4DLXA

H-ras set 1 cacl2/dte, ordered off
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlxA00
4HUQA 4LYAA 4Q1FA 1KO7A 1XBTA 3PIRA 4AYWA 3N2IA 1KK1A 4BLOA 1ESNA 3ASYA 3VHLB 2G83A 2QTHA 2R6FA 2VP6A 4OI4A 3QKSB 4DKXA 4DHEA 3FFBA 3VNUA 1JI0A 4X8OA 4DLTA 5BYKA 4YMVA 3QBTA 4O2RA 2FFBA 3WMFA 2GWHA 1B0UA 2QSZA 4BEBA 3X1YA 5EXTA 4LRWA 3RAPR 3PR1A 2O8DB 2DCUA 2QGZA 1R7RA 2WV9A 3I32A 1XJ0A 4RFSB 1W1WA 2GRJA 4ERNA 3PUZA 1WDTA 4BQSA 3GEEA 2CK3A 1E1RD 4JLNA 3GJ7A 2ZJ5A 3HP1A 2B7BA 1T5IA 2ZETA 3WNBA 4B76A 3FHTA 2JLRA 2NPIA 3AEZA 2IHBA 4TMXA 3I61A 4MUBA 3ZIAA 4BLRA 3ZZ0A 3NBFA 4XOIA 4LWZA 2IS4A 2FWRA 4AKHA 4B34A 2F1JA 4D0NA 5KHOC 4A8JA 3QE0A 5KNBA 1X1RA 1SVKA 3R7WA 1IY2A 1K8RA 2LKCA 3R8CA 2REOA 1QHHA 4LJ6A 1F48A 4V0LA 2OG2A 1TUEA 1XCPA 1ZU5A 3QJYA 3FHOA 2DFKB 3DKVA 1D8TA 1XD2A 4JJZA 4LHWA 4M2LA 2IW3A 1ZNZA 1H8HD 4DIDA 5K8UA 2YWGA 3OZXA 2BIFA 3W5IA 3DOFA 4QHTA 4EQ6A 1AQUA 5L8VA 4B6EA 3GD7A 4XSGA 1G18A 1YKSA 1XCMA 3SFZA 2BHRA 1KK3A 4LJ5A 3NHBA 4Q18A 5AUQA 4GNKA 2O0KA 3EIQA 4CEHB 3GJ0A 3ZQJA 4JLMA 1YHNA 1YRAA 2GEDA 3I8XA 1C9KA 3NEJA 3I8SA 4LK2A 2ORWA 1ZNXA 5KNCA 4NKRA 4D80A 1U0LA 2XOKD 1E0AA 4HAYA 2XTMA 5AUPB 1CJKC 1X8JA 4QGAA 1J8MF 3I1FA 2KSQA 2BMFA 3FGNA 4S35A 3R20A 3NG1A 3QBVA 3K0AA 2ZSFA 1II8A 5C1BA 4AIIA 3VU9A 1G19A 3RVBA 1YZGA 1DO0A 3SEAA 1LS1A 2AD5A 2G1KA 4HSEA 1NKSA 2GESA 5E4FA 4MGZR 1A82A 4C7OB 5BW8A 1UBGA 2MSEB 1KI6A 3QVUA 4PZYA 2DFNA 2F9MA 3EZ6A 4YMWA 3WHLA 3ZZUA 2JLZA 1XWIA 4IVPA 2QAGB 4PHHA 1N6HA 3U3OA 2F7SA 2XZLA 2ANBA 3QXJA 4LC1A 1KY2A 4PHTA 5FPSA 5J4KA 2PZFA 4RSGA 3ZQ6A 2CCKA 4IDOA 2J0UA 2DHRA 4QNMA 5GJWC 2O0JA 3BC1A 2XEXA 5E7IA 1Q0UA 1BMFD 1NG1A 1Z06A 1W36B 3VR4A 3D6TB 2QMHA 1E79A 2QSYA 1C4OA 3TJZA 3GLGE 4Q4HB 1L2TA 1OH5A 5JSZB 3HJNA 4B33A 5FBWB 3TSWA 5FBLB 1W2GA 1ZM2A 3KUDA 4DLRA 2LKDA 5KSPA 4MYHA 4NHOA 5CDFE 2CEAA 2C78A 2RMKA 4CT5A 5JFGA 2ZJ8A 2YWEA 2OEPA 3GLFB 1F2TB 3H4MA 3PCRB 2X1VA 4ZI2A 4GDFA 1Q57A 1G5PA 3K09C 4YXWD 4POAA 5IDVA 1IN5A 3VR2A 3IBYA 2W0SA 3FVQA 2J5XA 4LSGA 3TQFA 3PFIA 3P26A 5BWMA 2XB2A 5CM9C 1JPJA 3CONA 4TL7A 5KDDA 2GXQA 2QA5A 3KKPA 1A1VA 4EAQA 1VYVA 5DSZA 3U6BA 1O3YA 1TPZA 4I1VA 4TLEA 3MJRA 3X1ZA 2WM9B 3RS5A 5HPYB 4LY6A 2V54A 3VAAA 1US8B 2P6RA 3OIVA 5AJZA 4AD8A 3G5UA 1XB2A 2GK7A 1N6KA 5JZVA 1W0KD 4ARZB 1TU4A 2A5YB 1XTJA 3AGPA 4DJTA 4LHYA 4TYWA 2W6ID 2NG1A 1E9CA 1TQDA 2QT1A 2ZREA 1P5ZB 2F43B 3B82A 4EPYA 1W0JA 2H5EA 2YV5A 3GLHA 4Q66C 4A0RA 1R0WA 2PJZA 2GTPA 4OL0A 4PPGA 4PX9A 1OB2A 2ZJOA 1U98A 4OQLA 4JZKA 3NDPA 3CBQA 1UDXA 1E9FA 1XTKA 2OCAA 1VTKA 5DH9A 3KQLA 1G8YA 4PAQA 5DYGA 5G53C 3TK1A 5DIFA 3QQ5A 3THXA 4FINA 2G6BA 2OCPA 1CRPA 3DZDA 2GJAA 4EPTA 1KJZA 4LJ8A 2PMDA 3Q7QA 5JHHB 3OIYA 1DS6A 4LBWA 3GFOA 3U5ZB 4TLCA 3U7GA 2ZYUX 4JLJA 2QM7A 3GPLA 4MDFA 2FPMA 2QPOA 3ZS9A 1G21E 4LGMA 3PG5A 2JJ1A 4TL6A 1OXUA 4Q5IA 4IOLA 5BN3A 2QQ0A 4ON9A 3IEVA 2E1RA 1F2UB 2V7QD 1R8QA 2Q0HA 4ILEA 1P9NA 2ZI7A 3MG9A 4YMTA 1A2KC 3VR5A 2IXFA 1Q1EA 1B23P 2C98A 3UMSA 5DI3B 1ESMA 1DELA 1GVNB 1K5GA 3SN6A 4LYHA 5JCPA 4XWOA 2C5LA 2X2FA 1XDBA 1IJEA 1BIFA 4W7SA 4C0HA 2IYXA 3U44B 1UPTA 4DCTA 5JS7A 2WBLC 2GK6A 3EZFA 1Z0DA 3CRRA 1P75A 5J5CA 4WVFA 4XIGS 1Z83A 5JEEA 1G291 4ZCMA 2HLDD 2CXXA 2QNRA 1CR2A 3BFKA 2CK3D 1NN5A 5EZ6B 1IBRA 3SYKA 2OBMA 1TAGA 5HR5A 5FUWA 3WNCA 4OHWA 4FMCB 4MDEA 1JQLB 2GCPA 2NIPA 1SXJA 4MQBA 1A5TA 4PHFA 4W5HA 4UNSA 2F6RA 2ZRCA 1CF4A 2R6GA 2WPDA 1RKBA 1DEKA 4MKIA 1D2EA 3OF5A 2HV8A 2ZROA 3ZJYA 1TEVA 2NZ8A 2N1BA 2RGXA 3AKDA 2B92A 4OI0A 2KBEA 4M1SA 4UNNA 1KYIA 4G5RA 2R6AA 1K6MA 1TL7C 1RPZA 3REGA 1GILA 3U7FB 2FA9A 1SVWA 1U9IC 1HE1C 1NN3A 1E0SA 4NCNA 2Q3HA 4URWR 4ESHA 4IDNA 1KDTA 1NN1A 4ZDIA 3FMPB 3OE7A 4Q1DA 4QJ3A 3CNLA 4Q21A 3KL4A 1EK0A 1KI8A 1GITA 4NTZA 5B2ZA 2JASA 4KO8A 4HZUA 2EFGA 3CZPA 2UZ3A 3SHFA 3W6PA 4M1MA 4Q4JB 4Q9IA 4BWYA 1ZUHA 2CMKA 1AQYA 5EUQB 3QEOA 3DDCA 5F3WB 2XXAB 3AVYA 1MOZA 1GP2A 4RVCA 2NO7A 3MWJA 1G1MA 4HLCA 2BBOA 5K8TA 3TQCA 2RGNA 2CCGA 1CRQA 1KOFA 2G3YA 2SHKA 3HPRA 2HUPA 1E9RA 3TUZC 1ZVQA 1TF5A 5BQ5A 4QHSA 1T9HA 4RKFA 1N6RA 4AG6A 4GP7A 1N5KA 3ADKA 4QGGA 4DDWA 1PLKA 4M1WA 1CJTC 1ZJ6A 3FMFA 3GJ4A 2QM8A 2R9VA 2RAPA 4HAZA 4BRWA 2GBLA 4D82A 4N0DA 1A4RA 4TZ6A 1S8FA 2QEQA 3BFVA 3SJBA 1Z0IA 4NCKA 3B1ZA 4YC7A 4DCSA 3WP0A 3A1SA 2OXCA 4B75A 5GVRA 1MH1A 1G7RA 2DYKA 4L8GA 4Q1CA 5SZHB 4MYTA 1DBSA 1AS0A 1P2TA 1OYWA 2FH5B 4NYMR 3TIFA 5JEDA 3EXAA 1GKYA 1E79D 3GJ8A 221PA 1YE8A 2DY1A 2VEDA 2V6IA 3BH6A 1DAFA 1NLYA 3NH6A 5G3YA 1ANKA 4M9ZA 3R8FA 4TT3A 3R9XA 3N2EA 5B64A 1QBKC 2QP4A 2Z5FA 3QF7A 1LF5A 3PUYA 3CUEF 4RCYA 3D8BA 3PUVA 1G8FA 4PAOA 1CTQA 2E87A 5M04A 3E1SA 1LFDB 1QHXA 2HYIC 4KU4A 1KJYA 2C77A 3NBYC 3FHCB 2BM1A 3DL0A 4YDHB 5DNYB 4P4TA 5BN4A 2A3RA 3K0FB 5JHGB 1ZM9A 2QE7D 4AG5A 1ZAKA 2XSZA 2ZAOA 1NJGA 1VDZA 4Z1MA 1YR8A 5KUTA 4JJKA 4A4DA 1GRNA 3C7KA 1XX6A 5TVKA 3QKRA 1XEXB 2B8TA 4C2TA 2B6HA 1CEEA 1SVOA 3CB4A 3ZS8A 4MH0R 2QROA 4US0R 3LH5A 1HY3A 1E1RA 3BORA 2OHFA 4BLTA 4JBXA 5FTNA 5EP4A 4L15A 1U8AA 4UNQA 3BRWD 1XXHB 5JI2E 1G64A 1LVGA 1MR3F 1W0JD 2AXNA 4GOJA 4C30A 3QPWA 5ANRB 4V02A 