4DLXA

H-ras set 1 cacl2/dte, ordered off
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDEYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPase HRas
publication title Shift in the Equilibrium between On and Off States of the Allosteric Switch in Ras-GppNHp Affected by Small Molecules and Bulk Solvent Composition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 61
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2012-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4dlxA00
1JEEA 1WP9A 1BMFD 4A0GA 4D0LB 2YWGA 4W5JA 3E2IA 2GZAA 2QM7A 4BFTA 2CL7X 4DB2A 1N6PA 1GP2A 5EP1A 3BAFA 1LVGA 4A0FA 1KI2A 1XZQA 3FKSD 4JL6A 4R7ZA 4US2R 2VP6A 1G6OA 1KK3A 5C46F 4PC3A 3TLXA 4MRNA 2ZITA 4YXWD 3FHOA 4MRSA 4W5WA 1II9A 1X1RA 2CCJA 4BRUA 4M4SA 5JHGB 5CJPA 3L0SA 1HEIA 2RHMA 1GDDA 3O8RA 3AM1A 3AVXA 1ZP6A 1E2MA 4XJXA 4HLQB 4D0GA 1E2EA 5GJCA 1CR1A 2ZJBA 3NC1C 3U7EB 4QHYA 1R0YA 1Z83A 3I32A 1R10A 2IS4A 4YC7A 1G7TA 4URUR 1W4RA 4JLPA 621PA 1G18A 1XCMA 1WF3A 2FU5C 3OIUA 2X8AA 4MKHA 4KBGA 2VO1A 2JDIA 2QY9A 1E1RD 4URYR 3L0PA 2A2ZA 2BHRA 2REBA 5IHPA 4KV9A 5CYOA 3RANA 2XJ4A 4G5RA 3LW8A 5AJWA 3LV8A 5G40A 1EFTA 3K9NA 2D62A 3AQ4A 1OJLA 4DJTA 2A7QA 3GEHA 2GJSA 4BFVA 2PH1A 3M1IA 1JXOA 4YLGA 4B44A 2E9SA 3EASA 4ON9A 1QHXA 2J46A 2HEIA 3LBNA 4I1OA 4BLQA 1LF5A 3EC2A 4LJYA 2EFHB 4PQFA 3RLFA 1XEWY 1IOZA 4RY2A 4AYWA 1XXHE 2Z5FA 3ZQ6A 1RYHA 1Z0AA 4P3YA 5E7JA 2EFGA 2ZUDA 3BH7A 3QXJA 4KYUA 1NN0A 2X19A 2XITA 4RZXA 3EPKA 3ADKA 4WXPA 2C77A 2Q9CA 1M7HA 1XU4A 4BEBA 3TW4A 4EJSB 1OH6A 3QUSA 4B3FX 1R0WA 3PG5A 4Q9HA 1Q1BA 1P9WA 2XNSA 1MO4A 1Z6XA 4P4SA 1E79A 3W5JA 3T1QA 2JIZD 4ESVA 2FZ4A 4TMZA 2RCNA 3X1DA 4DCSA 2F43A 4QGGA 2IL1A 4XD7D 2P65A 4XVUA 5G3YA 1E9BA 1XD2A 4GT1A 5C18A 5JCZA 1NKTA 2B7BA 2J87A 2CJWA 3QKSB 1UEJA 3R9IA 3SNHA 4MUBA 5JEDA 3NDPA 2VHUA 2IF2A 2K5UA 1KI6B 2P5SA 4IDNA 2JJ2A 1E2GA 4EUNA 4QRHA 4J0QA 1WRBA 2YC2C 3REGA 1QBKC 2IYQA 1ZVQA 3QF7A 4TLAA 3IHLA 4F4CA 1D5CA 1J8MF 2MSDB 2QP4A 3DO6A 4Q02A 1WE2A 2BM0A 2ERXA 5DHAA 3AF2A 1QHIA 5CB6A 2J1LA 5JLJA 2KB0A 1RE0A 1XD9A 3TAUA 4UNNA 5FOUA 2QI9C 2AHOA 2YOHA 3KXLA 1DAKA 1TF2A 3BE4A 2C9YA 5CM8B 1E1QA 4Q47A 4PSKA 2PX0A 3ASYA 2NQ2C 3IBGA 4JLNA 4LCBA 4RFSA 2FE4A 4WZ6A 3K09C 4LSGA 4GI7A 2REXB 2CLSA 2BV3A 3AB3A 3FB4A 1JPJA 3QEOA 3K70C 4ZDJA 2ZIAA 3NEJA 3L2OB 3TE6A 4RKEA 1AZSC 1FP6A 2IXGA 1X8JA 5FR1A 1T4GA 3TUJC 4AYTA 2IYXA 3A4MA 2D06A 3ZQJA 5CDFA 4EIWA 4H9GA 4V0MA 1FX0B 3RS7A 4LV6A 1W48A 2FH5B 2OESA 4I99A 2DCUA 2GILA 1J8YF 5AUPB 4FMDB 3DZDA 4QC2A 1G5RA 4A92A 4AURA 2GEUA 2FX3A 4QXAA 1DAMA 5L3VA 3TQFA 4AD8A 1F60A 1JBKA 1KHTA 4DLYA 4TLEA 3AKDA 1EXMA 3VQTA 3THWA 4YMVA 4F38A 1UBFA 2ZRJA 1U9IA 2F1HA 1FNNA 1HURA 1NF3A 5J5CA 1QG4A 4JYCA 3A6PC 2WOJA 2ZJAA 4WIAA 1G19A 4OJQA 3CZPA 1KI3A 2X1VA 5TV2A 1TU3A 3BB1A 4PPNA 2VHJA 1A2BA 2XOKA 5KPJA 2WWGA 2IS6A 1YR7A 1TTTA 4Z8YA 1ESMA 2JAQA 4KU4A 2CBZA 3OFNA 4QNRA 2JA1A 5LD2B 1Z6YA 2VRWA 1M7BA 1DEKA 5FOXA 2RGDA 3LNCA 5FOTA 4X8MA 3L43A 3U4QB 2IYYA 4LX0A 4R9UC 3W5IA 2WTUA 1E9EA 3CRRA 3E70C 1N6HA 2ZROA 3W6NA 3SJAA 1CP2A 3A1WA 2F55A 2ZRNA 3HR8A 5SZHB 2NTYC 1P2TA 2FGKA 1DVRA 3DZ8A 2BVNA 3NHBA 2QBYA 1DBSA 1Q1ZA 1OIXA 4FD2A 3A4NA 3DOFA 3OEHD 1SVMA 4JBWA 3TK1A 1R8SA 1UADA 4UXHA 4ZV4A 2JJ2D 3GJ6A 2NO1A 4IDPA 4YMTA 1E98A 3B1VA 1UKYA 2CCGA 2J0UA 4HAYA 4HAVA 2DWOA 5IT5A 4B2PA 4UNRA 4XWAA 2ZPTX 1KSFX 3T12A 3H1TA 3GFTA 3PENA 4JVLA 3SHFA 5BN3A 1I2MA 4NBSA 5CYPA 1QHHA 4D80A 1N5JA 4N0EA 2ZRDA 1HA3A 2IUTA 2GBLA 1AK2A 3AKEA 4PSVA 4Q19A 4QHSA 4AC9A 1Z47A 1QF9A 5DN6A 2B8WA 1RC8A 4JT4A 4B3XA 3RRYA 2PCLA 2D4HA 3WMEA 1E0JA 2GK7A 4Q4AA 4MGYR 1UKVY 3QEJA 1KI8A 1PLKA 3ADBA 1YZUA 1NVVR 4LK2A 3QKUA 1XPUA 4BFXA 2OBLA 2RMKA 1R5NA 3UIEA 1QDEA 4RD6A 1E3MA 5IK2A 1E6CA 1FP7A 5FOSA 3I72A 3CF2A 1OB5A 2VHCA 3K0CA 4LYAA 4PC6A 2ZR7A 4EAQA 4A0HA 5JI3E 4LV5B 5BYJA 5TB5A 2GXSA 1EG7A 4OHXA 2ZSFA 1TF7A 3BFKA 1NBME 3RRZA 4A1FA 3AF3A 2ZEJA 1X86B 1KKMA 1U0LA 3MUFA 2FEMA 2JLWA 1LFDB 4L8GA 3D3QA 2IEYA 1G5TA 3AVQA 4Q9KA 2ZYVX 5FTLA 1KIMA 1PUIA 4DC9A 2P5TB 4OQMA 4S35A 1KAGA 4ZI3A 3KJGA 1N6OA 2WKQA 4PAMA 4C0AC 3K70D 3SBEA 2QMHA 3CH4B 1QHYA 2WV9A 2P6RA 5A0FA 3BK7A 1CRPA 1JEDA 2ZXUA 4PAOA 2OCBA 5FH9A 2LKDA 1G8YA 2C78A 2QG6A 4GZLA 2C8VA 3QSYA 3MJRA 1R5OA 3E5HA 1NJFA 2GEDA 4HYYA 5DH9A 1XPRA 4AKGA 3CX8A 3CW2A 4LDJA 2WAYA 1P2SA 1R6BX 1TF5A 5FOWA 5FL7D 3V4RA 2JLZA 2B21A 3A1TA 4U00A 1Z8FA 2B8TA 3VFDA 4V02A 4U7DA 4WXRA 2HT6A 3CM0A 2CHVA 1TADA 5JWRA 4IW3B 3AKYA 5IDVA 3VU9B 2G0NA 2ZE8A 3PQCA 4DWJA 3DOEA 3NHAA 2GJ8A 2QSYA 2ZI3A 3TSZA 1OXUA 2H17A 1XMJA 3CWZA 3W6PA 5JBQA 4QGAA 1LV7A 4LJ7A 4NYIQ 4CRWB 2O8DB 1G3RA 4N3NA 3GJ0A 3GJ7A 2CHQA 2Z0MA 3RS2A 4H1UA 2VYFA 1IM2A 3OE7D 4R71A 1KY2A 3U2QA 3O8CA 1A1VA 1EFUA 3DHWC 4HDOB 4C4PA 3M6AA 3GLFB 2BJVA 3DL0A 4HZUB 5AUNB 1SXJD 3SN6A 4JVNA 4LWZA 4TLCA 3ZIAD 2AXPA 4DLTA 1JJ7A 2L0XA 1CU1A 4Q1CA 4PHTA 1D2NA 1OIWA 2A5FA 4R2HA 1NJGA 1G8FA 3TSWA 1D8TA 2IX3A 5JWOA 3UMRA 4CT5A 1DAFA 3LX5A 5BN4A 2N46A 1NIPA 1UFQA 1K6MA 1LB1B 2VTKA 4OK5A 2F6RA 3GLHE 3K0AB 1MOZA 4FWIB 1T5LA 4M9QA 2QAJA 1U98A 4WA7A 3VKGA 2BBOA 1S2MA 2QMOA 4Q1DA 