Y0AA 5BT9A 5LP6B 3P1JA 4JLAA 3IJEB 2V9CA 4PANA 4PX2A 4B4WA 4MGIR 4OUDA 1D2RA 4L3WA 4HS4A 3P0IA 3FRJA 2YHIA 5KOHB 4PQFA 5BQPA 5JALA 5GADl 1H3EA 5IMBA 1G5PA 3WLNA 3LK6A 1RCUA 2O7RA 4M1TA 4K26A 4EHJA 4FDVA 3QEKA 4JDPA 1CUYA 1B6RA 4Y2XA 3TLJA 2ZT5A 3I45A 4RENA 5EZYB 2NVUA 3DMFA 5LYJB 2WHPA 3BQNB 5C8YF 4YP0A 3LWDA 2E85A 4RSHA 4JYMA 3VX4A 3PKJA 3B9PA 4TWAA 2ZB2A 3QUTA 4HXFB 5DV9A 3W6ZA 3BSSA 4LMAA 5I4BA 1UOQA 2WHQA 4LI3X 5CXSA 2IXEA 3LCVB 4HYTA 1ISSA 2AFHB 3HBFA 1G2QA 4HSGA 2D2EA 4FFNA 4OFWA 4IJVA 3ZWOA 2ZI3A 1OA0A 1BMFD 2F1HA 3BOSA 1GL3A 3JW8A 1HL7A 1HQKA 2GCIA 4HC4A 4LRWA 3T54A 3UY4A 3RU3A 1FPQA 5B12A 1MB9A 3CJRA 3F97A 4NOLA 4BGEA 2C9DA 5BT8A 5FH9A 4D4JA 1M2FA 2P4EA 2GYUA 4YP1A 2CXOA 4ARSA 3CR7A 2G9UA 4CL2A 5G0WA 4XIGS 4KTVE 1OXTA 4PGAA 2WMYA 3OEEA 1CY4A 4GMFA 5DTEA 2B35A 5FBHA 5AXDA 5D1HA 2XMBA 4MV1A 2YRWA 4NV1A 2C96A 5I9LA 1YQWA 4TTPA 4YMHA 1HNXB 4TTTS 1ZWKA 3I9LA 3SS7X 2REBA 3T94A 5JHHB 4ARZB 1GLNA 2GWRA 3O90A 1IAVA 4YAWA 3FI9A 1XG5A 1U2SA 1FUUA 1OGJA 1THZA 3CUWA 2Z5LA 3N2ZB 2HIGA 1I6MA 4X84A 1UPAA 1NN0A 1FYEA 1SVOA 4FYHA 5IAGA 3V7NA 5EMKA 4AMGA 4S24A 4A82A 1JLMA 2DWQA 3L1JA 4QU8A 5FTMA 2PO7A 2W98A 3VC1A 3T7JA 1YZQA 5EXTA 2V1UA 5IASA 4FP9A 1PVVA 2WWRA 1I2AA 1VMKA 3WYFA 2E82A 4U0JA 1NM5A 4YMTA 5CBKA 2BW0A 2ZTUA 1JAZA 1GJRA 3D6HA 3H2IA 2AHOA 3DO6A 2A57A 1GPKA 1GNTA 2H4JA 2W6PA 3A9UA 4KRXA 1NI4B 1Q14A 2ZR8A 4R8KA 2M6SA 2QG9A 4M87A 3GRUA 1EM8B 3F5MA 4O2AA 3S27A 3UKDA 2DSTA 1W47A 3KELA 4L9WA 1E64A 4X1YA 1U28C 2OZPA 4E5KA 5BQ3A 1M74A 2PPVA 4HVCA 5IH7A 3QA9A 3JQAA 3OZXA 3KZNA 2VHCA 4C7VA 2UYYA 3VDNB 4H3KB 1Q22A 1E9FA 3BMQA 3K15A 4G5QA 2FUG6 5KCMA 3RCBA 1QQTA 2VT2A 4FOLA 1I7QB 1G8KA 4LSZA 2DAPA 3F49S 3MAGA 1P6QA 4QRIA 5K3AA 5AYVA 1SHUX 3BXHA 2HJSA 1W36D 5LA6F 1XRMA 4S1PA 2EFCB 3N8KA 1QG6A 1Y8RB 2JIMA 2PKQP 4I66A 2AZMA 2F43A 4RD2A 5DHSA 1GQOA 4J7UA 4A26A 1DEAA 2BFFB 3K71B 2A7XA 3VR5A 4GSYA 1NMXA 3TBFA 2YXPX 3MXTA 3OTWA 1RZVA 2OV8A 2EW8A 2BHTA 3P2MA 4K7JA 3RC1A 3TZHA 3W9SA 1PNRA 3BL8A 5REQB 3Q3JB 3PENA 2BMJA 4WN3A 3THRA 1LSSA 3D43A 3WJ2A 4UQOA 2IHBA 3N5CA 4YV2A 4J49A 1P1IA 1RYHA 1SXJE 2ZI6A 5CAEB 