5E3HA 4OHVA 1QVAA 3LLUA 2ZRBA 3D7MA 4IRUB 3BBPA 3B8HA 1XEWY 1E94E 4LJ9A 3QPVA 4NL4H 4CEJA 2NO6A 5EE0A 3AKCA 1U0JA 1G41A 2QQEA 1NMXA 1UBFA 4ZCLA 1COWD 2QI9C 4F4JA 2FDCA 2DB3A 1GAJA 4JVMA 3OAAA 1R8SA 3EC1A 2JJ8A 4EPXA 5KNDA 4GOKA 1D5CA 2WIAA 3A1UA 2PX0A 2GZHA 4TQAA 2CE7A 1BS1A 5JWRA 2GILA 1OIVA 3KKOA 5KDLA 5L3SA 4PZZA 1D9ZA 4NYMQ 4AYXA 3CPHA 4H1UA 4EFNA 4OHYA 4H9GA 4PO9A 4XVRA 2V9PA 5KO2A 5A4JA 1MV5A 2CHGA 4AY2A 4GFDA 1NLZA 1D2MA 2VHCA 1NVUQ 1Z6AA 2BM0A 1GKUB 1JPNA 2CE2X 5E7JA 3KFVA 4G3XA 1FMLA 2AHOA 4KFSA 3SC3A 2EWVA 3CX7A 2J59A 4U7DA 1I4LD 5TY0A 3SHWA 1RVDA 2RH5A 4PC6A 2WOJA 1MO4A 2OCBA 5KDOA 4II7A 4FCVA 1R0ZA 1KY3A 1SHZA 4C0LA 3Q3JB 3ZVMA 2HT6A 1NLFA 1VECA 3IO5A 4GT1A 3TAUA 3QG1A 5JJIA 1F3OA 1FQJA 1ZINA 1UEIA 4WZBE 1FP6A 5TARA 2BV3A 4N0EA 2WMOB 4X8HA 1UBCA 4LJYA 3C4JA 3U3KA 4MKHA 1J70A 5FFMA 1EGAA 3HYTA 1N6PA 2WOOA 4UXJA 2CCJA 3KFXA 3B6EA 2D3WA 2Z4RA 1YZUA 3FOZA 4IVQA 1ZUIA 2WSMA 5E95A 5H70A 4QBHA 4BFZA 5FOVA 4LV8B 3KXLA 3O8BA 4BPBA 3AVWA 2QPAA 1GSIA 4TLAA 2WPDD 1E1QD 1NSTA 3C5CA 3JVVA 4A2PA 2ZU0C 5IT5A 2RGAA 3C8UA 4Q48A 5FL7A 4I1UA 3JZMA 3TGPA 2XAUA 1KI4A 3BOSA 1UBEA 1E9AA 2CDNA 4R2IA 3RWOA 3MAAC 1VYUA 1FPMA 4Q02A 3FPAA 2VHTA 2EU8A 2FPLA 3EA0A 4JLBA 4LJAA 1L4YA 3QEJA 3T35A 2G0TA 2NO0A 1DTSA 2GEVA 4JT2A 3EZ9A 5J40A 2OFWA 1SHKA 4LHXA 1XTSA 3OE7D 2IHYA 3G0HA 2XGJA 1FNNA 3T34A 3QI2A 2W2XA 2BDTA 3BH0A 5E7MA 1Y3AA 4ZO4A 4JSTA 4LYJA 1Z63A 3U61B 1NY6A 4ZDKA 2REBA 1XP8A 2IUUA 2ASEA 4JVSB 1GIAA 1RZ3A 3A4LA 3RLFA 1FX0B 5EXSA 4CDGA 4RZUA 5EP3A 4LC0A 2IS6A 1XMVA 2CLCX 5C2JB 2QGNA 3C14C 1IQPA 3CRVA 4LHZA 4QOSA 2CL6X 1G7SA 4BASA 4XVUA 1KIMA 2C8VA 1E3MA 1DARA 2ZRIA 4UKDA 4HDOB 3I92A 3QSYA 3K0CC 4KI0A 5DISB 4LDJA 2W6IA 2WWIA 4CGZA 3SQXA 3GFPA 4M22A 2NPFA 1S9HA 1YZNA 2WVJA 1P2UA 3NC0C 4Q47A 5KYKA 2WWWA 4PC7A 1AZSC 1U94A 3PVSA 2HF9A 2O8FB 4GZMA 4IOJA 2NO9A 2QAJA 1JXOA 2OT3B 1NIJA 4HYYA 4BFWA 4D0LB 3LBHA 3CF0A 1DAHA 3IPYA 2PBRA 5JJLA 2FFAA 1OXXK 1G4AE 4JVNA 1W48A 3S1AB 2H18A 4EPWA 3GLGA 3AKYA 2JLQA 2UKDA 1YZKA 3M0EA 4BRUA 3EAQA 2YZ2A 3L0SA 2AFHE 2PCJA 2AR7A 1A2BA 3HYRA 4TT3D 2Q3MA 3UANA 4EUNA 4IKEA 3A37A 3OEHA 1L8QA 3L0IB 3ZD6A 1J90A 3Q72A 2PL3A 4B3DA 4E22A 1HT2E 2VSXA 3DHWC 3B85A 2C95A 1P9RA 2V7QA 4NU0A 3DOEA 4URXR 2O52A 4HUQB 3KQNA 3EZ2A 2QAGC 1Z2CA 3F3YA 2D7CA 2F3TA 1IY1A 3IIJA 4HAUA 4IHQA 4RJLA 1Q1ZA 2FX3A 5CLQA 3K9GA 2VO1A 2RCNA 1U8ZA 3CRMA 1CR0A 1W5SA 3GJ5A 4LYFA 3E70C 4NBSA 2XSZD 3T5GA 2CVFA 2IL1A 3IGFA 4OYHA 4Z1MD 4ZDJA 1YU9A 2IT1A 1W36C 2AK2A 4EIWA 4DIEA 1FP7A 2BBSA 2P0EA 3LX8A 2EW1A 4JS0A 4Q03A 2NTYC 2HLDA 2J7KA 4AKGA 2IUTA 1Q1BA 1WBDA 4OJKA 2BEJA 4G0NA 3SOPA 5GJVC 2JCSA 5H1YA 4ZV4A 1NIPA 4RFVA 4D4JA 1VCMA 3HU1A 3QKSA 2IWRA 4QBIA 3V9PA 4OK5A 2PLRA 4NCJA 3CPEA 4U02A 1DADA 5J4VA 5JBQA 3PITA 3GLIB 5FBVB 2DWQA 2IYTA 4I4LA 1RYHA 4PSVA 1WXQA 1QHYA 4Q7JB 3R7WB 1V5WA 5EQTA 2O8DA 1J7KA 2MMCA 2W0MA 1LW7A 4RFSA 3IIKA 4XWKA 1XD2B 2GAOA 1Z28A 2AD1A 1NJFA 3EG5A 2EWWA 3T1QA 4N1AA 2QY9A 3SR0A 4PANA 2J87A 1DAKA 1MRSA 1ZM3A 2ZSAA 4EKDA 3A6PC 4PHGA 1Q3TA 2NOAA 1E9BA 3KKNA 3M6AA 3OIUA 3OAAD 4BGDA 4U5XA 5FOWA 1ZCAA 3AKEA 1TQ6A 1HYQA 1U99A 2B8WA 2HCJB 3EARA 3FB4A 5JRZA 1KDPA 2GF9A 3EPLA 4GP6A 2CHQA 3KZ1E 4F38A 3GP8A 4IDPA 4EDHA 3EZ7A 1ZMXA 2Y8EA 4JLOA 2Z4SA 2X77A 1XMSA 4NONA 5FI0B 3P4YA 1Z8FA 3WXMA 3KQHA 2ZQ5A 2QRZA 5JCZA 2N42A 3T1VA 4Z8YA 4AK9A 4AC9A 1XRJA 2C9OA 3K0AB 2PX3A 4QGHA 3B1YA 3RHFA 1Z47A 1R0XA 2EFHB 4H1VA 5DE3A 3EASA 4EJSA 1XZPA 4CEHA 3KKQA 3CRQA 2R44A 2GJKA 4TTPA 1KI6B 4OBEA 3BE4A 2IYYA 3EIEA 1RJ9B 3SYLA 1M2OB 5FOSA 3RWMB 3U4QB 2IYQA 1G20E 3U3MA 2FEOA 2YJTD 1OH7A 4KBGA 1SVLA 2KE5A 4L9WA 5HKKD 1XD8A 1QG2A 1NVWQ 4XSHA 2ATVA 3CF6R 1E0JA 5EP1A 2XJ4A 1GTVA 2A30A 1GL9B 1SQ5A 1X86B 1N0WA 2EYQA 3W3AA 2OXRA 2ZI9A 4PPNA 3N5CA 2DWPA 2ERYA 5A0FA 3KQKA 1NKTA 2NO1A 1ZYUA 4PSAA 1AZTA 1R5OA 2YHSA 4Z8XA 1PZNA 1KO8A 3CNOA 4CT4B 1VCIA 1TQ2A 5EE9A 3AP1A 3WHKA 5FL7D 2CLDX 2I1VB 2XTNA 1WQ1R 3KXKA 3UIEA 1BYIA 2QG6A 1FQKA 1HV8A 4M0LA 1KMQA 1G9XA 4KLNA 2GEUA 2C2HA 3LXRA 1S1CA 4CF7A 4TTRA 2BMDA 3P20A 5B57C 2GVDC 2MSCB 4HZIA 3FMOB 5JSZA 2ZJBA 5IK2A 2PEYA 2WICA 3AVOA 4FMDB 2GCOB 1I4TD 4KFTA 5LD2C 1QHSA 1T3LA 5DN6D 4FMDF 2J41A 2QE7A 4FMBB 3AVUA 4EPVA 2QU8A 4E09A 2GETA 3GLFA 4V0NA 1VG0B 1P2VA 1T0JB 2JA1A 1EX6A 3LRPA 3EPHA 2VBCA 4N3NA 2VP0A 2ZIAA 3CW2A 521PA 3AP2A 3ECCA 3OFND 3W90A 5IHPA 4DSUA 2ZJ2A 4LBVA 2BCGY 1SKYB 1SVMA 4Q1AA 1VKJA 4Q9JA 1DG1G 5JWHA 3OHMA 5DGXA 5HTKA 5F2EA 4QXAA 2Q9BA 1MO3A 2ZXUA 4TMKA 2J9RA 1TUIA 2ZJYA 3UPUA 3WYFA 4HDQB 3NHAA 1KSHA 1JAIA 1JAHA 1R5BA 3CIOA 5GJBA 2RGDA 2XTZA 3E2IA 3GLHB 1ZBDA 5A5GA 2H57A 2AWOA 5EE1A 5J47A 1US8A 1GM5A 2VPPA 4LPSA 1SVSA 4IJMA 1VIYA 3IHLA 1XPUA 3Q7PA 5BXQC 4FD2A 4MRRA 4A6PA 1NNEA 1L7VC 2OLJA 1IONA 2H1LA 4IOMA 5FTJA 4BEJA 1Q44A 2ZR9A 4A9AA 5LB4A 5KU1A 4OQXA 1JALA 3GFTA 3THXB 1YJ5A 1M34E 1Z07A 1COWA 1IXZA 2FU5C 3DPUA 1P7CA 2B7CA 2J0VA 3VTKA 1DAEA 1TF7A 3CH4B 1JB1A 4GPTA 3CLVA 4JYBA 2R6DA 1GL7A 4J0QA 1KO5A 1CP2A 4JKIA 4DUGD 2ZEJA 3EC2A 4EFMA 3TW8B 2O8EB 2DBYA 1G7CA 2A2ZA 5TB5A 