1Q1EA 2YZ2A 1U8ZA 2E87A 5EZ5A 5B58C 5FR2A 4DSNA 4TYWA 5K8TA 1D2MA 5AUQA 3OESA 1XTIA 4B33A 3QKRA 1CJVC 2CCKA 2N42A 3P26A 3WP1B 3WYGA 5HZKA 3DEFA 1ZM4A 3T15A 1PZNA 1GM5A 3ZVMA 1E2NA 4LUCA 1EFRD 2FV8A 3CBQA 4GOJA 2ZRKA 1Z3IX 1OH8A 5HE8A 4F93B 3THXA 3AKCA 1BOFA 1EX7A 1H8ED 2QORA 2NOAA 3SEAA 4DT1A 2ZETA 2CXXA 1UDWA 1NN1A 2HDNB 4S2EA 4BEJA 1G64A 5KYKA 3QOFA 2DBYA 3RWOA 3VR3A 1UM8A 4PPFA 4TWZA 2KE5A 2GA8A 1KDPA 1E94E 2YC4C 4JLMA 4LRWA 4NCKA 3JZMA 1R2QA 3IIJA 1S9DA 5JS7A 4JSYA 5GJVC 4A6PA 3GP8A 1OXVA 1Z0DA 3N2EA 3K70B 1KJZA 2D7DA 1VIAA 3BXZA 2G1KA 5SZKB 1RVDA 4C0HA 1EK0A 1M1YE 3LVQE 3L0OA 2ZI4A 3Q85A 4F7WA 1FL9A 5KDLA 2KSQA 3A1VA 2VF8A 3W9YA 3T1OA 2R6GA 4ZDIA 1CS4C 2IW3A 2OZEA 4TQAA 4HAUA 1YZGA 4P4TA 1T6NA 2IA5A 2WJJA 3FHTA 3RABA 1ZRHA 3GJ3A 1KSJA 1CXZA 4ABYA 1GIAA 1T5IA 1X1SA 2Q9AA 3KTAB 4KLNA 2IWRA 3EW9A 1NSTA 4LJ4A 4CDGA 1JAHA 2XTMA 3MRSA 4DSTA 1XB2A 2G0TA 2RGEA 2J7KA 5GJWC 1LS6A 1ZINA 3B1XA 2ZRLA 3AF4A 2QAGB 4KVGA 1SKYE 1G7RA 3LW7A 2RGCA 2ANCA 2IYTA 3TBKA 5K8LA 4G5OA 1SXJB 3KDSE 5C4GB 4M1SA 1A4RA 4JMPA 4HLUC 4FXPA 1HT1E 3BFXA 4NTZA 1ZD1A 1MO3A 2BM1A 2OFWA 4M21A 2JLYA 2LKCA 1ZUNB 3A36A 2G1JA 4YDSA 2YKGA 1E2IA 1QRAA 1XEWX 4LYHA 2FG5A 2GCNA 3FHCB 1GWNA 2IEZA 4MITA 3IKJA 4QGFA 1S1CA 4EFNA 1XEXA 4MRRA 3KJIA 3MLEA 3MG9A 4PC2A 5L3SB 2D74A 2H1LA 1N5LA 3B82A 4JBYA 4HLUA 4MYTA 1I4DD 4PFSA 2WIBA 4LYFA 1XDBA 5AUOB 3ZD6A 2KJQA 3D6TB 1DARA 4G5SA 2AR7A 5D3MB 1XXHA 3GD7A 3X1XA 4KAXA 4IFEA 3GLIE 2NIPA 2W0MA 5KPDA 4UQOA 1PUJA 1N3BA 4LBZA 4LOAA 4ZKEA 2F3TA 2IHBA 4NL4H 4D4KA 1OB2A 1CJUC 2FPKA 2PL3A 5UKDA 1GL7A 5JFGA 2PT5A 2W6ID 1YZQA 1SKQA 1M8PA 4HLCA 2WJYA 3KB2A 4F4IA 1M34E 2GJ9A 1OXSC 1Q57A 5EP4A 4BLSA 2WICA 3LRPA 4OQFA 1NG9A 4WZBE 5J4LA 4TYYA 1Q21A 2O8FB 4QBHA 3D7MA 1BIFA 1EWRA 2YHSA 3TSOA 2F1RA 4DBLC 4RKFA 1CJKC 1P62B 4A8JC 1E9DA 2DWPA 2Z43A 1L7VC 2YWHA 4CEHA 2YOGA 2VSOA 4OI2A 5JJKA 1OXXK 1MH1A 5KUTA 1NL3A 2W2VA 3HU3A 3K0SA 4Z51A 2JASA 4Z1MD 2ZUBA 5K8IA 4V03A 2BEJA 4TQ9A 2YWFA 2H92A 1ZMXA 4LHZA 1J99A 2PBRA 3I3SR 1Z6TA 3P20A 1P73A 3T5GA 2V4ZA 3UPUA 1IHUA 2BMJA 4MDFA 1NVWQ 2FFHA 2O0KA 4O3MA 4TLDA 5JJLA 4A8JA 4N0DA 2PCJA 1Z07A 3QPVA 1CLUA 4A2QA 1Q3TA 1UDXA 4LJ9A 1VIYA 2WPDA 2A3RA 4BZQA 3TR5A 2AD5A 1KDRA 1S3GA 1A7JA 2ZJ8A 3H84A 1NG1A 2F3RA 3U6KA 5TVKA 1US8B 2XNDA 3QIAA 5J4YA 3I4LA 1KYIA 3UMSA 1N5IA 4KLZA 2J0VA 1AA9A 1HT2E 2W83A 1TL7C 2VP9A 1FUKA 3EWAA 2C99A 1IN4A 2H16A 3RS0A 4OHVA 4DLZA 4JLDA 3VX3A 3HR7A 4OI0A 3C14C 4FMCF 2BBWA 2ZS7A 4DUGA 5F3WB 2GCPA 4DCTA 4CW7A 1QZXA 2ZYUX 4XTCS 4ZKDA 4AG5A 5F9HA 2W0SA 4JVMA 2B6HA 3BC1A 3NBXX 2WSMA 4I1SA 4MQBA 5AJYA 4BFUA 1KZGB 2G88A 4HDCA 2R6FA 2W58A 3CR7A 4UJ3A 3VR2A 3U6BA 2I1VB 3TMKA 5LB2A 1G1MA 2IYWA 2XB4A 1KOFA 1MKYA 3UWOA 4QM7A 4DCNA 3Q5EA 3U3KA 4RZ3A 4DSOA 2BKEA 1W46A 4LYJA 2CEAA 5LB4A 3ZZTA 4F4JA 3MWYW 1PLJA 2OCPA 3CNOA 1A2KC 5KDDA 1S1MA 1W1WA 4GBMA 2GZDA 1R4AA 1E9AA 4P31A 3B1WA 3KKPA 3QBTA 1M74A 2PZEA 1W4BA 3VKWA 1IAQA 5DHFA 2R6DA 1NVVQ 2WJIA 2ZQ5A 1KMHB 1U8YA 4TT3A 2RGNC 3AVTA 5KSYA 3K9GA 2XEXA 3NIBA 2HCBA 1CJMA 5A4JA 5JMTA 4PO8A 2XXAB 2MMGA 4LBWA 3B8HA 2I4IA 3NBZC 4TYPA 1ZU4A 3FMFA 4C2UA 3CR8A 2IYSA 3I92A 2BEKA 2EU8A 4ZI2A 3AH8A 4M22A 1LF0A 2CLCX 2VH5R 4ZCMA 1RIFA 5HPYB 3ZS9A 2DYKA 3X2SA 4Q1EA 1N0VC 1AKEA 4LGMA 2P0EA 4JLVA 2RGNA 3EZ6A 5TMPA 4EFLA 3B1ZA 1II8B 5KTYA 3GLGB 4ASUD 4GOXA 4PO1A 2AD1A 1W36C 3QVVA 1JR3E 2EW1A 3QBVA 2IHYA 2HCJB 3H4MA 1RJ9B 3B60A 3GFPA 3NG1A 2A30A 4DIDA 4DDWA 3WYAA 1OFUX 4O0MA 4ARZB 2XGJA 4JZKA 1E4YA 2XNDD 5K8UA 3PUZA 4IEEA 1KDOA 2ZSEA 2ZJZA 2WMOB 4TYNA 3GJ8A 4Q4JB 3D31A 4DDTA 2WZQA 2J7PA 5J4VA 4OQLA 1SVIA 1H8HA 2FDCA 2DPXA 3ONWA 4TL6A 4URXR 1Z29A 1U90A 1NBMA 3U3OA 1OKKD 1VG0B 1TQ2A 1IY2A 2FFQA 3ZJYA 4Q21A 4EQ6B 2ZVPX 5IF9A 3GCGA 4RJLA 5M04A 2BBSA 2HXYA 4TL9A 4BWYA 3SJBA 2PJRA 1ZW6A 3QPUA 2C9OA 3AVYA 3TH5A 5BW8A 2YINC 1B0UA 1TMKA 2V7QD 4PHFA 3C4JA 2WWYA 4RZ2A 3AEZA 1RYFA 2QRNA 4L4UA 2AXNA 2QE7A 3PVSA 3SDZA 4A4DA 2FSGA 4C0JA 1NN3A 3UWKA 1DTSA 4KFTA 4MGKR 4NU0A 2CE2X 2TMKA 3K0FA 4G01B 4HB0A 2GVDC 2ZI7A 3OEEA 1COWA 4ZIRA 4JKIA 3FTQA 4M1YA 2QGNA 4MUAA 2XTNA 3MAAC 4TL8A 1YKSA 4Q7MB 4Q9LA 4PHHA 1GAJA 5J4HA 2ZRGA 4QKQA 3U60B 2ZANA 5GADl 1XMVA 5A5GA 5CB8A 1E2DA 2GHIA 1GL6A 4A0RA 4H1VA 1F6BA 5ANRB 5JHHB 1WB9A 5BXQC 4M53A 2X77A 1XRJA 1ZNWA 2HXSA 4JJKA 5EXXA 3SJCA 2DY1A 2UKDA 4OQXA 3U44A 3L8ZA 3LLMA 2OEPA 2O8EA 2V3CC 4KVAA 1P4SA 3P4YA 1Z63A 1C1YA 3NWJA 3OIYA 4IRUB 2YV5A 3LQQA 1RW4A 3DM5A 5EE9A 1DAHA 2J0QA 3PV0A 4MYUA 3KKNA 4Q4HA 4IJMA 4DLXA 2Q3FA 4LPSA 1Z2AA 1KI4A 3MD0A 3R20A 2X2EA 3S1AB 3Q8XB 4C0BA 4DKXA 1Z06A 2KBFA 1YU9A 1YR8A 1AS0A 4B6FA 4ACBA 2QROA 3TKLA 4GZMA 5DI3B 4QHTA 1F2UB 4XSGA 4YMWA 2ECKA 4DZZA 1XJQA 3WNCA 2JDID 2HYIC 2JCSA 1U9IC 4RSGA 1HYQA 2KBEA 4MH0R 4B75A 3AVUA 1TEXA 1D6JA 1HTWA 3HU1A 2ATXA 1N6KA 1YJ5A 3KKOA 2OV2A 1N6RA 5BQ5A 2O8BA 3W3ZB 3FYHA 3THYA 3QXSA 1JQJC 1U81A 3A4LA 3SYLA 3IGFA 3ZZUA 4B34A 5JZVA 1KKLA 2ZE5A 1IY0A 4MYCA 1EFHA 2ATVA 3R9WA 4AY2A 2OLJA 3CPJB 2VLIA 1ZD8A 4AKEA 4ZDKA 3QENA 4UKDA 1H8HD 1YHNA 3HU2A 3CRQA 2MMCA 1IN8A 1GNQA 3ZVLA 1G6HA 1AQYA 1VCMA 4B32A 2J59A 