1L5KA 3TQSA 2NAPA 4B3BA 1SC1A 2EYUA 4ZICA 1ZNXA 4I4IA 4DIKA 6NULA 2O07A 3W77A 5J5AA 1PP4A 3H11B 2OXFA 4UD2A 5AM2A 5JIBA 2Q45A 1IWOA 4YWJA 3AMVA 3CB2A 5D51S 5DH9A 3ZHVA 3G79A 2QU7A 3K1JA 1DCFA 2YICA 1FVOA 3CMMA 4DZTA 3QE9Y 2ZI9A 1CFJA 4PNHA 2VO1A 2R5FA 3QU9A 5GGXA 5J5CA 5JDIC 1RAIA 3VVMA 4E21A 2B30A 3COJA 2H1WA 4I55B 4U7TB 1HL3A 1RJFA 3FUUA 3ABQB 4GC5A 1TPZA 1MEOA 3KFXA 1GG9A 1NPYA 2AC4A 2B6HA 3IDSA 2VHVA 3IS3A 1KIFA 3S2YA 5AW2A 1W48A 5AVUA 1M7GA 3WGMA 4LJ5A 1P7PA 1NF9A 3N1UA 4Q1BA 4C4ZA 5FOXA 5ITWA 2X41A 1CQIB 4DJDC 5EHZA 5K99A 3T9CA 4A6EA 3H4MA 4WZZA 3IC5A 1W1WA 2J45A 1YOVA 1W6UA 4ZCMA 4BATA 4FZ5A 1VLJA 2GN1A 2BEKA 2QSZA 1KP9A 3EDQA 3LC2O 4ENUA 5HP4A 3GUHA 2W6QA 1J06A 2A84A 2BHRA 3BXGA 4CQLB 4EBFA 2F9FA 2BTQB 4D92A 2B61A 4M1YA 2VXYA 2CVPA 4ZDJA 3OLCX 3ICVA 1NRIA 3H42B 3KUCA 2D1FA 1MX3A 4OI4A 4P3YA 5A6SA 5CD1A 3ECSA 1KMIY 1KNXA 3KT8A 2FUCA 3LY7A 1CIVA 3KAQA 2E4WA 4DLLA 2GPAA 2BEWB 3AEUA 3MJHA 1PJZA 1ZH0A 4XEHA 4YJKA 1FQOA 3LYHA 4DEXA 3ZE1B 4BV3A 5IH3A 3PQ4A 2FPMA 4C22A 4B7XA 3K2BA 1Y3DE 2DH6A 3RTAA 4CMEC 1Z82A 3RLFA 2DR2A 1M54A 4HDAA 3CN7A 4OQNA 3TQTA 4BKUA 2GESA 4GZMA 4XSHA 1KO4A 2F17A 4DQ0A 4MV9A 3DQQA 4N0EA 1LQUA 1XNHA 2HJWA 2QLLA 4BXOB 5FOTA 1QRTA 2OHJA 4QBGB 3RC8A 1PJAA 1A5SB 2XH8A 5IBCA 3W9YA 2R8YA 3DBLB 3RD5A 1Z5OA 5ALRA 1CUJA 2TMGA 3V8PA 1LD3A 2JA2A 3DTNA 3E3AA 3F7OA 2FWJA 4IIJA 3NKLA 3DPSA 3TZCA 4BFWA 5BR8B 4Z9YA 5ALNA 1A9RA 1V5EA 4HLUA 3A4TA 4DLUA 3RTDA 1A96A 4CLHA 2BISA 1XMSA 4PO1A 4URYR 4EX6A 2WZDA 2ZROA 4GSKA 2BGKA 2DM6A 3H2GA 4O4IA 5C8VA 2C20A 1NXWA 1VA4A 1HDRA 1K5DA 3GY0A 4EG8A 1NHWA 2XMCA 1BU8A 4QJ3A 1TVEA 2P4HX 2H31A 4JVOA 2TECE 1E6CA 5LCXA 3DW3X 3NJRA 1IDOA 2QTNA 1LLQA 3D3KA 3L82B 3MS4A 2XB2A 3V5NA 3BXEA 4KIJA 1FYWA 5C7YA 1TU0A 4ZOEA 2EIXA 3K3PA 1EE2A 1DQYA 1LW7A 2EDAA 1Q19A 2HSEA 3P94A 1UL1X 2BE9A 5EYPB 4B2IA 1P1KA 2PGOA 2GFHA 4ZI7F 1MQAA 3V34A 4FFRA 4MUKA 3I72A 3IIEA 1TEVA 4PSVA 3WLTA 4IL5A 2QYHA 3CYFA 2QRJA 1DAIA 1U8XX 3DHEA 1Y4UA 4HX9A 1GQ2A 1RLOA 2GASA 2VTKA 4DMKA 4YRGA 5C5CA 1SU6A 1Y5MA 3FMPB 5F9MA 5J2UA 2AR9A 5JATA 2JKYA 1P62B 1V1MB 2WG2A 4JBXA 1C8LA 4Q3NA <