4LZZA 3OEHD 4TZ0A 1MABB 2IYSA 4O2LA 4BFUA 5FH9A 1EFTA 2N46A 3RS3A 2YOGA 3IBGA 2XNDA 4D4KA 2XX3A 4QNRA 3WYGA 1LNZA 1AGRA 3RANA 2DWOA 1DPFA 1OT3A 4QBFA 1PLLA 5D3MA 1F6BA 3AVTA 1WF3A 2YNMA 1OSNA 4YONB 5C18A 3ZVNA 4P4SB 4MRNA 1KGDA 2FZ4A 3B60A 5CB6A 2AK3A 4RZ2A 2P3SA 4IFBA 3W9YA 3QXCA 1NVXQ 2IXGA 5FBRB 3IKJA 5LDDC 3U7HB 3QXHA 1UKVY 1XMJA 1IN8A 1W49A 3AVQA 4DDVA 2ZI4A 1UAAA 3VQTA 121PA 3HU3A 4Q7LA 3WBJA 5K8IA 2OZEA 5LD2B 2VLIA 4G5OA 1W46A 4K46A 2FE4A 2YVUA 4A6XA 1FW6A 3CM0A 2BWJA 4B2PA 2R62A 3PUWA 3LD9A 1NP6A 2F1HA 1KI3A 1Z29A 1KO4A 4FXPA 5G3ZA 1QZXA 3U44A 3L82B 1WBBA 2MSDB 1CR1A 1NMYA 2J3EA 2ZRNA 4BFXA 1E1QA 1UKZA 2GJSA 3SI7A 2XNSA 1E4YA 1S9DA 2WJYA 3A4NA 4G5QA 4WOPA 1XMIA 4JL6A 2OUKA 3K70B 4Q00A 1AM4D 2IYUA 2HJVA 4E03A 2V1XA 5KSZA 4ITRC 2F1IA 1FUUA 3IIMA 3ONWA 1JJVA 3QKTA 5L3RA 4FW9A 3TKLA 1NMZA 1GWNA 4TMWA 1W44A 2ZE5A 4ZI3A 2D74A 4LJ4A 4DSOA 1BYUA 4A2WA 4C4PA 3GLFE 4HATA 5HZKA 5H8WA 2WKPA 3H84A 4HZUB 4TYYA 3ETLA 4XH9B 3KX2A 3GJ6A 1GNQA 4A0HA 5AJXA 3ZH9B 2EFEB 4DLXA 2WWYA 4PPQA 1IY0A 1IXRC 5J4HA 1KSGA 1D2NA 1RW4A 3X1DA 2F55A 3FFAA 2YOFA 1FTSA 2QMUA 5LPNA 5FPHA 5BN5A 5FI1B 2ZJAA 1M7GA 3DEFA 2DPXA 2ZUDA 1VG1A 3H0KA 4IDHA 4BFYA 1VHLA 3TMKA 3EWAA 1P4SA 1U2RA 4TLBA 2VTKA 1T91A 4P32A 3BFXA 4NE2A 4NZYA 3SE0A 2OCYC 1Q12A 2WHXA 1TADA 1BO6A 1S96A 1IN6A 4Q4JA 2KI5A 2EQBA 4WZ6A 1BH2A 4OJQA 1AKYA 4BE7B 1MO6A 4D26A 2XXAA 3JVUA 1KDOA 5TDHA 4C0SA 4F93B 1TF2A 3VR3A 4ZIRA 1UFQA 1IM2A 3K9LA 2IYRA 3CZQA 4TMZA 4ZCIA 3O8RA 4LBZA 2VA8A 1KMHA 2R2AA 1JEEA 1LB1B 3K8YA 3AVVA 1NL3A 4TQ9A 4LV6A 2NQ2C 4URVR 1E9DA 1VHTA 2WWFA 3A1VA 2A9KA 3LAWA 1E69A 4L9SA 1I2DA 4Q01A 1CXZA 2OV2A 4TSFD 1IAQA 4WIAA 1PJRA 1I2MA 4R98A 5FPYA 1FNMA 1SGWA 4Q1EA 4D2IA 3W6OA 1R4AA 1CU1A 1ETUA 3AUXA 1N6OA 4Q4AB 3V4FA 2QBYA 3LBNA 2WJVA 2H92A 4NYIR 4WXRA 3AUYA 4ZKDA 2HJGA 1PVOA 5FUVA 4Q9LA 1Z08A 3KJEA 2VQSA 4UQOA 4G01B 4TQUS 2JLUA 1CLUA 1IJFA 1QHGA 1OXVA 1W36D 4LOAA 2BMJA 3AF2A 2J46A 4PQYA 4NCHA 3RSLA 2A5FA 2BCJQ 4B3BA 2YC4C 4KSCA 5IK2D 3VKHA 4IVRA 4KAXA 1KK0A 2IBMA 1E99A 3NVAA 4IDQA 4KODA 3SJCA 2P6NA 3LWNA 4LBYA 1KZGB 5KTYA 2Q3FA 1P3JA 2PT7A 2WWHA 1N5LA 1U90A 2CL7X 2RHMA 5H68A 1MT0A 1UEJA 4LJ7A 4IOKA 1T8UA 2V4ZA 3RC3A 3VX4A 1ZD1A 3QKRB 2ZUBA 1E2HA 3P27A 1VG9B 2BOVA 3MLEA 3PXGA 1KSJA 3OESA 3BB1A 4JYCA 4GOXA 2WZQA 1QHIA 4TMTA 3GJXC 3FDIA 4QJ4A 5FTKA 3ICQB 1CS4C 3K0FA 1XEWX 1ZUNB 1GNRA 2BVNA 2OSBA 3THWB 2W83A 5JLJA 4MGKR 1DO2A 1U9IA 2GDJA 5DLQC 2WIBA 4TL9A 3THYB 2IXEA 1PUJA 4YLGA 4QJ5A 3C16C 2YC2C 4KSBA 4TLDA 3QXSA 1XEXA 2OE2A 4KYIB 3IPXA 4W9MC 2ZSEA 3QIAA 3VFDA 3U3RA 2BJWA 4JKYA 4B48A 2JAQA 5KSOA 4B3GA 1JJ7A 1DAMA 2BKEA 3IUYA 2RKOA 2ZYVX 1RRFA 3KXIA 1XXHA 4IFEA 5CYOA 4YMUA 2GAAA 5L3VA 4GSYA 1JR6A 1WB9A 1KSFX 1NG9A 3Q5DA 1G17A 4TL8A 4R71A 1PV4A 3ADCA 3X2SA 1T5LA 1T0HB 2D7DA 1JXMA 721PA 2VSOA 1EWQA 3WBKA 5AJYA 2GJ9A 2GKSA 3KTAA 4V0KA 4JBWA 2E9SA 4HLQB 1Z6TA 1W4BA 2ZI3A 4TTQA 3BB3A 2XZOA 3QKUA 2XNDD 2YOHA 2ZE7A 3TNFA 1OFIA 5FR1A 3EWSA 4M4SA 5CYPA 2EVWX 4NYIQ 4M9QA 3B1VA 4B71A 2AX4A 3C15C 2J7PA 4NMMA 4FWTA 1ONBA 2GHIA 3BK7A 4URZR 1FMJA 4FI3C 1NVVR 4TMVA 4HLUC 4D4MA 1H8ED 2BMEA 3CR7A 3ZZTA 1EFUA 4RKEA 1ZC3A 1HT1E 2ODNA 2ZANA 4QL3A 5DO9A 2JEOA 3AVPA 3QF4A 1RYFA 5HKKA 5UKDA 4K81B 2FN4A 1E4VA 3KJHA 4PPFA 4C2UA 3KJGA 3THOA 5IRCD 4RY2A 1GFIA 2RGBA 4I81A 2O0HA 4NCIA 4XTRA 2I3BA 4C0KA 1OXTA 1JQJC 1Z0FA 4A1FA 2O8BA 4RD3A 2OAQ1 2OFOA 3BIFA 5SZJA 1VPLA 2PEZA 3SS8A 1XF9A 2ZRMA 4NP6A 2KBFA 4PZLA 4U00A 3BD9A 1P73A 3ZVLA 3I5XA 4LX0A 1CJVC 1JR3E 1OHHD 3CF2A 4MYUA 4WZAE 4A82A 3KJIA 5JJKA 2RGCA 4DT1B 1LY1A 5C4MA 4GBMA 3W8RA 2QTVB 1UF9A 2OBNA 4WBSA 4RZXA 1NI3A 2A5DA 3K1JA 2ZVQX 3GJ3A 2ERXA 3W3ZB 3DVLA 3KDSE 4C3ZA 3RYTC 1KI1A 1AIPA 3HPQA 3NKVA 4RD1A 5CJ2A 2BJVA 3TUIC 1N0UA 3UMRA 3BAFA 3QOFA 1NN0A 1OFTA 5DN6A 1AJEA 3LLMA 4LI0A 4US1R 4AWXA 3I5YA 4DCVA 3QY0A 1ZC4A 2FPKA 2BBTA 2OBLA 2WKQA 3ZYCA 1ZW6A 1RIFA 4YMSA 5DHAA 1LS6A 3OFNA 2VH5R 3X1XA 3SQWA 3VKWA 2FFHA 2ZYWX 5DHFA 2WAXA 2F1RA 4OQNA 1OXSC 4ZKEA 4OI1A 4A8JC 4DCUA 4JIMA 3AF4A 2R65A 1I4DD 1UKEA 3TR5A 4FN5A 2ODWA 2X8AA 3F0TA 1RC8A 1XPOA 2FEMA 2KJQA 5KOYA 1XTRA 1IN7A 1GRRA 2JGNA 3RRYA 3BGWA 3UG6A 1S2MA 4IEIA 2Q9CA 2O8CB 4AURA 4F4CA 2VP9A 4PQRA 2CLSA 4Q7KA 2VHQA 3P32A 2Z6VA 3SFVA 1YQTA 3T1TA 4GMDA 3AH8A 3GMTA 1VIAA 1XXHE 4CEIA 4IW3B 3FE2A 1NF3A 1NVVQ 5D3QA 1MRNA 4F7WA 3T15A 1G8HA 2ZITA 4Z51A 1ZNWA 2JATA 3PUXA 1G3RA 3UXMA 3AM1A 1R10A 2ZS9A 1EX7A 3IQXA 2CHVA 3LQQA 4Q19A 2ZE6A 2YKGA 2P6UA 1ZD9A 5FPTA 2IYLD 1T3HA 4DUGA 1QRAA 4OI2A 1X3SA 3WY9A 4URYR 3B1XA 2OM2A 5L3QB 3H2YA 2PH1A 4C0AC 2ANCA 4EJSC 4WW0A 1JR3D 4RCZA 2HXYA 2CJWB 1T3SA 4B73A 2HDNB 3CNNA 4M1YA 4XJXA 1N5IA 4FIDA 1OH6A 3PV0A 5BYJA 1E2IA 1OE0A 3S1AA 3LVRE 3T06B 2QRNA 1JBKA 1UDWA 1Z6YA 4GZLA 4M1OA 4DZZA 2REXB 2OESA 2Z43A 3WP1B 5HCIA 2D06A 5ELXA 3LW7A 2BBWA 2ZRAA 2G9NA 3CX6A 4PR0A 5JECA 2Z83A 3RS2A 1E2MA 2VIIA 4B2LA 3PEYA 3G82C 4L4UA 621PA 1G6OA 2BC9A 2FFQA 3KQUA 1ZU4A 3CR8A 5CIWA 5FPKA 3LXXA 3CRW1 2ZRKA 4A0GA 5TV2A 4DLSA 2P5TB 2JDID 2QN6A 2C04A 5HZHA 2PJRA 1E2FA 3MFYA 