2EFDB 4M1KA 4QGHA 5FOVA 4IVRA 3KJEA 3PUYA 721PA 1D9ZA 1N6NA 5JRJA 1CULC 3BBPA 2BKUA 3R8CA 4CEIB 1E2JA 1E79D 1DADA 1OPXA 2UZIR 2QA5A 5DYIA 4DIEA 1F2TA 4GFDA 1KJWA 3WBKA 1N6IA 3IQWA 3WRXC 1M2OB 4EPXA 4PHGA 4XVRA 2QE7D 2JGNA 2WBLC 5KNCA 2Y8EA 1XP8A 4NZYA 1DS6A 4L9SA 4MRVA 1CEEA 4IDHA 4HZIA 4OQNA 4RD4A 2XJ9A 2GBLC 1DG1G 1TQDA 2QPAA 4DRZA 1SVLA 1P75A 1DO2A 5KNBA 1BO6A 4RCZA 3QPWA 2KI5A 3Q5DA 1W4CA 1P9NA 1SHZA 1VG1A 1E9SA 1U0HC 4EPYA 1UKEA 1N2CE 3ZS8A 5HKKA 1ONBA 2C9CA 2GXUA 3KUDA 1LNZA 1T3HA 1A5TA 2ORIA 3QQ5A 1WBDA 5EP3A 5L3QA 1IBRA 2VQSA 4KCGA 3UATA 3K0CC 3TAHA 4JIMA 4DEXA 1L8QA 2ZRHA 3W8RA 1TPZA 2FOLA 3AUYA 5F98A 4KJZA 1IXZA 4TMXA 2XSZA 2J3EA 1MV5A 1RKBA 4NDZA 5CK4A 1AJEA 3LQRA 3P27A 4FW9A 1Z0KA 5J4KA 3TQCA 1ZNYA 2GJAA 3DMDA 4QJ5A 4M1OA 4WOPA 2ZYTX 1E1QD 3T1VA 3O8DA 4NCNA 2XB2A 3G5UA 1XTKA 3QF4A 1GILA 1S3SA 4B2IA 2IT1A 4E07A 3RDPA 3EZ7A 3ZD7A 2B92A 121PA 1CRQA 1ZUIA 2QQ0A 4GNKA 4QG7A 2LCFA 2NZJA 1J70A 3TIFA 3GFOA 5FTNA 3BH6A 2H8KA 2GRJA 2OUKA 1PJRA 4IKEA 1Z08A 2CE7A 1IY1A 3KXIA 2HF8A 2IYLD 1AQUA 2J0SA 4OK3A 4MDEA 3JZAA 4KXFB 5JJIA 3FPAA 2IYUA 1U94A 1WXQA 3VR4A 3MJHA 5HCIA 5DNYB 1ZC3A 3WMGA 2VP4A 3IEUA 5E7MA 4URZR 2GVZC 2GESA 3LX8A 4OKSA 3GLIA 4O2RA 2PMKA 2AK3A 1VKJA 5B2ZA 2PZGA 4EFMA 2W6JA 3LVRE 4B76A 4WZAE 1KMQA 3EARA 3WXMA 5LBIA 4C7OA 1UEIA 2ERYA 1S96A 3I73A 3K0EA 3KUCA 4V0NA 2ZI6A 4M1TA 2XOKD 4A2PA 4D4LA 2RKOA 5AK0A 4Q7KA 4W9MC 2ODBA 1YVDA 3I8XA 3ICQB 1BYUA 4IDOA 1D2EA 3QG5A 2ZS9A 4IOKA 2HUPA 1XBTA 1HQCA 2R9VA 3OFND 4TTQA 3GPLA 3WY9A 4GSYA 2FSFA 4TMWA 2HLDA 3LDAA 4BFSA 3VTKA 4ILEA 3CRW1 3GLFE 2V6IA 4P4SB 3FWYA 4Y0AA 2O8CA 1YRAA 2ZJ5A 4HLDA 3SQXA 4RD2A 4KODA 2F43B 3OAAA 2F9LA 5KNDA 4JL5A 4IFBA 4M2LA 1KY3A 1XD2B 2GAAA 1SGWA 3NC0C 4K81B 3T34A 3AGQA 3IQXA 4EPTA 2BMEA 2CJWB 4CEJA 1T91A 1V43A 2VA8A 3U3RA 3T35A 4KO8A 2P6UA 3X1ZA 1GKUB 1DE0A 4P4UA 3U7FB 3GJ5A 3FE2A 4X8HA 2RGXA 3X1YA 5HKKD 1IJEA 4PZZA 1MABA 3VAAA 3I8SA 3ETLA 4NP6A 4OI4A 2DHRA 1G4AE 4ZO4A 2GKSA 2J9RA 5IRCD 1ZM9A 1VHTA 4LZZA 5JCPA 1VCOA 3BWDD 3NKVA 4AG6A 2FWRA 4A36A 4TTPA 3GJXC 2WOOA 4NKRA 1SVOA 5DN6D 1AIPA 4NYMR 3VNVA 1KK0A 1KO4A 3U44B 4CIDA 1G3MA 1WA5A 3CIOA 5FL3A 4UNQA 2IWHA 4BZPA 1K5GA 4NCIA 3PXGA 5GVSA 4BFWA 1Q44A 2GETA 3EWSA 2AWOA 1AS2A 4DXAA 1IXSB 2ZI9A 1DG3A 1EWQA 5IK2D 2IYVA 4QJ3A 2C98A 4JL8A 4HUQA 5JSZA 5B57C 4O25A 4US1R 4R2IA 2NO0A 2SHKA 4RFSB 4BUJA 3T5DA 3AVPA 1W5TA 4TTRA 1NRJB 4MA4A 1ZM2A 4HUTA 4LJ6A 2A5YB 2ANBA 3KQHA 1CKEA 4P0TA 2OLKA 3GJ4A 3A1UA 5HR5A 1G5PA 4GPTA 4Q5IA 1E2QA 2JJ1A 5EUMA 4E5UA 2OCAA 3OIWA 2QTFA 3MWKA 2YYZA 2GCOA 2PJZA 3UXMA 3ZVRA 4Q7LA 1E9RA 521PA 2KWIA 2R8RA 2VHQA 3ZVNA 3QXHA 4HSEA 2QM8A 2HT1A 1E0SA 2Z4SA 3RAPR 1E9FA 1EGAA 3LH5A 3B7GA 3THWB 3O8BA 1Q3HA 3EAQA 3PUXA 4TSFA 1W5SA 4GL2A 1Z22A 2FZLA 5ELXA 1F3OA 3CWQA 1F5NA 2OSBA 4HI0E 3X1WA 2R65A 4KITB 4EPVA 4P32A 1TX4B 1SVWA 2CL6X 1NIJA 1QHSA 1ZM7A 5KSZA 1SVKA 4E09A 1U99A 1AGRA 5FTJA 1DELA 1VMAA 4B35A 3EZ2A 3U3MA 5CIQA 1UAAA 1D9XA 3HYRA 4CT4B 1IN5A 3QG1A 2IC5A 3R9XA 2EFEB 4Q66C 1X8LA 1SXJE 2ZR9A 3SS8A 4GMDA 1GTVA 1W49A 5F2EA 4BLOA 3TGPA 4JLJA 5LPNA 4WBSA 3KQUA 5HZHA 4D2IA 3TJZA 4TMTA 1ANKA 1KO7A 3ZZ0A 2DFNA 2QBYB 1G3UA 2EYUA 4X8LA 4IEIA 1JR3A 4KYIB 2BIFA 3WMFA 1LTQA 2R44A 1A82A 2JLXA 2J0UB 1G16A 2EVWX 5EJEA 1R8QA 3QNUA 4CYMA 1QG2A 4C0KA 1NLFA 1Y63A 4M1WA 4US0R 3NTUA 4Q01A 1QHHB 2QTVB 4Q9IA 4E22A 3B5JA 1W2GA 2ONKA 1JQLB 3KQNA 3B85A 3KJHA 4B3GA 4B6EA 5B30A 1L4UA 4Q4AB 3M4YA 4JYBA 4OHWA 2Q6TA 1TU4A 1ETUA 1OT3A 3NH9A 4Q00A 5G3ZA 2G9NA 4FINA 4EJSA 1CF4A 4G5GA 2YOFA 2IXFA 2V6JA 4QBFA 2UVQA 3TVDA 1R0XA 1OIVA 1KK2A 1FW6A 1GNRA 2YNMA 3K8YA 2FPMA 2WHXA 1FNMA 3PUVA 1H65A 2BOVA 2XTZA 1P2UA 1E2LA 3W90A 3EZFA 1Q1QA 2QP9X 3U7GA 1NKSA 5CK5A 1E0KA 4OYHA 1E2FA 3QKSA 3EC1A 1W0JA 4F92B 4YMSA 2VF7A 4D4MA 1OF1A 2RH5A 5G53C 1TUEA 3IEVA 3CF6R 2WAXA 2IK8A 1XNJA 3GEEA 1WBBA 4PPGA 2OG2A 4DLVA 1KI6A 3REFA 1FUUA 2VSXA 3KKQA 4Q18A 4URVR 2G77B 5FFMA 1SQ5A 4OL0A 3U3JA 2Q3MA 3N5CA 2CNWA 3AP3A 2ZE6A 3A8TA 1EESA 1BMFA 2AFHE 3RC8A 1G8HA 1FTNA 4NE2A 4GP6A 5JWHA 2WIAA 4XWKA 2VP0A 4B3DA 2BCGY 2O0HA 3BORA 5KHOC 1Z0FA 3KL4A 5C1BA 2AN9A 1JJVA 2ZE7A 2OE2A 3FKSA 3LWNA 4Y0VA 1ELOA 4ZPXA 1GVNB 1CIPA 3DDCA 5FBQB 1S8FA 4B3BA 4YXWA 2QP3A 3I5XA 1CR0A 3HJNA 5GVRA 1UBCA 4LHXA 1DAEA 4GRAA 5DI9A 4BFYA 2H5EA 2R62A 1XJCA 1Y3AA 2BMFA 4HB2A 1KI9A 2G83A 3DMNA 3CUEF 3ZLJA 1S9HA 1K5DA 4BASA 2ZYWX 2V9PA 4II7A 2V55B 5EP2A 5FTMA 3FFAA 5F9FA 4YDHB 2F1JA 1FX0A 2FA9A 3CRMA 2FN4A 1YRBA 2P67A 4JBXA 2ZJYA 2FFBA 4PC1A 2NPFA 1E1RA 1DAGA 1Q12A 4TZ0A 3C5HA 2D2FA 5KO2A 2OCYC 1YR9A 4I81A 2O52A 1S4QA 3F5FA 3EX7C 2HYDA 4ZDWA 5EE3A 3IPYA 4XVQA 3NDBB 4FWTA 3BGWA 2F1IA 1WMSA 1MRSA 4LBVA 221PA 1TQ4A 1P5ZB 1I2DA 1XX6A 2OAP1 1XTSA 3EG5A 3PJRA 3WHLA 4ZCLA 2FJUA 2NPIA 4NYIR 3P4XA 5SZJA 1QHNA 1P60A 5BYKA 4ESHA 3CX6A 4DSUA 3QKRB 2V54A 1XTJA 2GZHA 1CJTC 4IDQA 3AP2A 1P72A 3W34A 4YONB 3V00A 3VX4A 1ZUHA 2N1BA 1R7RA 2GTPA 3AF0A 4PR0A 3U4QA 2VIIA 4OK6A 2JIZA 3THXB 3IIKA 2ZS8A 3MCAA 1UBEA 1ESNA 4DT1B 1XEFA 4XD7A 2A5JA 1K8RA 2LWIA 2ZU0C 3RHFA 4C0SA 2AL7A 3HYTA 3C41J 5HTKA 2QPOA 1Q22A 2IUSA 4GDFA 3CPEA 4I4LA 1GNPA 4HAWA 3WHKA 5E3HA 5FBVB 4BGDA 2DWQA 5L8VA 2OM2A 1J2JA 3GLGE 4GMXA 3EIEA 3FVQA 5H8WA 2QRZA 3F8TA 4IHQA 1WDTA 3WBJA 1FZQA 1VPLA 2AWNA 2RHDA 2BMDA 3FKQA 4LHVA 3WNBA 1RPZA 4QM6A 2JATA 4B2LA 1XZPA 1M6NA 1ZD9A 2FSHA 1X8KA 2J5XA 3VKHA 1AGPA 4FMDF 3KQLA 5DO9A 2ORWA 2WPDD 2XX3A 3FMPB 4JLKA 3CNLA 3BH0A 5H70A 3KQKA 2FMXA 4XOIA 3SI7A 5DISB 4D25A 1IONA 2WWFA 3A58B 2F7SA 3K9LA 4B48A 1VCNA 2GNOA 2J41A 3VNUA 2DFTA 3DPUA 4Q9JA 3ZDQA 1AZTA 4D82A 4KI0A 1FQJA 4JS0A 4ACAA 1JAIA 3CX7A 4PTLA 2H57A 1NVXQ 4DUGD 4PZYA 4UNSA 2Z83A 1KNXA 2ZM5A 4M9XA 2QMUA 3SJZA 1KK1A 3ECCA 2H18A 2H7VA 3I5YA 5B64A 4BLPA 2Q9BA 2QMEA 1VECA 3VR1A 5EQTA 1HE8B 2IBMA 3HP1A 1T8TA 3MWLA 3RRMA 3CONA 1YZKA 1GL9B 1KSHA 2AFIE 3EA0A 2CVFA 5SZIA 1AS3A 4KFRA 3W8NA 1TEVA 1XEXB 8OHMA 1DO0A 1XTRA 4HB4A 4DLSA 3ADCA 5FPHA 4NPHA 4FN5A 3SYNA 2ODNA 3ND9A 2GF0A 2OBMA 1VDZA 1OW3B 2RGAA 5DSZA 1T0JB 1W0KA 2IXEA 2WSSA 3GMTA 3EPHA 5EE1A 4NCHA 3T1TA 2NO6A 3N70A 4FMCB 4MYHA 1KTVA 2HJGA 3VU9A 1OH7A 3OF5A 1XXHB 4DDUA 3Q9LA 4MKFA 4ITRC 1GG2A 1KO8A 2FPLA 1CR2A 1UJ2A 2WKPA 1ZC4A 4N1AA 4NYMQ 4PO9A 3TRFA 2Q3HA 4YMUA 3BB3A 2ZAOA 3RRNA 2O8DA 5TY0A 2ZR0A 1E69A 2GWHA 4HAXA 4JLBA 3BRWD 4M1MA 3BFVA 1BYIA 4D4JA 1GRQA 1C9KA 1U2RA 1UBGA 2WWHA 3FDIA 3F3YA 2P3SA 3KX2A 4TT3D 5KSPA 4HZUA 3GLFA 1FMJA 5EUQB 4LY6A 1JR6A 4BPBA 4RD0A 1JECA 4LHWA 3PEYA 1N5KA 2A78A 1KI1A 4QBIA 1YZTA 2G3YA 1LS1A 3OEHA 4M9SA 2Q21A 1R5BA 1G8PA 1SULA 4CZ2A 4PXAA 3TUZC 3DKVA 3FMOB 5FI0B 4PAQA 4CEHB 3L8YA 3K0AA 2QN6A 3SE0A 1E2KA 2ZJOA 4QOSA 5AJXA 1GRNA 2AK2A 4DLRA 3AUXA 3LXRA 5EXSA 3BJIC 1X6VA 5FI1B 3SFVA 5AR1A 3GLHA 3E1SA 1M7GA 1OV4A 2AKYA 5JI2E 3AVOA 4PSAA 5JRZA 3QVUA 3JVUA 1IQPA 4IOJA 3SR0A 2ODWA 4A8JB 1RRCA 3B6EA 3BIFA 2ASEA 3OZXA 2IS1A 3EXAA 4AKHA 3U5ZB 3PR1A 1T3SA 3CRVA 3NVAA 1ZM3A 2Q0HA 1U8AA 4PC7A 4HDQB 4LV8B 3PUWA 4KFSA 5FBRB 1P6XA 1W7AA 1W36D 1N25A 1YE8A 1Z0IA 5E7IA 4FCWA 2ZU6A 4U5XA 3RC3A 5TARA 1KAOA 1RRFA 3B13B 2J7PD 2I1QA 4LJ5A 4A15A 2FFAA 1OHHA 2R6CA 3HDTA 4X8OA 5E95A 1JI0A 5AJVB 1NBMD 1HH4A 4NYJR 2NZ8A 3CPHA 3IHWA 4RCYA 5EZ6B 2EQBA 5DGXA 4I1UA 2RGBA 2QUZA 1NI3A 2C03A 3H0KA 1NMXA 4V0KA 2C5LA 3K09A 2VP5A 4HAZA 2C2HA 1FTSA 4B73A 2WWWA 3N2IA 3DKPA 2EYQA 4B71A 2OT3B 3IO5A 4IVQA 4Z54A 1E0AA 3F0TA 3IPXA 3DM9B 4DCVA 1VYVA 1OYWA 4TN1A 1RFLA 3K9HA 3LD9A 2WWXA 4M8NE 1QHGA 2ZRPA 1W0KD 2WSSD 4WVFA 4AKIA 3B1YA 3OEED 1COWD 4JJZA 2QAGC 2QU8A 4E03A 5FL7A 3NBFA 4IOLA 3OIVA 2R6AA 1XCGB 4MKIA 4L9WA 2V8OA 1G4UR 2OXRA 1P9RA 1HV8A 1SXJC 2WKRA 4L15A 5DYGA 4AWXA 2JLQA 1FOEB 4F91B 1AM4D 1NMZA 4RFVA 3KTAA 1KJYA 1YZNA 3KFVA 4C0LA 2GXAA 5FTKA 2VEDA 2O5VA 1Q20A 4B74A 4LJAA 3WYFA 4TYQA 3UG6A 1T3LA 2P6NA 3KKMA 4QFMA 2QAGA 3OE7A 1E4VA 4PX9A 4BECA 2ZRCA 1P61B 4UXIA 1VHLA 1YZLA 4B43A 3IILA 1SXJA 1VCIA 3I1FA 3CZQA 1BKDR 2IF0A 2D3WA 3ZIAA 1G20E 2A9KA 2IUUA 1SZPA 3GQBA 5EXTA 2UZ3A 4Q1BA 4RD3A 1ZNZA 1J90A 4A82A 4JKYA 2PLRA 1VG8A 5AWFC 3EPJA 3CB4A 4W7SA 3TVTA 3Q3JB 4Q1AA 1UF9A 2ZRFA 2DFKB 3NEYA 5L3SA 3MGCA 1J7KA 1ZBDA 4K8OA 4XIGS 5BN5A 2XZLA 2VSFA 1E99A 5H1YA 3WNDA 3KZ1E 2VHTA 3MFYA 4C30A 1XMSA 3U61B 4DDVA 1Z2CA 3QKTA 4NONA 5J47A 1DAIA 3VHXA 4LHYA 4HEJA 1OXTA 2JLSA 2V1UA 1KGDA 4JVSB 5D3MA 3BD9A 1JXMA 2PEYA 2QENA 3UG7A 1Z6AA 1CBUA 1FQKA 3CNNA 4WW0A 2BC9A 1SHKA 2EWWA 2QTHA 2Z6VA 2CHGA 3MSXA 4GP7A 4ZCIA 5KDOA 1FFHA 1QVAA 1EFRA 1FPMA 3LXXA 4B3CA 1JNYA 1NSFA 2C96A 3IUYA 1HY3A 1NN5A 1P7CA 5TXGA 3LLUA 1OLOA 4U02A 1H8EA 1W36B 4D26A 3SHWA 3P32A 3RSOA 3SU8A 1OHHD 4JLOA 1N0WA 4Q7JB 5KSOA 1W47A 2E1RA 1N6LA 2JEOA 4BLTA 3EIHA 5EXPA 3VHLB 3DVLA 3FGNA 2HJVA 2HV8A 3ZYCA 2O8FA 3RS3A 1TNDA 3UANA 5KU1A 4O2LA 2ODEA 2ZRMA 4MRPA 1G3IA 3TUIC 2ZSBA 1KNQA 4OI1A 1XD8A 3H2YA 2MSCB 3MWJA 1AN0A 1MO6A 2BCJQ 1VTKA 1O87A 1GZSA 2A5GA 2FEOA 3EPLA 4LPKA 3PCRB 3ASZA 1XTQA 3QXXA 1Z6GA 4IXMA 4UNPA 3RVBA 3L82B 4FCTA 2ZAMA 1NLYA 5L3RA 2IS2A 4PZLA 1YQTA 2CLDX 4RD1A 3K1JA 4XSHA 5DIFA 4A9AA 4RVCA 3FOZA 4KSBA 3K0FB 2PEZA 1I4LD 1I4TD 1LY1A 5P21A 2RAPA 4XH9B 4ZIRB 2OHFA 1BS1A 3PITA 3JVVA 2ZSDA 3AGPA 3U7HB 4C2TA 4Q48A 2BBTA 2ZUCA 3C16C 1PLLA 1UKZA 1E9CA 2AX4A 3C8UA 4Q4LA 3A37A 1MO5A 1NNEA 1US8A 5KOYA 1U0JA 1KSGA 1C4OA 2JJ8A 2QEQA 3B9QA 5JEEA 3AP1A 3W3AA 1TUIA 3SYKA 5EE0A 3RS4A 1GOTA 3BS4A 2XSZD 1IN7A 1L4YA 4HB3A 2FNAA 6Q21A 4IXNA 2ZI5A 4YQFA 2O8EB 4G0NA 1VYTA 3G82C 3R7WA 4TMKA 3QXCA 4LC0A 3RS5A 3NXSA 3J81k 3ICEA 4DLUA 2QNRA 1GITA 2YWEA 1W2HA 5JECA 4DHEA 3SQWA 3BOSA 1GRRA 4NMMA 2GDJA 5LDDC 4W5HA 3I62A 2FSIA 2XAUA 5DE3A 4UJ5A 3SFZA 1ZIPA 3LBIA 4Q4HB 1XCPA 3UKDA 1NLZA 2YVUA 1GUAA 2OO7A 1RRPA 3RNLA 2PMDA 2W2XA 1W44A 5EE5B 3P1JA 4BFZA 2GXQA 3R8FA 5CDFE 4V0ME 4OHZA 3T06B 5CIWA 2CL0X 2OFOA 3GLHB 4GOKA 2X2FA 2O0JA 2ORVA 3LFUA 3LY5A 2IYZA 3HPRA 2B7CA 2PX3A 5CLLA 1VYUA 4AYXA 3LO5A 2IYRA 1HUQA 5AJZA 4WAUA 3TW8B 1ZNXA 2ZVQX 1NP6A 4FI3C 4FMBB 3QY0A 421PA 3LBHA 4DCUA 5FPYA 2V1XA 2O8BB 4TLBA 2WM9B 3THYB 1L2TA 2W6JD 3QJYA 2VL7A 4DEYA 2JLUA 1T0HB 4PPQA 1P2VA 1NY5A 1OFTA 4EPRA 1KMHA 1NMYA 4JT2A 5J40A 1FMLA 1BH2A 2W6IA 3PEVA 1QVRA 2XZOA 5FPTA 1PV4A 2XXAA 1NY6A 2W2TA 3VR6A 4P33A 1KI7A 4CF7A 4TZ6A 2PT7A 3PEUA 2NGRA 