3MUFA 3FYHA 3VR6A 5EP2A 1OPXA 3SZRA 1N25A 1CKEA 2FSFA 3ZLJA 5CB8A 1TTTA 1Z22A 1G6HA 4M21A 4OHZA 1J99A 1DE0A 1HE8B 1Y63A 1TEXA 2ZS8A 3PEUA 4A8JB 1V43A 3A4MA 3V4RA 1E2NA 4HAXA 2WMNB 1QHHB 1KHTA 2FSIA 3ASZA 3TW4A 1ZM7A 2ZUCA 4DVGA 1X8LA 3MRSA 1E9SA 1G5TA 5C4GB 4CW7A 4B32A 5GADl 4BLPA 5JWOA 1M7BA 3VKGA 2GF0A 4EQ6B 4LPKA 4DDUA 2WJHA 1LV7A 2VF8A 1AN0A 2ZPTX 3M4YA 3GLIA 3QNUA 1FFHA 2XJ9A 1R2QA 1GZSA 3KB2A 4DLYA 3GEHA 3RRMA 3BH7A 3GQBA 4MRVA 3K9NA 2K5UA 1EESA 5JI3E 2FF7A 3K0CA 4HB4A 2QPTA 1KI9A 1KJWA 1Z5ZA 1M74A 3ZDQA 3SU8A 3TSZA 4KITB 2PZGA 3K53A 3U3JA 2YYZA 1KNQA 1S1MA 2VF7A 5F9HA 4GRAA 1HTWA 3BERA 4DLWA 3CH5A 5JMTA 1FOEB 1J8YF 1AA9A 1GDDA 1II8B 3AF0A 3L8ZA 4C0JA 2IS1A 1KI2A 3UATA 3VU9B 1P9WA 2JLXA 2WSSD 1VMAA 2J7PD 1CJUC 5CIQA 3TUJC 4EJSB 4D0GA 4QKQA 2ONKA 3X1WA 2ZI6A 2ZRPA 3HDTA 1NBMA 5TMPA 2PMKA 3A58B 4JL8A 3SDZA 4A15A 4DCNA 4V0OA 2EFDB 5FUXA 1Z2AA 4JMPA 1RRCA 2A78A 421PA 3RC8A 4OHXA 4W5JA 2FG5A 4X8MA 1SZPA 3U60B 2QL6A 3SBDA 3L2OB 1XU4A 1Z3IX 2J0UB 3B78A 4ZPXA 4P33A 3UKDA 3WMGA 3REFA 1IHUA 1W4AA 1SVIA 3A1TA 1G3QA 4TSFA 5AWFC 4C7OA 2ONJA 2IUSA 1RJ9A 3T1OA 3U4QA 4HUTA 1S3SA 4FWIB 1XD9A 2QAGA 2ZRFA 3RRNA 3EIHA 3FKSD 4F4IA 1P61B 1FZQA 4WAUA 4G1UC 1A7JA 1GKIA 5HE8A 4TYPA 2JLSA 3U2QA 3W8NA 1JECA 4DB2A 3WRYC 1YR6A 2ZSBA 2V8OA 2HCBA 1KKMA 2QZ4A 1W4RA 1R0YA 3N70A 4BFTA 1II0A 1O87A 1YR9A 4D6PA 1P72A 3NBXX 4Q4HA 6Q21A 1G3MA 3VNVA 1EFHA 2P65A 4PSKA 2WTUA 4KCGA 4PAMA 2C03A 4MITA 2ZTSA 1KAOA 4RD2A 2GXUA 5AR1A 4JT4A 3BS4A 4IXNA 4XD7A 3DZ8A 4RD6A 4HEJA 3E5HA 1F2TA 3AF1A 1P60A 5EE3A 4QGFA 2PT5A 4KLZA 5AK0A 1SXJC 2KWIA 1W2HA 2VSFA 3C5HA 5J4YA 1DVRA 3RS4A 4TYQA 1J2JA 1Z0JA 4GI7A 3HR7A 2GCOA 4FCWA 3I62A 2H7VA 4TYNA 4ACBA 3B5JA 4JLVA 3K70C 5JRJA 4F92B 1M6NA 1OB5A 4G5GA 5C46F 2PZEA 2Q21A 3FMIA 3AVXA 1G8PA 1Z6XA 1ZIPA 3LFUA 3TSOA 4DSNA 2C99A 4UNPA 2GCNA 4JLPA 4KJZA 4R7ZA 3RSOA 4HB0A 4ARZA 1DAIA 3NXSA 1OKKA 3BXZA 1WE2A 2QMEA 1GOTA 2ZR0A 2QORA 4KV9A 3GLIE 1W7AA 1WA5A 3TLXA 4Q9KA 3ZVRA 2JLVA 2ZYTX 3CO5A 2F43A 1G16A 3EA5A 2ORVA 3LQRA 1YR7A 2W2TA 4MUAA 2H17A 4F91B 4B3CA 3NDBB 1IN4A 4A2QA 4D25A 2YWFA 3MWYW 2AKYA 4AKIA 3UK6A 2BEKA 3B7GA 1OW3B 2ZRJA 2RGNC 1UJ2A 3CWZA 1HQYE 1C1YA 3I4LA 4FCTA 1XCGB 4W5WA 4PFSA 2A5JA 4MYCA 2QP9X 2OILA 2G1JA 2W6JD 3KKMA 3WRXC 1G5RA 2ATXA 2GBLC 2ZE8A 4S2EA 4XWAA 3OEEA 3RABA 4ABYA 3ZD7A 2CBZA 3DO6A 5D3MB 1E2PA 1EFRA 1G8GA 4MRSA 4BFSA 3L0OA 5FOTA 1WP9A 4UJ5A 2GXAA 3PEVA 4PC2A 3FWYA 3ADBA 3IO3A 1RRPA 1NBME 3MD0A 4UXIA 5DI9A 4OQMA 3CX8A 2FSHA 3PJRA 2O8EA 4M1TA 1H8EA 4QM7A 1MABA 1S0UA 4R9UC 2HYDA 3B9PA 5CK5A 1SULA 2XITA 3EW9A 1KO1A 1EXMA 1FUKA 3MGCA 3B1WA 1F2UA 3CKLA 2AXPA 4M9SA 1DOAA 3AQ4A 1E2QA 8OHMA 3I72A 1TQ4A 1CIPA 4QHYA 2GZDA 5B58C 1GL6A 3MWKA 4P4SA 5DI3A 2V55B 1E0KA 1N0VC 2OO7A 4BUJA 5FL3A 4E5UA 1FL9A 3K0EA 2VHJA 4C0QC 5F98A 1SXJB 3LY5A 3K09A 1T6NA 2NGRA 4JVLA 2JJ2A 2TMKA 2Z0MA 1NSFA 1W4CA 3UG7A 4C0BA 3D31A 1OFHA 2VP5A 2ZRGA 3NBZC 2GJ8A 3A36A 3IHWA 4RZ3A 2AL7A 3DMDA 3ADDA 1KDRA 3O47A 2G77B 3HWSA 1OHHA 1WCV1 5LBIA 3RNLA 5EXPA 3EPJA 4ESVA 3KUCA 1GUAA 2ODBA 3W5JA 1VYTA 2YINC 3ICEA 4V0MA 5AJVB 5P21A 1IXSB 3ZIAD 4A36A 1F5NA 1ZCBA 4YDSA 1VCOA 4ASUA 4DB4A 1S3GA 2VHUA 4FMCF 2GA8A 4K8OA 2LCFA 2HF8A 3IILA 1HEIA 1TU3A 5GJCA 4O0MA 2JLWA 3FKQA 2CNWA 5B30A 1P6XA 1CJMA 2ZRLA 4I99A 2IC5A 3RDPA 4YQFA 2J0SA 3D3QA 2WJJA 3GEIA 4L16A 4DRZA 1E2EA 2AN9A 2QTFA 2WJGA 2JIZA 3FTQA 4NH0A 4DBLC 2W58A 1E6CA 3BB4A 2IYVA 2KB0A 2GZAA 4D4LA 1FTNA 5EUMA 4Q1BA 5AJWA 3LVQE 4EPRA 1M1YE 3B9QA 1TX4B 4CRWB 1AGPA 4IXMA 4QBGB 4DLVA 5AUNB 4B3XA 3F5FA 5FTMA 1N6IA 2QT0A 4QG7A 3K9HA 2C9CA 2WWGA 3LW8A 5KPDA 3VR1A 2WAYA 1HQCA 1II9A 2HT1A 1MKYA 4UNRA 2ZS7A 1Q1QA 2IF0A 2A7QA 1D6JA 3T5DA 4R2HA 2MMGA 4KFUA 1NBMD 1RE0A 2ORIA 3W34A 2VRWA 4V03A 5CJPA 4RD4A 1LF0A 3ND8A 1SKYE 5SZKB 3MSXA 2RHDA 1P62B 5EZ5A 5EXXA 2IYWA 4PO1A 5DYIA 4ZIRB 1RRGA 2RGEA 2FSGA 3LDAA 1R6BX 4DDTA 1ELOA 1KAGA 3TR0A 1OV4A 1KMHB 1JEDA 1QF9A 4D81A 1ZIOA 3GLHE 2FGKA 2YWHA 1ZP6A 2IS2A 4BZXA 1HUQA 3CPJB 1E2JA 3A8TA 5K8LA 3BJIC 1R5NA 4Z54A 1XEFA 3QENA 1E98A 4NDZA 4B43A 3TVDA 1HURA 3NWJA 2QBYB 2EYUA 1W47A 3R9WA 1N6LA 4QRHA 4HB2A 2ZVPX 3IEUA 4KHZA 2H8KA 4PO8A 3RS7A 4DEYA 1N2CE 2OAP1 821PA 3HU2A 1G3UA 1YZQA 1CULC 1JR3A 4M1KA 1AS3A 2HXSA 3AF3A 3SNHA 3UMFA 3I73A 3SJZA 1T4GA 2VP4A 2D62A 3B2EA 3SYNA 2Q9AA 2ODEA 3Q8XB 4PXAA 5EE5B 1BOFA 3K0SA 4DEXA 1M8PA 1UKYA 5IF9A 4MKFA 3I3SR 4M9XA 4BLSA 4MKGA 4Q4AA 4I1SA 2XB4A 5FR2A 4XD7D 4QFMA 4B47A 4NPHA 5AUOB 4WXPA 2ZJZA 2AFIE 2OLKA 1NRJB 3LV8A 3B13B 2XZPA 2QMOA 1NY5A 2G0NA 2W2VA 1CBUA 2L0XA 4PC3A 1U8YA 1E2DA 4JLDA 3WYAA 1IOZA 1F60A 3VMFA 4UXHA 1QVRA 2JDIA 1OH8A 4JSYA 1TNDA 5KPJA 1E2LA 1HA3A 3LNCA 1YZTA 1KI7A 4HAVA 3EX7C 3Q5EA 1E9EA 4KVAA 2QENA 3L0PA 1AK2A 4DSTA 4P31A 3UWOA 3L43A 3AV0B 3QXXA 2I4IA 2WKRA 4BECA 2BKUA 1Z6GA 4PQFA 4Q9HA 3O8CA 3MJHA 2IX3A 1OF1A 4I1OA 2X2EA 1S4QA 1GNPA 1OFUX 4AYTA 3V00A 3DKPA 4M8NE 4ZDWA 1E32A 1LTQA 4V0ME 1JNYA 1OKKD 1UM8A 2WWXA 3SJAA 4KXFB 2J45A 4KVGA 4CEJB 5GVSA 2LWIA 1SXJE 4ACAA 2HEIA 1XTQA 3THWA 4MGIR 4GMXA 