4QJ4A 2OAQ1 2WMNB 1WQ1R 4QL3A 3CH5A 4L16A 3NH6A 1MR3F 2HLDD 4KBFA 1KDTA 4BLRA 2CDNA 1WCV1 2WWIA 2REOA 2PZFA 1E32A 1F2TB 4POAA 2OXCA 2VP2A 1GKYA 1G7SA 1II8A 1JPNA 4OBEA 4Z1MA 4EKDA 3OAAD 5CITA 2GF9A 4FCVA 3GLGA 5GJBA 4KFUA 3A1SA 2OBNA 4C9BA 4FIDA 3HWSA 1PVOA 1Z5ZA 2C04A 2RB4A 4QNMA 1T8UA 4C3ZA 2NO7A 3B9PA 3THOA 3SZRA 4UXJA 2J45A 1RJ9A 2XZPA 4LI0A 2ONJA 1Z0JA 1NVUQ 5DLQC 4DB4A 1R0ZA 2WJVA 2C95A 3EZ9A 4R98A 1IXRC 2OFXA 4ARZA 3AVVA 1GSIA 3IIMA 5G41A 4EJSC 3T61A 4RZUA 4A2WA 2YJTD 3KFXA 4PQRA 1TQ6A 2ZRIA 3BB4A 4JLAA 5L3QB 4Q4JA 4TL7A 3PFIA 1ZYUA 2BDTA 3QI2A 3L0IB 2QPTA 1CTQA 2GAOA 1G7CA 2CK3A 2PLFA 4ERNA 1G9XA 1XF9A 3SC3A 3SBDA 1G41A 2AKAB 2ZJ2A 4NHOA 1SKYB 1LW7A 3B78A 4D0NA 1ZIOA 4EQ6A 3AF1A 3G0HA 4A6XA 3IDQA 4LJ8A 3RYTC 1RRGA 1P3JA 3QF4B 4D6PA 1G3QA 2QT0A 4D81A 2D7CA 1TAGA 4LC1A 4TMVA 4EPWA 3LA6A 3Q7QA 5FUYA 3PEWA 5FBLB 3QE0A 3RWMB 3WRYC 2CVHA 2JLRA 1ZJ6A 4AIIA 4BZXA 3C5CA 2CMKA 1ZCBA 5TDHA 1OH5A 4MGIR 2JJ1D 1OSNA 1YR6A 5E4FA 3CKLA 1F48A 2I3BA 3TR0A 1DPFA 1T9HA 2GEVA 4Q1FA 2GK6A 2QGZA 5HCNA 2NO9A 4MKGA 2D2EA 1DOAA 5C2JB 2QQEA 4QBGB 1RZ3A 3KXKA 2F9MA 2HF9A 1S0UA 2ZRBA 4G3XA 3H86A 5BWMA 3Q72A 3GLIB 2OILA 1G291 1AKYA 1KZ7B 1X3SA 4Q03A 1EFCA 4TSFD 4KSCA 3Q7PA 3OHMA 4V0OA 5FUVA 3K53A 1EX6A 4DVGA 4XTRA 4C7OB 3D8BA 1JALA 4PANA 1XJ0A 5C4MA 1E2PA 1E96A 2QZ4A 3MMPA 1V5WA 4LBYA 4L5BA 1OE0A 1SVSA 3FFBA 4MGZR 1N0UA 2QL6A 3I61A 3O47A 4G1UC 3S1AA 3V4FA 4IVPA 3W6OA 3C15C 3HPQA 1KO5A 2RGGA 3ADDA 1CR4A 1II0A 2QSZA 3EIQA 3ND8A 2ZSAA 4NYJQ 5CLQA 2O8CB 2GJKA 4HATA 1ODFA 4BQSA 1VG9B 3EA5A 1MT0A 3GEIA 1O3YA 5DI3A 2DB3A 1F2UA 4KHZA 3RSLA 3UK6A 4ASUA 1KO1A 2MSEB 3WP0A 3NBYC 2VBCA 4AI6A 3CO5A 4OHYA 5D3QA 5HE9A 2JLVA 2Z4RA 4CEJB 3B2EA 1MRNA 4C0QC 5FBWB 5H68A 2G6BA 821PA 3BERA 1JR3D 3LAWA 3VMFA 3UMFA 3C7KA 1ZAKA 3V9PA 2BJWA 4V0LA 4NCJA 2ZREA 2FF7A 2WVJA 4M9ZA 1MABB 2P2LA 2BWJA 1OYYA 2EWVA 3KB1A 4JSTA 4TQUS 4NH0A 4IOMA 2ZTSA 5LD2C 3AV0B 2DFLA 4CVNA 5FUWA 4URWR 1HQYE 4Z8XA 3SOPA 2VPPA 4I1VA 4K46A 1W4AA 3AVWA 2CK3D 1XMIA 1Z28A 5JS8A 3R7WB 4G5QA 3PIRA 5CM9C 3CLVA 3TNFA 1ZCAA 1ZU5A 3VR5A 1OKKA 2QT1A 1IN6A 5CJ2A 4CEIA 2NMVA 1Q0UA 3CF0A 3IBYA 4HUQB 4EDHA 1HE1C 3M0EA 5JSZB 4CGZA 2NG1A 3IO3A 1B23P 1IJFA 4PQYA 4BE7B 4XWOA 2DR3A 1XWIA 2FGJA 2V7QA 2W00A 5FPKA 1G17A 3ZH9B 4AK9A 2R2AA 2WJGA 1W0JD 1GKIA 1OFIA 1UPTA 4DLWA 2ZRAA 1GFIA 2WJHA 4B47A 1G8GA 2EFCB 4OJKA 4BRWA 1JB1A 5FUXA 1XPOA 1G21E 1XFAA 1E2HA 2GCOB 5FPSA 3FMIA 2CNWD 2A5DA 4M0LA 3ZGXA 1OFHA
chains in the Genus database with same CATH superfamily
1XZKA 4G85A 2YDYA 2HDOA 4CLEA 1ZX1A 2J5QA 3EXEB 1YOVA 3L40A 2QM7A 4BFTA 4MS4A 3IMEA 4I46A 2CXTA 4ZOLF 4JP3A 1LVGA 3FPBA 3FKSD 1CUBA 2O2XA 4NPCA 4R7ZA 4U6SA 5C46F 3FWPA 1YDFA 2BTQB 3HK2A 1OQAA 4PC3A 3R7DA 2ZITA 3FPLA 3JARB 4AM8A 3ZWBA 5FA5A 2NU7A 5ENDA 3UXHA 4BRUA 1II9A 1X1RA 4WN3A 5JHGB 3TL2A 1WXWA 3AR2A 1HEIA 2B78A 2RHGB 2RHMA 4QT0A 4BJ1A 5B1YA 4CWAA 4NU8X 5JVDA 1E2MA 1G20A 1ZGHA 4FS8A 4JN6B 1QX4A 1L5QA 1E2EA 5GJCA 4B85A 3IAEA 3P2IA 1VLZA 2JFYA 2JI8A 4P3NA 2ZJBA 5F64A 2HU5A 4QHYA 4OLBA 1Z83A 1W19A 2YIMA 4IEFB 3RT1A 6REQB 3H5NA 3IUNA 3L49A 4TZTA 2Y66A 4F3NA 1DZIA 4KZKA 4KR6A 1WF3A 3OIUA 4MKHA 2ODAA 2Q5JA 4MW9A 2GKOA 5AXCA 1U3DA 2VJMB 1XP5A 3SZUA 1DT5A 2RI1A 3COYA 4MA5A 3GK3A 1NMQA 2VPQA 4NENB 4PGMA 5AH0A 2N3ZA 5CURA 4E6PA 5AK3A 4AIRA 2GSDA 2GUGA 2XJ4A 4G5RA 5GP1A 3GGJA 2Q28A 4FLEA 2Q8PA 4MWBA 3GA0A 3DEZA 5G40A 1EFTA 3K9NA 4B0PA 2D62A 3AQ4A 2JJQA 2C54A 5LQUA 3GEHA 4ZPJA 1TPYA 3A1CA 3B52X 2EXXA 2I54A 4YASA 3AF6A 1F2DA 2ZB7A 4DUPA 4B44A 2NYAA 2Y1WA 1KR5A 3VPDA 3RUHA 1X70A 1QHXA 5A6VA 2HHHB 1TZMA 3L0DA 2JFWA 1DMSA 3A27A 3LBNA 3TAXA 3EC2A 1O94A 3Q9SA 1I7DA 1XEWY 3D3NA 3DTNA 3FCSB 4LF9B 2ILVA 2Z5FA 1D1PA 4WFKA 5F2EA 4KK3A 3ZQ6A 3DLHA 4FQ5A 1M33A 1K7XB 5DHTA 2ZUDA 2MYTA 4PZ9A 4QUHA 4C6SA 3UFBA 2XITA 2HC9A 3TRDA 4F5WA 3EPKA 1JYEA 1M7HA 1XU4A 4LSZA 3WJ7A 3QUSA 1E1DA 1MQ8B 5AKJA 5K4GA 1MVLA 4RCVA 3TXYA 1E3LA 1JHMA 5CP8A 4KGXA 1XN4A 1KRWA 4U7FA 3DWGA 1NUAA 4J49A 1TM5E 1ORIA 3VOBA 3ZWYA 1KRXA 4RLSA 2GN4A 1QE5A 4ZYZA 2RCNA 3OKFA 4J75A 4QGGA 3S44A 2C94A 4I3HA 1LSOA 1E9BA 1IUKA 3FPSA 4GT1A 1QC5A 4CQMB 5JCZA 2B7BA 4C6TA 3GPIA 4RESA 1GSAA 3FMGA 1U2EA 4DIMA 1OR8A 3G9ZA 4HRXA 4Y67A 3WKBA 4XI9A 5JEDA 4CQNA 2BFAA 1MVNA 3IKVA 4JA2A 1SHUX 3HUTA 4J7CA 5IDQA 2YV4A 3D2AA 5D1HA 4X66B 4G4JA 2I67A 3U80A 5C8YF 2JF0A 1E2GA 2PGLA 4EUNA 1JE1A 3RVJA 1RHUA 2B0CA 4E5PA 1LDBA 4CLOB 9GPBA 3REGA 3GUZA 4HQKA 3GDFA 1ENOA 2BY4A 3IVAA 3LKDA 4E33A 3OIGA 1U1IA 3FCOA 4FFBA 5DHAA 2Z95A 2QN3A 3ASUA 3I83A 4YALA 3IUMA 3M5CA 5JLJA 2KB0A 1RE0A 3WJAA 3TAUA 3UENA 3MQFA 2HPHA 3FPFA 4JT9A 5FOUA 1PBTA 1C2YA 1VP9A 3DZGA 3ZGLA 4EG0A 1RD4A 3WB0A 4C4YA 5CM8B 1UXIA 1E1QA 2GPTA 3EW7A 3VR5H 3MTQA 2OCGA 5A03A 2IODA 4AMZA 4JLNA 3CYFA 3I04A 3CINA 5KOJB 3JQ7A 4LSGA 3HKDA 1PV2A 2CLSA 4G1CA 3AHFA 1JPJA 3HLYA 3GJYA 4CUJA 4UM9B 4LA4A 2ZIAA 4GRIA 3L2OB 6ABPA 1I0LA 4TLLB 3TE6A 1AZSC 2XMRA 5ALPA 2GBCA 3HSKA 1K89A 1P39A 3JWEA 4V0RA 5HRCA 3TUJC 4JX8A 4AYTA 4EZIA 3A4MA 2D06A 3ZQJA 3G8AA 4TV9A 4EIWA 5EJ4A 5JIBA 2FH5B 2OESA 2QR2A 4DSAA 2GILA 1P5HA 1J8YF 1KYZA 5B37A 1YCFA 1TIKA 4FMDB 4FQ8A 1JKJA 3O8NA 1QV6A 3DZDA 4KLCA 5BQFA 1ECFA 1G5RA 3STTA 2QT9A 4AURA 2GEUA 3L6DA 3WLKX 2FX3A 1GN9A 1DAMA 2XRYA 3C3CA 3PC3A 3CNBA 3TQFA 4AD8A 2RHBA 5FWNA 4TUYA 1HKUA 2P35A 2R8ZA 1FQOA 4K0RA 4MO9A 3WLAA 1EXMA 2I7CA 2CUNA 1EFDN 1Y8RA 2PLWA 2XCOA 2XUGA 3K9CA 4XVCA 4YMVA 3LNTA 4KKVA 1U2DA 1UBFA 3HE3A 3HNRA 5LOVF 1HURA 1NF3A 2B98A 4HPWA 2AEMA 1QG4A 2GN8A 3KHKA 4JYCA 2NAFA 4MO2A 5J5CA 2WOJA 5LA6F 3TDNA 5M29A 1S8NA 1UQTA 3BB1A 2EDAA 4PWYA 1A2BA 4JELA 3TFWA 2DT8A 2Y9MB 4YTEA 4RABA 5FXMA 5KPJA 4EHNA 2CV0A 4MOWA 1QK3A 1E5TA 1YR7A 4UEOA 5F5XA 4CKXA 1LK7A 1OWNA 3NHYA 4C29A 1ZGJA 3O82A 3DYBA 2JA1A 2I76A 5LD2B 4GO1A 3PLAE 3BA6A 1DOZA 4RY9A 1NZDA 3JQAA 1WXFA 2ADOA 3LNCA 3PQ5A 3K0HA 4HDSB 3UGQA 3U4QB 4EW6A 2RHHA 2PFKA 4UCXA 3LIPA 1JA1A 1E9EA 5F52A 4B3TB 1ZDMA 5K5EA 4MKZA 3W6NA 3CEJA 3CXRA 4PWZA 1CP2A 3SJAA 2DLCX 1QUFA 1UMCB 3DZ8A 4O3FA 1AHNA 1MN6A 3FGZA 5KYNA 4FR5A 1RI1A 2JLAA 4OGFA 1L5ZA 3LPNA 4V2UA 4E3WA 4EGSA 1XIVA 1MB0A 3BEDA 3H2HA 3A4NA 3OZ7A 4EH1A 4P0PB 4KRFA 1JZSA 1LSJA 1RPAA 4NJEB 3TK1A 4ZV4A 2JJ2D 2XB9A 3GJ6A 2B3TA 4IDPA 1E98A 4YMTA 5ENVA 1OPRA 2J0UA 4HAVA 1QQ5A 2JGKA 3ZWNA 4I5DA 4B2PA 4PY2A 4XWAA 5FT9A 1IM5A 1ISSA 4ZGWA 2JBHA 3AI3A 2AOTB 5I9TA 1KSFX 1U31A 2PBLA 3GFTA 4JVLA 4XQCA 5C7LO 1EVIA 5GZ1A 1XMQB 4KQIA 4NBSA 1QHHA 2NZXA 4OB6A 1YOVB 1CS0A 3U4IA 2XMCA 4MV4A 3LKVA 4QHSA 3OLCX 4R1QA 5DN6A 2B8WA 1R6XA 3U4GA 4NBRA 1PNVA 2ZJ1A 3IT0A 3H4TA 1WZ2A 3E8MA 4L22A 4JC4A 4J6FA 3CBGA 4OXIA 4WK6A 2VDLB 1O6BA 3NWEA 3HJHA 3EHEA 1K4KA 4BEWA 2MSWA 3UMCA 4BAGA 1HT3A 2GFHA 2YJ4A 3LUAA 3MWEB 3OCWA 1QDEA 4WOJA 1QB7A 2JCXA 1EBUA 1U5BA 2WHPB 3BPSA 2NSLA 5KTOA 1OB5A 1GZ3A 2VHCA 2W6QA 5TF0A 5T3YA 4IMJB 3K0CA 4XARA 3RYFB 5A62A 5AW2A 3HCFA 4S04A 1OZ0A 1SXIA 1X2EA 3GEGA 5CW1A 2H63A 2XWQA 3PD7A 3MQ4A 5TB5A 4Z53A 1EG7A 2IV3A 1TF7A 3UAGA 3E3OA 1KKMA 1T36A 4IUBS 3F7MA 4ZC1A 2IEYA 4D9CA 1B41A 3OQJA 3AVQA 4CL3A 4Q9KA 5BNZA 4JB8A 2IS6A 3W9UA 5M3BA 4JUFA 1RRVA 5DOZA 5IMBA 1GTL1 1PSDA 4M0DA 1WXGA 3CLUD 2YHUA 1CB7A 2Q4RA 4FXOA 1XFDA 1S2LA 2WKQA 4PAMA 5LZ8A 4RTLA 5IXYA 3K9FC 2QMHA 3CH4B 3EEFA 3IELA 2P6RA 1LJ8A 1JEDA 4KH0A 2Q2VA 2R00A 1WZIA 4UQPA 2QG6A 1PSZA 3VBCA 2C8VA 3LWZA 5IEBA 4ZXFA 3QM1A 1R5OA 1DO8A 3E5HA 4J0GA 2GEDA 2VNJA 4NBTA 1A3CA 5FDFA 1XPRA 1J00A 5JYDA 1XOIA 3FNGA 2YN2A 1R6BX 1TF5A 1A1SA 3DT6A 1CHDA 3CSDA 4U2CA 2HKIA 5KYTA 2B21A 3A1TA 4R1SA 3UXYA 5I3CA 1N1MA 1Z8FA 2PUDA 4L4XA 2B8TA 5HF8A 3BAZA 2JKVA 3CM0A 3N8HA 1TADA 1A9QA 1WCIA 2HCFA 1BE8A 1CRWG 4IW3B 5AHXA 3FNRA 4AY5A 2G0NA 2Y1XA 1YI8A 1Z6PA 3UY4A 1A96A 3DTYA 4J0KA 2GJ8A 2QSYA 2ZI3A 1QIHA 3TSZA 1W9MA 4HNAB 3IRUA 2H17A 2JW5A 4HH4A 2BFCA 3KSRA 4LJ7A 5CX4A 5LDHA 3GJ0A 3RS2A 1ATIA 2JKYA 3IUJA 5E6UA 2VYFA 5JDIC 1GAXA 3LVBA 2SKDA 3PNKA 5AKXA 2B8JA 1DIGA 2N1MA 1Z4MA 4LGVA 4P6VF 4Q82A 2P5UA 4MQFA 3GLFB 2GSWA 3UH1A 2QYSA 3DL0A 5CT4A 4HZUB 4UDXX 2EV9A 5HMMA 1VPTA 3AFIA 3I2IA 4I08A 1HLGA 5CT9A 2IZ0A 1EZ4A 1VL2A 2HHLA 4TLCA 3TZCA 2AXPA 2VR1A 2B4YA 4NFHA 1CU1A 2V0NA 4CG2A 3AHCA 4OKNA 3SY8A 4OHBA 2XGGA 4OQZA 4R2HA 3RJ5A 3A9UA 5JWOA 2DUNA 4XE5A 4ESOA 1DAFA 2CT8A 1ZCZA 4PBTA 4D3ZA 1U3UA 1W75A 1LB1B 3KQWA 3LC7O 4GKVA 1JQ3A 4NOLA 2F6RA 3SS9X 4BKPA 1MOZA 4P7FA 2CXRA 2OHJA 1RHKA 1YJAA 3R5SA 2X7HA 1BKSB 1S2MA 3KQPA 3LT5A 1KDVA 1EFAA 3PKZA 1V8FA 4KWTA 1OY1A 1Z5OA 4G0YA 1LLDA 1MF7A 3JALB 5LQCA 3ED1A 1D2MA 1VA5A 3CH6A 3IHKA 3N53A 3VAZA 1KEUA 3QKRA 1O95A 2D1YA 4XXHA 5BMVB 5KWIA 4KAAA 2N42A 1RM0A 1RWNA 2PZMA 4XFKA 1I6LA 1P74A 1PZNA 1HXHA 3HL0A 7ABPA 1UPFA 2RHLA 2O5EA 2CV2A 1CVLA 5HM8A 7ADHA 4LXXA 1AUPA 4YAFA 1OLSB 4P36A 1ST3A 1RRKA 3DCIA 5U1PA 2IPNA 2OORA 4O8ZA 3THXA 3COPA 4O4JF 1P81A 2QORA 3FSGD 5JYBA 2VF4X 1YBVA 2JBAB 1D8AA 4RJJA 3IJRA 2CXXA 4S2EA 4X1IA 1M2WA 4XX1A 4DCJA 3OWHA 2HRBA 3TFOA 3QOFA 4UFPA 1VLLA 4TWZA 4PPFA 4K03A 4CJXA 1YONA 1M8FA 3KB8A 5A4IS 3HEAA 4NCKA 1Y3HA 1VM6A 1R2QA 2I4LA 4CKBB 3X3HA 4YH1A 5CA0F 1KHHA 2IPOA 1OXVA 2HU7A 4X61A 4UTRA 1DBQA 3VOAA 5KYUB 4PM4A 1VIAA 3GELA 2TMYA 1RVDA 3WZMA 3K6SA 2NU6A 2JCVA 3Q85A 4F7WA 1PBNA 4M7WA 4FN4A 4TWIA 5HQJA 2E89A 3MGBA 1XK7A 5C32A 3K4PA 3KQMA 3E9MA 3QITA 3CEPB 2Z6UA 2IA5A 4LY3A 1N7GA 2WJJA 3EVTA 3PQ4A 4D4IA 3IT3A 2P4HX 1JI3A 3OJLA 1KSJA 4IG4A 3FYUB 2V6MA 2X4DA 3FYSA 3KTAB 4KLNA 4XR4A 5FKJA 3UEOA 3WKEA 2JAXA 1R9NA 2DPGA 4F1KA 4LJ4A 3DKRA 4KOEC 1NVFA 3DE6X 3MRSA 4FHEA 1XB2A 3CGWA 5DRYA 2GBIA 1LS6A 5G0SA 2HA4A 4BX2A 3CY6A 4MLZA 3P2OA 1A2QA 1H4VB 1L5RA 3A70A 3NBKA 5BO5A 2BGIA 3WGJA 2RGCA 3AHGA 3TBKA 5K8LA 2LPMA 3MZ0A 4GVPA 3KDSE 4C21A 3DV0B 2Q6LA 1A4RA 4JMPA 3COJA 1Y6QA 4FZ3A 4NTZA 4UTNA 1K6IA 5K6RA 5ADUS 4JOBA 4YJ3F 2YV2A 3HFGA 1TZJA 2JLYA 2R8EA 2YKGA 2QJWA 3X2EA 2KQUA 1XEWX 4QXPA 5CW2A 4PLZA 3CZRA 5J59A 1DIAA 4MITA 1RC0A 3IKJA 3KAKA 4QGFA 1NONA 3H19A 4LZLA 4MRRA 5B53A 5JLAA 4ER7A 5C5CA 4AX4A 2LDXA 3OZGA 4OG2A 3M34A 1T5OA 4YAEA 5CCDA 2M6KA 4XAQA 5HVNA 5BRJA 4DLLA 3I01M 5M7EA 5C1PA 1Z7YA 2IRWA 1T1EA 5K3SA 2OBFA 3EK2A 3IJ5A 4I9FA 1XDBA 3M49A 3VHXB 1F5SA 5B6JA 1KP9A 2QRVA 1LW6E 1XG5A 2AR7A 2Y0EA 1PR1A 1XXHA 4GM0A 4HQOA 1N8NA 3MJTA 1BQEA 1MH9A 3DE7X 