2CVHA 3RRZA 2IWHA 3THYA 2ECKA 3PQCA 3TAHA 1KK2A 1XNJA 3VHXA 1OYYA 1MO5A 2AWNA 1E96A 3MMPA 2V1UA 2WJIA 2J1LA 2F3RA 1CR4A 3C41J 4DWJA 4O25A 5L3SB 2JLYA 5CLLA 3KTAB 4DC9A 4HI0E 2IYZA 1H8HA 2FV8A 4B44A 4DLUA 4NYJR 1WRBA 5HE9A 2PLFA 1G7TA 4Q7MB 1QG4A 4AI6A 3OEED 1E2GA 2V6JA 3F8TA 3H1TA 5JS8A 3MCAA 4QC2A 1E2KA 1EFRD 2FJUA 4G5SA 2WSSA 3U7EB 4HDCA 2FMXA 3T12A 3OIWA 1HH4A 2ZSDA 3QG5A 2C96A 1G4UR 4MGYR 2JJ1D 5SZIA 3NTUA 3BWDD 2XOKA 2I1QA 3QF4B 4CIDA 1XJCA 3PENA 1OJLA 4BZQA 3LA6A 1X1SA 1KZ7B 4Y0AA 1H65A 1Q20A 1EWRA 1VG8A 1W5TA 2IF2A 3VX3A 4B74A 2F9LA 4LV5B 2QUZA 2GVZC 5FBQB 3GCGA 5FOXA 4B35A 2O8BB 3QPUA 2V3CC 2PCLA 2JJ2D 3KB1A 3FKSA 4MA4A 1ODFA 1YZLA 3HR8A 3CWQA 1XZQA 1AKEA 3P4XA 3LO5A 2RGGA 3O8DA 1KKLA 2ZU6A 3Q9LA 4HLDA 1Q3HA 1K5DA 4HAWA 1EFCA 1G3IA 1WMSA 2P67A 1BMFA 3NEYA 4RD0A 1EG7A 2G88A 2ZM5A 1SXJD 2CL0X 2W00A 2UZIR 5G41A 3DM9B 4XVQA 4ASUD 1ZM4A 4B2IA 4HB3A 2RB4A 3DM5A 2OFXA 4TN1A 2IA5A 2NZJA 3NC1C 3H86A 4CYMA 5HCNA 4DXAA 2CNWD 2C9YA 4XTCS 2J0QA 4M53A 1BKDR 2A5GA 3K70D 4DT1A 2JIZD 2ZR7A 5KSYA 1Z0AA 4URUR 1KNXA 2FGJA 4JL5A 3R9IA 4YXWA 2NMVA 4KYUA 3A1WA 1N6NA 4Q4LA 4O3MA 3ZGXA 4PTLA 2H16A 3AP3A 2QP3A 2ZRHA 1ZRHA 5G40A 1GG2A 2D2FA 3AGQA 3W6NA 1RFLA 2VYFA 4A0FA 1P2SA 1SKQA 2EFCB 4EFLA 3J81k 2VL7A 2DFTA 2O5VA 2P2LA 4DLZA 4BZPA 1XTIA 1UADA 4QM6A 1X6VA 4NYJQ 3UWKA 3IDQA 1Z0KA 1L4UA 4US2R 1XPRA 1Q21A 1KTVA 4P4UA 4CZ2A 1FX0A 4IEEA 4JLAA 4CVNA 1X8KA 5J4LA 3JZAA 1ZD8A 4BLQA 1XFAA 3P1JA 1OIWA 1PLJA 3Q85A 4P3YA 1W0KA 3LX5A 1OLOA 1QDEA 1ZNYA 3MWLA 5LB2A 4AKEA 3NH9A 5FTLA 4WA7A 3DMNA 4CEIB 3SBEA 3T61A 1YVDA 5F9FA 1XJQA 3L8YA 3U6KA 3AB3A 2DR3A 4X8LA 4PC1A 1DG3A 5CK4A 3GLGB 1VCNA 5EJEA 2O8CA 4GL2A 1AS2A 2IK8A 1OIXA 3PEWA 3M1IA 2ZI5A 1PUIA 2O8FA 1TMKA 2P5SA 3WNDA 1QHNA 2FZLA 4JBYA 2AKAB 4LHVA 2R6CA 3IQWA 4KBFA 3WMEA 1U0HC 2ZRDA 5CM8B 4HLUA 3TVTA 2UVQA 2D4HA 2W6JA 4KFRA 4OK6A 5CITA 3QUSA 4L5BA 4E07A 3QVVA 3RS0A 3TRFA 3NIBA 2DFLA 4A92A 4MRPA 2IEZA 4B3FX 5FOUA 3LBIA 4C9BA 3ND9A 1D9XA 1N3BA 1U81A 5TXGA 2D2EA 2IEYA 4B6FA 2FOLA 4P0TA 4OQFA 3TBKA 1YRBA 4LUCA 2VP2A 3TH5A 4JLKA 2R8RA 4LCBA 5L3QA 1Q22A 5CDFA 1DAGA 2GNOA 4UJ3A 3TE6A 4OKSA 4BFVA 2B21A 2CJWA 2FNAA 4TWZA 4Y0VA 3EPKA 2Q6TA 1N5JA 1GRQA 2X19A 4OK3A 1T8TA 2GXSA 5FUYA 2ZAMA 1M7HA
chains in the Genus database with same CATH superfamily
4LYAA 4C04A 1XFDA 3Q1KA 4PONA 4CG1A 4DM4A 1ZONA 1K8ZB 3NHRA 1D0IA 1KK1A 4MS1A 4RIGA 4YV2A 1F17A 3VHLB 4TKVA 3QKSB 1CS0A 2JHCA 4PSCA 1VLMA 5HQ3A 1LTHR 3A04A 3R3UA 3CZ5A 4X8OA 4K0KB 4ZQIA 2FWIA 2HZBA 2J4DA 2XF2A 3LBFA 4F06A 3IEIA 4ND3A 2VH2A 3LJKA 1A9RA 3RAPR 4LRWA 3KQOA 1L7XA 2DCUA 4RZHA 2QGZA 3O91A 1C9EA 1E1YA 2WV9A 2WZDA 3DKKA 3E7WA 3I32A 1W1WA 1ZGZA 3C24A 3P7MA 1N7JA 5KYGA 2W4MA 2VJMA 1WDTA 2I67A 3EUAA 3QHQA 3SZLA 1B16A 4BQNA 2ZJ5A 5LLDA 2B7BA 2ZETA 1RZRD 2NPIA 3KQMA 3A9CA 4GXTA 2IHBA 3LUKA 4JGBA 4TMXA 3IUJA 3PPWA 3WQQA 4EG4A 1WZ2A 4J0KA 3NBFA 3BQNB 4P3KA 1BW9A 3N3AC 3I1IA 2GPJA 2Q27A 3BXPA 4YY3B 3GQBB 5KNBA 1X1RA 3R7WA 3SFTA 2TMYA 4ENVA 3ZZMA 5B12A 2V9ZA 2AG8A 1TUEA 1XCPA 2Q5QA 5TGZA 2DFKB 5H81A 1RP7A 2WLTA 2Y2UA 1R6TA 2FVYA 1CYDA 1GAQA 3W5HA 3AIMA 4UD2A 2YWGA 1MX1A 4D41A 4C43A 5IXJA 1IHYA 1JT9A 2BIFA 5I51A 1GRCA 2WT9A 2OMEA 5KWJA 3JQ7A 1AQUA 4XD2A 3MXTA 3BBLA 2BTOA 4B6EA 1KBZA 2HRRA 2PGNA 1XCMA 2ZR8A 2JA2A 1SCJA 3LS2A 2R5FA 1RHUA 3R1IA 3T7TA 2EX4A 3IRVA 1B74A 4D5GA 3NHBA 3T3PB 4NEQA 3PFHA 1LWNA 4Q18A 4YP7A 4GNKA 2O0KA 4CEHB 1K92A 1QIEA 3TRKA 1NASA 3I8XA 3DKRA 1C9KA 3PGKA 3I8SA 4LK2A 1XROA 1UMKA 2K6GA 2ORWA 2QVLA 3C8DA 1OX4B 3E9EA 2OVFA 1O7JA 3A11A 4DS3A 1QAOA 5AUPB 4C7VA 2A3NA 1J8MF 1QANA 2KSQA 4X6UA 5KCZA 2PE5A 3WLEA 3R20A 3T3IA 3L8DA 3NG1A 3K0AA 2ZSFA 1IUKA 3DB1A 3OT5A 3LKVA 5FUBA 4LQCA 1MEJA 2RHCA 1ICEA 3WIUA 5C1BA 3MMXA 4GOLD 3VU9A 4ZMRA 4FYKA 1YZGA 4UTNA 2I3AA 1QTNA 3N8GA 1FW8A 1XN1A 4C7OB 1Y1QA 4S04A 3QVUA 1WM1A 3A2LA 3SLRA 2AG0A 3DTVD 2CLOB 2PS1A 4KQWA 4H2DA 4GI1A 1MOPA 2O7QA 4KXNA 1XWIA 4PHHA 3W77A 3QXJA 2Z3ZA 4G0WA 1CNMA 5T4EA 4GKAA 4IDCA 4FNAA 1KY2A 4PHTA 4N0MA 1BXKA 5G0WA 5FPSA 2PZFA 4DNOA 1O9GA 3QELA 1VPTA 1JTFA 3KJNA 4AY3A 4EVRA 3BHJA 4KE6A 1I9GA 3S4YA 4E5DA 4U7PB 5ICSA 4RLHA 3P9CA 1V1JA 1X1AA 3ST7A 1GZDA 1UXOA 4AJKA 4AMZA 3O9ZA 1ZD4A 4YXFA 1Q0UA 1BMFD 1NG1A 2Z8YA 1P3DA 4K03A 4DM3A 2XE4A 2QSYA 1CUIA 1VSVA 1LA2A 2W6PA 4FZVA 4JEUA 4KOAA 4EYEA 1OH5A 1U2DC 5CTJA 5CXQA 1ZOSA 3P45A 3K1AA 3ZBUA 4B33A 4B2YA 2FHPA 1RXYA 3TSWA 1H2BA 1W2GA 5F2NA 4DDKA 3MINA 5BNZA 5LMCA 3GN1A 3GT4A 3L0ZA 5LQSA 2LKDA 1WUTA 4KXLA 4NHOA 1YQDA 1CX9B 4UD6A 2CEAA 2E5FA 5DPMA 4CT5A 4MROA 2ZIVB 1R8JA 3T7SA 3U62A 1GA6A 2OEPA 4CU5A 3MS7A 3PL5A 3WK6A 3GLFB 2PBLA 3QU4A 4N41A 3PCRB 4ZI2A 1N8NA 1GAEO 1G8KA 5AK4A 1Q7GA 5ERXA 3M3DA 5CDGA 3PXCX 1IN5A 4RGBA 4PRKA 4MI1A 3T7IA 2H9IA 5D86A 5KYXB 3EULA 3PX7A 1UC9A 3DNPA 2XB2A 4C6HA 2NNLD 1X7YA 5CM9C 1RMQA 2C5GA 4PX5A 1A1VA 4EAQA 1VYVA 3F3KA 4C4YA 3HVRA 1QJ4A 2P2YA 3MERA 1DT3A 1TPZA 5C8XA 1TEZA 3UWSA 2O2CA 1SQ6A 2HLHA 4IY1A 4DUYB 1MA0A 2ONYA 2RARA 3EOBI 3WOVA 3LRXA 1X80A 5BWOA 2YDYA 3VISA 1YOVB 4ZYXA 5AJZA 