4OXNA 3X1XA 5T4FA 5JZ9A 1YRYE 3D1JA 3M6IA 1T1JA 1RCUA 2NIPA 4MAMA 3TZKA 5BWOA 2W0MA 3H2IA 3B89A 1M1XB 4WGFA 4CI9A 1N3BA 3UOGA 4OM7A 1YIOA 1GYPA 1C80A 1SJ9A 2XUKA 3AK4A 3KE8A 4NL4H 2C82A 2ZWVA 1CJUC 2FPKA 2IGTA 3MYRA 1A4IA 3MT0A 1GL7A 2H6EA 3BMCB 3DEIA 3MMZA 1D07A 2VT3A 4DR1B 4DNOA 1YZQA 3E22B 4Y6OA 4HLCA 3EXHA 4A7PA 3RU3A 1M34E 1WQ3A 4L8FA 1Q57A 4AP5A 3A6KA 5EP4A 5CB4B 4EJFA 3WK8A 1UFOA 4ND8A 4ZV7A 4BP3A 4CL8A 1BIFA 4ZGGA 1L9KA 2YHSA 3QBDA 3IOEA 1EK6A 3PDIA 1CUWA 2XDYA 3UAVA 2PWPA 3ZCPA 1P62B 4A8JC 3KZXA 3KT0A 4NBNA 4BNFA 1E9DA 2AG1A 2B20A 1H0SA 2WZCA 3ROPA 3TD6A 4N6NA 3WGKA 4CEHA 1IZ9A 1UZUA 2VSOA 2QJOA 3MBIA 4M37A 4MINA 2OXFA 3K9WA 2PE5A 1GZDA 5JJKA 3ES9A 1JDJA 2YZNA 4GP9A 3PX2A 4PLPA 2CFCA 1IULA 3FGPA 5AKKA 2YWFA 4YUAA 1ZMXA 3A9VA 4J3NA 2P9BA 2HNKA 2IYFA 5BSGA 1EFPA 1MX3A 2O2SA 1Z6TA 2HRZA 3T5GA 2V4ZA 1HDOA 2BMJA 1BFKA 1JG4A 1JHVA 1U3GA 2IY8A 2ETVA 4TLDA 3OPXA 1ZJWA 3BRSA 5HHTA 2XWSA 4PVDA 4OQ4A 1X1BA 1X94A 1Z07A 3BMXA 2ZDQA 1CLUA 1BCRA 3N76A 5JFOA 3MAGA 1XJ5A 2H1HA 1UDXA 4Y6QA 2WPDA 3AUAA 1BX3A 3IDOA 3ZWQA 2AD5A 4AZ0A 4FGKA 2OCKA 4ZQFA 1A7JA 1L4BA 2ZJ8A 4GI2A 5K3BA 3T7DA 5HK9A 5HF9A 3GFGA 4M7OA 4DIUA 2VJQA 3BKXA 4K9MA 1KJQA 4UHBA 2D1FA 2XNDA 3QIAA 2YY5A 4MJLA 5KVCA 1U2SA 2Z5LA 2JD2A 3D8RA 3I4LA 3UMSA 1Y7HA 4KWHA 2QXUA 1HT2E 1NBAA 4J0JA 5IC5A 4S1NA 1VL1A 3OWOA 1AQJA 2XYQA 1GL3A 3HR7A 4HQNA 4MUHA 2X86A 1E8MA 3D4BA 4LRTB 3SC6A 4F2GA 2ZS7A 3PPVA 2I8CA 5C1IA 5LZ2A 4D92A 3M6LA 2PVSA 2NU9B 4CW7A 1L5KA 4JB0A 1B26A 1IRXA 3WHPA 1K2WA 4ZKDA 2BTOA 2G6TA 3LA8A 5F9HA 3PYLA 2WSMA 4I1SA 4LFCB 3W8FA 4MV6A 3WIUA 4ODIA 1UWVA 1KZGB 2ENUA 4X7BA 4PG8A 4FFRA 4PNHA 3KJQA 3KIPA 1OWMA 3LCCA 2YHAA 4L4ZA 2W58A 3LUHA 4C4OA 3M1AA 1UMKA 2XF8A 2I1VB 2XRFA 1NC3A 3AFMA 3R7NA 3ZV3A 3CZ5A 4GQAA 3VJRA 1MKYA 2B5WA 1UIRA 3UWOA 3EGDB 3OPYB 1SBQA 4BNYA 4FT4A 1R12A 4UVDA 4RZ3A 3T0GA 2C7OA 1JG2A 2IHZA 5LB4A 3MWYW 1PLJA 4JP1A 1QHFA 3CNOA 2X9GA 1AHIA 4TWBA 3FRJA 1M66A 4DMUB 2GZDA 3H9QA 3TVYA 3DDOA 1XU9A 2QMYA 3H5TA 4P31A 3T5CA 3ENVA 5MGNA 3G6KA 3KKPA 1RLMA 1CG6A 3DVAA 3RK0A 4CQLA 2PUBA 4ZZ2A 3PC2A 1A9ZA 3SX2A 1G4HA 2R6DA 1CQPA 2WJIA 4DLZA 5DNCA 4DG5A 1KMHB 1U8YA 4TT3A 3TKYA 3K9GA 2XEXA 4RMIA 1TTPB 1NP7A 2J4FA 3NO4A 3WOHA 5AJUA 4BV3A 5A4JA 1S3FA 4DMLA 2F1OA 4LBWA 3NBZC 4NSNA 2CB9A 1JLLA 1F8YA 3HGMA 1W25A 4Y1EA 3FMFA 5IAGA 1QIKA 4YV2A 1H6DA 4M3NA 1I30A 2IDKA 2QMQA 4Y9RA 3RYIB 2EU8A 4WJKB 1YKFA 4EK9A 1P0CA 2PKQO 2G5TA 1VE9A 2VH5R 3O6VA 5HPYB 1YE3A 3L0YA 1I6MA 2H4FA 5J5VA 3ZS9A 4YDRA 3H17A 1X9IA 2HIHA 3FPJA 1AKEA 4LGMA 1PG5A 1U7UA 5JC8A 3EZ6A 3NUQA 1BN6A 4QX6A 4ASUD 2I87A 5K3FB 5G0TA 1T9AA 4PO1A 2QD4A 4P83A 5JFTA 1C9EA 3OPVA 1EX9A 1W36C 2AN3A 1JR3E 3BGSA 3L77A 3P9KA 4L74A 2EW1A 3BJEA 3QBVA 3QOWA 2IHYA 2QG4A 2DG2A 3HZZA 4N7MA 3NASA 4G0OA 4WCFC 5JNUA 3HN7A 3T7TA 3D7RA 3GFPA 1FVFA 3NG1A 4B9AA 4MUFA 3PT9A 5K0TA 5LKRA 1NNUA 1QVVA 1G98A 3WAKA 1U02A 2GZ3A 3AR9A 1UC9A 1DX4A 1Y5RA 3PXUA 4RMNA 4F12A 3EBPA 2IBTA 4Z4IA 2BEUB 1WVIA 3MWGA 3I2KA 3Q87B 5A7FA 1E4YA 5K8UA 3AC0A 4QEDA 3HDJA 1LI4A 5DJ5A 3RIMA 1A27A 2D1TA 2AFVA 5B1IA 4PXYA 3UMVA 2G25A 3GCZA 3MCTA 3D31A 4WUTA 4WXMA 2EFJA 1NDQA 2J7PA 2P9ZA 5J4VA 1UPXA 4OQLA 3DE4X 3MGAA 4GX0A 2XTJA 1SVIA 5E9WA 5A9TA 3RSGA 3VI3B 2DPXA 4OB7A 1JH9A 2UZ1B 3KKEA 1R18A 2IU6A 1OKKD 1SCIA 4S0XA 2II6A 3M3DA 4HADA 1H69A 1S7CA 5IF9A 3GCGA 4FJ0A 2BBSA 4TL9A 4NI5A 1E5VA 4ZYXA 2NO4A 2UYHA 3QPUA 2C3YA 3TH5A 4URFA 3OP1A 3QTTA 4J1NA 3JRNA 2YINC 5LLDA 4LMPA 1FJXA 4QQNA 3QJGA 1FRQA 1ZH8A 4F6RB 3AEZA 5AW9A 2QRNA 4YK7A 2QE7A 3PVSA 3SDZA 1DTSA 4MGKR 4M1EA 3M6FA 2VXCA 4IJQA 4EUKA 4HB0A 1U28C 1KF0A 4ZC8A 4BMDA 3OEEA 4FDLA 3QFTA 3R3WA 5JMPA 2IPLA 2WF6A 4M1YA 2QGNA 2RHOA 1YKSA 4HDNA 4DCPA 3R5XA 1SD5A 2R7LA 1ML3A 4GHWA 2G06A 3LECA 5C7YA 1ARZA 4IGEA 3UO8B 1T3TA 4MVXA 1CNEA 3EWIA 5EZYA 2JIRA 3PZRA 5F77A 5HIJA 4DA7A 5CB8A 3EZXA 5CD1A 1Z2OX 2HTFA 3HC7A 2GHIA 4R01A 3RRXA 1KARA 4ARVA 1JT9A 2DEUA 5FV7A 3ZW9A 1V11A 1U0TA 1QO9A 4H15A 4KO3S 5BXQC 1U0BB 3ZV5A 2VUIB 2HPAA 2E6KA 3TX6A 4TRNA 1SCNE 3P2MA 4GGPA 3NNDA 3QVLA 2H1RA 1REQB 4A6EA 4N12A 3KBBA 1L5MA 3D3KA 4HH0A 1OOEA 3FNBA 4PU0A 3I42A 1JV2B 3OIYA 4GLFA 4UMVA 3RO7A 3RVLA 1ORWA 3DM5A 1KYYA 1EGQA 3I61A 1DAHA 1U9YA 2VCHA 3AERB 4FILA 4K6HA 3PV0A 5I7OA 4MYUA 4RM2A 2G17A 4B09A 1CQZA 3GFRA 4IJMA 1UXGA 2R6JA 3BMOA 1KI4A 3UK7A 1NX6A 1SCAA 1TA0A 4UM5A 2DWUA 2HHJA 3CLRC 1Z06A 1BFDA 3WNQA 2F2TA 1DRVA 4OGGA 5FUQA 2G9RA 1DQRA 1E1MA 3ITNA 4WJLA 4AZSA 4ZO7A 3AY7A 2R68A 2AG0A 2GPBA 1L4LA 3HBAA 3HCAA 2GF2A 2X6QA 2ZTLA 3MS4A 4C0WA 2ECKA 3EAFA 2VYVD 3KKKA 5FHQA 2JCSA 2I8LA 1U9IC 2PGOA 2VQ6A 2YHIA 3CRZA 4RL6A 4Y1FA 4JFAA 5IASA 4TV8F 4ND2A 1HTWA 3HU1A 4MPPA 3HA3A 4U63A 3TW8A 4PINA 4EB6B 3ZWDA 1OD6A 3VYVA 4O4IF 1G8AA 2DH5A 1RXCA 1FYEA 2OV2A 1PN3A 3PUIA 3V3KA 5KHAA 4KN8A 2ZUFA 4QPPA 1N6RA 2O8BA 3D5TA 4MR9B 4TXHA 3NX4A 2VN8A 3FYHA 2FVYA 1VBKA 2LCIA 4QBTA 2ZBDA 2ATVA 3R44A 3OQ1A 3BYZA 4MYCA 4DUYB 2OLJA 3UKOA 5KKCA 3MWFA 4J1TA 3ZG6A 3GZTB 4R68A 1M72A 5K99A 5DLPA 3UFXA 3PHBE 1WX1A 2CFIA 3ZCUA 3I9KA 4X7RA 1YHNA 5CHYA 3NOOA 4JHXA 1IN8A 4HTFA 4J0FA 4Q9NA 