1WO8A 1AKNA 1KYYA 1BCSA 1XB2A 2JJQA 4QO8A 4AJJA 3OHSX 3DFUA 1N6KA 2A0XA 2Q2NA 1V5GA 3BHIA 4MUEA 4ARZB 1TU4A 2A5YB 2YJ6A 2DVMA 3GELA 3LHIA 4BKPA 1A50B 2C7BA 3JQBC 2GKGA 2IEAA 1GQQA 2WMDA 3NBMA 2W6ID 3ORYA 3R41A 4HQ0A 4JU8A 5JALA 1E5LA 3S5JA 2QOEA 1P5ZB 2IPMA 4OSEA 4YK7A 2I3GA 4MLPA 1FTWA 2WAMA 3KP1A 1VJ5A 1WB6A 4B5LA 4P1ZA 3P0EA 3D3KA 4G8DA 3JQGB 3MD9A 4ZVPA 3TM5A 4HS4A 4BU1A 2WD8A 2NSJA 4Z9AA 2ACKA 2GTPA 2O3RA 2PJZA 1UWLA 3AL2A 3CMCO 4JEMA 4V2UA 5EHNA 3F6EX 3U40A 1SKMA 1I7QB 2ZJOA 3F6CA 1U98A 1YUNA 3JYQA 3MJSA 4JZKA 2Z8YM 3WVNA 3O9VA 3B53X 1UDXA 1PTJA 5ITZA 1RLJA 5DH9A 4PAQA 3TK1A 3H83A 1DC3A 1NM5C 2KS6A 2M6RA 1IIRA 4MS4A 3L9XA 2J9YB 1CRPA 3DZDA 4XGQA 3A06A 3ABQB 1KJZA 4OLBA 3IQDB 3D4BA 3EGIA 5JHHB 1DS6A 2EW2A 4MX8A 4BAGA 3BWVA 4TLCA 3RVJA 2PG3A 3F3MA 3U7GA 2DG2A 2FMHA 4JLJA 2QM7A 3RG2A 3OMWA 5LOVB 2I2AA 4HJRA 2OC9A 4CM3A 3DFKA 3MTJA 2QPOA 3ZS9A 1ZISA 3UICA 2RK4A 1OXUA 1P4GA 4Y2RA 2I4TA 3HKCA 4NPCA 4IOLA 4IHJA 4J6FA 4C5CA 4CTMA 3BAZA 4A8HA 2G17A 4J0FA 2DT8A 2VQ3A 3NALA 4BQRA 4CTKA 2IDMA 5F77A 4CM1A 4IIGA 4CMIB 2Q0HA 3NTVA 4XR9A 2JFHA 1O2DA 4HH3C 2ZI7A 3IP1A 3MG9A 3D0RA 4HJXA 4P2GA 3L18A 3R0VA 1A2KC 4GX0A 5BRAA 4I9GA 2BLLA 4MEAA 1FNBA 5DI3B 1NUAA 5EJ9A 2G8LA 1DELA 3SXJA 1M76A 1GVNB 5CDUA 5AW2A 3QWAA 3LT1A 4N9WA 3ROXA 1T2FA 1XDBA 1BIFA 2P41A 4W7SA 2IYXA 3HXKA 3VMMA 1U8XX 1UPTA 1YFZA 1H69A 3A4TA 3KR1A 1QVZA 2AEFA 3MMNA 4AKSA 3SVZA 1YF3A 3DE5X 2XQVA 3OZVA 2SKCA 1AGNA 1B6TA 5LZ4A 5GINE 5HUQA 1RPJA 2CLHB 1F8FA 2H08A 4K88A 4JR2A 4EAAA 1T4BA 1U7XA 3FBWA 2QNRA 3MUEA 1IY9A 2RHHA 1TI7A 4INZA 3IDZA 4LXUA 2RJ3A 2OBMA 5JQGB 1UODA 4WCFC 5FI3A 3K2IA 4JNCA 3UN1A 1YS1X 4ZGBA 3L1JA 4JKOA 3DR3A 3EOZA 4MQBA 5JD3A 4DZTA 2VYND 3N58A 4UNSA 2QN7A 1XR3A 3PWKA 4W5HA 4UMVA 1U2SA 5TQJA 2IBSA 2ZJFA 3MBIA 4K9RA 2WPDA 5CNJA 3SMQA 4RPLA 1D2EA 2XMZA 3OF5A 2VK8A 1Q0SA 5CVTA 4YREA 4Z9FA 2VNIA 2WHRA 1TEVA 3ZJYA 2ZJ0A 1QYVA 4HH1A 4D57A 4TTTS 3NZEA 4ZPJA 3Q2KA 2JGMA 1DT5A 1G4HA 4QPJC 1DHTA 1ZY2A 2BRUA 5DHUA 2FA9A 3BDIA 1EGQA 3AZPA 4PF1A 2PUCA 5BN5B 4QT0A 4ZHQA 2RKWA 4IDNA 1KDTA 4OO3A 3ONDA 3MLAA 1JR4A 3HJFA 4M0UA 2W5UA 4RSMA 1RJDA 4KAJA 2C59A 5D87A 1J0BA 3EVBA 4GWKA 3HXQA 3I9V1 3G2KA 3EQZA 5B2ZA 5PNTA 4KO8A 4TRJA 2EFGA 3CZPA 1ZLYA 2UZ3A 1KEEA 2YS6A 4M1MA 4Q4JB 5F4ZA 4DBVO 4AUEA 4FOLA 1ZUHA 2CMKA 4EF4A 3RM3A 1V2HE 2L2QA 4MB0A 5HIKA 1IIBA 1VL6A 1CT9A 2SNIE 3DDCA 3K2QA 5J43A 5K8VA 1YKGA 3DAFA 4WNAA 4M0PA 1TMYA 3I6YA 3ZU6A 3EH1A 1PNQA 3BGDA 4BYGA 3FVRA 4TKUB 1ZITA 4BB0A 1R9GA 1AO0A 4KMSA 1O97D 2XIQA 1ZGHA 4EUHA 3M4XA 3IOCA 1NXTA 1T9HA 4U7HA 5BQ5A 3A4YA 5JYBA 4GP7A 5DMXA 2OO3A 2HGZA 1ZI9A 4JEIA 4M1WA 2CFRA 1JJIA 1CJTC 3GJ4A 2WY2D 2B82A 4HAZA 3CZAA 4W1RA 1I14A 5DYWA 1NVBA 2PMWB 4RVHA 3DAYA 1S8FA 3C6ZA 4H7HA 1I0ZA 3DBHB 3FUTA 5DW3A 3GPLA 1JHRA 4DCSA 1MAAA 3ZUPA 3WP0A 1J23A 3P0RA 4NFLA 4HWPA 1I6LA 3NM6B 1O95D 1XZLA 4Q1CA 2IKSA 3W3AD 4D9IA 1O0CA 4NYMR 1OYWA 1ZR2A 3WJ1A 2PSJA 3EXAA 3OQMA 4GLFA 3R3YA 1JQKA 1U6JA 2X40A 3AI1A 2XCRB 1R6UA 3GJ8A 5IU6A 2DY1A 4RS4A 3WB9A 1RQ7A 4IH4A 3GK3A 2OXIA 3ZNQA 4GXRA 4LRXA 5ALQA 3R3ZA 5G3YA 3TTYA 1ANKA 2C2MA 1YK1A 3FLEA 1ID1A 5K05A 5K0FA 3U09A 4QXOA 4AF8A 5C5CA 1QBKC 4ZZ1A 4FIZA 2ZBEA 2DLNA 1ZK0A 4ZCPA 1LF5A 3PUYA 1OA1A 3TQTA 1YC5A 4B3IA 4YLEA 1DXQA 4MQUA 1NLMA 1EWVA 2PNFA 2ZXEA 1RKVA 5T4BA 2VSYA 4N01A 4HXEB 5JAZA 1K08A 1E18A 2IXDA 4I19A 5L6LB 4NLLA 3ZU5A 3EBPA 4ZCRA 2C77A 3FHCB 1HFJA 4YDHB 1RXIA 1SHUX 3VZPA 3Q2IA 5JHGB 5L4LA 5JU6A 2ERCA 2YYSA 5DGHA 2XUPA 3D1LA 4G5FA 4RW0A 1VKZA 4ZTBA 1G8MA 1MC4A 4N5LA 5LP6F 2WW8A 3WRWA 1VL8A 1T5HX 2R6R1 3QSGA 2ZBQA 4EW6A 4LYGA 2G80A 2CXQA 2JH9A 2B8TA 1NOJA 1Z4JA 3PDIB 5HFAA 5H9VA 5KJ6A 5KYTA 4A8TA 4Q16A 5HF8A 4D43A 1F8GA 5EHIA 2OXEA 2M32A 5GIPE 4UMEA 5JYDA 3ZS8A 2BI8A 2XDWA 4MH0R 3VC2A 3UXEA 4LRYA 3A6ZA 4US0R 3LH5A 3KYDB 1Z73A 4NXNB 4JBXA 3SHOA 3ESQA 1BAPA 4L15A 1U8AA 2ZG6A 4J94A 3VZCA 4D1YA 4EBFA 3LGXA 1IQUA 2HMTA 2ID4A 2YN0A 1D2GA 4KFCA 1G64A 4F5YA 4C30A 3D2LA 3TLMA 3DXZA 4JI5B 4EYSA 1WCXA 5HOQA 4OAPA 2PD4A 1ZRSA 2NZ2A 1DQSA 3JATA 4LK3A 1IULA 3HHPA 4A23A 2XWJI 3I6QA 1LBQA 1PNOA 4AMVA 1LSJA 2ZIFA 3BBPA 3ZNPA 2IOHA 4GOOD 2PGJA 4UBLA 1UAGA 3QPVA 2NU7B 3P2KA 5I9TA 4TWAA 4CEJA 2V97A 3NFYA 5EE0A 1U0JA 3N3BC 4QU5A 4LVUA 2L17A 1U7WA 3B70A 1B8VA 1HDRA 1RQXA 2C4VA 4LG1A 1SQFA 1GG5A 2SECE 2VZ8A 4IIEA 4NR0A 3OAAA 3FJOA 3EC1A 1RAGA 4R83A 5KNDA 4GOKA 5CB4B 3VDNB 3NRCA 4UBNA 2Z09A 4I66A 2GZHA 2K7FA 2Z56A 1G0NA 4HDNA 3I58A 4PS1A 2CE7A 4PBRA 1QQTA 5M2QA 5JWRA 3OLWA 5KDLA 4EUFA 5L3SA 4KHPB 3B6KA 4NYMQ 4AYXA 4KMMA 4OMFG 4D4GA 5KYWA 3KAPA 2OPHA 2PTGA 4H9GA 1JEAA 2DCMA 3H9BA 4O59O 5BR8B 1Z82A 2IHNA 1R0BA 3EXEA 4GR5A 5A4JA 5HJ5A 1KDVA 1JEOA 2JFOA 3QLUA 2ZULA 4X1IA 3FNQA 3HL0A 3SD7A 4RZQA 4WFQA 1NVUQ 3H42B 1WDWB 5E7JA 2I4LA 3OQHA 5DM60 1R9MA 4KFSA 2AHOA 5KNLA 4BV3A 1PJQA 3GHYA 3ZIDA 1DBVO 4WLVA 1IBKB 3FPKA 2C3UA 3TLAA 4FFDA 1MO4A 5KDOA 1N77A 4C4RA 4A2CA 1Y6RA 2I2BA 2R66A 1W73A 4C0LA 3DTVA 3U5TA 4X65B 1QRSA 3HB5X 1NLFA 2Y9MB 3G2HA 4UHKA 3URKA 1QH9A 3ZLVA 4GT1A 2FUCA 1JIUA 2PS9A 