4CM8B 2F8MA 1AQYA 2Z3VA 4B32A 4M1KA 5GGYA 4C4XA 2A88A 4FZRA 1C7JA 1EA5A 2NT3A 2VAPA 3T3DA 3EMVA 1L0BA 4RVOA 4RLFA 4TX1A 3G68A 721PA 1F0KA 4KVFA 2PQMA 4ISBA 1CULC 4UCWA 2BKUA 5DYIA 1E79D 4OL9A 5CT5A 4COKA 3EN0A 4UHEA 4P7GA 2HSDA 3WRXC 3C2QA 1SG9A 4DWWA 2Y8EA 4ZEWA 1XP8A 4KL8S 1FLAA 4NZYA 4DMRA 3VKFA 1DS6A 5JQGA 4IIYA 2AZ4A 4HZIA 4OQNA 4I2NA 2XJ9A 3G8YA 4G2TA 1FS6A 4QDOA 1DG1G 1NOIA 1GPYA 3VHRA 2R0QC 5KNBA 4ES6A 3PFGA 2YJ5A 2I0FA 2YQ5A 1DHTA 4JFRA 4ZOQI 1YV9A 1FFEA 3DVRX 3N8GA 3L7LA 3OZRA 4P92A 2Z57A 3A7EA 1M5TA 3Q5DA 1W4CA 5I5EA 1G9TA 3NIGB 3MUNA 4H7JA 1FFXA 1U0HC 1Y4UA 1D4OA 4U3JA 4F72A 1YL7A 2C9CA 3KUDA 3WZLA 1Z2PX 3OM1A 4DQDA 1LNZA 1T3HA 1NJ1A 1THZA 3ZUPA 4EG3A 1WBDA 3EEIA 4OXXA 1XVVA 1BFUA 2ZWPA 4CL2A 5C8VA 1DSSG 5L3QA 2L82A 4GU5A 4KQ2A 4I1YA 2LZ0A 3E35A 1RLUA 1I5EA 2JCYA 4HN2A 4XYMA 3T5AA 1L8QA 3S81A 5C51B 5C52B 3IXMA 1TPZA 3F2VA 1SCUB 3QK7A 4UVIA 2XSZA 3MK31 3RGGA 2Q07A 1FBTA 1GR0A 1RKBA 4Z3KA 3HQ4O 2ZJ6A 3LQRA 3P27A 2VH1A 3ZHBA 3A6LA 4MVJE 3AW9A 5L3ZA 4N41A 1J0DA 4O2BA 4FBGA 2OMKA 2YVKA 4P53A 3RBVA 4WOPA 4FTWA 3BX1A 5CXQA 2YWBA 4RH0A 3QF4A 4NE9A 1L5GB 3GGCA 1KP2A 2IIVA 4GEGA 1L5LA 3DMFA 4B2IA 3IR6A 4E07A 3ZD7A 1PGJA 3BIXA 4K86A 4RENA 121PA 2W6CX 1QANA 3K2BA 3O4IA 3EGXA 4QG7A 1MZVA 4BATA 5B7GA 5AK5A 1RBMA 3Q3VA 3TIFA 5FTNA 3TLGB 4XB6B 3IRVA 5DT2A 1I4OA 2H8KA 3T52A 4DE5A 4RTJA 3EQ8A 1N3IA 4WBNB 2DPLA 1I2AA 1Y1LA 2IYLD 4L75A 3ZDCA 5TGDA 2J0SA 2VXOA 4OK3A 2V58A 2PSEA 3S7ZA 3UAXA 3YASA 4ETMA 3JZAA 4MDEA 5EJMA 3FPAA 4YV7A 3CLRD 1U0SY 1UP7A 3VR4A 4JJ8A 3SBXA 4LRYA 4AL4A 4B8WA 3GGDA 4IMIB 1ZC3A 9ATCA 4URZR 3SXJA 1WQ4A 2FUCA 2ZCUA 1CZNA 1CQIB 4MHSA 4O2RA 2PMKA 4OKSA 5EIHA 2JFOA 3C3JA 2PZGA 4EFMA 3RVNA 3SGLA 1Y37A 3ANSA 1G2OA 3QNWA 3UC5A 5D3ZA 3AWIA 1SQSA 4UTZA 1ISPA 4LXHA 4U2GA 4BO5A 5C0OE 3V8EA 1R4ZA 3OUTA 3WXMA 1V9LA 5LBIA 3B12A 4UOZA 2JRLA 1UEIA 3K0EA 4BMXA 3G2NA 2O7NA 2PUJA 2VUSA 2XOKD 4A2PA 4AJOA 4FOOA 4D9IA 1K6JA 4Q7KA 4W9MC 1YVDA 2VCEA 1O5OA 3I8XA 4IDOA 2AHRA 2JVKA 3FUVA 5I4CA 4YCAA 2ZS9A 2BFPA 4LTDA 1XBTA 2R9VA 2ZSHA 5AVUA 3I37X 4H0CA 4MV1A 5KI6A 3TLAA 2VKTA 3GHHA 3VTKA 2VDWA 5LM3A 2NQ8A 3U7IA 3GLFE 3I04M 5JSHA 4GR5A 3I2HA 2V98A 1YRAA 3A11A 3VAYA 1VBNA 4HHEA 4K26A 4CLHA 3WBBA 1J07A 4F3CA 2PJDA 3CUVA 5EJ6A 3JRXA 2F9LA 4U7JA 5I51A 4FYHA 1C1XB 4IFBA 4JL5A 2X4LA 4OEHA 4X5OA 3SC2A 1XD2B 3ZGOA 5D6NA 5ARBA 4PR3A 3HBFA 3PNBA 3COZA 2VZ8A 4JLSA 1QH1A 2AVNA 1K5PA 1L4KA 2F1KA 3ZE0B 4A8PA 3FGOA 5AW8A 4AJKA 4KQMA 5EKDA 5LR6A 5KNLA 2IDMA 2P6UA 1Q92A 1GKUB 3DG9A 4LJRA 3GJ5A 1X7YB 3NTOA 4X8HA 2RGXA 4HK4A 4D8VA 5HKKD 1IJEA 4RH1A 1Y1SA 3VAAA 3H2BA 3PQ3A 2VDUE 1NQ5A 4M54A 4PYQA 2NVUA 4ARAA 5IHXA 3AIMA 2HBQA 1I2BA 4FFNA 1YB2A 3EAGA 1VHTA 4LZZA 4ND3A 1VCOA 2XB6A 2Z5GA 4QJBA 2FWRA 7MDHA 4G4SO 4G5HA 5J2TB 2D13A 4NKRA 3V2GA 4A36A 4G0WA 3GDWA 3CXUA 4NYMR 2LXNA 1E7MA 1KK0A 1KO4A 4JODA 1XF1A 5FL3A 2RKBA 4UNQA 5IKPA 2ICAA 5EIOA 2WDZA 4NCIA 1JFFB 2QRLA 4G0ZA 3WI7A 1N1GA 3BMQA 3DWIA 3OZAA 3EWSA 1KQNA 1FFGA 2OPHA 1C7QA 3ZGNA 4TTJA 3HKEA 1GAWA 3WL3A 1EWQA 4IHAA 4MP3A 4EG6A 3AV3A 5IK2D 1ZITA 2GAJA 2HX1A 4JL8A 3STWA 5JSZA 1KQ3A 2GZSA 4F11A 1JUDA 4IHJA 4O25A 1HLPA 5IJXA 2VTBB 2SHKA 4AQ7A 2N9UA 3G8DA 4BUJA 2WKWA 1JSRA 3G0DA 1JXQA 1PD0A 3IDAA 3PU6A 5ALDA 1V8BA 3TMAA 3E0XA 2FUG6 5EIXA 1AH2A 1RQRA 2B1QA 4LJ6A 4ZAXA 3KPWA 3U7QA 2AEFA 5LP6C 1ZH0A 1NW3A 2WJ6A 1YULA 1M2VB 1YDGA 2QUHA 3NB0A 4FR2A 4IIJF 4Y1RA 4E15A 4YMGA 3WA6A 2EHJA 3M1YA 4AMBA 3CE9A 1Z33A 3FJ1A 2BKVA 3CX4A 1TJ5A 2GCOA 2OGZA 2PJZA 1UC4B 3KQSA 1I7PA 4OO3A 4RHYA 2BFFB 3ME5A 3ZVRA 2AZXA 2CNDA 3KSDO 5AESA 4MK4A 4EO9A 2VHQA 3EOZA 3ZVNA 1TKBA 3JD0A 4NOKA 5CNIA 2EDCA 3A4YA 2JHAA 1ADFA 1RQ7A 1E0SA 2W8BB 3RAPR 4QSMA 1E9FA 3ZU6A 5ESRA 4HD8A 4GZ3A 5ABPA 3LWBA 3O8QB 2HN9A 3G9QA 5CM2Z 2WW8A 1U1DA 3EF3A 3EAQA 4GL2A 1U80A 1H0HA 5T4EA 1GUBA 1Z22A 4ZOAA 2YMLA 3RSSA 3MINB 3DZIA 1XDUA 8ABPA 1FSFA 1PR2A 4LCEA 2A59A 5KBYA 4HI0E 3X1WA 1UJ5A 2R65A 4CIXA 4KITB 3O8OA 2IHVA 2LGJA 1SVWA 2C20A 3AZOA 3D5QA 1QHSA 4LISA 1SVKA 5KSZA 3ETDA 3Q5GA 2BMVA 1XZJA 4E09A 5BN1A 1AGRA 3TNDA 4JCCA 2KMLA 3JSAA 3EZ2A 2PKWA 1THTA 1CK4A 2OQRA 2JFFA 1YQWA 3F9IA 3OICA 4LG1A 4Z5XA 3HHEA 3HLKA 2JGEA 4UAUA 4CT4B 4F1JA 4PCVA 3ZI7A 1NU8A 3R9XA 1BCSA 1IHYA 3FUXA 3CG0A 1Q7RA 3C70A 4IZ6A 3TW6A 4H16A 3E8SA 1W49A 3ONFA 3TL6A 2I4RA 3WGYA 4ZHQB 2H1VA 2WU3A 4WBSA 2FPXA 3F3KA 4D2IA 3TJZA 2I66A 5HZHA 3DWEX 1Y6JA 3RR2A 3ZZ0A 4QGSA 3KEMA 1G3UA 4X8LA 5AHKA 2YYSA 3QNMA 1B8PA 1WB5A 2YDXA 3F6SA 3BGVA 5A06A 3AEYA 3EG9B 1VBFA 2RH9B 4RXUA 1R8QA 5DSXA 2R1VB 2Z1DA 3AB8A 4IX1A 1EHCA 4KQWA 4TVOA 4YAOA 1IZZA 5CNKA 3E9ZA 3WB1A 4M1WA 5JXGA 3JWHA 1SBIA 5IKOA 5LQNA 4INZA 4A3SA 1VJDA 3C8MA 2FXIA 3BXEA 2WD7B 3RYCA 2ZBGA 4NZ9A 2DQSA 2ONKA 3GEPA 5L40A 3AX6A 2BMWA 1FU7A 2RAVA 4GF5A 4HY3A 4B6EA 5BUCA 4MAAA 2JS7A 3M4YA 4JYBA 4KNWA 2HSWA 1QDLB 2CLLB 1DRWA 1ETUA 1OT3A 3R6DA 3UAYA 5BW4A 4FINA 4EJSA 3ONVA 5IYZF 3G49A 2XUIA 4LVUA 5HFNA 2IXFA 4HQLA 2UVQA 3TVDA 2X8JB 4OMCA 2JC3A 1W4ZA 2GI4A 5D1NA 5BVHA 4FX5A 1HEUA 3PSAA 4U2BA 4AECA 2WF7A 2FPMA 4GSLA 7YASA 1RCFA 2WHXA 1I3NA 4N3BA 1H65A 1UM9B 2F3SA