5DP2A 1NBAA 2GN6A 2WT4A 3QG1A 3ZXXA 5JJIA 1U7TA 3TLGA 4ZRMA 1FP6A 1G2PA 2BCEA 3U3KA 2WMOB 4Y1RB 3AY6A 2BR3A 1ADGA 4GEKA 4C7XA 1QRUA 3BHNA 2J9XB 1VPEA 3HYTA 3W2GA 1KMMA 1N6PA 3KFXA 4KDFA 3B6EA 3FOZA 1IEVA 2I6QA 4IVQA 5ERGB 5K4AA 3PT9A 4BTLA 5I8PA 5H70A 1GNVA 4BMXA 4QBHA 4BFZA 2Z9CA 5FOVA 3O8BA 3RUIA 4RH0A 1DNPA 3U39A 3AVWA 1ENOA 3V1KA 2NQ8A 1GSIA 4RY8A 3ROQA 4E5KA 3EXFA 3JVVA 1Q0PA 3W4KA 2NWQA 3KPYA 4H7KA 3UYKA 3PWSA 5FL7A 3ZU2A 4I1UA 4E4RA 5MN4A 2C83A 1FTGA 1C3LA 4EB8A 1BS9A 2YYAA 3OF3A 4OXYA 2PUEA 4MR8A 2XMPA 3QMVA 3RWOA 4Q02A 3Q11A 2H2WA 3Q7SA 5HMMA 5E2BA 3FHJA 5KB3A 5T8KA 2C00A 3EYAA 2A84A 1XAHA 3UMMA 1N34B 1L4YA 1XU7A 3C7DB 3QEJA 2E21A 2NO0A 2RG1A 2GEVA 3EZ9A 1AB5A 2BN4A 1ZS9A 1FB5A 3DHVA 5TPZA 1ESDA 3AHGA 3BMCB 4G36A 3WADA 5JCXA 3G0HA 3AIKA 3TIVA 3L6EA 3IJPA 5UKDA 5ICCA 3KETA 4WKPA 3JD4A 4HUJA 2CBGA 1TYAE 2JHPA 5E7MA 3E82A 4JSTA 3NJ4A 4BU0A 3HLYA 2EF1A 1W29A 3O2QB 5TQ2A 1NY6A 4RELA 4XOUA 1L0BA 4UBIA 1XP8A 3DBRB 4OQQA 3U7IA 2HJSA 1RQPA 3M81A 1RZ3A 1Y3DE 3A4LA 5C3MA 5EXSA 5DTIA 2FZ5A 3RS8A 5EXEA 4G0MA 1VKRA 1FVOA 5EP3A 5C2JB 2CLCX 1DG9A 2QGNA 2HH9A 5CBPB 5AD1A 4XVUA 1KC3A 2CL6X 4B7CA 1KIMA 2C8VA 3QH4A 3VZRA 4FHFA 2PR2A 1X15A 4EB3A 2HA5A 1UZNA 4YCSA 1UOPA 4ES6A 1BU5A 2W6IA 1NXXA 3L07A 3GL9A 5D2CA 3KHSA 1Z4LA 4IJUA 4CLOA 3DD1A 2GN8A 2FPIB 3IXMA 3GFPA 4QX6A 1ABEA 4U2KA 1YZNA 2D2XA 2NPFA 3BL8A 2X9LA 5DNWA 1HKUA 1P2UA 2Y77A 1P9LA 3RSZA 2Y0DA 3BM5A 4O4JF 2DKNA 5KYKA 2I8CA 3GN2A 2HO5A 3PPIA 1V26A 3ENQA 1U94A 2VRBA 2RG7A 3FTDA 3EQ6A 1TCVA 1RHJA 1J21A 2BGUA 3K0HA 3TB6A 4ZVQA 1PT7A 3I6ZA 2HRDA 3RQSA 2QAJA 1JXOA 3I83A 4JOCA 3EY4A 4HYYA 5HS4A 4D0LB 3CF0A 4FZRA 1DAHA 1FFXB 2PBRA 2Y0CA 3DHNA 3RBVA 5JJLA 2FFAA 4KPGA 1Z74A 4XPZA 4FUTA 2C0QA 3LFHA 1CB0A 5ALKA 1Z26A 4HSGA 4EPWA 3GLGA 3KQQA 4MAFA 5B3JA 3AKYA 3CO0S 5IABA 1EFAA 5BT9A 1CFZA 2JLQA 2YWDA 3RJ9A 4RPCA 2Y66A 1DU4A 4BNJA 1BVUA 1F8UA 4EZBA 3SLGA 2SKDA 1YJQA 2RIRA 4OGFA 1LBTA 1A2BA 5DJ5A 1C0IA 2Q3MA 4RXUA 4Z7QB 2II6A 3ZDFA 1L8QA 2A14A 1RM5A 2JD1A 3Q72A 4FM9A 1GY8A 4E22A 1HT2E 1WSDA 2VSXA 3I2KA 3O8LA 2C95A 1P9RA 1NW8A 3W79A 2YMPA 3HA3A 3DOEA 2ZBDA 4XM0A 4YASA 4HUQB 2QAGC 4MINA 4UM9D 1EP1B 6YASA 4NBWA 1JZQA 2F3TA 2B5OA 2XTJA 2AOVA 4IHQA 5B58T 1AXGA 5B6PA 4S05A 1EH5A 4BAZA 1OFUA 2RCNA 5GWXA 3CRMA 1W5SA 2V96A 2FPSA 1OFVA 2XSZD 4NBSA 2CVFA 3BQMB 3IGFA 3T5AA 2AB0A 3EFEA 2H1OA 1KJ9A 2AK2A 3F5SA 3WGKA 1FP7A 1NNUA 2O2IA 1UJ4A 3BMOB 1ECJA 2EW1A 2P62A 1TCCA 4Q03A 5AJHA 2OSVA 2QDXA 2Y67A 3N7AA 1HFWA 5J1TB 4MQLA 1PW5A 2WYIA 1LDBA 1YB2A 3KU4A 3SQNA 4Z7JA 3GRRA 4BX3A 4ENTA 2ZWMA 4KE9A 1NW5A 3SOPA 5GJVC 2JCSA 4HFJA 1DQZA 3U0BA 3QPAA 5J2UF 3V9PA 1MC5A 1Z4IA 3GT0A 3JWEA 5HGJA 4NCJA 1V47A 3TIGA 3HJCA 1YA8A 3BMXA 3H1PA 4Z0HO 5JBQA 3I30X 3FPSA 2VYNA 2UUOA 1I6KA 3WGQA 1GNTA 1LSUA 1WXQA 2AJ8A 4R68A 4F97A 4Q7JB 1V5WA 3FNEA 1N5RA 2O8DA 5ULLA 5FJJA 1G8SA 2YMQA 2W0MA 4CIBA 3ML1A 4RFSA 1FY2A 1XD2B 2X14A 1D2HA 2AD1A 3MILA 1K5PA 3GNQA 1NJFA 2C1XA 2KYRA 1BQEA 1WXDA 1UOEA 3T1QA 3SIWA 3ZDYB 3ZCSA 1IEWA 4MW6A 2QUAA 4YQEA 3CXUA 4PHGA 1JFLA 4JJFA 1LQTA 4ID3A 2IW1A 2JCGA 3DZJA 4GBGA 4QULA 3AKEA 5NULA 1HYQA 1U99A 5T57A 1C50A 2B8WA 4IO0A 1SG9A 4BS9A 4E88A 5JRZA 3EPLA 1NQAO 4TVOA 3EUFA 1XCBA 4JFRA 4Y1FA 3GP8A 2XYRA 4IDPA 4ZVTA 4UCWA 4C2BA 2Y8EA 3W5DA 1LDGA 1WKCA 1K8YB 2VAWA 1NUHA 2IODA 3L41A 4FT2A 2X77A 4JGGA 4GR4A 1ZXBA 5FI0B 3EAFA 3UV3A 3WXMA 1G21A 4LMBA 3OPXA 3PWTA 3S0JA 2HJHA 3SQOA 4JJGA 5JY6A 3OT1B 3T1VA 3G8DA 4NECA 4QZVA 2ASVA 2GSWA 2QE6A 4HNVA 5A9SA 3SNKA 3MVEA 4FLEA 1R0XA 2EFHB 3LFTA 4J29A 4CV2A 4NK5A 3VA7A 1UJNA 4EJSA 1I4OA 4OG2A 2R44A 1ABBA 1V4NA 3E9CA 4OBEA 3SYLA 1JQAA 3GFFA 3TBFA 3VYVA 1NXPA 3RWMB 5KQSA 2IYQA 1D0VA 5A1JA 2IGTA 4RVFA 1OH7A 2V6MA 1O8BA 1YB6A 2HRBA 5TMBA 1A3CA 2PUDA 1XD8A 4WFIA 1NVWQ 4AZVA 1SHTX 2QW8A 1E0JA 5EIHA 2XJ4A 3I45A 3NIGB 2A30A 2R8EA 4ICIA 4GQIA 1O95A 3PQ8A 3W3AA 2OXRA 4RH3A 3RK0A 4Z4QA 5KU7A 1IBMB 5ALDA 1X74A 1Y9DA 2Y0EA 5JPDA 4Y6GB 4LGVA 4F8JA 3FMVA 4LQDA 2AJLI 4PSAA 1AZTA 1M1UA 4LZJA 1GG9A 1FSZA 2HMYB 4LZWA 2FPWA 1KO8A 3CNOA 1DAPA 1PBNA 3HADA 3IKVA 3UAOA 1J2TA 1WU8A 2XADA 5EE9A 3AP1A 1NZJA 2FUG6 3OBIA 4KN5A 4IV0A 3OURA 4E2WA 1KP2A 3REQA 5JISA 3RNOA 3D7KA 4JI0B 4DPMA 1I7NA 3AINA 3L5KA 4ZYTA 1NVKA 1PT9A 2ACWA 2DWCA 1OROA 1PJZA 1FQKA 1DQNA 3VU0A 1VE5A 4YNBA 5A6SB 1YFJA 1UDRA 3KZKA 2O2GA 4KXXA 4X60A 1F4PA 1EK1A 1G5FA 1BDMA 2VDUE 2MSCB 3D6UA 3FMOB 3D7NA 1M0WA 2ZJBA 4FDMA 3CZ9A 5JXWA 3AR6A 1W75A 2W11A 4KMOA 1I4TD 1KXJA 1MU0A 3EHDA 4HEA1 7REQA 3T7AA 3PUKA 2QR3A 3DZFA 2JD0A 4KO4S 3S40A 1NKVA 3VVMA 1OTHA 4LF8B 3D2CA 1WOMA 4BB9A 2OG1A 4HF7A 2EZ9A 5U4QA 5L7TA 4ZI7B 2QN1A 3SJ7A 2QN8A 4G1EB 3GH3A 2JG3A 2JA1A 5EWJB 4FYYA 2PWYA 2R5WA 4AWAA 4TGLA 1MF7A 2ZIAA 4F46A 4YV0A 3ECCA 2WFMA 1VSTA 4QYIB 4DSUA 3DMGA 2E4WA 2ZJ2A 4K9LA 4LBVA 1A8PA 1JUDA 1QBGA 7YASA 4L51A 4Q9JA 1DG1G 5JWHA 1TT7A 4JUCA 1AKUA 1Q92A 2OBXA 4G9GA 5HTKA 5A7FA 3KTOA 3QPDA 5E6UA 3GRFA 4LGCA 3M8KA 2QD2A 5AH0A 2ZJYA 1Z9BA 3O93A 3WL5A 4OQ4A 5L7WA 4DQLA 3UPUA 2Z04A 3HI6A 4WXYB 3TQQA 3KLOA 5GJBA 4BO3A 1AD2A 4CUZA 2RGDA 3FOEC 1V7CA 5H3HA 2AW5A 3HM2A 2B78A 2QW1A 2H57A 3KUUA 1NPYA 2PMEA 5A5GA 2V59A 5J47A 4AJ4A 1SVSA 4YJGA 3H5VA 1DWPA 4IJMA 4KRGA 3KYBA 1S3IA 4ZXFA 4ETWA 3Q7PA 2P9FA 2XIJA 3V2IA 2RK6A 1E1MA 1TM2A 4A6PA 3DONA 3JRXA 5ESWA 1IONA 2H1LA 5I8WA 3DF9A 5FTJA 2AOUA 3BIJA 3FFWA 2ZSJA 3E9MA 5CXXA 4JJ7A 4Z7OB 3F7NA 5LB4A 4WFJA 1NFQA 1L5GB 3UB4A 1D7OA 1YJ5A 3O3OB 4JP5A 4KRFA 1P7CA 2B7CA 2J0VA 5F64A 3OJCA 1PTKA 1O77A 2OORC 4GPTA 1RZUA 5DOZA 2C29D 4QSHA 1GL7A 3DFIA 4RACA 3QWIA 4DCPA 5E2AA 4BZWA 4DMHA 1CP2A 3I05A 2YFYA 4EL5A 5CNMA 4KR9A 2ZEJA 5BMVA 2QRVB 3KOMA 4WXMA 1Z6ZA 3TW8B 2DBYA 2PA0A 1L8XA 1IC6A 1MABB 4O2LA 4ZVVA 4BFUA 4MVJD 2R1ZA 2BI7A 2YN2A 2V6FA 4NVRA 3BIWA 5LP1A 1GO2A 3JTMA 4E0BA 2CDRA 2AC7A 2COEA 2JAXA 1YSCA 2YCLA 4R2WA 3DNFA 5D3MA 4U8HA 3RVOA 4BKOA 1B76A 2AYYA 3V80A 1JIQA 3AVTA 1G8AA 3CLHA 1WQ3A 4PAWA 3LIIA 5C18A 3UJAA 4P4SB 1I3OA 2XKJE 1X0VA 3URMA 2A1UA 4L07A 1XRLA 5DWQA 5CAEB 1A97A 4GR9A 2CXSA 1NVXQ 2DFPA 2IXGA 3QXCA 1C4WA 2PWBA 1GZ3A 5D85A 5IT4A 3OCVA 4WKNA 2WC1A 4RIIA 2WTMA 2VJPA 1PWXA 1Y1RA 3B6ZA 4KK4A 4CM4B 3TLKA 2Z4TA 3VV2A 1U2DA 2PRIA 1EM8A 3TLJA 1X14A 2WM8A 2OZEA 1TFRA 4MUIA 3JVIA 3DL2A 4FWBA 3RVMA 4G5OA 4BX8A 3HV0A 3RR2A 3IAFA 3V3TA 1KMNA 3SMVA 1FW6A 3F1LA 4L8WB 4L0DA 2A35A 3GEBA 1XAJA 4B2PA 4B3MB 1OAAA 4K6GA 2LE0A 3JQDA 3P2JA 1NP6A 2QLFA 1KI3A 1KO4A 3OSZA 1JHZA 5G3ZA 3L82B 4MVWA 2MSDB 2YICA 1GPDG 3PICA 1CR1A 3SQLA 4K9PA 4BNDA 1VFPA 1EBFA 4B4VA 3UXYA 1E4YA 2WJYA 2AQKA 3HBAA 3VOTA 5IYZA 1X7ZB 4WOPA 1XMIA 4N8SA 5LP6C 1CEXA 3Q3GE 3WS7A 5IDQA 1LBHA 1O96B 1Q74A 1OI2A 4L73A 4Q00A 4ROTA 1N2ZA 1Y8RB 2HJVA 3I53A 5KSZA 3S2YA 1E4EB 1NX6A 4C0XA 1FUUA 1KR2A 1WDLA 2JPDA 3HSYA 3QKTA 1ST2A 4JI8B 3TKLA 1K6XA 1V39A 2FE1A 3AIOA 1GWNA 2IVZA 3DMFA 3OA0A 4YAWA 1WZEA 4ZI3A 4B8WA 4MCAA 5CP8A 4C01A 2FTKE 3MOIA 4E5NA 2YWXA 4LJ4A 1XMOB 3LPCA 3WSVA 3G2QA 1UCFA 3ZHOA 4DSOA 1SQGA 5JANA 1SVNA 3GLFE 4HATA 1L4FA 2XMQA 4PXYA 1USIA 3HDGA 1LNQA 1W93A 2D1RA 2NV6A 1NUPA 2NQTA 3GWZA 3JQBA 3KX2A 2C7OA 4DLXA 3ZH9B 5TMEA 1PWYE 3FOWA 1T25A 1IY0A 4DTCA 4MWCA 1RW4A 2GPWA 3SZOA 3X1DA 1K86A 1UPFA 3FFAA 3OMXA 3T4PA 1FTSA 4HMOA 3OZFA 5F51A 4C4ZA 3GNSA 3HA7A 3T1HB 3DEFA 3H0KA 3BA1A 3HSKA 4L2IA 4BAUA 1C14A 4KAAA 3RYIB 2GBPA 4RVOA 1LJUA 2X58A 2ZCUA 1T91A 3FGOA 4P32A 3SF8A 2IU3A 4IGFA 4NZYA 3UAWA 1XTTA 3BL5A 1OMOA 3M70A 1Z25A 3PWZA 1NM5A 4GLJA 2Y3IA 4L5CA 1IN6A 1P0IA 1YUMA 2W2NA 4WESA 4YO8A 1ZGAA 3AW8A 1YE3A 2FZCA 3I9JA 1A5ZA 1SK9A 4WMLA 2VUUA 2VBFA 3DMRA 4D26A 2JLAA 2XXAA 4R8LA 3QGMA 3WGLA 3ER8A 1DBQA 4ZIRA 3N0TA 1F6WA 1DMSA 4O4LF 5DGIA 1GPNA 4NZPA 4BMOB 5I7FA 1IM2A 2IZ6A 1IVYA 1L5SA 2IYRA 3K9LA 2WYHA 2WA2A 1LB1B 2YS7A 3P52A 4BJHB 4YAUA 5BOSB 4A5SA 2VSNA 1MW8X 1VHTA 1NT4A 2WWFA 3A1VA 2A9KA 3O90A 1E69A 1I2DA 5CDTA 1CXZA 2FRVA 2ETXA 4PV7A 2C8JA 2D1QA 3M3HA 4IGEA 1G0OA 3TIIA 1SA0A 5THQA 1SGWA 4Q1EA 5ERYA 5K3BA 1DRVA 4U9UA 1ETUA 3WQSB 5BNIA 1BEUB 4TVSA 3OC0A 2TMDA 2QBYA 3LBNA 1TLTA 3HYCA 3QBDA 4WXRA 2YVKA 4ZKDA 3B48A 4EY7A 3KVYA 1E3SA 3BMQA 1S2DA 2XRMA 3JYPA 4G63A 1T9AA 2O2XA 5SICE 4HDAA 5HF5A 1GCIA 1L5NA 2OYRA 3OUZA 3GG2A 1OXVA 2IYNA 4LOAA 3WYDA 2BMJA 4LY3A 3RSLA 3FI9A 2A5FA 3NEPX 1Y37A 2XZDA 4FOTA 1YNSA 2BCJQ 3WGZA 1ZPDA 1CCWA 4KRXA 1ILEA 2R97A 4IVRA 1SXIA 3CRNA 1KK0A 5T64A 1E99A 2P6NA 5HRUA 5CD9A 3GUUA 2OD9A 4I6EA 1KZGB 1E5QA 1W6RA 2BF7A 4LBYA 5KTYA 1C8BA 1V3QE 2PT7A 5AM0A 3OICA 1U90A 1KHHA 2CY0A 2G72A 3LUJA 4WCFA 3ZOZA 1BCRA 3IRUA 4RSHA 4IOKA 2V4ZA 5JXHA 3WFJA 2QL9A 4HDRA 1SIOA 2QZ9A 4WLUA 1E2HA 4U2DA 2BP7B 3QITA 2YL2A 2PRKA 2BOVA 3EC7A 4W6QA 1XZGA 4KQ6A 4C4TA 4N4AA 5DHPA 4K86A 3BB1A 3EQ7A 2HCRA 4HQFA 4JLUA 3D3JA 3OX2A 4GOXA 2ZAYA 3PA8A 1TIPA 3GJXC 4QJ4A 4TMTA 5FTKA 4EEKA 3A9TA 2Z6QA 2Y05A 4FHGA 1XEWX 3H9EO 2JHGA 2W83A 3HGMA 3BIOA 5JLJA 2YHUA 2QMYA 2MR6A 3M5WA 3HDHA 4RYDA 5DHQA 1ZMOA 5LA6B 3RHTA 1LLDA 2Q6LA 3B1KA 4CF5A 4PX2A 4YLGA 4KDCA 1A2OA 2B2NA 2YC2C 4QJ5A 2CLFB 4TLDA 3ASVA 5FWAA 4E33A 5CDSA 2OE2A 3IS3A 5CA0B 3K96A 1ORVA 4HYEA 4ZU3A 4WBNA 5LM3A 3FNIA 2Q49A 1D2RA 3AUJB 3VFDA 1QQ6A 3VSCA 2XV1A 5KOHA 3NWOA 1VKNA 5CG1A 1GTJ1 2VYQA 2IHKA 1DAMA 3QTBA 1XAGA 4F84A 1BDIA 3IUYA 4JUFA 3NHSA 1EINA 3BE8A 1MAWA 3Q40A 2ZYVX 4K2AA 4N5HX 1RRFA 3KXIA 4ZO8A 4AP6A 4YMUA 5L3VA 1CEQA 4GSYA 3B6JA 2V7XA 4D96A 3L6UA 5DTMA 1ACJA 2KW5A 3EK2A 3GAMA 4FGJA 1NG9A 3Q5DA 1G17A 3MTAA 4D8UA 3CUVA 3SX2A 4R1NA 2NP6A 5JNTA 4KQFA 5DYTA 1T5LA 2EBFX 1HDZA 3O7MA 2NSHA 2NLOA 3O4JA 2Z5GA 4O4IA 1IXKA 2PR7A 4QT4A 3KTAA 3KU1A 2IE0A 1XHFA 4V0KA 2YJZA 4ILKA 2NUAB 3SYRA 4CBVA 4EY3A 1UXGA 1GPBA 4XGRA 2XVYA 2ENWA 4NZZA 1OFIA 2D0PB 4OLAA 5FYQA 5CYPA 3VTFA 4KKXB 3X43A 1YQGA 1YCDA 4DAOA 2B1JA 4DQXA 3FAZA 1YASA 4LIPD 5LKAA 4Q9AA 2A0WA 2YNMD 2OOSA 4RKWA 1EKXA 4YALA 4AG3A 2J7PA 1ONBA 1ONNA 2AMLA 3D8UA 1QIGA 1YB4A 2JI8A 4URZR 1DC8A 5DWDA 4QQFA 3NUGA 3MCUA 4RF5A 1NDHA 4TMVA 1QR6A 4TUYB 3SEZA 4D4MA 1EFUA 1KFCB 2ZANA 5DO9A 3VKVA 3GIDA 3QF4A 3AVPA 3WWYA 1MEEA 4P7GA 5AVWA 3EGWA 1A7KA 2O1EA 1E4VA 3A7DA 3P9IA 4PPFA 4RK7A 1A98A 3EDCA 4I50A 4BO2A 5IJ9A 2E5LB 1UINA <